5FWBA

Human spectrin sh3 domain d48g, e7f, k60f
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
b'DETGKFLVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNGRQGFVPAAYVKFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPECTRIN ALPHA CHAIN, NON-ERYTHROCYTIC 1
molecule tags Structural protein
source organism Homo sapiens
publication title Human Spectrin SH3 Domain D48G, E7F, K60F
rcsb
total genus 13
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5fwbA00
2ABLA 4K11A 2IIMA 2RMOA 2RN8A 4D8KA 1YP5A 2L3SA 4AFZC 2EYXA 3M0TA 1SHGA 2W0ZA 2L2PA 2JTEA 1K0SA 3PE0A 2CDTA 2FG0A 1UECA 2JXBA 2VVKA 3VS3A 3H0HA 2DE0X 2PTKA 2SRCA 2DLPA 2FO0A 2HCKA 2DYBA 1U06A 4JPBW 1PHTA 1T0HA 2GQIA 2RQWA 1M3CA 2V1QA 4ORZA 1N5ZA 2DL4A 1QWFA 2KT1A 1UDLA 3H0FA 1WXUA 3VS4A 1WFWA 1ZX6A 3PVLA 4RTYA 1AVZC 2EKHA 2KE9A 1UUEA 1GFCA 1YWPA 2RF0A 2VKNA 1GFDA 3VS1A 2RQUA 1TUCA 2J7IA 1K4US 2KR3A 2KRMA 2FPDA 4ESRA 2CUBA 2KROA 1W1FA 3C0CA 1TUDA 1T3SA 3EG1A 2C0IA 1QLYA 4X1VA 1VYUA 4Z88A 2O9VA 1OPKA 2JS2A 4RTVA 2LJ0A 2DA9A 2J6KA 3VRZA 3UATA 2VWFA 1PKTA 5I22A 1JQQA 2M51A 2DNUA 3RNJA 2ESWA 1AEYA 1MV0B 3I5RA 1WYXA 2DX1A 1CSKA 2YUNA 3O5ZA 2QDLA 1VA7A 2DL7A 2OI3A 3KFVA 2ROTA 1SRMA 1V1CA 3I9QA 2LQNA 3H0IA 3VS2A 4RTZA 4ZNXA 2AZVA 2MCNA 2JMAA 3SHWA 4Y92A 1X6BA 1Z9QA 2X3WD 2DF6A 4J9FA 1GBQA 2JMCA 4LUEA 2DJQA 2GNCA 1X2KA 2BTTA 4AFUC 2K2MA 2L3PA 3R6NA 2DL5A 1ZUKA 2GTOA 5IXFA 2KBTA 1NLOC 2ED0A 4KRTA 2A36A 1YWOA 1K76A 1ABOA 1X69A 3QWXX 1M30A 2G6FX 1ARKA 1W70A 2O2OA 2EGCA 2ECZA 1QKXA 5ECAA 1SHFA 2O9SA 2YSQA 2HEQA 1S1NA 2EW3A 2CSIA 1ZUUA 2D8JA 2EVRA 4OMMA 2FRYA 1T0JA 4DEXA 1J3TA 1NM7A 2DVJA 1NEGA 4LUDA 2EGAA 4JJDA 2D0NA 1VYVA 3PVQA 4CC7A 5IHKA 2YUQA 1NLPC 3H41A 2JW4A 5GJVB 3FJ5A 2HSPA 1AZEA 2E5KA 1NYFA 2RQVA 2J05A 4J9EA 5L23A 4J9CA 2FRWA 3M0PA 2GGRA 5IXBA 3EGUA 3EHQA 2OAWA 2ED1A 2C0TA 4OMPA 1E6GA 3M0QA 1MUZA 1UGVA 2CH4A 1M3BA 4A63B 4J9IA 3NPFA 4OMOA 1WXTA 1UHFA 1BB9A 2DL8A 2A37A 1WI7A 2RNAA 1H92A 3THKA 2EYYA 3UA6A 3TSWA 4LN2A 1GL5A 1M3AA 5FW9A 1AWJA 2CH4W 2RQTA 2J6FA 4JZ4A 1QCFA 3REBB 1ZSGA 1SPKA 2CUDA 2DBKA 4HXJA 2CSQA 1AWWA 4OMNA 2K79A 1UHCA 4CC2A 1I0CA 2EYZA 3VS7A 1GCQA 4RTTA 3NHNA 1E7OA 4F14A 4AFQC 4IIMA 5FWBA 2KRSA 5EC7A 2EGEA 1U5SA 1I07A 2ENMA 3LH5A 3EG2A 4WCIA 1EFNA 2HDAA 1YCSB 2EQIA 3I35A 4AG1C 2BZ8A 2LJ1A 5IHIA 1Y0MA 1X43A 2CREA 1WX6A 3A98A 1KSWA 2JS0A 4HVUA 2RPNA 4JJCA 1GCQC 3TVTA 1JO8A 1PNJA 2EPDA 2KT8A 1H3HA 4JJBA 1FYNA 1MV3A 2RQRA 2HBWA 1OOTA 2AZSA 2JM9A 2CT3A 2F2WA 2KGTA 1YN8A 1BU1A 2EYWA 2I0NA 2BZXA 1K0XA 2AK5A 2NUZA 3U23A 1KFZA 1NYGA 1PWTA 3VRYA 4J9GA 2CT4A 2KYMA 1E6HA 2K7AA 5IH2A 5HCKA 4CC4B 1UTIA 2OJ2A 2PZ1A 4EIKA 1CKBA 3QWYA 1WIEA 3M0UA 2AKLA 4GBQA 2W10A 3SEMA 4LE9A 2D8HA 1UG1A 1ABQA 2KYBA 2O31A 1ZLMA 1SRLA 1RLQC 2KEAA 1RLPC 1QKWA 1GRIA 2YUPA 4HVVA 4RTUA 2K3BA 1X2QA 1XOVA 1BK2A 4IIOA 1ZUYA 1NEBA 3VS5A 1UE9A 1I1JA 1HJDA 3EG0A 4JZ3A 1PRLC 4AFSC 1CKAA 1UJYA 1K9AA 1OEBA 2BZYA 1X6GA 1ZBJA 4HCKA 1WA7A 1K1ZA 2YDLA 3VS6A 4Z89A 2K9GA 1JU5C 2MIOA 1UFFA 2LNHB 2DL3A 2FEIA 2GTJA 2DM1A 1BBZA 4CC3A 1HSQA 1NG2A 1KJWA 3EHRA 2X3XD 3NMZC 1HD3A 2F2VA 4QT7A 4D8DA 1G83A 2PNIA 1AWOA 2O88A 2AKKA 1RUWA 4RTWA 4E6RA 2M0YA 1SSHA 4F16A 2K6DA 1Y57A 4RTXA 2DBMA 2C0OA 2A28A 4OMLA 4RUGA 1AD5A 4R0KA 1QWEA 1LCKA 1PKSA 3EG3A 3UA7A 2A08A 2LZ6B 2GBQA 3M0RA 2B86A 2L3QA 1AWXA 2JM8A 2F2XA 1RI9A 1WLPB 4GLMA 1M8MA 4FSSA 1WDXA 1SEMA 1UJ0A 2DILA 1VYTA 4Z8AA 5IHNA 2V1RA 2KXCA 4OMQA 1IO6A 3RBBB 1X27A 4LNPA 2LCSA 1T3LA 2DMOA 2DRKA 1JEGA 4J9DA 2YUOA 3ULRB 5I11A 3CQTA 5FWCA 1TG0A 3VS0A 2YT6A 2SEMA 2FPEA 2KXDA 2KRNA 1G2BA 2LJ3A 3NGPA 1KIKA 1PRMC 2LQWA 1GCPA 1Z9ZA 2DRMA 3GBQA 1OPLA 2ROLA 3ZL7C 3IQLA 1B07A 1JXMA 2EBPA 5GJWB 4HVWA 1AZGB 2KNBB 2P4RA 2LX7A 4J9HA 3REAB 2FPFA 2J6OA 1U3OA 2LP5A 4F17A 1AOJA 4M4ZA 2NWMA 1H8KA 4J9BA 1M27C 2LMJA 2L0AA 1A0NB 2MOXA 2D1XA 2XMFA 3M0SA 2J06A 3JV3A 1OV3A 1YNZA 3TSZA 3UF4A 4AG2C 3I5SA 1WXBA 2H8HA 1GBRA 1FMKA 1W6XA 2JT4A 1B3QA 4DEYA 1JXOA
chains in the Genus database with same CATH superfamily
4K11A 1TU0B 3M53A 5KYUA 2V8IA 3OS5A 1KK7A 2RN8A 4D8KA 2L3SA 2WSCE 3CEYA 2K5IA 1SHGA 1M90U 4OB3B 1SG5A 2PVGB 2JXBA 1P92A 1WHGA 2JVVA 2DLPA 2DYBA 4A4KA 4JPBW 2DO3A 5D6XA 4EMKC 2XKOC 5IT9E 2LC4A 2DL4A 4F7UG 3DLLA 2DTHA 4FYWB 4ZN3A 4M7DA 1QWFA 3H0FA 2CZ1B 3JCMh 4RTYA 2HQXA 1BI0A 1EZZB 1GFCA 3CCJA 1GFDA 3V7SA 1R77A 2RQUA 1VQMT 1ZA2B 3JB9D 1O9SA 2E65A 1W1FA 4E7LA 3V8JA 1KD1C 5GAOn 2XIDA 2A7YA 1VQMQ 1M2OA 4Z88A 4PJOA 3VRZA 2VWFA 3CCQA 4KT0E 2M51A 1WJQA 2VGMA 3I5RA 1WYXA 5CCAA 3GIBA 4QVCA 1SRMA 3G4ST 3H0IA 1YJ9T 4HA8A 2HKQB 4ZNXA 4HCCA 3EH2A 4VUBA 1YJWQ 1Z9QA 3DKMA 2V8KA 5GAN7 3EFOB 1GBQA 2JMCA 3CCMT 2DJQA 3TQ7P 3M54A 5GANj 1UGSB 3FB9A 1IZ6A 2KBTA 1YJWT 1NPPA 2M1HA 2A36A 3QWXX 3H6ZA 1ARKA 1TOVA 1BI2A 1UGRB 2DETA 5ECAA 5C0MA 1SHFA 1VQLA 1Q86R 2CS7A 1ZSZB 4C92F 1GXIE 2EW3A 1ZUUA 2D8JA 2PU9B 2FRYA 3CCUQ 3OYYA 2FHDA 4FCYA 1MMAA 2D0NA 5CKFA 3QZ5B 3J80E 2OTJA 3OYEA 3PVQA 4CC7A 1EX4A 3H41A 5KYXB 2EFIA 4ZN1A 3FJ5A 2HSPA 3M56A 3JCMb 1NYFA 1JJ2S 2L3RA 5L23A 4J9CA 1BCOA 2E3IA 3ZFJA 4M78F 3G1JA 3CCRA 2OAWA 1NPRA 2ED1A 2YXYA 2DIQA 1M1KR 4PJOE 2LTOA 1OI1A 4FL6A 1M3BA 3PNWC 4J9IA 3NPFA 4OMOA 2RH2A 5FU6B 4E7ZA 4BI3A 3E1SA 4IURA 1H92A 2AIRB 2EYYA 3OYHA 2PQWA 5FU7B 1IHVA 2JZ2A 2QXFA 1QP3A 3M5AA 5FW9A 4HCBA 1MMDA 3OW2P 4JZ4A 3REBB 1ZSGA 4B6MA 5KYYA 2CZ6B 1D0XA 4ZGDB 2DBKA 2ZPEB 3OB9A 2EJ9A 1WPYA 4L59A 4OMNA 3JCMe 3CMEA 2K2VA 1SF9A 4AFQC 4PJOB 2E1HA 2KRSA 1U5SA 4JS5A 1I07A 4YTLA 1EFNA 5DLQE 2MK5A 4AG1C 2DXTA 2BZ8A 5KE2A 1I8FA 3ME9A 1R0CB 2OX7A 4HVUA 4JJCA 2D9TA 1GCQC 2HL5C 3TVTA 1PG5B 3META 4M7DF 5GAOq 1PNJA 2KT8A 5GMKm 2HQEA 1IRXA 1H3ZA 2HBWA 1OOTA 2JM9A 3VUBA 4RG8A 4HKEA 1IXDA 1NJIC 1M2VB 3HSBA 2XDDA 1BYMA 3U23A 1KFZA 5GMKi 3HFOA 3HRUA 4J9GA 1QVFP 2KYMA 2R57A 