5FWBA

Human spectrin sh3 domain d48g, e7f, k60f
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
DETGKFLVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNGRQGFVPAAYVKFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human Spectrin SH3 Domain D48G, E7F, K60F
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords SPECTRIN ALPHA CHAIN, NON-ERYTHROCYTIC 1
total genus 13
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5fwbA00
4HVVA 1BBZA 3I9QA 3A98A 3NMZC 4LUEA 2J05A 2VWFA 4AFUC 2YUPA 2LX7A 2EYWA 1AVZC 2K9GA 1WYXA 1PWTA 4EIKA 1UFFA 2C0TA 2DL5A 2RMOA 2LJ3A 1ARKA 3JV3A 2OJ2A 2RQUA 1K9AA 3H0IA 5EC7A 2O9SA 4JPBW 2YT6A 2LQWA 1B3QA 2AK5A 1UUEA 4J9DA 4M4ZA 2FO0A 2JS0A 4CC3A 2CSIA 1FYNA 2RQWA 2EVRA 2DLPA 1B07A 2K79A 3I35A 5I22A 3KFVA 4RTVA 2OAWA 1SSHA 2KR3A 1HSQA 3NHNA 1YWPA 1GCQC 3VS6A 4HCKA 1OPKA 1W6XA 2CUBA 3M0QA 2CDTA 4RUGA 1MV0B 4RTZA 3UA7A 2D8HA 2DRKA 1NEBA 4WCIA 2NUZA 1I0CA 2DVJA 4K11A 2EYZA 2K7AA 2X3XD 1E6HA 2J7IA 1RLQC 2KXDA 2FG0A 1JXOA 2W10A 1OPLA 4Y92A 1E6GA 1ZUKA 2LMJA 5L23A 1PKSA 4Z89A 4E6RA 4ORZA 1RUWA 1SHFA 1M3BA 2DBKA 4CC7A 1MV3A 3QWYA 3UF4A 2FPFA 3RNJA 2LP5A 1PHTA 2J6KA 1G2BA 2RQRA 1NLOC 1OOTA 2AZSA 2HBWA 2SRCA 3I5RA 4OMMA 2K3BA 2CSQA 2DL4A 2DE0X 5ECAA 3EG2A 1SRMA 2J06A 1I1JA 2CT4A 1K76A 1J3TA 2KNBB 1YWOA 1UE9A 3PVLA 2P4RA 3NGPA 3VS7A 2F2VA 2DA9A 2RQVA 2CH4W 2EQIA 1BK2A 1H3HA 2X3WD 1Z9QA 2G6FX 1AWJA 2ESWA 4OMPA 1PRLC 2CT3A 1VYUA 2IIMA 3H41A 4D8DA 2JXBA 2PTKA 2B86A 4R0KA 1G83A 2YUOA 2K6DA 4AFQC 1AZGB 2JMAA 2I0NA 1KFZA 1VA7A 1BB9A 3THKA 1ABQA 1PNJA 5IHKA 2KRMA 1UECA 2KYBA 2GGRA 3QWXX 2JM9A 2FEIA 2OI3A 2KROA 1UDLA 1H92A 3GBQA 4RTUA 2LJ0A 1ZUUA 2JM8A 1WXUA 4RTWA 1K1ZA 2MIOA 1Y57A 2V1RA 4LE9A 2RF0A 4JZ4A 1EFNA 1SPKA 4J9HA 2L3SA 1UJYA 4J9FA 2D0NA 2AZVA 2JT4A 1QCFA 2ENMA 2KT8A 3EGUA 2GTJA 2EBPA 4AG2C 2LQNA 4F17A 4J9GA 1UHFA 1U3OA 4ZNXA 4F16A 2EYXA 2KEAA 1A0NB 2RNAA 3U23A 2GTOA 1SHGA 2MCNA 1LCKA 3IQLA 1WX6A 2H8HA 3VRZA 4Z88A 2SEMA 1X2QA 2O2OA 2DBMA 1K4US 1PRMC 1SRLA 4DEXA 1NEGA 5IHNA 2JMCA 1BU1A 5FWBA 1W70A 2RN8A 1AWWA 1KSWA 5FWCA 2F2WA 1JXMA 1UTIA 2LZ6B 2EPDA 1GFCA 2J6FA 4LNPA 2JS2A 2D1XA 2C0OA 4LN2A 3EG0A 4X1VA 2F2XA 2HSPA 1X6GA 1WLPB 2KYMA 2AKLA 1ZUYA 4IIMA 4AG1C 2L0AA 4OMNA 2EGCA 2BZXA 4QT7A 4F14A 2HDAA 2DYBA 1OV3A 2BZ8A 1ZX6A 1ZBJA 1QKWA 4LUDA 1NYFA 2EW3A 2W0ZA 3NPFA 1U5SA 3R6NA 1AOJA 1X27A 3TVTA 1H8KA 1AD5A 2EKHA 1UGVA 2L3PA 3M0RA 1JO8A 1YN8A 2DL7A 5IXBA 1VYVA 1YNZA 2ROLA 3REAB 4RTTA 2KRNA 3M0TA 4KRTA 1M30A 1GRIA 1CSKA 3VS5A 4JZ3A 1X43A 3VS4A 1S1NA 2BTTA 1ABOA 4OMQA 1T3SA 1I07A 2RQTA 1CKAA 2GQIA 3EG1A 2LCSA 4JJDA 1WFWA 1JQQA 4HXJA 5IXFA 1VYTA 4J9EA 2DNUA 2LNHB 2MOXA 1T0HA 1ZLMA 1T0JA 2O88A 1RI9A 4GLMA 2L2PA 2O9VA 2V1QA 5GJWB 1T3LA 1GCPA 4RTXA 1KJWA 1UHCA 3M0PA 3CQTA 1WXTA 3VS2A 2ROTA 3VRYA 2AKKA 2EGEA 4CC2A 1K0SA 1IO6A 2EYYA 2JTEA 3LH5A 3FJ5A 1HJDA 2M0YA 2GNCA 5HCKA 4AFZC 1NLPC 3REBB 1NYGA 2DMOA 1FMKA 4DEYA 3VS3A 2ABLA 4J9BA 1TUDA 2E5KA 4IIOA 3UA6A 4A63B 4FSSA 2CUDA 1AZEA 1PKTA 4ESRA 3O5ZA 3VS1A 1WI7A 1RLPC 1GCQA 5I11A 2NWMA 3TSZA 4OMOA 2KT1A 3ULRB 4D8KA 4HVUA 2A08A 1NG2A 2DL8A 1W1FA 3UATA 1YP5A 4RTYA 1X2KA 1E7OA 1WXBA 1GBQA 1TG0A 1M3AA 2KGTA 4JJBA 2VVKA 2JW4A 2ED0A 2FRWA 2DX1A 2PNIA 4GBQA 3PE0A 1AWOA 1AWXA 2A36A 2DRMA 4Z8AA 1GL5A 1WIEA 2ECZA 2O31A 2VKNA 4AFSC 1Y0MA 2DJQA 2FPEA 2L3QA 2CREA 5GJVB 1ZSGA 2DILA 2LJ1A 1HD3A 1M8MA 1WA7A 2D8JA 2DM1A 4JJCA 1AEYA 2A28A 1NM7A 2KBTA 3TSWA 2EGAA 2K2MA 1UG1A 2KE9A 2RPNA 1MUZA 5IHIA 1CKBA 3EG3A 3M0UA 3I5SA 2BZYA 2FRYA 1SEMA 1M3CA 3EHQA 4HVWA 1GFDA 1QKXA 1QLYA 1YCSB 2KRSA 2PZ1A 1Z9ZA 2HCKA 2HEQA 2ED1A 1KIKA 2GBQA 3RBBB 2FPDA 1X6BA 3ZL7C 1GBRA 1QWFA 1K0XA 1JU5C 3SHWA 4CC4B 1OEBA 1X69A 3M0SA 5FW9A 2M51A 1XOVA 3VS0A 4J9CA 1JEGA 2CH4A 2C0IA 2KXCA 2YDLA 1M27C 1V1CA 1UJ0A 3H0HA 2YSQA 3C0CA 1N5ZA 3SEMA 2A37A 3EHRA 2YUQA 2DL3A 5IH2A 2J6OA 2QDLA 1U06A 3H0FA 1TUCA 2DF6A 4J9IA 1WDXA 1QWEA 4OMLA 2XMFA 3PVQA 2YUNA
chains in the Genus database with same CATH superfamily
4NL2A 2CP0A 1WQ7A 2J05A 2LT4A 4AFUC 2YUPA 2LX7A 2KAFA 3OYFA 4EIKA 3OYDA 2C0TA 2RMOA 1U1SA 3L2UA 3NTKA 3SWNC 2O9SA 2LQWA 2Y4YA 4QQDA 3M59A 1S72T 4J7IA 3CD6T 1JBMA 4FT4A 4M7AG 2DIGA 4CC3A 1EX4A 4MZPA 4D6WA 1W2BP 1PG5B 5KYYA 1FYNA 3J81E 1YBYA 3OMCA 2OTJT 4LD6A 4RG8A 2K79A 3KFVA 1QCOA 2E6ZA 2QEXT 3NHNA 1YWPA 2ZGWA 5CAIA 2DETA 4RTZA 3RMQA 2DRKA 3CPFA 1K8AR 3GPLA 2MF2A 1W2BS 3QZ5B 1K73R 2X3XD 2J7IA 2KXDA 3CMAQ 2FG0A 4A4HA 1VIFA 4NOYA 2OTLT 2H3EB 1VQNA 1PKSA 5IAYA 4Z89A 1VQKT 1W2BA 1IRXA 2DBKA 4GLKA 1MV3A 4CC7A 3QWYA 4RKUE 3A5ZB 2E64A 2J6KA 8ATCB 1KC8U 3OS0A 1VIEA 1IGQA 2JN0A 2AZSA 1QVFA 3NTIA 2HQXA 3LGLA 2QYZA 3OSSC 1NBEB 1RL2A 3P8HA 1K76A 2X4JA 4OGEA 5CKFA 3NGPA 3VS7A 2F2VA 1VQ7A 2DA9A 1N8RC 3CBMA 2RQVA 2CH4W 1BK2A 1H3HA 3OW2S 2CZ6B 2DIQA 1B34B 4OMPA 3LH0A 2CT3A 3H41A 2A0FB 1TOVA 3UT1A 2PTKA 5A2QE 5FU6B 1TU0B 5J39A 4M7DA 3BW1A 1BB9A 2EYQA 4C92D 4IURA 3JB9G 3CCRA 4OB1B 1I5OB 2XD0A 4PJOG 2FZKB 4EMKB 1P92A 3CC7Q 3SFMA 1YFNA 2E41A 1FMVA 2GGRA 2JM9A 3M4YA 1VQNQ 4EMGA 1VQNT 4M7AE 1B34A 2KROA 4M75C 2QA4T 2LJ0A 5GMKl 4M77G 2JM8A 1WXUA 2QQAA 4RTWA 2XI9A 2QQBA 2RF0A 1KQ2A 1SPKA 2L3SA 3L2WA 3UWNA 1UJYA 3MJXA 4FM4B 2AZVA 2JT4A 1D09B 2GF7A 1QCFA 2NUPA 2P4TA 2CP6A 2LQNA 4JLIA 4OMFB 4QVCA 1UHFA 4M7DB 2P0KA 2ZAEA 4XTZA 4F16A 4OB0B 2EYXA 4EMKA 3U23A 3X25B 1VQ7Q 1OX8A 2RI2A 4C8QB 3SWNB 3V8LA 1X2QA 4C8QF 5HY6A 1K4US 2YRVA 3HRSA 3M57A 5IHNA 1BU1A 5FWCA 2F2WA 1JXMA 3CMEQ 3VYHB 1QVPA 1GFCA 4M78E 1M5Q1 4LNPA 1VQMT 4X1VA 1YJ9A 2VV5A 2EAYA 4KUDK 1ZUYA 2L0AA 2EGCA 2BZXA 4F14A 2DD5A 3QJ6A 4J7FA 1OV3A 3QHSA 1ZBJA 1X27A 4HCZA 4IUUA 2DEQA 2RD1A 3TVTA 5FLXE 1VQ5A 1OX9A 1AD5A 2DKGA 2LC4A 5CK9A 3CCET 1JO8A 5LJ5j 1QW1A 1VQ4Q 1W4SA 2DL7A 1VYVA 4ELZC 1YNZA 2KRNA 1GRIA 3L2ZA 4J6XA 3VS5A 4JZ3A 2MWOA 1S1NA 1ABOA 4OMQA 1T3SA 5KYWA 2RHYA 1I07A 4FSXA 2EQMA 2DJZA 4JJDA 1WFWA 3EFOA 4E7JA 4PJOE 4B9WA 4BI3A 3OYEA 2WSFE 3QJYA 2LNHB 2MOXA 1VQPT 4PFPA 1YIJT 4GLMA 1G3WA 2L2PA 5GMKj 2O9VA 3M53A 3H9NA 3JB9J 2V1QA 3FC3A 2LT1A 1TWBA 3META 4O6JA 2A7YA 1WXTA 4PJJA 1VQMA 1Q7YC 5KYYB 2AKKA 3E2UA 5LJ3h 2BUDA 2EQJA 2BIVA 4JJNK 3FDRA 3V8JA 1SKUB 2GNCA 