1VQ8T 2QYZA 4C0GA 4WF2A 4EIKA 4KULA 3LW5E 2L89A 3OYIA 4GBQA 3CCST 1ABQA 2KYBA 2O31A 1ZLMA 1HYOA 2KEAA 3A8GB 1QKWA 3OS1A 4HVVA 2XDPA 2E70A 2QGGA 2EWNA 1LNXA 2Y90A 4IIOA 3URGA 3G6EQ 2RJCA 3BE3A 4N4GA 1PRLC 1N8RR 2WSFE 2RJEA 1OEBA 2RHIA 4PFPA 2G3RA 1WA7A 1XQHA 1OX9A 2LT4A 2K9GA 2E3HA 1UFFA 1W4SA 2LNHB 4EPCA 1Q7YU 2DM1A 1R0BG 3CPWS 4JRKA 1G3SA 3JRZA 5LJ3f 2DKGA 2QTVA 3GLXA 1JJ2P 3OMGA 1ZA1B 2F5KA 3EHRA 2X3XD 4N4HA 1N8RC 1X6OA 4QQDA 2NYSA 4PFZA 3JB9H 4D8DA 4N4IA 1G83A 2LT1A 3PIOA 5J3BA 4V2SA 1RUWA 4RTWA 4XQ3A 2M0YA 2JOYA 2K6DA 4L5GA 4KUDK 3X24B 4R0KA 3I55A 2FB7A 1YIJQ 2EIFA 4PKCC 2B86A 2JM8A 5KYWB 2F2XA 5CAIA 5CK9A 3X28B 1VYTA 2MMPA 1G3YA 2V1RA 2KXCA 4OMQA 3CCMA 3JCMW 1VOMA 3RUXA 3OYFA 3TREA 1JEGA 3N5BB 4BUGA 1N27A 3EGDA 1AHJB 2LNVA 5I11A 2GFAA 4PJJA 4C8QD 5GAMh 3UT1A 1YI2T 3DB4A 2RHUA 5GAOl 2K3YA 5HKCA 2SEMA 4M78E 4XU2A 3FIFA 2KRNA 2Z0WA 2GCXA 1VQ9A 1M1FA 2LQWA 1Z9ZA 4M75C 1OPLA 2CKKA 1VQ9Q 1YHQQ 5GJWB 3RIRA 3OBYA 4HVWA 4F7UE 5GMKl 1IREB 2RJDA 3MP6A 4F7UB 1UB4A 2FPFA 4XTUA 3SD4A 2J6OA 1XTDA 2LP5A 5CR2A 1TWBA 3JB9I 1H8KA 4M78A 1M27C 3EGXB 4HT9A 2LMJA 2D1XA 2O01E 2J06A 3QYGB 2P4TA 1LJOA 4AG2C 1VQ6Q 2H8HA 1FMKA 3SB2A 4FW1A 1Y7XA 3V8LA 1VQKQ 1IGUA 5FU7C 4TVRA 3OSSC 1QVFS 3VUZA 1BIAA 3OBWA 3RKWA 2OTLQ 2RMOA 1VQOA 2QQRA 3OW2S 1VQ6T 4MZTA 3GNGA 2OTLA 2JUFA 2L2PA 5IN1A 3PE0A 5GANd 1VQKT 2FG0A 2CP7A 1OZ2A 2PTKA 5GANe 1Y96A 2X9HA 2FO0A 2HCKA 1EIFA 1PHTA 1G3TA 2GQIA 2RQWA 4A53A 1M5Q1 4ZTJA 1K8AU 3JB9F 1YJNQ 4LDXA 2KT1A 3JCMX 3PVLA 2KE9A 1YFNA 3L42A 3BDLA 4FM4B 3S6WA 4BDZA 2IPOB 4HT8A 2J7IA 1X75C 2KRMA 2X4JA 4M78C 2CUBA 4ESRA 2KROA 4O6JA 4O5VA 1YIJT 3RDVA 1TUDA 1QVGP 1T3SA 3EG1A 3R6OA 2DTOA 3QIIA 2M9UA 1VYUA 2MPXC 2O9VA 3D7SB 2XDBA 4RTVA 2CP3A 2DXCA 2DA9A 4PJOG 3UATA 4C92G 1PKTA 2KAFA 2RI2A 2DNUA 1Q86U 2V26A 4JS4A 4FIBA 1AEYA 5LJ3g 2DX1A 1CSKA 2YUNA 1W2BP 3S3NA 2KY9A 2ZPIB 4DBRA 2DL7A 2YLBA 2ROTA 1V1CA 2HL3A 2P0QA 3I9QA 4B9WA 5LJ5j 3VS2A 5HY6A 1BCMA 2XHCA 1K9MU 2AZVA 1ZBXA 4C0FA 5GAN2 2HKNA 3VU3C 2NLUA 4BE1A 5GAMd 2DF6A 4J9FA 3C94A 3JCMJ 2IG0A 2ZZDA 1D1CA 2FVUA 1ZUKA 2GTOA 2DEUA 5IXFA 5GAOp 2ED0A 3VYGA 5A0LA 4KRTA 4C92B 4EMGA 3QG1A 4IUUA 3S3MA 4DOVA 5LJ3j 1JB0E 4JUVA 2YSQA 4MMKA 4MZPA 3RMSA 2DJZA 5M9OA 3CCLA 2EVRA 1T0JA 3L2WA 1NM7A 3HFNA 2WSEE 4QW2A 5J39A 4LUDA 2EGAA 4JJDA 4P5NA 1YJNA 1VYVA 4M75E 4E7SA 2YUQA 1NLPC 4M75B 3LX7A 1RAEB 5GJVB 4DBFA 1NJIU 3OS0A 2E5KA 2KK4A 2RQVA 2NUTA 4FT2A 2FRWA 3M0PA 4BACA 2CP5A 2GGRA 5IXBA 4AT1B 3CPWA 3SWNB 3X25B 2C0TA 1OZ3A 1E6GA 1VQ5Q 3JCMg 1MUZA 2RD1A 1MMNA 1UGVA 2CH4A 2PVDB 4M75D 4QKUA 1QP2A 3FC3A 3INZA 4PFOA 1UHFA 3V8KA 2A37A 1KQSS 1WI7A 3RMQA 5KE3A 5CQXA 2BE9B 4UC4A 4C5GA 1GL5A 1FX7A 2MF2A 2LCCA 2CH4W 3UDCA 5CKHA 2D0QB 2X4WA 3OW2A 1K8AC 4WTOB 1VQ4T 3HRTA 1R8OB 2CSQA 2EYQA 1V29B 1AWWA 5FU6C 4CC2A 1I0CA 2EYZA 4XU3A 3VS7A 1GCQA 4C92D 3NHNA 4M78G 3E9FA 1VQ5A 4OGCA 2P0PA 4F14A 2PVOB 4IIMA 5FWBA 5J26A 1WGSA 5EC7A 1VQ4Q 1M4ZA 2ENMA 2YWWA 3EG2A 4FSXA 1Q81C 2HDAA 3QXEB 2RB6A 2E12A 2DVEA 5IHIA 1OYXA 4C5IA 4FU6A 2CREA 2VASA 4C8QC 2HAXA 1WJRA 3CD6T 3CC4T 1H3HA 4JJBA 2RQRA 1MV3A 2RM4A 1VUBA 3TEEA 2F2WA 1ZSZC 5GMKh 1YN8A 1BU1A 2PUOB 2EYWA 2LDMA 1K0XA 2AHJB 1NE8A 3OYBA 3KBGA 4CC4B 1UTIA 2ZPHB 3EAEA 1CKBA 1NBEB 1FWZA 4LDWA 1WHMA 2K3BA 4DBQA 1XOVA 1VQNA 1QW1A 5GAMg 1BK2A 1ZUYA 2NUPA 1NEBA 3EFOA 1RAAB 5GAMj 3VJPA 3G4SQ 4AFSC 1YJWA 1CKAA 5GANh 3LH0A 2JTMA 3OYMA 1ZBJA 3HKSA 5I21A 2F1LA 9ATCB 1K1ZA 1K9MC 3CMAA 1IB8A 1JU5C 1D1AA 2FEIA 5KCHA 1WHLA 3SDZA 3S3OA 4CC3A 4C8QA 1NG2A 3CCSA 4DOWA 1U1TA 3PMIA 1KJWA 2RI5A 3Q1JA 3NMZC 2D6FA 1XNIA 2RK2A 1HD3A 2X51A 3G6EA 2F2VA 3A8MB 1VQ4A 1AWOA 2AKKA 2QTXA 3RR6A 1G5VA 4F16A 3PT9A 1Y57A 2ZPGB 2DBMA 2C0OA 2VYTA 3EGDB 4M77D 3T9NA 4IUPA 1V76A 1AD5A 4F7UF 1QWEA 1N8RU 1C0MA 3G7ZA 2FZCB 4OB2B 2QA4T 5L8RE 1WLPB 4GLMA 2DZ9A 3ASKA 3CCJT 2COWA 2HZYA 4M7AC 1UJ0A 1SSFA 2DILA 4Z02A 2R5MA 1WJSA 2DEQA 2QGFB 1X27A 2LCSA 1T3LA 2DMOA 4F7UA 1I5OB 2ZAEA 2YUOA 2KQWA 3ULRB 4PK4A 5LJ5f 3CQTA 5LJ3h 3I55Q 5KYYB 2RI3A 4EMKA 1G2BA 2XI9A 4C8QB 3NGPA 2DTIA 2M16A 4M77A 1PRMC 1KC8R 2Y4YA 2DRMA 5FRNA 2QEXA 3IQLA 3CCEQ 4BY6B 4X34A 2H3EB 2P4RA 4J9HA 3OSVA 1U3OA 2OTJQ 2FZKB 3L2ZA 1RAIB 1AOJA 3GF5A 2NUTB 2L0AA 1A0NB 2YRDA 2MOXA 1VIFA 3SWNA 1H641 3A1PA 4JRIA 3UF4A 4QQGA 4IKFA 4M7AF 1WXBA 2CP2A 3I56Q 1W6XA 1I4K1 2RHZA 2HNIA 3KXTA 4DEYA 1KC8C 5D6WA 2ABLA 1RAHB 2O4XB 5GMKj 3QYHB 2HQHA 4BB7A 5GAMf 2DPPB 3DB3A 4C92E 1YP5A 4AFZC 4M7AG 2EYXA 1VQ7T 2MWPA 5KYNA 1PM3A 1M9SA 1K0SA 1C6VX 4EMHA 4ME7A 4C8QE 3VS3A 2MI6A 3H0HA 4OMFB 2DE0X 4X9CA 2YRCA 2OAUA 3CXCS 2SRCA 1Q95G 1U06A 2XICA 1T0HA 1FXXA 4B9XA 3CCUA 4ORZA 2K5FA 2C06A 3BW1A 1YI2A 2VXEA 2CP6A 2KI7A 1TTHB 3MEVA 3CCMQ 1UDLA 3NFCA 1N9RA 4D6WA 1WFWA 5GAMe 1VQOT 1VQ9T 3RKYA 3CCLT 1IGQA 3QDFA 1TUCA 4XK8E 3L2QA 2FPDA 1VQKA 1Q7YR 3C0CA 1N6AA 4E2FB 2K4YA 1M90R 3GPLA 1QCNA 2C0IA 1QLYA 2E6NA 3HL8A 2X4YA 3RKXA 2JS2A 2J6KA 5I2MA 2DD5A 3A8HB 1JQQA 4GLKA 3RNJA 2P84A 1MV0B 5I2SA 1KQ2A 1VA7A 1S72T 2OI3A 3M59A 1QVGA 2EQUA 1RADB 4M75F 3CBOA 4KBMB 3MJXA 2L8DA 4EMKB 3JAME 4ZGJB 4RTZA 1Y07A 1KG1A 3WVEB 3SHWA 4Y92A 1X6BA 4LXCA 2X3WD 4RCBA 3QSUA 4PJOC 4LUEA 1S72Q 2M02A 2GNCA 1TSFA 1X2KA 5GAN5 4R55A 2BTTA 1M2VA 4AFUC 3MO8A 4MDWA 4PJOD 4OVAA 2LQKA 5LJ5h 3MEAA 2MAMA 5C6SA 4C5EA 4M75A 5GAN4 1ABOA 1X69A 2M0OA 3QUIA 1M30A 2DERA 4QQ6A 5GAN6 1QKXA 4PJNA 2O9SA 1VQ7A 1VQ8A 2HEQA 1S1NA 4NL3A 2R5AA 3P8HA 2CSIA 4DEXA 5CKBA 2DVJA 4C0DB 5KYUB 1YI2Q 3MHXA 1NEGA 1MNDA 3UPUA 3J7AF 2QQAA 4MMLA 1WQWA 4J83A 1U8RA 5IHKA 4J5YA 2JNGA 1JRIA 4LDYA 3JB9G 1B34A 1YJ9Q 4M78B 3EGUA 3EHQA 4XTYA 3MPUB 3CPWP 3M58A 4A63B 2E4HA 3H9NA 1WXTA 3ZBDA 4C8QG 3O8VA 2KDSA 2QG9B 2RNAA 1YHQT 2E41A 1PSEA 1QMCA 3UA6A 4HCZA 3EG9B 3OA6A 5GAN8 1KQSP 1VQNT 2FL7A 4RCCA 2XK0A 2V8JA 1YITT 1PSFA 1AWJA 3SWNC 2BKDN 2RQTA 1Q82R 5D7UA 1Y71A 4KH1B 4Q5WA 1SPKA 2CUDA 4HXJA 3CCQT 2CP0A 6AT1B 4M77B 1UHCA 2AT1B 4KGXB 4RTTA 4IUVA 1E7OA 4WCIA 2RJFA 2EQIA 1G3WA 3FRNA 3QJYA 2YHTA 3PTAA 4QVDA 1WX6A 2K3XA 2VGNA 3A98A 2DXUA 4C8QF 2COYA 1LOJA 1YJNT 4J7FA 1RAFB 1MNEA 1JO8A 3OYJA 3CCVA 1FYNA 3M57A 3TCJA 2AZSA 1QVGS 2CT3A 1BKBA 2I0NA 2BZXA 7AT1B 2AK5A 5GAOm 1KQSA 2PUKB 1WHKA 3X26B 1PWTA 3VRYA 1W2BA 3QBYA 3MEUA 2QA4A 1WQ7A 5KCOA 2K7AA 1TXQA 5HCKA 2OJ2A 3MKDA 1HK9A 4KUIA 3QWYA 1WIEA 1N9SA 2JTFA 2CZ7B 3M0UA 2AKLA 3SEMA 4LE9A 1D1BA 2QEXQ 2D8HA 1UG1A 4E7KA 1ZSZA 5KYWA 3CD6A 1U1SA 4RTUA 2YLCA 3HTRA 2EQKA 3VS5A 5CVIA 3EG0A 4JZ3A 2Y4XA 3QO3A 3SFMA 1K9AA 2RO0A 1X6GA 2E64A 4HCKA 4M78D 1I81A 4PJOF 1B34B 2YDLA 4BI8B 1K73C 2ZCFB 2MIOA 4ZTFA 3VKIA 4M7AA 2I2LA 1TH7A 2GTJA 1BBZA 3MP1A 1K73R 1MHNA 3CBPA 4M77E 3F70A 3L1AA 3G71A 2KMTA 1VQ8Q 4PJLA 4CI0C 1YITQ 2E10A 2PNIA 3EG9A 4N0AC 2XG8D 2MWOA 4LD6A 3AHUA 1SSHA 2E6ZA 2HBPA 4M7DC 2XD0A 3CC2T 4OMLA 2CGHA 4E7HA 3EFSA 3EH1A 1OU9A 4NS5A 5A2QE 3NTIA 1LCKA 4FYVB 1PKSA 2A08A 2LZ6B 1DJ7B 3UWNA 2DK3A 3M0RA 2L3QA 3OYNA 2DYIA 3CXCA 2DD4A 2DXBA 3CC2Q 1M8MA 1TS9A 3E9GA 1SEMA 4J7IA 3WXMB 5GANf 4ZGEB 4QVZA 4XTVA 1UGPB 2CYZB 4Z8AA 3H8ZA 1IO6A 3M4GA 5LJ5d 4JJNK 2DRKA 2EQMA 4J9DA 2VXFA 5FWCA 1TG0A 3CCUT 4M7DE 2YT6A 2GFUA 4DQ2A 1Y96B 2FPEA 1ACMB 2KSSA 1BIBA 1D0YA 1M1GA 2RK1A 1VQ5T 4A4FA 4A4HA 3JCMc 1GCPA 4E47A 2X35A 2P0KA 3GBQA 3CXCP 1JXMA 3FDRA 4AMCA 2EBPA 5KH6A 1SKUB 1IHWA 1AZGB 3E19A 3CMEQ 3I56A 4M7DG 3AT1B 4C92A 3JCMP 4J9BA 2HMAA 2JJ9A 4XU0A 2XMFA 3CC4A 1MGQA 1M8VA 3JV3A 1Q82C 1OV3A 1YNZA 1D09B 3BDUA 3I5SA 1GBRA 3LYIA 1JXOA 4ATOA 3L2UA 1Q81R 2IIMA 5AT1B 2DAQA 1RL2A 4C92C 1YJ9A 5GMKe 1I5LA 3MEWA 1YHQA 3M0TA 1W2BS 1KC8U 1VQMA 2W0ZA 1TUGB 2JTEA 4RG2A 2HSEB 2CDTA 4LDUA 1UECA 2VVKA 4OB1B 3CD6Q 1C1AA 3VYHB 5EG2A 4R56A 2A3LA 3I55T 1M3CA 2V1QA 5GAOr 1N5ZA 4PNOA 2L5QA 4EDUA 3ZEHA 1RAGB 4OB0B 3VS4A 1WXUA 3RESA 2JN0A 1ZX6A 3DLMA 1AVZC 1K9MR 2EKHA 5LJ5g 3L2RA 3CCET 1UUEA 1ZHIA 1YWPA 2RF0A 2VKNA 3G4SA 1UGQB 3VS1A 1FMWA 1LPLA 4C5HA 1K4US 2KR3A 2GQVA 2VC8A 5A0GA 1WZOA 2IVWA 5GANg 4LD9K 1VQPT 2DIGA 5HK0A 3FJPA 1AT1B 1VIEA 4X1VA 5CQYA 1OPKA 1YBYA 4XTWA 2RHXA 2LJ0A 4Y28E 5I22A 2GF7A 4JRQA 4ELYC 2RA2A 4E7JA 2ESWA 2MYSA 3O5ZA 2QDLA 4M77G 2BUDA 4FYYB 3OYCA 3QJ6A 3KFVA 2EJGA 3PMTA 3V7CA 2LQNA 4DA4A 2YRVA 4II1A 2MCNA 2JMAA 2QQ9A 5LJ3d 3LLRA 3A8OB 4M7DD 3NTHA 2K2MA 4IUQA 3OYGA 2L3PA 2FYKA 3R6NA 1B7TA 2DL5A 3A5ZB 5IAYA 3A8LB 1FMVA 1NLOC 1M90C 3C4SA 4OGEA 2WACA 1YWOA 3CMET 2QQSA 1K76A 5KYXA 3TU4K 1Q7YC 2VUBA 4M7AD 4M7AB 2G6FX 4M75G 3JCMQ 4CRIA 1D3BB 1W70A 1JBMA 2O2OA 4RMOA 3RERA 1K73U 2EGCA 1NZ9A 2ECZA 4MDXA 2ATCB 4PL6A 1VQOQ 1HXDA 3CCLQ 3OYKA 4JLGA 2QA4Q 4X9DA 4OMMA 3QPHA 4M77C 1J3TA 1Q82U 2H3JA 5CIUA 4L6V5 2QQBA 5LL6S 3OYAA 2ZPFB 2B8AA 3LWIA 2JW4A 3E2UA 4FW2A 2HD0A 2QK0A 1AZEA 2J05A 4J9EA 3CC2A 3C12A 4LDVA 3CC7T 4OMPA 3M4YA 3M0QA 8AT1B 4FT4A 3MP8A 4OP0A 5FLXE 1PD1A 2EQJA 3EFRA 1BB9A 2DL8A 1S72A 3VV0A 4E7IA 3THKA 1Q81U 3CC7Q 1BI3A 3TSWA 2E5QA 4LN2A 3KUFA 3CCSQ 3OY9A 2OTJT 1QQJA 2F5TX 1M3AA 1VQPQ 3HPWA 2J6FA 1QCFA 3OMCA 3QHSA 4ELZC 3G6ET 2LX9A 2QASA 4GY5A 4JDSA 3GOXA 3P8BB 1VQLQ 1YCYA 3CCRT 2K79A 3JSCA 2NUPB 4XTZA 1OQKA 4OF1A 3JCMd 2QI2A 4PJMA 3FLGA 1F1BB 2EGEA 2QDYB 1M1KC 2EJFA 3LH5A 4M7DB 1VQLT 1WNLA 1YCSB 3I35A 2LJ1A 4XU1A 3OYDA 1Y0MA 1X43A 3OS2A 3EGXA 5GAN3 5DLOA 1KSWA 3PGGA 2JS0A 4M7AE 1QVFA 5DY9A 2RPNA 3HRSA 4ANJA 4C0ZA 2EPDA 2RHYA 5AYFA 3NTKA 4PLLA 2XU8A 4PLIA 4NOYA 3X20B 1WHHA 3PIPA 4BE2A 2KGTA 3ER0A 4C0DC 4MZMA 2NUZA 1X01A 4KH0B 3WVDB 1Q86C 3BY7A 1NYGA 2EAYA 2CT4A 1D0ZA 1E6HA 5IH2A 4A54A 2LRQA 5FROA 2PZ1A 1PCXA 1D3BA 1PC0A 3BFMA 2QEXT 4M77F 2W10A 5A0DA 2VV5A 1MMGA 1VQNQ 3CPFA 1SRLA 1RLQC 8ATCB 1RLPC 2CZ0B 1GRIA 2YUPA 3LGFA 1X2QA 1YITA 3LWHA 4J6XA 5FRMA 4Y91A 1UE9A 1I1JA 3GNFB 3FEOA 1HJDA 2O4XA 3LGLA 3CCJQ 1UJYA 3M9QA 4XAXB 2BZYA 4J6YA 3CMAQ 1O75A 4BE0A 5CKEA 4BD3A 2R58A 4N0AA 3VS6A 4Z89A 3GP8A 3CC4Q 3JCMf 2DL3A 4RKUE 4DBHA 3M55A 3QDRB 1HSQA 2VB6A 1JJ2A 3L2VA 3CCVQ 4BI4A 4BDYA 3HP9A 1VQPA 1YIJA 5DM7R 4XTXA 1OU8A 1KD1R 1G8XA 4JRPA 4QT7A 2O88A 2BE7D 1LVKA 4E6RA 5HK3A 3CCVT 1WHJA 4RTXA 2FZGB 2LVMA 2A28A 3JB9J 4RUGA 3CCRQ 2DZCA 4A4EA 3EG3A 3V7RA 3UA7A 3PFSA 1VQ6A 2GBQA 3OQ5A 1AWXA 3CBMA 1RI9A 2OTLT 1KHIA 1M1KU 4FSSA 2EKOA 4A4GA 1WDXA 2COZA 4FYXB 1OULA 3I56T 2A0FB 5CO7A 5IHNA 3RBBB 2KVQG 3P8DA 4LNPA 3JCMV 3OYLA 1RABB 5LJ5e 3J81E 1RI0A 1QVPA 1KHCA 3VS0A 2ZGWA 3QZ9B 1KD1U 1VQ7Q 1QCOA 2F69A 2KXDA 2LJ3A 1KQ1A 2DFUA 2K57A 3QKJA 4F04B 1XJWB 3CCEA 4J8OA 1KIKA 2X4XA 1OX8A 2ROLA 3ZL7C 5CKDA 1BI1A 1B07A 3HHTB 3G71Q 1UEBA 2QAZA 2KNBB 2LX7A 3REAB 4NL2A 2BIVA 1NJIR 2LQ8A 4F17A 4M4ZA 4IUTA 5LJ3e 2NWMA 1RACB 1ZQ1A 4KGVB 3G71T 1K8AR 3M0SA 1PD0A 5D6YA 2K5LA 4KGZB 4BY6C 2LCLA 3TSZA 3CCQQ 4JLIA 3C95A 3CC7A 2JT4A 3MCAB 1B3QA 2ZPBB 3CMAT 4J6WA
chains in the Genus database with same CATH topology
2ABLA 4K11A 2IIMA 2RMOA 2RN8A 4D8KA 1YP5A 2L3SA 4AFZC 2EYXA 3M0TA 1SHGA 2W0ZA 2L2PA 2JTEA 1K0SA 3PE0A 2CDTA 2FG0A 1UECA 2JXBA 2VVKA 3VS3A 3H0HA 2DE0X 2PTKA 2SRCA 2DLPA 2FO0A 2HCKA 2DYBA 1U06A 4JPBW 1PHTA 1T0HA 2GQIA 2RQWA 1M3CA 2V1QA 4ORZA 1N5ZA 2DL4A 1QWFA 2KT1A 1UDLA 3H0FA 1WXUA 3VS4A 1WFWA 1ZX6A 3PVLA 4RTYA 1AVZC 2EKHA 2KE9A 1UUEA 1GFCA 1YWPA 2RF0A 2VKNA 1GFDA 3VS1A 2RQUA 1TUCA 2J7IA 1K4US 2KR3A 2KRMA 2FPDA 4ESRA 2CUBA 2KROA 1W1FA 3C0CA 1TUDA 1T3SA 3EG1A 2C0IA 1QLYA 4X1VA 1VYUA 4Z88A 2O9VA 1OPKA 2JS2A 4RTVA 2LJ0A 2DA9A 2J6KA 3VRZA 3UATA 2VWFA 1PKTA 5I22A 1JQQA 2M51A 2DNUA 3RNJA 2ESWA 1AEYA 1MV0B 3I5RA 1WYXA 2DX1A 1CSKA 2YUNA 3O5ZA 2QDLA 1VA7A 2DL7A 2OI3A 3KFVA 2ROTA 1SRMA 1V1CA 3I9QA 2LQNA 3H0IA 3VS2A 4RTZA 4ZNXA 2AZVA 2MCNA 2JMAA 3SHWA 4Y92A 1X6BA 1Z9QA 2X3WD 2DF6A 4J9FA 1GBQA 2JMCA 4LUEA 2DJQA 2GNCA 1X2KA 2BTTA 4AFUC 2K2MA 2L3PA 