1NLPC 1YHQA 4WF2A 1YJ9T 2DMOA 5CO7A 4BDZA 2AIRB 2R5AA 3JCMP 1YI2Q 2E5KA 4IIOA 4F7UA 4C92F 1VQ6T 1ZA2B 1VQLA 1WI7A 1FWZA 1GCQA 2RM4A 4OMOA 2L8DA 4HKEA 2YWWA 4D8KA 4JLGA 3ASKA 1R8OB 2QTVA 1UGPB 3OS2A 3L2RA 1Q86R 3L2VA 1E7OA 1M2VA 4J8OA 2EQKA 2KGTA 5CKDA 2QXFA 2ED0A 1U8RA 2MPXC 1YJWT 2FRWA 2PNIA 3VU3C 4M75G 1NPRA 3EFSA 5IT9E 2ECZA 2O31A 1QVFS 2HMAA 4AFSC 4RCCA 2OX7A 3X28B 2FL7A 1Y0MA 2FPEA 4LDUA 1K9MR 5CVIA 4E7SA 4HCBA 1IHWA 2KBTA 4MDXA 2K2MA 3SDZA 1UG1A 5D7UA 1I5LA 4M7AB 3I5SA 3CCST 2BZYA 3EGXA 3E9GA 1GFDA 4KBMB 3WXMB 3MP1A 3DB3A 2PZ1A 3HRUA 4C0DB 2JJ9A 5D6WA 2ED1A 1XTDA 4DOWA 3CCUA 4ZTJA 5LJ5f 1AHJB 3KUFA 4RG2A 1K0XA 1JU5C 4AMCA 2O4XB 4CC4B 1D1BA 4LD9K 4HT9A 1V1CA 3QO3A 2CP3A 4KUIA 3C0CA 1YITQ 1N5ZA 3VUBA 2A37A 2QK0A 5GAOp 2J6OA 3CCVA 1TUCA 1K73C 4Z02A 5A0LA 1EZZB 5GAMj 2QQRA 5GAMh 3I56T 4HVVA 3I9QA 3A98A 3NMZC 1V76A 4BD3A 1AVZC 3OY9A 4F04B 1KQSP 2HKNA 1PWTA 2HAXA 4EMKC 3OYYA 2DL5A 5FROA 4DQ2A 1WHMA 2OJ2A 5EC7A 1Q81U 1M1GA 3KXTA 3BDUA 1Y7XA 2E3IA 3CCJT 2BKDN 3QZ9B 1B3QA 1QVGP 2AK5A 1JRIA 3OYJA 1GXIE 1UUEA 1VQ9Q 3PGGA 1WJQA 3CMAA 1KQSA 3BY7A 3V7CA 4E7ZA 1ZBXA 1KG1A 1PD1A 1KQ1A 2RQWA 4XTVA 2EVRA 3H6ZA 2WSCE 4PLLA 3HTRA 2LTOA 4M78A 2DLPA 1PC0A 2HSEB 2HQHA 1SSHA 2KR3A 5A0DA 1D1CA 3SWNA 3RMSA 5LJ5g 1GCQC 5A0GA 3GIBA 4E7KA 4RUGA 5GAOq 1B7TA 3CBPA 2D8HA 5D6YA 4M75D 4WCIA 4JRQA 1HK9A 2QASA 3Q1JA 4PL6A 3M9QA 2EYZA 2K7AA 1KD1U 2F69A 2OTLA 4L6V5 2D6FA 1E6HA 1VQ9T 2VXEA 1KC8R 4M78C 2W10A 2FVUA 1OPLA 1YIJA 1E6GA 2IG0A 1XNIA 2RJDA 1UGSB 1VQOT 1RUWA 1OU9A 4N0AC 4XU0A 4C8QA 5GAOn 5GAN2 3PIOA 2LP5A 2FYKA 3PMIA 1G2BA 2DZ9A 1ZA1B 1G5VA 3J7AF 4R55A 1YCYA 1WNLA 5ECAA 3OB9A 1PSEA 4MZTA 1YJWA 3PVLA 2E3HA 1DJ7B 2P4RA 1M1KC 4JS5A 2DTOA 3BDLA 4M78D 1Z9QA 2ESWA 3A8OB 3NFCA 5KYNA 2IIMA 4PJOC 4B6MA 1N6AA 2V8IA 1ZSZC 2JXBA 1VQMQ 2K4YA 4BDYA 4V2SA 4BI8B 5CKHA 4AFQC 5EG2A 1VQLT 2YXYA 2NUTB 3THKA 4N4IA 3EGXB 1BIAA 4LDWA 5LJ3f 4Q5WA 2OI3A 2RJFA 4EDUA 2DD4A 2Y4XA 2XKOC 1TTHB 5GAN4 3KBGA 5D6XA 2V1RA 4LE9A 1S72Q 3CCEA 2DVEA 1WHKA 2M9UA 5I21A 4F7UE 1D1AA 2KEAA 2GTOA 3IQLA 2LQ8A 1TH7A 2LCLA 4XU1A 3VRZA 4Z88A 5GMKe 5LJ3j 3JCMX 3CCMA 3CC7T 2COYA 1NEGA 3I55Q 1RI0A 5FWBA 3VKIA 2A3LA 2RN8A 1QVGS 1WHGA 1UTIA 4RCBA 2EPDA 2DO3A 3DKMA 4TVRA 1K8AC 2JS2A 2C0OA 4LN2A 1WQWA 2F2XA 4L5GA 4JRIA 3CCUT 3H8ZA 1WLPB 3CCUQ 2MI6A 3HSBA 4OMNA 2LDMA 4KT0E 4DOVA 2DXBA 2DYBA 3LWIA 2BZ8A 1QKWA 2NUPB 2EW3A 2JNGA 3NPFA 2WACA 1AOJA 3EGDB 3CD6Q 4AT1B 3OYCA 2EKHA 3A8HB 1UGVA 2YLCA 3RKWA 2HL3A 2RHXA 3EGDA 5GAOl 1Q95G 2VUBA 1IZ6A 4RTTA 4KRTA 1M30A 2RJEA 5KCHA 4BE1A 1CSKA 1KHIA 2XDDA 4O5VA 3OBWA 3JRZA 1MGQA 3P8DA 3OYBA 2RQTA 4QQ6A 4HXJA 1JQQA 4A4FA 2DTIA 3BFMA 4J9EA 1N9RA 4BI4A 3C95A 3OYMA 2HL5C 1M1KU 2EJGA 1VQ7T 3BE3A 1RAEB 4NS5A 1YI2A 2RHUA 2R58A 1IHVA 1BYMA 5GJWB 1T3LA 3LYIA 5L8RE 4LDYA 4XTXA 3DLLA 3P8BB 5HK0A 3CQTA 3VS2A 2ROTA 2EWNA 3ZFJA 5HKCA 3VRYA 9ATCB 1KQSS 5J3BA 3CBOA 2L89A 2F5TX 1K0SA 4C92B 2LNVA 5HK3A 3S3NA 2EYYA 5M9OA 1VQ4T 2EFIA 2KVQG 2VXFA 3OSVA 4AFZC 4EPCA 3FB9A 3JCMb 2AT1B 5GAMg 1AT1B 4P5NA 1D3BA 2HBPA 1TUDA 4OVAA 3UA6A 4A63B 4QQGA 4FSSA 3CC4T 1RAAB 4ESRA 3VS1A 1UGRB 4C8QG 3TCJA 4F7UG 3JAME 2EKOA 7AT1B 4QW2A 2LQKA 1D0YA 3OYNA 2QEXA 3FLGA 1YP5A 1X2KA 2QQSA 1I81A 1M3AA 3M55A 2JW4A 1M9SA 3CCJQ 4C0GA 1UB4A 3PTAA 2KQWA 1VQOQ 4LDVA 1X75C 3E19A 2A36A 1GL5A 1WIEA 5AT1B 1Q81C 2E4HA 2VKNA 5IN1A 2CREA 1RADB 5GJVB 5GAOr 2CS7A 3I55T 4XTYA 3I56A 1M8MA 1WA7A 4F7UB 4JJCA 4DBRA 2LRQA 5GMKh 1AEYA 1NM7A 1WHJA 4M78F 3CMEA 4PFZA 3RIRA 2CZ0B 2RPNA 2F1LA 1CKBA 3EG3A 1SEMA 3EHQA 1LOJA 1PM3A 1QLYA 2NYSA 2NUTA 3HRTA 4MMKA 2EJFA 3TEEA 1Z9ZA 1SG5A 4FU6A 1KIKA 2PUKB 2VYTA 2GBQA 4A4KA 4FYXB 1RACB 3SHWA 3OA6A 2L3RA 4OB3B 3A1PA 2QEXQ 3CCRT 1VQ5Q 4M75E 3G6ET 1KD1R 2GFUA 3CPWP 3OMGA 2YLBA 3GLXA 2F5KA 2RO0A 1D0ZA 4QVDA 2CZ1B 1X6OA 3SEMA 2DFUA 2DL3A 3RESA 5IH2A 5DLQE 2QDLA 3RKXA 3MEUA 1WDXA 3CC7A 1ACMB 2QAZA 4OMLA 2X9HA 2XMFA 4C92G 5LJ3g 3QXEB 1D3BB 4R56A 1BBZA 4JDSA 4LUEA 5KE2A 4FW2A 4CRIA 3CCMT 4XTWA 1HXDA 1UFFA 3QYGB 2COWA 3CXCS 2LJ3A 3I55A 2RQUA 1K9AA 3H0IA 3PT9A 2YT6A 4J6YA 2LCCA 2ZPHB 4C8QE 2CGHA 2HZYA 2V8JA 4M4ZA 5CQXA 2FO0A 2JS0A 4WTOB 4HT8A 1Y07A 3JCMJ 3QDFA 3M4GA 5GAMd 4M77A 4E7LA 4BY6B 3I35A 2JUFA 4RTVA 4M7AF 2GQVA 4FT2A 1HSQA 4M75A 3J80E 1VQ5T 3JSCA 3AHUA 1WHLA 3VS6A 5FU7B 1VQLQ 4PJOB 2CUBA 1N8RR 1G3TA 2D9TA 2IVWA 4GY5A 1TUGB 3PFSA 3RUXA 4M7DG 2DVJA 4C92A 3S3OA 1F1BB 4K11A 2MAMA 3CEYA 2O4XA 3QG1A 3V7SA 2RHZA 2FHDA 1RLQC 4ATOA 1OQKA 5GANf 4A4EA 3CC2Q 2LVMA 1SHFA 3M5AA 4KH1B 3RNJA 3HPWA 1K9MU 4OF1A 3JCMe 3EFOB 1M90C 1VQ4A 5GAN5 1ZSZA 3I5RA 2CSQA 2DL4A 3EG9A 4VUBA 1VQPA 3EG2A 2J06A 3FJPA 1OZ3A 1I1JA 2CKKA 4M75F 5LJ5h 2CT4A 3G71Q 3QDRB 2KNBB 2K3YA 4J5YA 1YJNT 2RI5A 4N0AA 2R5MA 3VJPA 4C8QC 1LJOA 2DXUA 3TQ7P 2EQIA 5C6SA 1WJRA 1YHQT 2QDYB 1NJIC 3RR6A 3JB9F 1VYUA 4D8DA 2OTJQ 3CCLQ 3V7RA 3A8MB 3PIPA 2MWPA 4R0KA 5CIUA 4M7DD 1G83A 2K5LA 2ZPIB 2YUOA 3E9FA 2K6DA 3QBYA 3GOXA 1VA7A 2PVDB 3L2QA 3JB9H 1ABQA 4CI0C 1PNJA 5IHKA 2VC8A 2KRMA 3DB4A 4PJLA 5GAMf 4C92E 3TU4K 1TSFA 2KYBA 3CCVT 1BI0A 2FEIA 1ZHIA 1UDLA 1H92A 3GBQA 4RTUA 3CC2T 5CCAA 1IREB 3S6WA 2MIOA 4M7AD 1Y57A 3L42A 4JZ4A 4J9HA 2P0PA 4J9FA 2CYZB 2D0NA 1MMDA 4RMOA 1JB0E 2KT8A 3EGUA 3URGA 4AG2C 1M2VB 4J9GA 2DK3A 3OS5A 1O9SA 1U3OA 1BCOA 1X01A 4A4GA 1UEBA 5CQYA 1A0NB 3SB2A 3I56Q 1SHGA 1LCKA 1WX6A 3LWHA 1C1AA 2H8HA 4E7IA 1YJNQ 2HQEA 2M16A 1VQOA 3F70A 4ELYC 2JTFA 2RK2A 2DBMA 4ZGJB 1MNEA 3DLMA 1SRLA 4DEXA 3VUZA 4BACA 4M77D 4QKUA 4JS4A 2OTJA 2JMCA 3CCRQ 1W70A 2VGNA 1AWWA 2ZPBB 1WZOA 5KYXA 1M8VA 2D1XA 2MYSA 1WGSA 3NTHA 1S72A 3EG0A 4ZN3A 2HSPA 2KYMA 4HA8A 2AKLA 4IIMA 3A8LB 1H3ZA 4YTLA 5GAN3 4M7DE 1ZX6A 1NYFA 2W0ZA 4IUVA 4FYVB 2ZZDA 4X34A 2QG9B 1OULA 4M7AC 1H8KA 2E65A 1BI1A 2L3PA 3M0RA 3FEOA 5IXBA 2K3XA 1Q82U 3M0TA 3M56A 2M0OA 3VS4A 3S3MA 3MEWA 1CKAA 2GQIA 4PJOA 4IUTA 2E1HA 4J6WA 2KMTA 3JB9D 1ZLMA 1T0JA 2O88A 1WHHA 4M78B 8AT1B 5GAN8 2E5QA 2HNIA 1KJWA 1M4ZA 1YJWQ 1UHCA 1I8FA 4J83A 3CCVQ 2OAUA 5GANd 3M0PA 3OYLA 2DYIA 2G3RA 3LLRA 2K57A 4X9DA 3PNWC 4N4HA 2JTEA 3SD4A 1BKBA 3LH5A 1HJDA 2M0YA 2PUOB 3MEAA 2PVGB 2PQWA 1NYGA 3C94A 1FMKA 1KHCA 2QQ9A 4M7DC 4DEYA 3UDCA 4C0FA 3JCMh 4C0DC 2ABLA 2HD0A 3LX7A 3MEVA 4EMHA 2X51A 2XK0A 1JJ2P 4MZMA 2ATCB 3QKJA 1VQ9A 2NWMA 3TSZA 3EH2A 2KT1A 5LJ5e 3VV0A 1M90U 2QTXA 2QGGA 4C5IA 4HVUA 3V8KA 1M1FA 2A08A 5KYUB 1R0CB 4JUVA 4HCCA 3UATA 3FIFA 2FZCB 1QMCA 3OS1A 1GBQA 2CP2A 4JJBA 2VVKA 1U1TA 1OZ2A 4PLIA 1PSFA 2FB7A 4FYWB 2COZA 1VQ8T 4GBQA 3PE0A 2X35A 2P84A 1AWOA 3CC2A 1VQPQ 4Z8AA 2OTLQ 3JCMV 2AHJB 1YITA 4DBQA 4FYYB 3GNGA 3RDVA 5GANh 4ME7A 1ZSGA 2DILA 2LJ1A 1HD3A 4DBFA 4DA4A 4M7AA 1MMNA 2D8JA 1PD0A 2DM1A 2XDBA 1Q86C 2A28A 2QGFB 2HKQB 3CCQT 2EGAA 2KE9A 2KI7A 1MUZA 1QCNA 5IHIA 1VQ6Q 3M0UA 2FRYA 1M3CA 3VYGA 5KYXB 1QKXA 5J26A 4BY6C 2RB6A 3CCSA 2HEQA 3G71T 1Y96B 3RBBB 4C5EA 3HFNA 3ZL7C 1VOMA 1GBRA 3G6EA 4E2FB 4BUGA 2XU8A 5C0MA 2CP7A 5FW9A 4PJMA 2M51A 1XOVA 2DPPB 3VS0A 5LJ3e 1JEGA 4KGZB 2CH4A 4C5HA 4Y28E 4Y91A 4ZN1A 3C4SA 3GP8A 1UJ0A 3H0HA 1VQKQ 1Q7YR 2YSQA 6AT1B 1MMGA 3EHRA 5FRMA 1VQ8A 1XJWB 3GF5A 2FZGB 1NE8A 3H0FA 2DF6A 3G1JA 5KCOA 3PMTA 1QWEA 4UC4A 2DZCA 5GAMe 3CXCA 2DERA 2K5IA 2PVOB 2CP5A 2VWFA 1K8AU 1G8XA 3EH1A 2EYWA 2K9GA 3QUIA 1WYXA 2X4YA 1G3YA 1BI2A 3MP8A 4XAXB 4E7HA 1KD1C 1ARKA 3CCEQ 3JV3A 3L1AA 4II1A 4M78G 1RAHB 2L5QA 4DBHA 3ZEHA 4JPBW 3TREA 4JRPA 3OBYA 2Z0WA 2Y90A 2RK1A 3OYHA 3CCQA 2IPOB 3A8GB 1RAIB 5GMKi 2B8AA 4J9DA 3QPHA 4C8QD 4JRKA 2CSIA 2RA2A 1N27A 5CR2A 2DXCA 2E6NA 3CXCP 1B07A 5I22A 2R57A 4FIBA 2OAWA 3HFOA 1QVFP 3CCMQ 3JCMd 4BE2A 4HCKA 1OPKA 1W6XA 3M0QA 2CDTA 2JOYA 1MV0B 4A53A 3UA7A 1NEBA 2NUZA 1I0CA 4FL6A 2YHTA 5CKEA 5DLOA 2RI3A 1JXOA 1Y71A 4M77F 4Y92A 4BB7A 1ZUKA 2LMJA 3G4SQ 5L23A 1QP3A 5GANg 4E6RA 4ORZA 4IKFA 1MNDA 1M3BA 3EFRA 3JB9I 1JJ2A 3UF4A 2FPFA 1PHTA 2KDSA 3CCLA 3OW2P 2RQRA 4C92C 1NLOC 1OOTA 3G7ZA 3G4ST 3OYIA 1NJIU 3E1SA 2HBWA 2SRCA 1LVKA 4OMMA 2K3BA 4XK8E 2DE0X 2RHIA 1SRMA 3WVEB 2EIFA 4M75B 1J3TA 1YWOA 1Q86U 2QI2A 1UE9A 2H3JA 4C5GA 1RAGB 2E12A 3QIIA 2I2LA 5GAN6 1QVGA 2DAQA 2X3WD 1Y96A 3X24B 2G6FX 1H641 1AWJA 2X4XA 4E47A 4BE0A 1PRLC 2X4WA 1K73U 4IUQA 5GMKm 3JCMc 3JCMQ 2LX9A 2B86A 1Q82R 2KSSA 2RJCA 4KH0B 1AZGB 1O75A 2JMAA 3OW2A 1YIJQ 2I0NA 5DY9A 1KFZA 2M1HA 4ZGEB 3OYKA 4XTUA 3EAEA 2EQUA 4OB2B 2XHCA 4XU2A 1UECA 4FCYA 2VB6A 3QWXX 3ZBDA 4PNOA 4LXCA 3CPWA 4IUPA 1XQHA 4LDXA 4OP0A 3G71A 3X26B 5DM7R 5FRNA 4PJOF 1ZUUA 1YI2T 2XDPA 1K1ZA 2K5FA 4ANJA 1EFNA 4PK4A 3JCMf 2DXTA 1YJ9Q 1NPPA 5GAN7 3INZA 2PU9B 2BE7D 2RH2A 2ENMA 3MPUB 4KGVB 1K9MC 2GTJA 5GAOm 2EBPA 1SF9A 3MHXA 4F17A 1ZSZB 5LL6S 4ZNXA 4KULA 1NZ9A 4C0ZA 1D0XA 2RNAA 2C06A 3EG9B 2MCNA 1YITT 5KYWB 4X9CA 3AT1B 3CMAT 1SSFA 2V26A 2SEMA 5KE3A 1LNXA 2O2OA 2VASA 3CCJA 1PRMC 3M58A 3UPUA 1KSWA 5I2MA 3CMET 2LZ6B 1VUBA 2JVVA 2J6FA 4M77E 2YRDA 3OQ5A 3N5BB 1X6GA 4OGCA 1FX7A 3C12A 4AG1C 1TXQA 3G6EQ 2MMPA 4QT7A 2HDAA 1QP2A 2XIDA 3MO8A 3ME9A 4LUDA 1VQ6A 2XICA 1IXDA 1U5SA 3R6NA 2O01E 1M90R 5KYUA 4PFOA 3T9NA 3LGFA 4A54A 5GANe 1EIFA 3MP6A 1YN8A 1OU8A 2ROLA 3REAB 1R0BG 1X43A 2E10A 4M7DF 2BTTA 5FU7C 2QA4Q 4MMLA 3EG1A 2LCSA 1OI1A 2V8KA 3ER0A 1VQKA 5IXFA 1VYTA 2DNUA 1TS9A 1T0HA 3RERA 1BCMA 3OYGA 1RI9A 2CZ7B 4PJOD 1I4K1 1RABB 4ZGDB 3M54A 2DEUA 1GCPA 4RTXA 2DTHA 3HKSA 4F7UF 2VGMA 1RAFB 2KY9A 5LJ5d 3HP9A 2EGEA 4CC2A 5I2SA 1OYXA 1IO6A 1IB8A 2YRCA 3D7SB 3FJ5A 2WSEE 4N4GA 5HCKA 3REBB 3WVDB 1QQJA 3CPWS 2GCXA 1BI3A 4L59A 1N8RU 3CC4A 3VS3A 2ZPGB 1Q82C 1HYOA 4J9BA 4ZTFA 5FU6C 3JCMW 1N9SA 2CUDA 2KK4A 1AZEA 1IGUA 1PKTA 4QVZA 1C6VX 3O5ZA 3OYAA 1RLPC 5I11A 5GANj 1G3SA 1M1KR 3ULRB 2QA4A 1Q7YU 3CCLT 1NG2A 4PKCC 2EJ9A 3G4SA 2DL8A 1W1FA 4RTYA 5KH6A 1LPLA 1WXBA 1YHQQ 1TG0A 5CKBA 2BE9B 2MK5A 2DX1A 1KK7A 1PCXA 3RKYA 3CCSQ 1AWXA 4M77B 2DRMA 3LW5E 1WPYA 2GFAA 3MKDA 1FMWA 4FW1A 1YJNA 2DJQA 2L3QA 1C0MA 1FXXA 1UGQB 2P0QA 1MHNA 1M2OA 5LJ3d 1JJ2S 2K2VA 4M77C 5AYFA 4XU3A 2D0QB 3HL8A 3MCAB 3TSWA 4XQ3A 3CD6A 2ZPEB 3CC4Q 4PJNA 1V29B 4HVWA 1VQ8Q 1YCSB 2KRSA 2M02A 4MDWA 2HCKA 2ZCFB 3QSUA 2FPDA 1X6BA 1QWFA 3X20B 3HHTB 4KGXB 1BIBA 1OEBA 1MMAA 1X69A 2NLUA 3M0SA 1Q81R 3QYHB 3O8VA 4B9XA 3R6OA 4J9CA 1NJIR 1R77A 3GNFB 2C0IA 2KXCA 2YDLA 2JTMA 1M27C 1ZQ1A 3JCMg 2ZPFB 2YUQA 2JZ2A 4NL3A 1U06A 1KC8C 3CCQQ 4J9IA 2XG8D 1WJSA 3PVQA 2YUNA 3FRNA 2E70A
chains in the Genus database with same CATH topology
4HVVA 1BBZA 3I9QA 3A98A 3NMZC 4LUEA 2J05A 2VWFA 4AFUC 2YUPA 2LX7A 2EYWA 1AVZC 2K9GA 1WYXA 1PWTA 4EIKA 1UFFA 2C0TA 2DL5A 2RMOA 2LJ3A 1ARKA 3JV3A 2OJ2A 2RQUA 1K9AA 3H0IA 5EC7A 2O9SA 4JPBW 2YT6A 2LQWA 1B3QA 2AK5A 1UUEA 4J9DA 4M4ZA 2FO0A 2JS0A 4CC3A 2CSIA 1FYNA 2RQWA 2EVRA 2DLPA 1B07A 2K79A 3I35A 5I22A 3KFVA 4RTVA 2OAWA 1SSHA 2KR3A 1HSQA 3NHNA 1YWPA 1GCQC 3VS6A 4HCKA 1OPKA 1W6XA 2CUBA 3M0QA 2CDTA 4RUGA 1MV0B 4RTZA 3UA7A 2D8HA 2DRKA 1NEBA 4WCIA 2NUZA 1I0CA 2DVJA 4K11A 2EYZA 2K7AA 2X3XD 1E6HA 2J7IA 1RLQC 2KXDA 2FG0A 1JXOA 2W10A 1OPLA 4Y92A 1E6GA 1ZUKA 2LMJA 5L23A 1PKSA 4Z89A 4E6RA 4ORZA 1RUWA 1SHFA 1M3BA 2DBKA 4CC7A 1MV3A 3QWYA 3UF4A 2FPFA 3RNJA 2LP5A 1PHTA 2J6KA 1G2BA 2RQRA 1NLOC 1OOTA 2AZSA 2HBWA 2SRCA 3I5RA 4OMMA 2K3BA 2CSQA 2DL4A 2DE0X 5ECAA 3EG2A 1SRMA 2J06A 1I1JA 2CT4A 1K76A 1J3TA 2KNBB 1YWOA 1UE9A 3PVLA 2P4RA 3NGPA 3VS7A 2F2VA 2DA9A 2RQVA 2CH4W 2EQIA 1BK2A 1H3HA 2X3WD 1Z9QA 2G6FX 1AWJA 2ESWA 4OMPA 1PRLC 2CT3A 1VYUA 2IIMA 3H41A 4D8DA 2JXBA 2PTKA 2B86A 4R0KA 1G83A 2YUOA 2K6DA 4AFQC 1AZGB 2JMAA 2I0NA 1KFZA 1VA7A 1BB9A 3THKA 1ABQA 1PNJA 5IHKA 2KRMA 1UECA 2KYBA 2GGRA 3QWXX 2JM9A 2FEIA 2OI3A 2KROA 1UDLA 1H92A 3GBQA 4RTUA 2LJ0A 1ZUUA 2JM8A 1WXUA 4RTWA 1K1ZA 2MIOA 1Y57A 2V1RA 4LE9A 2RF0A 4JZ4A 1EFNA 1SPKA 4J9HA 2L3SA 1UJYA 4J9FA 2D0NA 2AZVA 2JT4A 1QCFA 2ENMA 2KT8A 3EGUA 2GTJA 2EBPA 4AG2C 2LQNA 4F17A 4J9GA 1UHFA 1U3OA 4ZNXA 4F16A 2EYXA 2KEAA 1A0NB 2RNAA 3U23A 2GTOA 1SHGA 2MCNA 1LCKA 3IQLA 1WX6A 2H8HA 3VRZA 4Z88A 2SEMA 1X2QA 2O2OA 2DBMA 1K4US 1PRMC 1SRLA 4DEXA 1NEGA 5IHNA 2JMCA 1BU1A 5FWBA 1W70A 2RN8A 1AWWA 1KSWA 5FWCA 2F2WA 1JXMA 1UTIA 2LZ6B 2EPDA 1GFCA 2J6FA 4LNPA 2JS2A 2D1XA 2C0OA 4LN2A 3EG0A 4X1VA 2F2XA 2HSPA 1X6GA 1WLPB 2KYMA 2AKLA 1ZUYA 4IIMA 4AG1C 2L0AA 4OMNA 2EGCA 2BZXA 4QT7A 4F14A 2HDAA 2DYBA 1OV3A 2BZ8A 1ZX6A 1ZBJA 1QKWA 4LUDA 1NYFA 2EW3A 2W0ZA 3NPFA 1U5SA 3R6NA 1AOJA 1X27A 3TVTA 1H8KA 1AD5A 2EKHA 1UGVA 2L3PA 3M0RA 1JO8A 1YN8A 2DL7A 5IXBA 