3R6NA 2DL5A 1ZUKA 2GTOA 5IXFA 2KBTA 1NLOC 2ED0A 4KRTA 2A36A 1YWOA 1K76A 1ABOA 1X69A 3QWXX 1M30A 2G6FX 1ARKA 1W70A 2O2OA 2EGCA 2ECZA 1QKXA 5ECAA 1SHFA 2O9SA 2YSQA 2HEQA 1S1NA 2EW3A 2CSIA 1ZUUA 2D8JA 2EVRA 4OMMA 2FRYA 1T0JA 4DEXA 1J3TA 1NM7A 2DVJA 1NEGA 4LUDA 2EGAA 4JJDA 2D0NA 1VYVA 3PVQA 4CC7A 5IHKA 2YUQA 1NLPC 3H41A 2JW4A 5GJVB 3FJ5A 2HSPA 1AZEA 2E5KA 1NYFA 2RQVA 2J05A 4J9EA 5L23A 4J9CA 2FRWA 3M0PA 2GGRA 5IXBA 3EGUA 3EHQA 2OAWA 2ED1A 2C0TA 4OMPA 1E6GA 3M0QA 1MUZA 1UGVA 2CH4A 1M3BA 4A63B 4J9IA 3NPFA 4OMOA 1WXTA 1UHFA 1BB9A 2DL8A 2A37A 1WI7A 2RNAA 1H92A 3THKA 2EYYA 3UA6A 3TSWA 4LN2A 1GL5A 1M3AA 5FW9A 1AWJA 2CH4W 2RQTA 2J6FA 4JZ4A 1QCFA 3REBB 1ZSGA 1SPKA 2CUDA 2DBKA 4HXJA 2CSQA 1AWWA 4OMNA 2K79A 1UHCA 4CC2A 1I0CA 2EYZA 3VS7A 1GCQA 4RTTA 3NHNA 1E7OA 4F14A 4AFQC 4IIMA 5FWBA 2KRSA 5EC7A 2EGEA 1U5SA 1I07A 2ENMA 3LH5A 3EG2A 4WCIA 1EFNA 2HDAA 1YCSB 2EQIA 3I35A 4AG1C 2BZ8A 2LJ1A 5IHIA 1Y0MA 1X43A 2CREA 1WX6A 3A98A 1KSWA 2JS0A 4HVUA 2RPNA 4JJCA 1GCQC 3TVTA 1JO8A 1PNJA 2EPDA 2KT8A 1H3HA 4JJBA 1FYNA 1MV3A 2RQRA 2HBWA 1OOTA 2AZSA 2JM9A 2CT3A 2F2WA 2KGTA 1YN8A 1BU1A 2EYWA 2I0NA 2BZXA 1K0XA 2AK5A 2NUZA 3U23A 1KFZA 1NYGA 1PWTA 3VRYA 4J9GA 2CT4A 2KYMA 1E6HA 2K7AA 5IH2A 5HCKA 4CC4B 1UTIA 2OJ2A 2PZ1A 4EIKA 1CKBA 3QWYA 1WIEA 3M0UA 2AKLA 4GBQA 2W10A 3SEMA 4LE9A 2D8HA 1UG1A 1ABQA 2KYBA 2O31A 1ZLMA 1SRLA 1RLQC 2KEAA 1RLPC 1QKWA 1GRIA 2YUPA 4HVVA 4RTUA 2K3BA 1X2QA 1XOVA 1BK2A 4IIOA 1ZUYA 1NEBA 3VS5A 1UE9A 1I1JA 1HJDA 3EG0A 4JZ3A 1PRLC 4AFSC 1CKAA 1UJYA 1K9AA 1OEBA 2BZYA 1X6GA 1ZBJA 4HCKA 1WA7A 1K1ZA 2YDLA 3VS6A 4Z89A 2K9GA 1JU5C 2MIOA 1UFFA 2LNHB 2DL3A 2FEIA 2GTJA 2DM1A 1BBZA 4CC3A 1HSQA 1NG2A 1KJWA 3EHRA 2X3XD 3NMZC 1HD3A 2F2VA 4QT7A 4D8DA 1G83A 2PNIA 1AWOA 2O88A 2AKKA 1RUWA 4RTWA 4E6RA 2M0YA 1SSHA 4F16A 2K6DA 1Y57A 4RTXA 2DBMA 2C0OA 2A28A 4OMLA 4RUGA 1AD5A 4R0KA 1QWEA 1LCKA 1PKSA 3EG3A 3UA7A 2A08A 2LZ6B 2GBQA 3M0RA 2B86A 2L3QA 1AWXA 2JM8A 2F2XA 1RI9A 1WLPB 4GLMA 1M8MA 4FSSA 1WDXA 1SEMA 1UJ0A 2DILA 1VYTA 4Z8AA 5IHNA 2V1RA 2KXCA 4OMQA 1IO6A 3RBBB 1X27A 4LNPA 2LCSA 1T3LA 2DMOA 2DRKA 1JEGA 4J9DA 2YUOA 3ULRB 5I11A 3CQTA 5FWCA 1TG0A 3VS0A 2YT6A 2SEMA 2FPEA 2KXDA 2KRNA 1G2BA 2LJ3A 3NGPA 1KIKA 1PRMC 2LQWA 1GCPA 1Z9ZA 2DRMA 3GBQA 1OPLA 2ROLA 3ZL7C 3IQLA 1B07A 1JXMA 2EBPA 5GJWB 4HVWA 1AZGB 2KNBB 2P4RA 2LX7A 4J9HA 3REAB 2FPFA 2J6OA 1U3OA 2LP5A 4F17A 1AOJA 4M4ZA 2NWMA 1H8KA 4J9BA 1M27C 2LMJA 2L0AA 1A0NB 2MOXA 2D1XA 2XMFA 3M0SA 2J06A 3JV3A 1OV3A 1YNZA 3TSZA 3UF4A 4AG2C 3I5SA 1WXBA 2H8HA 1GBRA 1FMKA 1W6XA 2JT4A 1B3QA 4DEYA 1JXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ABL A;  4K11 A;  2IIM A;  2RMO A;  2RN8 A;  4D8K A;  1YP5 A;  2L3S A;  4AFZ C;  2EYX A;  3M0T A;  1SHG A;  2W0Z A;  2L2P A;  2JTE A;  1K0S A;  3PE0 A;  2CDT A;  2FG0 A;  1UEC A;  2JXB A;  2VVK A;  3VS3 A;  3H0H A;  2DE0 X;  2PTK A;  2SRC A;  2DLP A;  2FO0 A;  2HCK A;  2DYB A;  1U06 A;  4JPB W;  1PHT A;  1T0H A;  2GQI A;  2RQW A;  1M3C A;  2V1Q A;  4ORZ A;  1N5Z A;  2DL4 A;  1QWF A;  2KT1 A;  1UDL A;  3H0F A;  1WXU A;  3VS4 A;  1WFW A;  1ZX6 A;  3PVL A;  4RTY A;  1AVZ C;  2EKH A;  2KE9 A;  1UUE A;  1GFC A;  1YWP A;  2RF0 A;  2VKN A;  1GFD A;  3VS1 A;  2RQU A;  1TUC A;  2J7I A;  1K4U S;  2KR3 A;  2KRM A;  2FPD A;  4ESR A;  2CUB A;  2KRO A;  1W1F A;  3C0C A;  1TUD A;  1T3S A;  3EG1 A;  2C0I A;  1QLY A;  4X1V A;  1VYU A;  4Z88 A;  2O9V A;  1OPK A;  2JS2 A;  4RTV A;  2LJ0 A;  2DA9 A;  2J6K A;  3VRZ A;  3UAT A;  2VWF A;  1PKT A;  5I22 A;  1JQQ A;  2M51 A;  2DNU A;  3RNJ A;  2ESW A;  1AEY A;  1MV0 B;  3I5R A;  1WYX A;  2DX1 A;  1CSK A;  2YUN A;  3O5Z A;  2QDL A;  1VA7 A;  2DL7 A;  2OI3 A;  3KFV A;  2ROT A;  1SRM A;  1V1C A;  3I9Q A;  2LQN A;  3H0I A;  3VS2 A;  4RTZ A;  4ZNX A;  2AZV A;  2MCN A;  2JMA A;  3SHW A;  4Y92 A;  1X6B A;  1Z9Q A;  2X3W D;  2DF6 A;  4J9F A;  1GBQ A;  2JMC A;  4LUE A;  2DJQ A;  2GNC A;  1X2K A;  2BTT A;  4AFU C;  2K2M A;  2L3P A;  3R6N A;  2DL5 A;  1ZUK A;  2GTO A;  5IXF A;  2KBT A;  1NLO C;  2ED0 A;  4KRT A;  2A36 A;  1YWO A;  1K76 A;  1ABO A;  1X69 A;  3QWX X;  1M30 A;  2G6F X;  1ARK A;  1W70 A;  2O2O A;  2EGC A;  2ECZ A;  1QKX A;  5ECA A;  1SHF A;  2O9S A;  2YSQ A;  2HEQ A;  1S1N A;  2EW3 A;  2CSI A;  1ZUU A;  2D8J A;  2EVR A;  4OMM A;  2FRY A;  1T0J A;  4DEX A;  1J3T A;  1NM7 A;  2DVJ A;  1NEG A;  4LUD A;  2EGA A;  4JJD A;  2D0N A;  1VYV A;  3PVQ A;  4CC7 A;  5IHK A;  2YUQ A;  1NLP C;  3H41 A;  2JW4 A;  5GJV B;  3FJ5 A;  2HSP A;  1AZE A;  2E5K A;  1NYF A;  2RQV A;  2J05 A;  4J9E A;  5L23 A;  4J9C A;  2FRW A;  3M0P A;  2GGR A;  5IXB A;  3EGU A;  3EHQ A;  2OAW A;  2ED1 A;  2C0T A;  4OMP A;  1E6G A;  3M0Q A;  1MUZ A;  1UGV A;  2CH4 A;  1M3B A;  4A63 B;  4J9I A;  3NPF A;  4OMO A;  1WXT A;  1UHF A;  1BB9 A;  2DL8 A;  2A37 A;  1WI7 A;  2RNA A;  1H92 A;  3THK A;  2EYY A;  3UA6 A;  3TSW A;  4LN2 A;  1GL5 A;  1M3A A;  5FW9 A;  1AWJ A;  2CH4 W;  2RQT A;  2J6F A;  4JZ4 A;  1QCF A;  3REB B;  1ZSG A;  1SPK A;  2CUD A;  2DBK A;  4HXJ A;  2CSQ A;  1AWW A;  4OMN A;  2K79 A;  1UHC A;  4CC2 A;  1I0C A;  2EYZ A;  3VS7 A;  1GCQ A;  4RTT A;  3NHN A;  1E7O A;  4F14 A;  4AFQ C;  4IIM A;  5FWB A;  2KRS A;  5EC7 A;  2EGE A;  1U5S A;  1I07 A;  2ENM A;  3LH5 A;  3EG2 A;  4WCI A;  1EFN A;  2HDA A;  1YCS B;  2EQI A;  3I35 A;  4AG1 C;  2BZ8 A;  2LJ1 A;  5IHI A;  1Y0M A;  1X43 A;  2CRE A;  1WX6 A;  3A98 A;  1KSW A;  2JS0 A;  4HVU A;  2RPN A;  4JJC A;  1GCQ C;  3TVT A;  1JO8 A;  1PNJ A;  2EPD A;  2KT8 A;  1H3H A;  4JJB A;  1FYN A;  1MV3 A;  2RQR A;  2HBW A;  1OOT A;  2AZS A;  2JM9 A;  2CT3 A;  2F2W A;  2KGT A;  1YN8 A;  1BU1 A;  2EYW A;  2I0N A;  2BZX A;  1K0X A;  2AK5 A;  2NUZ A;  3U23 A;  1KFZ A;  1NYG A;  1PWT A;  3VRY A;  4J9G A;  2CT4 A;  2KYM A;  1E6H A;  2K7A A;  5IH2 A;  5HCK A;  4CC4 B;  1UTI A;  2OJ2 A;  2PZ1 A;  4EIK A;  1CKB A;  3QWY A;  1WIE A;  3M0U A;  2AKL A;  4GBQ A;  2W10 A;  3SEM A;  4LE9 A;  2D8H A;  1UG1 A;  1ABQ A;  2KYB A;  2O31 A;  1ZLM A;  1SRL A;  1RLQ C;  2KEA A;  1RLP C;  1QKW A;  1GRI A;  2YUP A;  4HVV A;  4RTU A;  2K3B A;  1X2Q A;  1XOV A;  1BK2 A;  4IIO A;  1ZUY A;  1NEB A;  3VS5 A;  1UE9 A;  1I1J A;  1HJD A;  3EG0 A;  4JZ3 A;  1PRL C;  4AFS C;  1CKA A;  1UJY A;  1K9A A;  1OEB A;  2BZY A;  1X6G A;  1ZBJ A;  4HCK A;  1WA7 A;  1K1Z A;  2YDL A;  3VS6 A;  4Z89 A;  2K9G A;  1JU5 C;  2MIO A;  1UFF A;  2LNH B;  2DL3 A;  2FEI A;  2GTJ A;  2DM1 A;  1BBZ A;  4CC3 A;  1HSQ A;  1NG2 A;  1KJW A;  3EHR A;  2X3X D;  3NMZ C;  1HD3 A;  2F2V A;  4QT7 A;  4D8D A;  1G83 A;  2PNI A;  1AWO A;  2O88 A;  2AKK A;  1RUW A;  4RTW A;  4E6R A;  2M0Y A;  1SSH A;  4F16 A;  2K6D A;  1Y57 A;  4RTX A;  2DBM A;  2C0O A;  2A28 A;  4OML A;  4RUG A;  1AD5 A;  4R0K A;  1QWE A;  1LCK A;  1PKS A;  3EG3 A;  3UA7 A;  2A08 A;  2LZ6 B;  2GBQ A;  3M0R A;  2B86 A;  2L3Q A;  1AWX A;  2JM8 A;  2F2X A;  1RI9 A;  1WLP B;  4GLM A;  1M8M A;  4FSS A;  1WDX A;  1SEM A;  1UJ0 A;  2DIL A;  1VYT A;  4Z8A A;  5IHN A;  2V1R A;  2KXC A;  4OMQ A;  1IO6 A;  3RBB B;  1X27 A;  4LNP A;  2LCS A;  1T3L A;  2DMO A;  2DRK A;  1JEG A;  4J9D A;  2YUO A;  3ULR B;  5I11 A;  3CQT A;  5FWC A;  1TG0 A;  3VS0 A;  2YT6 A;  2SEM A;  2FPE A;  2KXD A;  2KRN A;  1G2B A;  2LJ3 A;  3NGP A;  1KIK A;  1PRM C;  2LQW A;  1GCP A;  1Z9Z A;  2DRM A;  3GBQ A;  1OPL A;  2ROL A;  3ZL7 C;  3IQL A;  1B07 A;  1JXM A;  2EBP A;  5GJW B;  4HVW A;  1AZG B;  2KNB B;  2P4R A;  2LX7 A;  4J9H A;  3REA B;  2FPF A;  2J6O A;  1U3O A;  2LP5 A;  4F17 A;  1AOJ A;  4M4Z A;  2NWM A;  1H8K A;  4J9B A;  1M27 C;  2LMJ A;  2L0A A;  1A0N B;  2MOX A;  2D1X A;  2XMF A;  3M0S A;  2J06 A;  3JV3 A;  1OV3 A;  1YNZ A;  3TSZ A;  3UF4 A;  4AG2 C;  3I5S A;  1WXB A;  2H8H A;  1GBR A;  1FMK A;  1W6X A;  2JT4 A;  1B3Q A;  4DEY A;  1JXO A; 
#chains in the Genus database with same CATH topology
 4K11 A;  1TU0 B;  3M53 A;  5KYU A;  2V8I A;  3OS5 A;  1KK7 A;  2RN8 A;  4D8K A;  2L3S A;  2WSC E;  3CEY A;  2K5I A;  1SHG A;  1M90 U;  4OB3 B;  1SG5 A;  2PVG B;  2JXB A;  1P92 A;  1WHG A;  2JVV A;  2DLP A;  2DYB A;  4A4K A;  4JPB W;  2DO3 A;  5D6X A;  4EMK C;  2XKO C;  5IT9 E;  2LC4 A;  2DL4 A;  4F7U G;  3DLL A;  2DTH A;  4FYW B;  4ZN3 A;  4M7D A;  1QWF A;  3H0F A;  2CZ1 B;  3JCM h;  4RTY A;  2HQX A;  1BI0 A;  1EZZ B;  1GFC A;  3CCJ A;  1GFD A;  3V7S A;  1R77 A;  2RQU A;  1VQM T;  1ZA2 B;  3JB9 D;  1O9S A;  2E65 A;  1W1F A;  4E7L A;  3V8J A;  1KD1 C;  5GAO n;  2XID A;  2A7Y A;  1VQM Q;  1M2O A;  4Z88 A;  4PJO A;  3VRZ A;  2VWF A;  3CCQ A;  4KT0 E;  2M51 A;  1WJQ A;  2VGM A;  3I5R A;  1WYX A;  5CCA A;  3GIB A;  4QVC A;  1SRM A;  3G4S T;  3H0I A;  1YJ9 T;  4HA8 A;  2HKQ B;  4ZNX A;  4HCC A;  3EH2 A;  4VUB A;  1YJW Q;  1Z9Q A;  3DKM A;  2V8K A;  5GAN 7;  3EFO B;  1GBQ A;  2JMC A;  3CCM T;  2DJQ A;  3TQ7 P;  3M54 A;  5GAN j;  1UGS B;  3FB9 A;  1IZ6 A;  2KBT A;  1YJW T;  1NPP A;  2M1H A;  2A36 A;  3QWX X;  3H6Z A;  1ARK A;  1TOV A;  1BI2 A;  1UGR B;  2DET A;  5ECA A;  5C0M A;  1SHF A;  1VQL A;  1Q86 R;  2CS7 A;  1ZSZ B;  4C92 F;  1GXI E;  2EW3 A;  1ZUU A;  2D8J A;  2PU9 B;  2FRY A;  3CCU Q;  3OYY A;  2FHD A;  4FCY A;  1MMA A;  2D0N A;  5CKF A;  3QZ5 B;  3J80 E;  2OTJ A;  3OYE A;  3PVQ A;  4CC7 A;  1EX4 A;  3H41 A;  5KYX B;  2EFI A;  4ZN1 A;  3FJ5 A;  2HSP A;  3M56 A;  3JCM b;  1NYF A;  1JJ2 S;  2L3R A;  5L23 A;  4J9C A;  1BCO A;  2E3I A;  3ZFJ A;  4M78 F;  3G1J A;  3CCR A;  2OAW A;  1NPR A;  2ED1 A;  2YXY A;  2DIQ A;  1M1K R;  4PJO E;  2LTO A;  1OI1 A;  4FL6 A;  1M3B A;  3PNW C;  4J9I A;  3NPF A;  4OMO A;  2RH2 A;  5FU6 B;  4E7Z A;  4BI3 A;  3E1S A;  4IUR A;  1H92 A;  2AIR B;  2EYY A;  3OYH A;  2PQW A;  5FU7 B;  1IHV A;  2JZ2 A;  2QXF A;  1QP3 A;  3M5A A;  5FW9 A;  4HCB A;  1MMD A;  3OW2 P;  4JZ4 A;  3REB B;  1ZSG A;  4B6M A;  5KYY A;  2CZ6 B;  1D0X A;  4ZGD B;  2DBK A;  2ZPE B;  3OB9 A;  2EJ9 A;  1WPY A;  4L59 A;  4OMN A;  3JCM e;  3CME A;  2K2V A;  1SF9 A;  4AFQ C;  4PJO B;  2E1H A;  2KRS A;  1U5S A;  4JS5 A;  1I07 A;  4YTL A;  1EFN A;  5DLQ E;  2MK5 A;  4AG1 C;  2DXT A;  2BZ8 A;  5KE2 A;  1I8F A;  3ME9 A;  1R0C B;  2OX7 A;  4HVU A;  4JJC A;  2D9T A;  1GCQ C;  2HL5 C;  3TVT A;  1PG5 B;  3MET A;  4M7D F;  5GAO q;  1PNJ A;  2KT8 A;  5GMK m;  2HQE A;  1IRX A;  1H3Z A;  2HBW A;  1OOT A;  2JM9 A;  3VUB A;  4RG8 A;  4HKE A;  1IXD A;  1NJI C;  1M2V B;  3HSB A;  2XDD A;  1BYM A;  3U23 A;  1KFZ A;  5GMK i;  3HFO A;  3HRU A;  4J9G A;  1QVF P;  2KYM A;  2R57 A;  1VQ8 T;  2QYZ A;  4C0G A;  4WF2 A;  4EIK A;  4KUL A;  3LW5 E;  2L89 A;  3OYI A;  4GBQ A;  3CCS T;  1ABQ A;  2KYB A;  2O31 A;  1ZLM A;  1HYO A;  2KEA A;  3A8G B;  1QKW A;  3OS1 A;  4HVV A;  2XDP A;  2E70 A;  2QGG A;  2EWN A;  1LNX A;  2Y90 A;  4IIO A;  3URG A;  3G6E Q;  2RJC A;  3BE3 A;  4N4G A;  1PRL C;  1N8R R;  2WSF E;  2RJE A;  1OEB A;  2RHI A;  4PFP A;  2G3R A;  1WA7 A;  1XQH A;  1OX9 A;  2LT4 A;  2K9G A;  2E3H A;  1UFF A;  1W4S A;  2LNH B;  4EPC A;  1Q7Y U;  2DM1 A;  1R0B G;  3CPW S;  4JRK A;  1G3S A;  3JRZ A;  5LJ3 f;  2DKG A;  2QTV A;  3GLX A;  1JJ2 P;  3OMG A;  1ZA1 B;  2F5K A;  3EHR A;  2X3X D;  4N4H A;  1N8R C;  1X6O A;  4QQD A;  2NYS A;  4PFZ A;  3JB9 H;  4D8D A;  4N4I A;  1G83 A;  2LT1 A;  3PIO A;  5J3B A;  4V2S A;  1RUW A;  4RTW A;  4XQ3 A;  2M0Y A;  2JOY A;  2K6D A;  4L5G A;  4KUD K;  3X24 B;  4R0K A;  3I55 A;  2FB7 A;  1YIJ Q;  2EIF A;  4PKC C;  2B86 A;  2JM8 A;  5KYW B;  2F2X A;  5CAI A;  5CK9 A;  3X28 B;  1VYT A;  2MMP A;  1G3Y A;  2V1R A;  2KXC A;  4OMQ A;  3CCM