1VYVA 1YNZA 2ROLA 3REAB 4RTTA 2KRNA 3M0TA 4KRTA 1M30A 1GRIA 1CSKA 3VS5A 4JZ3A 1X43A 3VS4A 1S1NA 2BTTA 1ABOA 4OMQA 1T3SA 1I07A 2RQTA 1CKAA 2GQIA 3EG1A 2LCSA 4JJDA 1WFWA 1JQQA 4HXJA 5IXFA 1VYTA 4J9EA 2DNUA 2LNHB 2MOXA 1T0HA 1ZLMA 1T0JA 2O88A 1RI9A 4GLMA 2L2PA 2O9VA 2V1QA 5GJWB 1T3LA 1GCPA 4RTXA 1KJWA 1UHCA 3M0PA 3CQTA 1WXTA 3VS2A 2ROTA 3VRYA 2AKKA 2EGEA 4CC2A 1K0SA 1IO6A 2EYYA 2JTEA 3LH5A 3FJ5A 1HJDA 2M0YA 2GNCA 5HCKA 4AFZC 1NLPC 3REBB 1NYGA 2DMOA 1FMKA 4DEYA 3VS3A 2ABLA 4J9BA 1TUDA 2E5KA 4IIOA 3UA6A 4A63B 4FSSA 2CUDA 1AZEA 1PKTA 4ESRA 3O5ZA 3VS1A 1WI7A 1RLPC 1GCQA 5I11A 2NWMA 3TSZA 4OMOA 2KT1A 3ULRB 4D8KA 4HVUA 2A08A 1NG2A 2DL8A 1W1FA 3UATA 1YP5A 4RTYA 1X2KA 1E7OA 1WXBA 1GBQA 1TG0A 1M3AA 2KGTA 4JJBA 2VVKA 2JW4A 2ED0A 2FRWA 2DX1A 2PNIA 4GBQA 3PE0A 1AWOA 1AWXA 2A36A 2DRMA 4Z8AA 1GL5A 1WIEA 2ECZA 2O31A 2VKNA 4AFSC 1Y0MA 2DJQA 2FPEA 2L3QA 2CREA 5GJVB 1ZSGA 2DILA 2LJ1A 1HD3A 1M8MA 1WA7A 2D8JA 2DM1A 4JJCA 1AEYA 2A28A 1NM7A 2KBTA 3TSWA 2EGAA 2K2MA 1UG1A 2KE9A 2RPNA 1MUZA 5IHIA 1CKBA 3EG3A 3M0UA 3I5SA 2BZYA 2FRYA 1SEMA 1M3CA 3EHQA 4HVWA 1GFDA 1QKXA 1QLYA 1YCSB 2KRSA 2PZ1A 1Z9ZA 2HCKA 2HEQA 2ED1A 1KIKA 2GBQA 3RBBB 2FPDA 1X6BA 3ZL7C 1GBRA 1QWFA 1K0XA 1JU5C 3SHWA 4CC4B 1OEBA 1X69A 3M0SA 5FW9A 2M51A 1XOVA 3VS0A 4J9CA 1JEGA 2CH4A 2C0IA 2KXCA 2YDLA 1M27C 1V1CA 1UJ0A 3H0HA 2YSQA 3C0CA 1N5ZA 3SEMA 2A37A 3EHRA 2YUQA 2DL3A 5IH2A 2J6OA 2QDLA 1U06A 3H0FA 1TUCA 2DF6A 4J9IA 1WDXA 1QWEA 4OMLA 2XMFA 3PVQA 2YUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HVV A;  1BBZ A;  3I9Q A;  3A98 A;  3NMZ C;  4LUE A;  2J05 A;  2VWF A;  4AFU C;  2YUP A;  2LX7 A;  2EYW A;  1AVZ C;  2K9G A;  1WYX A;  1PWT A;  4EIK A;  1UFF A;  2C0T A;  2DL5 A;  2RMO A;  2LJ3 A;  1ARK A;  3JV3 A;  2OJ2 A;  2RQU A;  1K9A A;  3H0I A;  5EC7 A;  2O9S A;  4JPB W;  2YT6 A;  2LQW A;  1B3Q A;  2AK5 A;  1UUE A;  4J9D A;  4M4Z A;  2FO0 A;  2JS0 A;  4CC3 A;  2CSI A;  1FYN A;  2RQW A;  2EVR A;  2DLP A;  1B07 A;  2K79 A;  3I35 A;  5I22 A;  3KFV A;  4RTV A;  2OAW A;  1SSH A;  2KR3 A;  1HSQ A;  3NHN A;  1YWP A;  1GCQ C;  3VS6 A;  4HCK A;  1OPK A;  1W6X A;  2CUB A;  3M0Q A;  2CDT A;  4RUG A;  1MV0 B;  4RTZ A;  3UA7 A;  2D8H A;  2DRK A;  1NEB A;  4WCI A;  2NUZ A;  1I0C A;  2DVJ A;  4K11 A;  2EYZ A;  2K7A A;  2X3X D;  1E6H A;  2J7I A;  1RLQ C;  2KXD A;  2FG0 A;  1JXO A;  2W10 A;  1OPL A;  4Y92 A;  1E6G A;  1ZUK A;  2LMJ A;  5L23 A;  1PKS A;  4Z89 A;  4E6R A;  4ORZ A;  1RUW A;  1SHF A;  1M3B A;  2DBK A;  4CC7 A;  1MV3 A;  3QWY A;  3UF4 A;  2FPF A;  3RNJ A;  2LP5 A;  1PHT A;  2J6K A;  1G2B A;  2RQR A;  1NLO C;  1OOT A;  2AZS A;  2HBW A;  2SRC A;  3I5R A;  4OMM A;  2K3B A;  2CSQ A;  2DL4 A;  2DE0 X;  5ECA A;  3EG2 A;  1SRM A;  2J06 A;  1I1J A;  2CT4 A;  1K76 A;  1J3T A;  2KNB B;  1YWO A;  1UE9 A;  3PVL A;  2P4R A;  3NGP A;  3VS7 A;  2F2V A;  2DA9 A;  2RQV A;  2CH4 W;  2EQI A;  1BK2 A;  1H3H A;  2X3W D;  1Z9Q A;  2G6F X;  1AWJ A;  2ESW A;  4OMP A;  1PRL C;  2CT3 A;  1VYU A;  2IIM A;  3H41 A;  4D8D A;  2JXB A;  2PTK A;  2B86 A;  4R0K A;  1G83 A;  2YUO A;  2K6D A;  4AFQ C;  1AZG B;  2JMA A;  2I0N A;  1KFZ A;  1VA7 A;  1BB9 A;  3THK A;  1ABQ A;  1PNJ A;  5IHK A;  2KRM A;  1UEC A;  2KYB A;  2GGR A;  3QWX X;  2JM9 A;  2FEI A;  2OI3 A;  2KRO A;  1UDL A;  1H92 A;  3GBQ A;  4RTU A;  2LJ0 A;  1ZUU A;  2JM8 A;  1WXU A;  4RTW A;  1K1Z A;  2MIO A;  1Y57 A;  2V1R A;  4LE9 A;  2RF0 A;  4JZ4 A;  1EFN A;  1SPK A;  4J9H A;  2L3S A;  1UJY A;  4J9F A;  2D0N A;  2AZV A;  2JT4 A;  1QCF A;  2ENM A;  2KT8 A;  3EGU A;  2GTJ A;  2EBP A;  4AG2 C;  2LQN A;  4F17 A;  4J9G A;  1UHF A;  1U3O A;  4ZNX A;  4F16 A;  2EYX A;  2KEA A;  1A0N B;  2RNA A;  3U23 A;  2GTO A;  1SHG A;  2MCN A;  1LCK A;  3IQL A;  1WX6 A;  2H8H A;  3VRZ A;  4Z88 A;  2SEM A;  1X2Q A;  2O2O A;  2DBM A;  1K4U S;  1PRM C;  1SRL A;  4DEX A;  1NEG A;  5IHN A;  2JMC A;  1BU1 A;  5FWB A;  1W70 A;  2RN8 A;  1AWW A;  1KSW A;  5FWC A;  2F2W A;  1JXM A;  1UTI A;  2LZ6 B;  2EPD A;  1GFC A;  2J6F A;  4LNP A;  2JS2 A;  2D1X A;  2C0O A;  4LN2 A;  3EG0 A;  4X1V A;  2F2X A;  2HSP A;  1X6G A;  1WLP B;  2KYM A;  2AKL A;  1ZUY A;  4IIM A;  4AG1 C;  2L0A A;  4OMN A;  2EGC A;  2BZX A;  4QT7 A;  4F14 A;  2HDA A;  2DYB A;  1OV3 A;  2BZ8 A;  1ZX6 A;  1ZBJ A;  1QKW A;  4LUD A;  1NYF A;  2EW3 A;  2W0Z A;  3NPF A;  1U5S A;  3R6N A;  1AOJ A;  1X27 A;  3TVT A;  1H8K A;  1AD5 A;  2EKH A;  1UGV A;  2L3P A;  3M0R A;  1JO8 A;  1YN8 A;  2DL7 A;  5IXB A;  1VYV A;  1YNZ A;  2ROL A;  3REA B;  4RTT A;  2KRN A;  3M0T A;  4KRT A;  1M30 A;  1GRI A;  1CSK A;  3VS5 A;  4JZ3 A;  1X43 A;  3VS4 A;  1S1N A;  2BTT A;  1ABO A;  4OMQ A;  1T3S A;  1I07 A;  2RQT A;  1CKA A;  2GQI A;  3EG1 A;  2LCS A;  4JJD A;  1WFW A;  1JQQ A;  4HXJ A;  5IXF A;  1VYT A;  4J9E A;  2DNU A;  2LNH B;  2MOX A;  1T0H A;  1ZLM A;  1T0J A;  2O88 A;  1RI9 A;  4GLM A;  2L2P A;  2O9V A;  2V1Q A;  5GJW B;  1T3L A;  1GCP A;  4RTX A;  1KJW A;  1UHC A;  3M0P A;  3CQT A;  1WXT A;  3VS2 A;  2ROT A;  3VRY A;  2AKK A;  2EGE A;  4CC2 A;  1K0S A;  1IO6 A;  2EYY A;  2JTE A;  3LH5 A;  3FJ5 A;  1HJD A;  2M0Y A;  2GNC A;  5HCK A;  4AFZ C;  1NLP C;  3REB B;  1NYG A;  2DMO A;  1FMK A;  4DEY A;  3VS3 A;  2ABL A;  4J9B A;  1TUD A;  2E5K A;  4IIO A;  3UA6 A;  4A63 B;  4FSS A;  2CUD A;  1AZE A;  1PKT A;  4ESR A;  3O5Z A;  3VS1 A;  1WI7 A;  1RLP C;  1GCQ A;  5I11 A;  2NWM A;  3TSZ A;  4OMO A;  2KT1 A;  3ULR B;  4D8K A;  4HVU A;  2A08 A;  1NG2 A;  2DL8 A;  1W1F A;  3UAT A;  1YP5 A;  4RTY A;  1X2K A;  1E7O A;  1WXB A;  1GBQ A;  1TG0 A;  1M3A A;  2KGT A;  4JJB A;  2VVK A;  2JW4 A;  2ED0 A;  2FRW A;  2DX1 A;  2PNI A;  4GBQ A;  3PE0 A;  1AWO A;  1AWX A;  2A36 A;  2DRM A;  4Z8A A;  1GL5 A;  1WIE A;  2ECZ A;  2O31 A;  2VKN A;  4AFS C;  1Y0M A;  2DJQ A;  2FPE A;  2L3Q A;  2CRE A;  5GJV B;  1ZSG A;  2DIL A;  2LJ1 A;  1HD3 A;  1M8M A;  1WA7 A;  2D8J A;  2DM1 A;  4JJC A;  1AEY A;  2A28 A;  1NM7 A;  2KBT A;  3TSW A;  2EGA A;  2K2M A;  1UG1 A;  2KE9 A;  2RPN A;  1MUZ A;  5IHI A;  1CKB A;  3EG3 A;  3M0U A;  3I5S A;  2BZY A;  2FRY A;  1SEM A;  1M3C A;  3EHQ A;  4HVW A;  1GFD A;  1QKX A;  1QLY A;  1YCS B;  2KRS A;  2PZ1 A;  1Z9Z A;  2HCK A;  2HEQ A;  2ED1 A;  1KIK A;  2GBQ A;  3RBB B;  2FPD A;  1X6B A;  3ZL7 C;  1GBR A;  1QWF A;  1K0X A;  1JU5 C;  3SHW A;  4CC4 B;  1OEB A;  1X69 A;  3M0S A;  5FW9 A;  2M51 A;  1XOV A;  3VS0 A;  4J9C A;  1JEG A;  2CH4 A;  2C0I A;  2KXC A;  2YDL A;  1M27 C;  1V1C A;  1UJ0 A;  3H0H A;  2YSQ A;  3C0C A;  1N5Z A;  3SEM A;  2A37 A;  3EHR A;  2YUQ A;  2DL3 A;  5IH2 A;  2J6O A;  2QDL A;  1U06 A;  3H0F A;  1TUC A;  2DF6 A;  4J9I A;  1WDX A;  1QWE A;  4OML A;  2XMF A;  3PVQ A;  2YUN A; 