A;  3JCM W;  1VOM A;  3RUX A;  3OYF A;  3TRE A;  1JEG A;  3N5B B;  4BUG A;  1N27 A;  3EGD A;  1AHJ B;  2LNV A;  5I11 A;  2GFA A;  4PJJ A;  4C8Q D;  5GAM h;  3UT1 A;  1YI2 T;  3DB4 A;  2RHU A;  5GAO l;  2K3Y A;  5HKC A;  2SEM A;  4M78 E;  4XU2 A;  3FIF A;  2KRN A;  2Z0W A;  2GCX A;  1VQ9 A;  1M1F A;  2LQW A;  1Z9Z A;  4M75 C;  1OPL A;  2CKK A;  1VQ9 Q;  1YHQ Q;  5GJW B;  3RIR A;  3OBY A;  4HVW A;  4F7U E;  5GMK l;  1IRE B;  2RJD A;  3MP6 A;  4F7U B;  1UB4 A;  2FPF A;  4XTU A;  3SD4 A;  2J6O A;  1XTD A;  2LP5 A;  5CR2 A;  1TWB A;  3JB9 I;  1H8K A;  4M78 A;  1M27 C;  3EGX B;  4HT9 A;  2LMJ A;  2D1X A;  2O01 E;  2J06 A;  3QYG B;  2P4T A;  1LJO A;  4AG2 C;  1VQ6 Q;  2H8H A;  1FMK A;  3SB2 A;  4FW1 A;  1Y7X A;  3V8L A;  1VQK Q;  1IGU A;  5FU7 C;  4TVR A;  3OSS C;  1QVF S;  3VUZ A;  1BIA A;  3OBW A;  3RKW A;  2OTL Q;  2RMO A;  1VQO A;  2QQR A;  3OW2 S;  1VQ6 T;  4MZT A;  3GNG A;  2OTL A;  2JUF A;  2L2P A;  5IN1 A;  3PE0 A;  5GAN d;  1VQK T;  2FG0 A;  2CP7 A;  1OZ2 A;  2PTK A;  5GAN e;  1Y96 A;  2X9H A;  2FO0 A;  2HCK A;  1EIF A;  1PHT A;  1G3T A;  2GQI A;  2RQW A;  4A53 A;  1M5Q 1;  4ZTJ A;  1K8A U;  3JB9 F;  1YJN Q;  4LDX A;  2KT1 A;  3JCM X;  3PVL A;  2KE9 A;  1YFN A;  3L42 A;  3BDL A;  4FM4 B;  3S6W A;  4BDZ A;  2IPO B;  4HT8 A;  2J7I A;  1X75 C;  2KRM A;  2X4J A;  4M78 C;  2CUB A;  4ESR A;  2KRO A;  4O6J A;  4O5V A;  1YIJ T;  3RDV A;  1TUD A;  1QVG P;  1T3S A;  3EG1 A;  3R6O A;  2DTO A;  3QII A;  2M9U A;  1VYU A;  2MPX C;  2O9V A;  3D7S B;  2XDB A;  4RTV A;  2CP3 A;  2DXC A;  2DA9 A;  4PJO G;  3UAT A;  4C92 G;  1PKT A;  2KAF A;  2RI2 A;  2DNU A;  1Q86 U;  2V26 A;  4JS4 A;  4FIB A;  1AEY A;  5LJ3 g;  2DX1 A;  1CSK A;  2YUN A;  1W2B P;  3S3N A;  2KY9 A;  2ZPI B;  4DBR A;  2DL7 A;  2YLB A;  2ROT A;  1V1C A;  2HL3 A;  2P0Q A;  3I9Q A;  4B9W A;  5LJ5 j;  3VS2 A;  5HY6 A;  1BCM A;  2XHC A;  1K9M U;  2AZV A;  1ZBX A;  4C0F A;  5GAN 2;  2HKN A;  3VU3 C;  2NLU A;  4BE1 A;  5GAM d;  2DF6 A;  4J9F A;  3C94 A;  3JCM J;  2IG0 A;  2ZZD A;  1D1C A;  2FVU A;  1ZUK A;  2GTO A;  2DEU A;  5IXF A;  5GAO p;  2ED0 A;  3VYG A;  5A0L A;  4KRT A;  4C92 B;  4EMG A;  3QG1 A;  4IUU A;  3S3M A;  4DOV A;  5LJ3 j;  1JB0 E;  4JUV A;  2YSQ A;  4MMK A;  4MZP A;  3RMS A;  2DJZ A;  5M9O A;  3CCL A;  2EVR A;  1T0J A;  3L2W A;  1NM7 A;  3HFN A;  2WSE E;  4QW2 A;  5J39 A;  4LUD A;  2EGA A;  4JJD A;  4P5N A;  1YJN A;  1VYV A;  4M75 E;  4E7S A;  2YUQ A;  1NLP C;  4M75 B;  3LX7 A;  1RAE B;  5GJV B;  4DBF A;  1NJI U;  3OS0 A;  2E5K A;  2KK4 A;  2RQV A;  2NUT A;  4FT2 A;  2FRW A;  3M0P A;  4BAC A;  2CP5 A;  2GGR A;  5IXB A;  4AT1 B;  3CPW A;  3SWN B;  3X25 B;  2C0T A;  1OZ3 A;  1E6G A;  1VQ5 Q;  3JCM g;  1MUZ A;  2RD1 A;  1MMN A;  1UGV A;  2CH4 A;  2PVD B;  4M75 D;  4QKU A;  1QP2 A;  3FC3 A;  3INZ A;  4PFO A;  1UHF A;  3V8K A;  2A37 A;  1KQS S;  1WI7 A;  3RMQ A;  5KE3 A;  5CQX A;  2BE9 B;  4UC4 A;  4C5G A;  1GL5 A;  1FX7 A;  2MF2 A;  2LCC A;  2CH4 W;  3UDC A;  5CKH A;  2D0Q B;  2X4W A;  3OW2 A;  1K8A C;  4WTO B;  1VQ4 T;  3HRT A;  1R8O B;  2CSQ A;  2EYQ A;  1V29 B;  1AWW A;  5FU6 C;  4CC2 A;  1I0C A;  2EYZ A;  4XU3 A;  3VS7 A;  1GCQ A;  4C92 D;  3NHN A;  4M78 G;  3E9F A;  1VQ5 A;  4OGC A;  2P0P A;  4F14 A;  2PVO B;  4IIM A;  5FWB A;  5J26 A;  1WGS A;  5EC7 A;  1VQ4 Q;  1M4Z A;  2ENM A;  2YWW A;  3EG2 A;  4FSX A;  1Q81 C;  2HDA A;  3QXE B;  2RB6 A;  2E12 A;  2DVE A;  5IHI A;  1OYX A;  4C5I A;  4FU6 A;  2CRE A;  2VAS A;  4C8Q C;  2HAX A;  1WJR A;  3CD6 T;  3CC4 T;  1H3H A;  4JJB A;  2RQR A;  1MV3 A;  2RM4 A;  1VUB A;  3TEE A;  2F2W A;  1ZSZ C;  5GMK h;  1YN8 A;  1BU1 A;  2PUO B;  2EYW A;  2LDM A;  1K0X A;  2AHJ B;  1NE8 A;  3OYB A;  3KBG A;  4CC4 B;  1UTI A;  2ZPH B;  3EAE A;  1CKB A;  1NBE B;  1FWZ A;  4LDW A;  1WHM A;  2K3B A;  4DBQ A;  1XOV A;  1VQN A;  1QW1 A;  5GAM g;  1BK2 A;  1ZUY A;  2NUP A;  1NEB A;  3EFO A;  1RAA B;  5GAM j;  3VJP A;  3G4S Q;  4AFS C;  1YJW A;  1CKA A;  5GAN h;  3LH0 A;  2JTM A;  3OYM A;  1ZBJ A;  3HKS A;  5I21 A;  2F1L A;  9ATC B;  1K1Z A;  1K9M C;  3CMA A;  1IB8 A;  1JU5 C;  1D1A A;  2FEI A;  5KCH A;  1WHL A;  3SDZ A;  3S3O A;  4CC3 A;  4C8Q A;  1NG2 A;  3CCS A;  4DOW A;  1U1T A;  3PMI A;  1KJW A;  2RI5 A;  3Q1J A;  3NMZ C;  2D6F A;  1XNI A;  2RK2 A;  1HD3 A;  2X51 A;  3G6E A;  2F2V A;  3A8M B;  1VQ4 A;  1AWO A;  2AKK A;  2QTX A;  3RR6 A;  1G5V A;  4F16 A;  3PT9 A;  1Y57 A;  2ZPG B;  2DBM A;  2C0O A;  2VYT A;  3EGD B;  4M77 D;  3T9N A;  4IUP A;  1V76 A;  1AD5 A;  4F7U F;  1QWE A;  1N8R U;  1C0M A;  3G7Z A;  2FZC B;  4OB2 B;  2QA4 T;  5L8R E;  1WLP B;  4GLM A;  2DZ9 A;  3ASK A;  3CCJ T;  2COW A;  2HZY A;  4M7A C;  1UJ0 A;  1SSF A;  2DIL A;  4Z02 A;  2R5M A;  1WJS A;  2DEQ A;  2QGF B;  1X27 A;  2LCS A;  1T3L A;  2DMO A;  4F7U A;  1I5O B;  2ZAE A;  2YUO A;  2KQW A;  3ULR B;  4PK4 A;  5LJ5 f;  3CQT A;  5LJ3 h;  3I55 Q;  5KYY B;  2RI3 A;  4EMK A;  1G2B A;  2XI9 A;  4C8Q B;  3NGP A;  2DTI A;  2M16 A;  4M77 A;  1PRM C;  1KC8 R;  2Y4Y A;  2DRM A;  5FRN A;  2QEX A;  3IQL A;  3CCE Q;  4BY6 B;  4X34 A;  2H3E B;  2P4R A;  4J9H A;  3OSV A;  1U3O A;  2OTJ Q;  2FZK B;  3L2Z A;  1RAI B;  1AOJ A;  3GF5 A;  2NUT B;  2L0A A;  1A0N B;  2YRD A;  2MOX A;  1VIF A;  3SWN A;  1H64 1;  3A1P A;  4JRI A;  3UF4 A;  4QQG A;  4IKF A;  4M7A F;  1WXB A;  2CP2 A;  3I56 Q;  1W6X A;  1I4K 1;  2RHZ A;  2HNI A;  3KXT A;  4DEY A;  1KC8 C;  5D6W A;  2ABL A;  1RAH B;  2O4X B;  5GMK j;  3QYH B;  2HQH A;  4BB7 A;  5GAM f;  2DPP B;  3DB3 A;  4C92 E;  1YP5 A;  4AFZ C;  4M7A G;  2EYX A;  1VQ7 T;  2MWP A;  5KYN A;  1PM3 A;  1M9S A;  1K0S A;  1C6V X;  4EMH A;  4ME7 A;  4C8Q E;  3VS3 A;  2MI6 A;  3H0H A;  4OMF B;  2DE0 X;  4X9C A;  2YRC