#chains in the Genus database with same CATH topology
 4NL2 A;  2CP0 A;  1WQ7 A;  2J05 A;  2LT4 A;  4AFU C;  2YUP A;  2LX7 A;  2KAF A;  3OYF A;  4EIK A;  3OYD A;  2C0T A;  2RMO A;  1U1S A;  3L2U A;  3NTK A;  3SWN C;  2O9S A;  2LQW A;  2Y4Y A;  4QQD A;  3M59 A;  1S72 T;  4J7I A;  3CD6 T;  1JBM A;  4FT4 A;  4M7A G;  2DIG A;  4CC3 A;  1EX4 A;  4MZP A;  4D6W A;  1W2B P;  1PG5 B;  5KYY A;  1FYN A;  3J81 E;  1YBY A;  3OMC A;  2OTJ T;  4LD6 A;  4RG8 A;  2K79 A;  3KFV A;  1QCO A;  2E6Z A;  2QEX T;  3NHN A;  1YWP A;  2ZGW A;  5CAI A;  2DET A;  4RTZ A;  3RMQ A;  2DRK A;  3CPF A;  1K8A R;  3GPL A;  2MF2 A;  1W2B S;  3QZ5 B;  1K73 R;  2X3X D;  2J7I A;  2KXD A;  3CMA Q;  2FG0 A;  4A4H A;  1VIF A;  4NOY A;  2OTL T;  2H3E B;  1VQN A;  1PKS A;  5IAY A;  4Z89 A;  1VQK T;  1W2B A;  1IRX A;  2DBK A;  4GLK A;  1MV3 A;  4CC7 A;  3QWY A;  4RKU E;  3A5Z B;  2E64 A;  2J6K A;  8ATC B;  1KC8 U;  3OS0 A;  1VIE A;  1IGQ A;  2JN0 A;  2AZS A;  1QVF A;  3NTI A;  2HQX A;  3LGL A;  2QYZ A;  3OSS C;  1NBE B;  1RL2 A;  3P8H A;  1K76 A;  2X4J A;  4OGE A;  5CKF A;  3NGP A;  3VS7 A;  2F2V A;  1VQ7 A;  2DA9 A;  1N8R C;  3CBM A;  2RQV A;  2CH4 W;  1BK2 A;  1H3H A;  3OW2 S;  2CZ6 B;  2DIQ A;  1B34 B;  4OMP A;  3LH0 A;  2CT3 A;  3H41 A;  2A0F B;  1TOV A;  3UT1 A;  2PTK A;  5A2Q E;  5FU6 B;  1TU0 B;  5J39 A;  4M7D A;  3BW1 A;  1BB9 A;  2EYQ A;  4C92 D;  4IUR A;  3JB9 G;  3CCR A;  4OB1 B;  1I5O B;  2XD0 A;  4PJO G;  2FZK B;  4EMK B;  1P92 A;  3CC7 Q;  3SFM A;  1YFN A;  2E41 A;  1FMV A;  2GGR A;  2JM9 A;  3M4Y A;  1VQN Q;  4EMG A;  1VQN T;  4M7A E;  1B34 A;  2KRO A;  4M75 C;  2QA4 T;  2LJ0 A;  5GMK l;  4M77 G;  2JM8 A;  1WXU A;  2QQA A;  4RTW A;  2XI9 A;  2QQB A;  2RF0 A;  1KQ2 A;  1SPK A;  2L3S A;  3L2W A;  3UWN A;  1UJY A;  3MJX A;  4FM4 B;  2AZV A;  2JT4 A;  1D09 B;  2GF7 A;  1QCF A;  2NUP A;  2P4T A;  2CP6 A;  2LQN A;  4JLI A;  4OMF B;  4QVC A;  1UHF A;  4M7D B;  2P0K A;  2ZAE A;  4XTZ A;  4F16 A;  4OB0 B;  2EYX A;  4EMK A;  3U23 A;  3X25 B;  1VQ7 Q;  1OX8 A;  2RI2 A;  4C8Q B;  3SWN B;  3V8L A;  1X2Q A;  4C8Q F;  5HY6 A;  1K4U S;  2YRV A;  3HRS A;  3M57 A;  5IHN A;  1BU1 A;  5FWC A;  2F2W A;  1JXM A;  3CME Q;  3VYH B;  1QVP A;  1GFC A;  4M78 E;  1M5Q 1;  4LNP A;  1VQM T;  4X1V A;  1YJ9 A;  2VV5 A;  2EAY A;  4KUD K;  1ZUY A;  2L0A A;  2EGC A;  2BZX A;  4F14 A;  2DD5 A;  3QJ6 A;  4J7F A;  1OV3 A;  3QHS A;  1ZBJ A;  1X27 A;  4HCZ A;  4IUU A;  2DEQ A;  2RD1 A;  3TVT A;  5FLX E;  1VQ5 A;  1OX9 A;  1AD5 A;  2DKG A;  2LC4 A;  5CK9 A;  3CCE T;  1JO8 A;  5LJ5 j;  1QW1 A;  1VQ4 Q;  1W4S A;  2DL7 A;  1VYV A;  4ELZ C;  1YNZ A;  2KRN A;  1GRI A;  3L2Z A;  4J6X A;  3VS5 A;  4JZ3 A;  2MWO A;  1S1N A;  1ABO A;  4OMQ A;  1T3S A;  5KYW A;  2RHY A;  1I07 A;  4FSX A;  2EQM A;  2DJZ A;  4JJD A;  1WFW A;  3EFO A;  4E7J A;  4PJO E;  4B9W A;  4BI3 A;  3OYE A;  2WSF E;  3QJY A;  2LNH B;  2MOX A;  1VQP T;  4PFP A;  1YIJ T;  4GLM A;  1G3W A;  2L2P A;  5GMK j;  2O9V A;  3M53 A;  3H9N A;  3JB9 J;  2V1Q A;  3FC3 A;  2LT1 A;  1TWB A;  3MET A;  4O6J A;  2A7Y A;  1WXT A;  4PJJ A;  1VQM A;  1Q7Y C;  5KYY B;  2AKK A;  3E2U A;  5LJ3 h;  2BUD A;  2EQJ A;  2BIV A;  4JJN K;  3FDR A;  3V8J A;  1SKU B;  2GNC A;  1NLP C;  1YHQ A;  4WF2 A;  1YJ9 T;  2DMO A;  5CO7 A;  4BDZ A;  2AIR B;  2R5A A;  3JCM P;  1YI2 Q;  2E5K A;  4IIO A;  4F7U A;  4C92 F;  1VQ6 T;  1ZA2 B;  1VQL A;  1WI7 A;  1FWZ A;  1GCQ A;  2RM4 A;  4OMO A;  2L8D A;  4HKE A;  2YWW A;  4D8K A;  4JLG A;  3ASK A;  1R8O B;  2QTV A;  1UGP B;  3OS2 A;  3L2R A;  1Q86 R;  3L2V A;  1E7O A;  1M2V A;  4J8O A;  2EQK A;  2KGT A;  5CKD A;  2QXF A;  2ED0 A;  1U8R A;  2MPX C;  1YJW T;  2FRW A;  2PNI A;  3VU3 C;  4M75 G;  1NPR A;  3EFS A;  5IT9 E;  2ECZ A;  2O31 A;  1QVF S;  2HMA A;  4AFS C;  4RCC A;  2OX7 A;  3X28 B;  2FL7 A;  1Y0M A;  2FPE A;  4LDU A;  1K9M R;  5CVI A;  4E7S A;  4HCB A;  1IHW A;  2KBT A;  4MDX A;  2K2M A;  3SDZ A;  1UG1 A;  5D7U A;  1I5L A;  4M7A B;  3I5S A;  3CCS T;  2BZY A;  3EGX A;  3E9G A;  1GFD A;  4KBM B;  3WXM B;  3MP1 A;  3DB3 A;  2PZ1 A;  3HRU A;  4C0D B;  2JJ9 A;  5D6W A;  2ED1 A;  1XTD A;  4DOW A;  3CCU A;  4ZTJ A;  5LJ5 f;  1AHJ B;  3KUF A;  4RG2 A;  1K0X A;  1JU5 C;  4AMC A;  2O4X B;  4CC4 B;  1D1B A;  4LD9 K;  4HT9 A;  1V1C A;  3QO3 A;  2CP3 A;  4KUI A;  3C0C A;  1YIT Q;  1N5Z A;  3VUB A;  2A37 A;  2QK0 A;  5GAO p;  2J6O A;  3CCV A;  1TUC A;  1K73 C;  4Z02 A;  5A0L A;  1EZZ B;  5GAM j;  2QQR A;  5GAM h;  3I56 T;  4HVV A;  3I9Q A;  3A98 A;  3NMZ C;  1V76 A;  4BD3 A;  1AVZ C;  3OY9 A;  4F04 B;  1KQS P;  2HKN A;  1PWT A;  2HAX A;  4EMK C;  3OYY A;  2DL5 A;  5FRO A;  4DQ2 A;  1WHM A;  2OJ2 A;  5EC7 A;  1Q81 U;  1M1G A;  3KXT A;  3BDU A;  1Y7X A;  2E3I A;  3CCJ T;  2BKD N;  3QZ9 B;  1B3Q A;  1QVG P;  2AK5 A;  1JRI A;  3OYJ A;  1GXI E;  1UUE A;  1VQ9 Q;  3PGG A;  1WJQ A;  3CMA A;  1KQS A;  3BY7 A;  3V7C A;  4E7Z A;  1ZBX A;  1KG1 A;  1PD1 A;  1KQ1 A;  2RQW A;  4XTV A;  2EVR A;  3H6Z A;  2WSC E;  4PLL A;  3HTR A;  2LTO A;  4M78 A;  2DLP A;  1PC0 A;  2HSE B;  2HQH A;  1SSH A;  2KR3 A;  5A0D A;  1D1C A;  3SWN A;  3RMS A;  5LJ5 g;  1GCQ C;  5A0G A;  3GIB A;  4E7K A;  4RUG A;  5GAO q;  1B7T A;  3CBP A;  2D8H A;  5D6Y A;  4M75 D;  4WCI A;  4JRQ A;  1HK9 A;  2QAS A;  3Q1J A;  4PL6 A;  3M9Q A;  2EYZ A;  2K7A A;  1KD1 U;  2F69 A;  2OTL A;  4L6V 5;  2D6F A;  1E6H A;  1VQ9 T;  2VXE A;  1KC8 R;  4M78 C;  2W10 A;  2FVU A;  1OPL A;  1YIJ A;  1E6G A;  2IG0 A;  