A;  2OAU A;  3CXC S;  2SRC A;  1Q95 G;  1U06 A;  2XIC A;  1T0H A;  1FXX A;  4B9X A;  3CCU A;  4ORZ A;  2K5F A;  2C06 A;  3BW1 A;  1YI2 A;  2VXE A;  2CP6 A;  2KI7 A;  1TTH B;  3MEV A;  3CCM Q;  1UDL A;  3NFC A;  1N9R A;  4D6W A;  1WFW A;  5GAM e;  1VQO T;  1VQ9 T;  3RKY A;  3CCL T;  1IGQ A;  3QDF A;  1TUC A;  4XK8 E;  3L2Q A;  2FPD A;  1VQK A;  1Q7Y R;  3C0C A;  1N6A A;  4E2F B;  2K4Y A;  1M90 R;  3GPL A;  1QCN A;  2C0I A;  1QLY A;  2E6N A;  3HL8 A;  2X4Y A;  3RKX A;  2JS2 A;  2J6K A;  5I2M A;  2DD5 A;  3A8H B;  1JQQ A;  4GLK A;  3RNJ A;  2P84 A;  1MV0 B;  5I2S A;  1KQ2 A;  1VA7 A;  1S72 T;  2OI3 A;  3M59 A;  1QVG A;  2EQU A;  1RAD B;  4M75 F;  3CBO A;  4KBM B;  3MJX A;  2L8D A;  4EMK B;  3JAM E;  4ZGJ B;  4RTZ A;  1Y07 A;  1KG1 A;  3WVE B;  3SHW A;  4Y92 A;  1X6B A;  4LXC A;  2X3W D;  4RCB A;  3QSU A;  4PJO C;  4LUE A;  1S72 Q;  2M02 A;  2GNC A;  1TSF A;  1X2K A;  5GAN 5;  4R55 A;  2BTT A;  1M2V A;  4AFU C;  3MO8 A;  4MDW A;  4PJO D;  4OVA A;  2LQK A;  5LJ5 h;  3MEA A;  2MAM A;  5C6S A;  4C5E A;  4M75 A;  5GAN 4;  1ABO A;  1X69 A;  2M0O A;  3QUI A;  1M30 A;  2DER A;  4QQ6 A;  5GAN 6;  1QKX A;  4PJN A;  2O9S A;  1VQ7 A;  1VQ8 A;  2HEQ A;  1S1N A;  4NL3 A;  2R5A A;  3P8H A;  2CSI A;  4DEX A;  5CKB A;  2DVJ A;  4C0D B;  5KYU B;  1YI2 Q;  3MHX A;  1NEG A;  1MND A;  3UPU A;  3J7A F;  2QQA A;  4MML A;  1WQW A;  4J83 A;  1U8R A;  5IHK A;  4J5Y A;  2JNG A;  1JRI A;  4LDY A;  3JB9 G;  1B34 A;  1YJ9 Q;  4M78 B;  3EGU A;  3EHQ A;  4XTY A;  3MPU B;  3CPW P;  3M58 A;  4A63 B;  2E4H A;  3H9N A;  1WXT A;  3ZBD A;  4C8Q G;  3O8V A;  2KDS A;  2QG9 B;  2RNA A;  1YHQ T;  2E41 A;  1PSE A;  1QMC A;  3UA6 A;  4HCZ A;  3EG9 B;  3OA6 A;  5GAN 8;  1KQS P;  1VQN T;  2FL7 A;  4RCC A;  2XK0 A;  2V8J A;  1YIT T;  1PSF A;  1AWJ A;  3SWN C;  2BKD N;  2RQT A;  1Q82 R;  5D7U A;  1Y71 A;  4KH1 B;  4Q5W A;  1SPK A;  2CUD A;  4HXJ A;  3CCQ T;  2CP0 A;  6AT1 B;  4M77 B;  1UHC A;  2AT1 B;  4KGX B;  4RTT A;  4IUV A;  1E7O A;  4WCI A;  2RJF A;  2EQI A;  1G3W A;  3FRN A;  3QJY A;  2YHT A;  3PTA A;  4QVD A;  1WX6 A;  2K3X A;  2VGN A;  3A98 A;  2DXU A;  4C8Q F;  2COY A;  1LOJ A;  1YJN T;  4J7F A;  1RAF B;  1MNE A;  1JO8 A;  3OYJ A;  3CCV A;  1FYN A;  3M57 A;  3TCJ A;  2AZS A;  1QVG S;  2CT3 A;  1BKB A;  2I0N A;  2BZX A;  7AT1 B;  2AK5 A;  5GAO m;  1KQS A;  2PUK B;  1WHK A;  3X26 B;  1PWT A;  3VRY A;  1W2B A;  3QBY A;  3MEU A;  2QA4 A;  1WQ7 A;  5KCO A;  2K7A A;  1TXQ A;  5HCK A;  2OJ2 A;  3MKD A;  1HK9 A;  4KUI A;  3QWY A;  1WIE A;  1N9S A;  2JTF A;  2CZ7 B;  3M0U A;  2AKL A;  3SEM A;  4LE9 A;  1D1B A;  2QEX Q;  2D8H A;  1UG1 A;  4E7K A;  1ZSZ A;  5KYW A;  3CD6 A;  1U1S A;  4RTU A;  2YLC A;  3HTR A;  2EQK A;  3VS5 A;  5CVI A;  3EG0 A;  4JZ3 A;  2Y4X A;  3QO3 A;  3SFM A;  1K9A A;  2RO0 A;  1X6G A;  2E64 A;  4HCK A;  4M78 D;  1I81 A;  4PJO F;  1B34 B;  2YDL A;  4BI8 B;  1K73 C;  2ZCF B;  2MIO A;  4ZTF A;  3VKI A;  4M7A A;  2I2L A;  1TH7 A;  2GTJ A;  1BBZ A;  3MP1 A;  1K73 R;  1MHN A;  3CBP A;  4M77 E;  3F70 A;  3L1A A;  3G71 A;  2KMT A;  1VQ8 Q;  4PJL A;  4CI0 C;  1YIT Q;  2E10 A;  2PNI A;  3EG9 A;  4N0A C;  2XG8 D;  2MWO A;  4LD6 A;  3AHU A;  1SSH A;  2E6Z A;  2HBP A;  4M7D C;  2XD0 A;  3CC2 T;  4OML A;  2CGH A;  4E7H A;  3EFS A;  3EH1 A;  1OU9 A;  4NS5 A;  5A2Q E;  3NTI A;  1LCK A;  4FYV B;  1PKS A;  2A08 A;  2LZ6 B;  1DJ7 B;  3UWN A;  2DK3 A;  3M0R A;  2L3Q A;  3OYN A;  2DYI A;  3CXC A;  2DD4 A;  2DXB A;  3CC2 Q;  1M8M A;  1TS9 A;  3E9G A;  1SEM A;  4J7I A;  3WXM B;  5GAN f;  4ZGE B;  4QVZ A;  4XTV A;  1UGP B;  2CYZ B;  4Z8A A;  3H8Z A;  1IO6 A;  3M4G A;  5LJ5 d;  4JJN K;  2DRK A;  2EQM A;  4J9D A;  2VXF A;  5FWC A;  1TG0 A;  3CCU T;  4M7D E;  2YT6 A;  2GFU A;  4DQ2 A;  1Y96 B;  2FPE A;  1ACM B;  2KSS A;  1BIB A;  1D0Y A;  1M1G A;  2RK1 A;  1VQ5 T;  4A4F A;  4A4H A;  3JCM c;  1GCP A;  4E47 A;  2X35 A;  2P0K A;  3GBQ A;  3CXC P;  1JXM A;  3FDR A;  4AMC A;  2EBP A;  5KH6 A;  1SKU B;  1IHW A;  1AZG B;  3E19 A;  3CME Q;  3I56 A;  4M7D G;  3AT1 B;  4C92 A;  3JCM P;  4J9B A;  2HMA A;  2JJ9 A;  4XU0 A;  2XMF A;  3CC4 A;  1MGQ A;  1M8V A;  3JV3 A;  1Q82 C;  1OV3 A;  1YNZ A;  1D09 B;  3BDU A;  3I5S A;  1GBR A;  3LYI A;  1JXO A;  4ATO A;  3L2U A;  1Q81 R;  2IIM A;  5AT1 B;  2DAQ A;  1RL2 A;  4C92 C;  1YJ9 A;  5GMK e;  1I5L A;  3MEW A;  1YHQ A;  3M0T A;  1W2B S;  1KC8 U;  1VQM A;  2W0Z A;  1TUG B;  2JTE A;  4RG2 A;  2HSE B;  2CDT A;  4LDU A;  1UEC A;  2VVK A;  4OB1 B;  3CD6 Q;  1C1A A;  3VYH B;  5EG2 A;  4R56 A;  2A3L A;  3I55 T;  1M3C A;  2V1Q A;  5GAO r;  1N5Z A;  4PNO A;  2L5Q A;  4EDU A;  3ZEH A;  1RAG B;  4OB0 B;  3VS4 A;  1WXU A;  3RES A;  2JN0 A;  1ZX6 A;  3DLM A;  1AVZ C;  1K9M R;  2EKH A;  5LJ5 g;  3L2R A;  3CCE T;  1UUE A;  1ZHI A;  1YWP A;  2RF0 A;  2VKN A;  3G4S A;  1UGQ B;  3VS1 A;  1FMW A;  1LPL A;  4C5H A;  1K4U S;  2KR3 A;  2GQV A;  2VC8 A;  5A0G A;  1WZO A;  2IVW A;  5GAN g;  4LD9 K;  1VQP T;  2DIG A;  5HK0 A;  3FJP A;  1AT1 B;  1VIE A;  4X1V A;  5CQY A;  1OPK A;  1YBY A;  4XTW A;  2RHX A;  2LJ0 A;  4Y28 E;  5I22 A;  2GF7 A;  4JRQ A;  4ELY C;  2RA2 A;  4E7J A;  2ESW A;  2MYS A;  3O5Z A;  2QDL A;  4M77 G;  2BUD A;  4FYY B;  3OYC A;  3QJ6 A;  3KFV A;  2EJG A;  3PMT A;  3V7C A;  2LQN A;  4DA4 A;  2YRV A;  4II1 A;  2MCN A;  2JMA A;  2QQ9 A;  5LJ3 d;  3LLR A;  3A8O B;  4M7D D;  3NTH A;  2K2M A;  4IUQ A;  3OYG A;  2L3P A;  2FYK A;  3R6N A;  1B7T A;  2DL5 A;  3A5Z B;  5IAY A;  3A8L B;  1FMV A;  1NLO C;  1M90 C;  3C4S A;  4OGE A;  2WAC A;  1YWO A;  3CME T;  2QQS A;  1K76 A;  5KYX A;  3TU4 K;  1Q7Y C;  2VUB A;  4M7A D;  4M7A B;  2G6F X;  4M75 G;  3JCM Q;  4CRI A;  1D3B B;  1W70 A;  1JBM A;  2O2O A;  4RMO A;  3RER A;  