1XNI A;  2RJD A;  1UGS B;  1VQO T;  1RUW A;  1OU9 A;  4N0A C;  4XU0 A;  4C8Q A;  5GAO n;  5GAN 2;  3PIO A;  2LP5 A;  2FYK A;  3PMI A;  1G2B A;  2DZ9 A;  1ZA1 B;  1G5V A;  3J7A F;  4R55 A;  1YCY A;  1WNL A;  5ECA A;  3OB9 A;  1PSE A;  4MZT A;  1YJW A;  3PVL A;  2E3H A;  1DJ7 B;  2P4R A;  1M1K C;  4JS5 A;  2DTO A;  3BDL A;  4M78 D;  1Z9Q A;  2ESW A;  3A8O B;  3NFC A;  5KYN A;  2IIM A;  4PJO C;  4B6M A;  1N6A A;  2V8I A;  1ZSZ C;  2JXB A;  1VQM Q;  2K4Y A;  4BDY A;  4V2S A;  4BI8 B;  5CKH A;  4AFQ C;  5EG2 A;  1VQL T;  2YXY A;  2NUT B;  3THK A;  4N4I A;  3EGX B;  1BIA A;  4LDW A;  5LJ3 f;  4Q5W A;  2OI3 A;  2RJF A;  4EDU A;  2DD4 A;  2Y4X A;  2XKO C;  1TTH B;  5GAN 4;  3KBG A;  5D6X A;  2V1R A;  4LE9 A;  1S72 Q;  3CCE A;  2DVE A;  1WHK A;  2M9U A;  5I21 A;  4F7U E;  1D1A A;  2KEA A;  2GTO A;  3IQL A;  2LQ8 A;  1TH7 A;  2LCL A;  4XU1 A;  3VRZ A;  4Z88 A;  5GMK e;  5LJ3 j;  3JCM X;  3CCM A;  3CC7 T;  2COY A;  1NEG A;  3I55 Q;  1RI0 A;  5FWB A;  3VKI A;  2A3L A;  2RN8 A;  1QVG S;  1WHG A;  1UTI A;  4RCB A;  2EPD A;  2DO3 A;  3DKM A;  4TVR A;  1K8A C;  2JS2 A;  2C0O A;  4LN2 A;  1WQW A;  2F2X A;  4L5G A;  4JRI A;  3CCU T;  3H8Z A;  1WLP B;  3CCU Q;  2MI6 A;  3HSB A;  4OMN A;  2LDM A;  4KT0 E;  4DOV A;  2DXB A;  2DYB A;  3LWI A;  2BZ8 A;  1QKW A;  2NUP B;  2EW3 A;  2JNG A;  3NPF A;  2WAC A;  1AOJ A;  3EGD B;  3CD6 Q;  4AT1 B;  3OYC A;  2EKH A;  3A8H B;  1UGV A;  2YLC A;  3RKW A;  2HL3 A;  2RHX A;  3EGD A;  5GAO l;  1Q95 G;  2VUB A;  1IZ6 A;  4RTT A;  4KRT A;  1M30 A;  2RJE A;  5KCH A;  4BE1 A;  1CSK A;  1KHI A;  2XDD A;  4O5V A;  3OBW A;  3JRZ A;  1MGQ A;  3P8D A;  3OYB A;  2RQT A;  4QQ6 A;  4HXJ A;  1JQQ A;  4A4F A;  2DTI A;  3BFM A;  4J9E A;  1N9R A;  4BI4 A;  3C95 A;  3OYM A;  2HL5 C;  1M1K U;  2EJG A;  1VQ7 T;  3BE3 A;  1RAE B;  4NS5 A;  1YI2 A;  2RHU A;  2R58 A;  1IHV A;  1BYM A;  5GJW B;  1T3L A;  3LYI A;  5L8R E;  4LDY A;  4XTX A;  3DLL A;  3P8B B;  5HK0 A;  3CQT A;  3VS2 A;  2ROT A;  2EWN A;  3ZFJ A;  5HKC A;  3VRY A;  9ATC B;  1KQS S;  5J3B A;  3CBO A;  2L89 A;  2F5T X;  1K0S A;  4C92 B;  2LNV A;  5HK3 A;  3S3N A;  2EYY A;  5M9O A;  1VQ4 T;  2EFI A;  2KVQ G;  2VXF A;  3OSV A;  4AFZ C;  4EPC A;  3FB9 A;  3JCM b;  2AT1 B;  5GAM g;  1AT1 B;  4P5N A;  1D3B A;  2HBP A;  1TUD A;  4OVA A;  3UA6 A;  4A63 B;  4QQG A;  4FSS A;  3CC4 T;  1RAA B;  4ESR A;  3VS1 A;  1UGR B;  4C8Q G;  3TCJ A;  4F7U G;  3JAM E;  2EKO A;  7AT1 B;  4QW2 A;  2LQK A;  1D0Y A;  3OYN A;  2QEX A;  3FLG A;  1YP5 A;  1X2K A;  2QQS A;  1I81 A;  1M3A A;  3M55 A;  2JW4 A;  1M9S A;  3CCJ Q;  4C0G A;  1UB4 A;  3PTA A;  2KQW A;  1VQO Q;  4LDV A;  1X75 C;  3E19 A;  2A36 A;  1GL5 A;  1WIE A;  5AT1 B;  1Q81 C;  2E4H A;  2VKN A;  5IN1 A;  2CRE A;  1RAD B;  5GJV B;  5GAO r;  2CS7 A;  3I55 T;  4XTY A;  3I56 A;  1M8M A;  1WA7 A;  4F7U B;  4JJC A;  4DBR A;  2LRQ A;  5GMK h;  1AEY A;  1NM7 A;  1WHJ A;  4M78 F;  3CME A;  4PFZ A;  3RIR A;  2CZ0 B;  2RPN A;  2F1L A;  1CKB A;  3EG3 A;  1SEM A;  3EHQ A;  1LOJ A;  1PM3 A;  1QLY A;  2NYS A;  2NUT A;  3HRT A;  4MMK A;  2EJF A;  3TEE A;  1Z9Z A;  1SG5 A;  4FU6 A;  1KIK A;  2PUK B;  2VYT A;  2GBQ A;  4A4K A;  4FYX B;  1RAC B;  3SHW A;  3OA6 A;  2L3R A;  4OB3 B;  3A1P A;  2QEX Q;  3CCR T;  1VQ5 Q;  4M75 E;  3G6E T;  1KD1 R;  2GFU A;  3CPW P;  3OMG A;  2YLB A;  3GLX A;  2F5K A;  2RO0 A;  1D0Z A;  4QVD A;  2CZ1 B;  1X6O A;  3SEM A;  2DFU A;  2DL3 A;  3RES A;  5IH2 A;  5DLQ E;  2QDL A;  3RKX A;  3MEU A;  1WDX A;  3CC7 A;  1ACM B;  2QAZ A;  4OML A;  2X9H A;  2XMF A;  4C92 G;  5LJ3 g;  3QXE B;  1D3B B;  4R56 A;  1BBZ A;  4JDS A;  4LUE A;  5KE2 A;  4FW2 A;  4CRI A;  3CCM T;  4XTW A;  1HXD A;  1UFF A;  3QYG B;  2COW A;  3CXC S;  2LJ3 A;  3I55 A;  2RQU A;  1K9A A;  3H0I A;  3PT9 A;  2YT6 A;  4J6Y A;  2LCC A;  2ZPH B;  4C8Q E;  2CGH A;  2HZY A;  2V8J A;  4M4Z A;  5CQX A;  2FO0 A;  2JS0 A;  4WTO B;  4HT8 A;  1Y07 A;  3JCM J;  3QDF A;  3M4G A;  5GAM d;  4M77 A;  4E7L A;  4BY6 B;  3I35 A;  2JUF A;  4RTV A;  4M7A F;  2GQV A;  4FT2 A;  1HSQ A;  4M75 A;  3J80 E;  1VQ5 T;  3JSC A;  3AHU A;  1WHL A;  3VS6 A;  5FU7 B;  1VQL Q;  4PJO B;  2CUB A;  1N8R R;  1G3T A;  2D9T A;  2IVW A;  4GY5 A;  1TUG B;  3PFS A;  3RUX A;  4M7D G;  2DVJ A;  4C92 A;  3S3O A;  1F1B B;  4K11 A;  2MAM A;  3CEY A;  2O4X A;  3QG1 A;  3V7S A;  2RHZ A;  2FHD A;  1RLQ C;  4ATO A;  1OQK A;  5GAN f;  4A4E A;  3CC2 Q;  2LVM A;  1SHF A;  3M5A A;  4KH1 B;  3RNJ A;  3HPW A;  1K9M U;  4OF1 A;  3JCM e;  3EFO B;  1M90 C;  1VQ4 A;  5GAN 5;  1ZSZ A;  3I5R A;  2CSQ A;  2DL4 A;  3EG9 A;  4VUB A;  1VQP A;  3EG2 A;  2J06 A;  3FJP A;  1OZ3 A;  1I1J A;  2CKK A;  4M75 F;  5LJ5 h;  2CT4 A;  3G71 Q;  3QDR B;  2KNB B;  2K3Y A;  4J5Y A;  1YJN T;  2RI5 A;  4N0A A;  2R5M A;  3VJP A;  4C8Q C;  1LJO A;  2DXU A;  3TQ7 P;  2EQI A;  5C6S A;  1WJR A;  1YHQ T;  2QDY B;  1NJI C;  3RR6 A;  3JB9 F;  1VYU A;  4D8D A;  2OTJ Q;  3CCL Q;  3V7R A;  3A8M B;  3PIP A;  2MWP A;  4R0K A;  5CIU A;  4M7D D;  1G83 A;  2K5L A;  2ZPI B;  2YUO A;  3E9F A;  2K6D A;  3QBY A;  3GOX A;  1VA7 A;  2PVD B;  3L2Q A;  3JB9 H;  1ABQ A;  4CI0 C;  1PNJ A;  5IHK A;  2VC8 A;  2KRM A;  3DB4 A;  4PJL A;  5GAM f;  4C92 E;  3TU4 K;  1TSF A;  2KYB A;  3CCV T;  1BI0 A;  2FEI A;  1ZHI A;  1UDL A;  1H92 A;  3GBQ A;  4RTU A;  3CC2 T;  5CCA A;  1IRE B;  3S6W A;  2MIO A;  4M7A D;  1Y57 A;  3L42 A;  4JZ4 A;  4J9H A;  2P0P A;  4J9F A;  2CYZ B;  2D0N A;  1MMD A;  4RMO A;  1JB0 E;  2KT8 A;  3EGU A;  3URG A;  4AG2 C;  1M2V B;  4J9G A;  2DK3 A;  3OS5 A;  1O9S A;  1U3O A;  1BCO A;  1X01 A;  4A4G A;  1UEB A;  5CQY A;  1A0N B;  3SB2 A;  3I56 Q;  1SHG A;  1LCK A;  1WX6 A;  3LWH A;  1C1A A;  2H8H A;  4E7I A;  1YJN Q;  2HQE A;  2M16 A;  1VQO A;  3F70 A;  4ELY C;  2JTF A;  2RK2 A;  2DBM A;  4ZGJ B;  1MNE A;  3DLM A;  1SRL A;  4DEX A;  3VUZ A;  4BAC A;  4M77 D;  4QKU A;  4JS4 A;  2OTJ A;  2JMC A;  3CCR Q;  1W70 A;  2VGN A;  1AWW A;  2ZPB B;  1WZO A;  5KYX A;  1M8V A;  2D1X A;  2MYS A;  1WGS A;  3NTH A;  1S72 A;  3EG0 A;  4ZN3 A;  2HSP A;  2KYM A;  4HA8 A;  2AKL A;  4IIM A;  3A8L B;  1H3Z A;  4YTL A;  5GAN 3;  4M7D E;  1ZX6 A;  1NYF A;  2W0Z A;  4IUV A;  4FYV B;  2ZZD A;  4X34 A;  2QG9 B;  1OUL A;  4M7A C;  1H8K A;  2E65 A;  1BI1 A;  2L3P A;  3M0R A;  3FEO A;  5IXB A;  2K3X A;  1Q82 U;  3M0T A;  3M56 A;  2M0O A;  3VS4 A;  3S3M A;  3MEW A;  1CKA A;  2GQI A;  4PJO A;  4IUT A;  2E1H A;  4J6W A;  2KMT A;  3JB9 D;  1ZLM A;  1T0J A;  2O88 A;  1WHH A;  4M78 B;  8AT1 B;  5GAN 8;  2E5Q A;  2HNI A;  1KJW A;  1M4Z A;  1YJW Q;  1UHC A;  1I8F A;  4J83 A;  3CCV Q;  2OAU A;  5GAN d;  3M0P A;  3OYL A;  2DYI A;  2G3R A;  3LLR A;  2K57 A;  4X9D A;  3PNW C;  4N4H A;  2JTE A;  3SD4 A;  1BKB A;  3LH5 A;  1HJD A;  2M0Y A;  2PUO B;  3MEA A;  2PVG B;  2PQW A;  1NYG A;  3C94 A;  1FMK A;  1KHC A;  2QQ9 A;  4M7D C;  4DEY A;  3UDC A;  4C0F A;  3JCM h;  4C0D C;  2ABL A;  2HD0 A;  3LX7 A;  3MEV A;  4EMH A;  2X51 A;  2XK0 A;  1JJ2 P;  4MZM A;  2ATC B;  3QKJ A;  1VQ9 A;  2NWM A;  3TSZ A;  3EH2 A;  2KT1 A;  5LJ5 e;  3VV0 A;  1M90 U;  2QTX A;  2QGG A;  4C5I A;  4HVU A;  3V8K A;  1M1F A;  2A08 A;  5KYU B;  1R0C B;  4JUV A;  4HCC A;  3UAT A;  3FIF A;  2FZC B;  1QMC A;  3OS1 A;  1GBQ A;  2CP2 A;  4JJB A;  2VVK A;  1U1T A;  1OZ2 A;  4PLI A;  1PSF A;  2FB7 A;  4FYW B;  2COZ A;  1VQ8 T;  4GBQ A;  3PE0 A;  2X35 A;  2P84 A;  1AWO A;  3CC2 A;  1VQP Q;  4Z8A A;  2OTL Q;  3JCM V;  2AHJ B;  1YIT A;  4DBQ A;  4FYY B;  3GNG A;  3RDV A;  5GAN h;  4ME7 A;  1ZSG A;  2DIL A;  2LJ1 A;  1HD3 A;  4DBF A;  4DA4 A;  4M7A A;  1MMN A;  2D8J A;  1PD0 A;  2DM1 A;  2XDB A;  1Q86 C;  2A28 A;  2QGF B;  2HKQ B;  3CCQ T;  2EGA A;  2KE9 A;  2KI7 A;  1MUZ A;  1QCN A;  5IHI A;  1VQ6 Q;  3M0U A;  2FRY A;  1M3C A;  3VYG A;  5KYX B;  1QKX A;  5J26 A;  4BY6 C;  2RB6 A;  3CCS A;  2HEQ A;  3G71 T;  1Y96 B;  3RBB B;  4C5E A;  3HFN A;  3ZL7 C;  1VOM A;  1GBR A;  3G6E A;  4E2F B;  4BUG A;  2XU8 A;  5C0M A;  2CP7 A;  5FW9 A;  4PJM A;  2M51 A;  1XOV A;  2DPP B;  3VS0 A;  5LJ3 e;  1JEG A;  4KGZ B;  2CH4 A;  4C5H A;  4Y28 E;  4Y91 A;  4ZN1 A;  3C4S A;  3GP8 A;  1UJ0 A;  3H0H A;  1VQK Q;  1Q7Y R;  2YSQ A;  6AT1 B;  1MMG A;  3EHR A;  5FRM A;  1VQ8 A;  1XJW B;  3GF5 A;  2FZG B;  1NE8 A;  3H0F A;  2DF6 A;  3G1J A;  5KCO A;  3PMT A;  1QWE A;  4UC4 A;  2DZC A;  5GAM e;  3CXC A;  2DER A;  2K5I A;  2PVO B;  2CP5 A;  2VWF A;  1K8A U;  1G8X A;  3EH1 A;  2EYW A;  2K9G A;  3QUI A;  1WYX A;  2X4Y A;  1G3Y A;  1BI2 A;  3MP8 A;  4XAX B;  4E7H A;  1KD1 C;  1ARK A;  3CCE Q;  3JV3 A;  3L1A A;  4II1 A;  4M78 G;  1RAH B;  2L5Q A;  4DBH A;  3ZEH A;  4JPB W;  3TRE A;  4JRP A;  3OBY A;  2Z0W A;  2Y90 A;  2RK1 A;  3OYH A;  3CCQ A;  2IPO B;  3A8G B;  1RAI B;  5GMK i;  2B8A A;  4J9D A;  3QPH A;  4C8Q D;  4JRK A;  2CSI A;  2RA2 A;  1N27 A;  5CR2 A;  2DXC A;  2E6N A;  3CXC P;  1B07 A;  5I22 A;  2R57 A;  4FIB A;  2OAW A;  3HFO A;  1QVF P;  3CCM Q;  3JCM d;  4BE2 A;  4HCK A;  1OPK A;  1W6X A;  3M0Q A;  2CDT A;  2JOY A;  1MV0 B;  4A53 A;  3UA7 A;  1NEB A;  2NUZ A;  1I0C A;  4FL6 A;  2YHT A;  5CKE A;  5DLO A;  2RI3 A;  1JXO A;  1Y71 A;  4M77 F;  4Y92 A;  4BB7 A;  1ZUK A;  2LMJ A;  3G4S Q;  5L23 A;  1QP3 A;  5GAN g;  4E6R A;  4ORZ A;  4IKF A;  1MND A;  1M3B A;  3EFR A;  3JB9 I;  1JJ2 A;  3UF4 A;  2FPF A;  1PHT A;  2KDS A;  3CCL A;  3OW2 P;  2RQR A;  4C92 C;  1NLO C;  1OOT A;  3G7Z A;  3G4S T;  3OYI A;  1NJI U;  3E1S A;  2HBW A;  2SRC A;  1LVK A;  4OMM A;  2K3B A;  4XK8 E;  2DE0 X;  2RHI A;  1SRM A;  3WVE B;  2EIF A;  4M75 B;  1J3T A;  1YWO A;  1Q86 U;  2QI2 A;  1UE9 A;  2H3J A;  4C5G A;  1RAG B;  2E12 A;  3QII A;  2I2L A;  5GAN 6;  1QVG A;  2DAQ A;  2X3W D;  1Y96 A;  3X24 B;  2G6F X;  1H64 1;  1AWJ A;  2X4X A;  4E47 A;  4BE0 A;  1PRL C;  2X4W A;  1K73 U;  4IUQ A;  5GMK m;  3JCM c;  3JCM Q;  2LX9 A;  2B86 A;  1Q82 R;  2KSS A;  2RJC A;  4KH0 B;  1AZG B;  1O75 A;  2JMA A;  3OW2 A;  1YIJ Q;  2I0N A;  5DY9 A;  1KFZ A;  2M1H A;  4ZGE B;  3OYK A;  4XTU A;  3EAE A;  2EQU A;  4OB2 B;  2XHC A;  4XU2 A;  1UEC A;  4FCY A;  2VB6 A;  3QWX X;  3ZBD A;  4PNO A;  4LXC A;  3CPW A;  4IUP A;  1XQH A;  4LDX A;  4OP0 A;  3G71 A;  3X26 B;  5DM7 R;  5FRN A;  4PJO F;  1ZUU A;  1YI2 T;  2XDP A;  1K1Z A;  2K5F A;  4ANJ A;  1EFN A;  4PK4 A;  3JCM f;  2DXT A;  1YJ9 Q;  1NPP A;  5GAN 7;  3INZ A;  2PU9 B;  2BE7 D;  2RH2 A;  2ENM A;  3MPU B;  4KGV B;  1K9M C;  2GTJ A;  5GAO m;  2EBP A;  1SF9 A;  3MHX A;  4F17 A;  1ZSZ B;  5LL6 S;  4ZNX A;  4KUL A;  1NZ9 A;  4C0Z A;  1D0X A;  2RNA A;  2C06 A;  3EG9 B;  2MCN A;  1YIT T;  5KYW B;  4X9C A;  3AT1 B;  3CMA T;  1SSF A;  2V26 A;  2SEM A;  5KE3 A;  1LNX A;  2O2O A;  2VAS A;  3CCJ A;  1PRM C;  3M58 A;  3UPU A;  1KSW A;  5I2M A;  3CME T;  2LZ6 B;  1VUB A;  2JVV A;  2J6F A;  4M77 E;  2YRD A;  3OQ5 A;  3N5B B;  1X6G A;  4OGC A;  1FX7 A;  3C12 A;  4AG1 C;  1TXQ A;  3G6E Q;  2MMP A;  4QT7 A;  2HDA A;  1QP2 A;  2XID A;  3MO8 A;  3ME9 A;  4LUD A;  1VQ6 A;  2XIC A;  1IXD A;  1U5S A;  3R6N A;  2O01 E;  1M90 R;  5KYU A;  4PFO A;  3T9N A;  3LGF A;  4A54 A;  5GAN e;  1EIF A;  3MP6 A;  1YN8 A;  1OU8 A;  2ROL A;  3REA B;  1R0B G;  1X43 A;  2E10 A;  4M7D F;  2BTT A;  5FU7 C;  2QA4 Q;  4MML A;  3EG1 A;  2LCS A;  1OI1 A;  2V8K A;  3ER0 A;  1VQK A;  5IXF A;  1VYT A;  2DNU A;  1TS9 A;  1T0H A;  3RER A;  1BCM A;  3OYG A;  1RI9 A;  2CZ7 B;  4PJO D;  1I4K 1;  1RAB B;  4ZGD B;  3M54 A;  2DEU A;  1GCP A;  4RTX A;  2DTH A;  3HKS A;  4F7U F;  2VGM A;  1RAF B;  2KY9 A;  5LJ5 d;  3HP9 A;  2EGE A;  4CC2 A;  5I2S A;  1OYX A;  1IO6 A;  1IB8 A;  2YRC A;  3D7S B;  3FJ5 A;  2WSE E;  4N4G A;  5HCK A;  3REB B;  3WVD B;  1QQJ A;  3CPW S;  2GCX A;  1BI3 A;  4L59 A;  1N8R U;  3CC4 A;  3VS3 A;  2ZPG B;  1Q82 C;  1HYO A;  4J9B A;  4ZTF A;  5FU6 C;  3JCM W;  1N9S A;  2CUD A;  2KK4 A;  1AZE A;  1IGU A;  1PKT A;  4QVZ A;  1C6V X;  3O5Z A;  3OYA A;  1RLP C;  5I11 A;  5GAN j;  1G3S A;  1M1K R;  3ULR B;  2QA4 A;  1Q7Y U;  3CCL T;  1NG2 A;  4PKC C;  2EJ9 A;  3G4S A;  2DL8 A;  1W1F A;  4RTY A;  5KH6 A;  1LPL A;  1WXB A;  1YHQ Q;  1TG0 A;  5CKB A;  2BE9 B;  2MK5 A;  2DX1 A;  1KK7 A;  1PCX A;  3RKY A;  3CCS Q;  1AWX A;  4M77 B;  2DRM A;  3LW5 E;  1WPY A;  2GFA A;  3MKD A;  1FMW A;  4FW1 A;  1YJN A;  2DJQ A;  2L3Q A;  1C0M A;  1FXX A;  1UGQ B;  2P0Q A;  1MHN A;  1M2O A;  5LJ3 d;  1JJ2 S;  2K2V A;  4M77 C;  5AYF A;  4XU3 A;  2D0Q B;  3HL8 A;  3MCA B;  3TSW A;  4XQ3 A;  3CD6 A;  2ZPE B;  3CC4 Q;  4PJN A;  1V29 B;  4HVW A;  1VQ8 Q;  1YCS B;  2KRS A;  2M02 A;  4MDW A;  2HCK A;  2ZCF B;  3QSU A;  2FPD A;  1X6B A;  1QWF A;  3X20 B;  3HHT B;  4KGX B;  1BIB A;  1OEB A;  1MMA A;  1X69 A;  2NLU A;  3M0S A;  1Q81 R;  3QYH B;  3O8V A;  4B9X A;  3R6O A;  4J9C A;  1NJI R;  1R77 A;  3GNF B;  2C0I A;  2KXC A;  2YDL A;  2JTM A;  1M27 C;  1ZQ1 A;  3JCM g;  2ZPF B;  2YUQ A;  2JZ2 A;  4NL3 A;  1U06 A;  1KC8 C;  3CCQ Q;  4J9I A;  2XG8 D;  1WJS A;  3PVQ A;  2YUN A;  3FRN A;  2E70 A; 
#chains in the Genus database with same CATH homology
 4HVV A;  1BBZ A;  3I9Q A;  3A98 A;  3NMZ C;  4LUE A;  2J05 A;  2VWF A;  4AFU C;  2YUP A;  2LX7 A;  2EYW A;  1AVZ C;  2K9G A;  1WYX A;  1PWT A;  4EIK A;  1UFF A;  2C0T A;  2DL5 A;  2RMO A;  2LJ3 A;  1ARK A;  3JV3 A;  2OJ2 A;  2RQU A;  1K9A A;  3H0I A;  5EC7 A;  2O9S A;  4JPB W;  2YT6 A;  2LQW A;  1B3Q A;  2AK5 A;  1UUE A;  4J9D A;  4M4Z A;  2FO0 A;  2JS0 A;  4CC3 A;  2CSI A;  1FYN A;  2RQW A;  2EVR A;  2DLP A;  1B07 A;  2K79 A;  3I35 A;  5I22 A;  3KFV A;  4RTV A;  2OAW A;  1SSH A;  2KR3 A;  1HSQ A;  3NHN A;  1YWP A;  1GCQ C;  3VS6 A;  4HCK A;  1OPK A;  1W6X A;  2CUB A;  3M0Q A;  2CDT A;  4RUG A;  1MV0 B;  4RTZ A;  3UA7 A;  2D8H A;  2DRK A;  1NEB A;  4WCI A;  2NUZ A;  1I0C A;  2DVJ A;  4K11 A;  2EYZ A;  2K7A A;  2X3X D;  1E6H A;  2J7I A;  1RLQ C;  2KXD A;  2FG0 A;  1JXO A;  2W10 A;  1OPL A;  4Y92 A;  1E6G A;  1ZUK A;  2LMJ A;  5L23 A;  1PKS A;  4Z89 A;  4E6R A;  4ORZ A;  1RUW A;  1SHF A;  1M3B A;  2DBK A;  4CC7 A;  1MV3 A;  3QWY A;  3UF4 A;  2FPF A;  3RNJ A;  2LP5 A;  1PHT A;  2J6K A;  1G2B A;  2RQR A;  1NLO C;  1OOT A;  2AZS A;  2HBW A;  2SRC A;  3I5R A;  4OMM A;  2K3B A;  2CSQ A;  2DL4 A;  2DE0 X;  5ECA A;  3EG2 A;  1SRM A;  2J06 A;  1I1J A;  2CT4 A;  1K76 A;  1J3T A;  2KNB B;  1YWO A;  1UE9 A;  3PVL A;  2P4R A;  3NGP A;  3VS7 A;  2F2V A;  2DA9 A;  2RQV A;  2CH4 W;  2EQI A;  1BK2 A;  1H3H A;  2X3W D;  1Z9Q A;  2G6F X;  1AWJ A;  2ESW A;  4OMP A;  1PRL C;  2CT3 A;  1VYU A;  2IIM A;  3H41 A;  4D8D A;  2JXB A;  2PTK A;  2B86 A;  4R0K A;  1G83 A;  2YUO A;  2K6D A;  4AFQ C;  1AZG B;  2JMA A;  2I0N A;  1KFZ A;  1VA7 A;  1BB9 A;  3THK A;  1ABQ A;  1PNJ A;  5IHK A;  2KRM A;  1UEC A;  2KYB A;  2GGR A;  3QWX X;  2JM9 A;  2FEI A;  2OI3 A;  2KRO A;  1UDL A;  1H92 A;  3GBQ A;  4RTU A;  2LJ0 A;  1ZUU A;  2JM8 A;  1WXU A;  4RTW A;  1K1Z A;  2MIO A;  1Y57 A;  2V1R A;  4LE9 A;  2RF0 A;  4JZ4 A;  1EFN A;  1SPK A;  4J9H A;  2L3S A;  1UJY A;  4J9F A;  2D0N A;  2AZV A;  2JT4 A;  1QCF A;  2ENM A;  2KT8 A;  3EGU A;  2GTJ A;  2EBP A;  4AG2 C;  2LQN A;  4F17 A;  4J9G A;  1UHF A;  1U3O A;  4ZNX A;  4F16 A;  2EYX A;  2KEA A;  1A0N B;  2RNA A;  3U23 A;  2GTO A;  1SHG A;  2MCN A;  1LCK A;  3IQL A;  1WX6 A;  2H8H A;  3VRZ A;  4Z88 A;  2SEM A;  1X2Q A;  2O2O A;  2DBM A;  1K4U S;  1PRM C;  1SRL A;  4DEX A;  1NEG A;  5IHN A;  2JMC A;  1BU1 A;  5FWB A;  1W70 A;  2RN8 A;  1AWW A;  1KSW A;  5FWC A;  2F2W A;  1JXM A;  1UTI A;  2LZ6 B;  2EPD A;  1GFC A;  2J6F A;  4LNP A;  2JS2 A;  2D1X A;  2C0O A;  4LN2 A;  3EG0 A;  4X1V A;  2F2X A;  2HSP A;  1X6G A;  1WLP B;  2KYM A;  2AKL A;  1ZUY A;  4IIM A;  4AG1 C;  2L0A A;  4OMN A;  2EGC A;  2BZX A;  4QT7 A;  4F14 A;  2HDA A;  2DYB A;  1OV3 A;  2BZ8 A;  1ZX6 A;  1ZBJ A;  1QKW A;  4LUD A;  1NYF A;  2EW3 A;  2W0Z A;  3NPF A;  1U5S A;  3R6N A;  1AOJ A;  1X27 A;  3TVT A;  1H8K A;  1AD5 A;  2EKH A;  1UGV A;  2L3P A;  3M0R A;  1JO8 A;  1YN8 A;  2DL7 A;  5IXB A;  1VYV A;  1YNZ A;  2ROL A;  3REA B;  4RTT A;  2KRN A;  3M0T A;  4KRT A;  1M30 A;  1GRI A;  1CSK A;  3VS5 A;  4JZ3 A;  1X43 A;  3VS4 A;  1S1N A;  2BTT A;  1ABO A;  4OMQ A;  1T3S A;  1I07 A;  2RQT A;  1CKA A;  2GQI A;  3EG1 A;  2LCS A;  4JJD A;  1WFW A;  1JQQ A;  4HXJ A;  5IXF A;  1VYT A;  4J9E A;  2DNU A;  2LNH B;  2MOX A;  1T0H A;  1ZLM A;  1T0J A;  2O88 A;  1RI9 A;  4GLM A;  2L2P A;  2O9V A;  2V1Q A;  5GJW B;  1T3L A;  1GCP A;  4RTX A;  1KJW A;  1UHC A;  3M0P A;  3CQT A;  1WXT A;  3VS2 A;  2ROT A;  3VRY A;  2AKK A;  2EGE A;  4CC2 A;  1K0S A;  1IO6 A;  2EYY A;  2JTE A;  3LH5 A;  3FJ5 A;  1HJD A;  2M0Y A;  2GNC A;  5HCK A;  4AFZ C;  1NLP C;  3REB B;  1NYG A;  2DMO A;  1FMK A;  4DEY A;  3VS3 A;  2ABL A;  4J9B A;  1TUD A;  2E5K A;  4IIO A;  3UA6 A;  4A63 B;  4FSS A;  2CUD A;  1AZE A;  1PKT A;  4ESR A;  3O5Z A;  3VS1 A;  1WI7 A;  1RLP C;  1GCQ A;  5I11 A;  2NWM A;  3TSZ A;  4OMO A;  2KT1 A;  3ULR B;  4D8K A;  4HVU A;  2A08 A;  1NG2 A;  2DL8 A;  1W1F A;  3UAT A;  1YP5 A;  4RTY A;  1X2K A;  1E7O A;  1WXB A;  1GBQ A;  1TG0 A;  1M3A A;  2KGT A;  4JJB A;  2VVK A;  2JW4 A;  2ED0 A;  2FRW A;  2DX1 A;  2PNI A;  4GBQ A;  3PE0 A;  1AWO A;  1AWX A;  2A36 A;  2DRM A;  4Z8A A;  1GL5 A;  1WIE A;  2ECZ A;  2O31 A;  2VKN A;  4AFS C;  1Y0M A;  2DJQ A;  2FPE A;  2L3Q A;  2CRE A;  5GJV B;  1ZSG A;  2DIL A;  2LJ1 A;  1HD3 A;  1M8M A;  1WA7 A;  2D8J A;  2DM1 A;  4JJC A;  1AEY A;  2A28 A;  1NM7 A;  2KBT A;  3TSW A;  2EGA A;  2K2M A;  1UG1 A;  2KE9 A;  2RPN A;  1MUZ A;  5IHI A;  1CKB A;  3EG3 A;  3M0U A;  3I5S A;  2BZY A;  2FRY A;  1SEM A;  1M3C A;  3EHQ A;  4HVW A;  1GFD A;  1QKX A;  1QLY A;  1YCS B;  2KRS A;  2PZ1 A;  1Z9Z A;  2HCK A;  2HEQ A;  2ED1 A;  1KIK A;  2GBQ A;  3RBB B;  2FPD A;  1X6B A;  3ZL7 C;  1GBR A;  1QWF A;  1K0X A;  1JU5 C;  3SHW A;  4CC4 B;  1OEB A;  1X69 A;  3M0S A;  5FW9 A;  2M51 A;  1XOV A;  3VS0 A;  4J9C A;  1JEG A;  2CH4 A;  2C0I A;  2KXC A;  2YDL A;  1M27 C;  1V1C A;  1UJ0 A;  3H0H A;  2YSQ A;  3C0C A;  1N5Z A;  3SEM A;  2A37 A;  3EHR A;  2YUQ A;  2DL3 A;  5IH2 A;  2J6O A;  2QDL A;  1U06 A;  3H0F A;  1TUC A;  2DF6 A;  4J9I A;  1WDX A;  1QWE A;  4OML A;  2XMF A;  3PVQ A;  2YUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...