1K73 U;  2EGC A;  1NZ9 A;  2ECZ A;  4MDX A;  2ATC B;  4PL6 A;  1VQO Q;  1HXD A;  3CCL Q;  3OYK A;  4JLG A;  2QA4 Q;  4X9D A;  4OMM A;  3QPH A;  4M77 C;  1J3T A;  1Q82 U;  2H3J A;  5CIU A;  4L6V 5;  2QQB A;  5LL6 S;  3OYA A;  2ZPF B;  2B8A A;  3LWI A;  2JW4 A;  3E2U A;  4FW2 A;  2HD0 A;  2QK0 A;  1AZE A;  2J05 A;  4J9E A;  3CC2 A;  3C12 A;  4LDV A;  3CC7 T;  4OMP A;  3M4Y A;  3M0Q A;  8AT1 B;  4FT4 A;  3MP8 A;  4OP0 A;  5FLX E;  1PD1 A;  2EQJ A;  3EFR A;  1BB9 A;  2DL8 A;  1S72 A;  3VV0 A;  4E7I A;  3THK A;  1Q81 U;  3CC7 Q;  1BI3 A;  3TSW A;  2E5Q A;  4LN2 A;  3KUF A;  3CCS Q;  3OY9 A;  2OTJ T;  1QQJ A;  2F5T X;  1M3A A;  1VQP Q;  3HPW A;  2J6F A;  1QCF A;  3OMC A;  3QHS A;  4ELZ C;  3G6E T;  2LX9 A;  2QAS A;  4GY5 A;  4JDS A;  3GOX A;  3P8B B;  1VQL Q;  1YCY A;  3CCR T;  2K79 A;  3JSC A;  2NUP B;  4XTZ A;  1OQK A;  4OF1 A;  3JCM d;  2QI2 A;  4PJM A;  3FLG A;  1F1B B;  2EGE A;  2QDY B;  1M1K C;  2EJF A;  3LH5 A;  4M7D B;  1VQL T;  1WNL A;  1YCS B;  3I35 A;  2LJ1 A;  4XU1 A;  3OYD A;  1Y0M A;  1X43 A;  3OS2 A;  3EGX A;  5GAN 3;  5DLO A;  1KSW A;  3PGG A;  2JS0 A;  4M7A E;  1QVF A;  5DY9 A;  2RPN A;  3HRS A;  4ANJ A;  4C0Z A;  2EPD A;  2RHY A;  5AYF A;  3NTK A;  4PLL A;  2XU8 A;  4PLI A;  4NOY A;  3X20 B;  1WHH A;  3PIP A;  4BE2 A;  2KGT A;  3ER0 A;  4C0D C;  4MZM A;  2NUZ A;  1X01 A;  4KH0 B;  3WVD B;  1Q86 C;  3BY7 A;  1NYG A;  2EAY A;  2CT4 A;  1D0Z A;  1E6H A;  5IH2 A;  4A54 A;  2LRQ A;  5FRO A;  2PZ1 A;  1PCX A;  1D3B A;  1PC0 A;  3BFM A;  2QEX T;  4M77 F;  2W10 A;  5A0D A;  2VV5 A;  1MMG A;  1VQN Q;  3CPF A;  1SRL A;  1RLQ C;  8ATC B;  1RLP C;  2CZ0 B;  1GRI A;  2YUP A;  3LGF A;  1X2Q A;  1YIT A;  3LWH A;  4J6X A;  5FRM A;  4Y91 A;  1UE9 A;  1I1J A;  3GNF B;  3FEO A;  1HJD A;  2O4X A;  3LGL A;  3CCJ Q;  1UJY A;  3M9Q A;  4XAX B;  2BZY A;  4J6Y A;  3CMA Q;  1O75 A;  4BE0 A;  5CKE A;  4BD3 A;  2R58 A;  4N0A A;  3VS6 A;  4Z89 A;  3GP8 A;  3CC4 Q;  3JCM f;  2DL3 A;  4RKU E;  4DBH A;  3M55 A;  3QDR B;  1HSQ A;  2VB6 A;  1JJ2 A;  3L2V A;  3CCV Q;  4BI4 A;  4BDY A;  3HP9 A;  1VQP A;  1YIJ A;  5DM7 R;  4XTX A;  1OU8 A;  1KD1 R;  1G8X A;  4JRP A;  4QT7 A;  2O88 A;  2BE7 D;  1LVK A;  4E6R A;  5HK3 A;  3CCV T;  1WHJ A;  4RTX A;  2FZG B;  2LVM A;  2A28 A;  3JB9 J;  4RUG A;  3CCR Q;  2DZC A;  4A4E A;  3EG3 A;  3V7R A;  3UA7 A;  3PFS A;  1VQ6 A;  2GBQ A;  3OQ5 A;  1AWX A;  3CBM A;  1RI9 A;  2OTL T;  1KHI A;  1M1K U;  4FSS A;  2EKO A;  4A4G A;  1WDX A;  2COZ A;  4FYX B;  1OUL A;  3I56 T;  2A0F B;  5CO7 A;  5IHN A;  3RBB B;  2KVQ G;  3P8D A;  4LNP A;  3JCM V;  3OYL A;  1RAB B;  5LJ5 e;  3J81 E;  1RI0 A;  1QVP A;  1KHC A;  3VS0 A;  2ZGW A;  3QZ9 B;  1KD1 U;  1VQ7 Q;  1QCO A;  2F69 A;  2KXD A;  2LJ3 A;  1KQ1 A;  2DFU A;  2K57 A;  3QKJ A;  4F04 B;  1XJW B;  3CCE A;  4J8O A;  1KIK A;  2X4X A;  1OX8 A;  2ROL A;  3ZL7 C;  5CKD A;  1BI1 A;  1B07 A;  3HHT B;  3G71 Q;  1UEB A;  2QAZ A;  2KNB B;  2LX7 A;  3REA B;  4NL2 A;  2BIV A;  1NJI R;  2LQ8 A;  4F17 A;  4M4Z A;  4IUT A;  5LJ3 e;  2NWM A;  1RAC B;  1ZQ1 A;  4KGV B;  3G71 T;  1K8A R;  3M0S A;  1PD0 A;  5D6Y A;  2K5L A;  4KGZ B;  4BY6 C;  2LCL A;  3TSZ A;  3CCQ Q;  4JLI A;  3C95 A;  3CC7 A;  2JT4 A;  3MCA B;  1B3Q A;  2ZPB B;  3CMA T;  4J6W A; 
#chains in the Genus database with same CATH homology
 2ABL A;  4K11 A;  2IIM A;  2RMO A;  2RN8 A;  4D8K A;  1YP5 A;  2L3S A;  4AFZ C;  2EYX A;  3M0T A;  1SHG A;  2W0Z A;  2L2P A;  2JTE A;  1K0S A;  3PE0 A;  2CDT A;  2FG0 A;  1UEC A;  2JXB A;  2VVK A;  3VS3 A;  3H0H A;  2DE0 X;  2PTK A;  2SRC A;  2DLP A;  2FO0 A;  2HCK A;  2DYB A;  1U06 A;  4JPB W;  1PHT A;  1T0H A;  2GQI A;  2RQW A;  1M3C A;  2V1Q A;  4ORZ A;  1N5Z A;  2DL4 A;  1QWF A;  2KT1 A;  1UDL A;  3H0F A;  1WXU A;  3VS4 A;  1WFW A;  1ZX6 A;  3PVL A;  4RTY A;  1AVZ C;  2EKH A;  2KE9 A;  1UUE A;  1GFC A;  1YWP A;  2RF0 A;  2VKN A;  1GFD A;  3VS1 A;  2RQU A;  1TUC A;  2J7I A;  1K4U S;  2KR3 A;  2KRM A;  2FPD A;  4ESR A;  2CUB A;  2KRO A;  1W1F A;  3C0C A;  1TUD A;  1T3S A;  3EG1 A;  2C0I A;  1QLY A;  4X1V A;  1VYU A;  4Z88 A;  2O9V A;  1OPK A;  2JS2 A;  4RTV A;  2LJ0 A;  2DA9 A;  2J6K A;  3VRZ A;  3UAT A;  2VWF A;  1PKT A;  5I22 A;  1JQQ A;  2M51 A;  2DNU A;  3RNJ A;  2ESW A;  1AEY A;  1MV0 B;  3I5R A;  1WYX A;  2DX1 A;  1CSK A;  2YUN A;  3O5Z A;  2QDL A;  1VA7 A;  2DL7 A;  2OI3 A;  3KFV A;  2ROT A;  1SRM A;  1V1C A;  3I9Q A;  2LQN A;  3H0I A;  3VS2 A;  4RTZ A;  4ZNX A;  2AZV A;  2MCN A;  2JMA A;  3SHW A;  4Y92 A;  1X6B A;  1Z9Q A;  2X3W D;  2DF6 A;  4J9F A;  1GBQ A;  2JMC A;  4LUE A;  2DJQ A;  2GNC A;  1X2K A;  2BTT A;  4AFU C;  2K2M A;  2L3P A;  3R6N A;  2DL5 A;  1ZUK A;  2GTO A;  5IXF A;  2KBT A;  1NLO C;  2ED0 A;  4KRT A;  2A36 A;  1YWO A;  1K76 A;  1ABO A;  1X69 A;  3QWX X;  1M30 A;  2G6F X;  1ARK A;  1W70 A;  2O2O A;  2EGC A;  2ECZ A;  1QKX A;  5ECA A;  1SHF A;  2O9S A;  2YSQ A;  2HEQ A;  1S1N A;  2EW3 A;  2CSI A;  1ZUU A;  2D8J A;  2EVR A;  4OMM A;  2FRY A;  1T0J A;  4DEX A;  1J3T A;  1NM7 A;  2DVJ A;  1NEG A;  4LUD A;  2EGA A;  4JJD A;  2D0N A;  1VYV A;  3PVQ A;  4CC7 A;  5IHK A;  2YUQ A;  1NLP C;  3H41 A;  2JW4 A;  5GJV B;  3FJ5 A;  2HSP A;  1AZE A;  2E5K A;  1NYF A;  2RQV A;  2J05 A;  4J9E A;  5L23 A;  4J9C A;  2FRW A;  3M0P A;  2GGR A;  5IXB A;  3EGU A;  3EHQ A;  2OAW A;  2ED1 A;  2C0T A;  4OMP A;  1E6G A;  3M0Q A;  1MUZ A;  1UGV A;  2CH4 A;  1M3B A;  4A63 B;  4J9I A;  3NPF A;  4OMO A;  1WXT A;  1UHF A;  1BB9 A;  2DL8 A;  2A37 A;  1WI7 A;  2RNA A;  1H92 A;  3THK A;  2EYY A;  3UA6 A;  3TSW A;  4LN2 A;  1GL5 A;  1M3A A;  5FW9 A;  1AWJ A;  2CH4 W;  2RQT A;  2J6F A;  4JZ4 A;  1QCF A;  3REB B;  1ZSG A;  1SPK A;  2CUD A;  2DBK A;  4HXJ A;  2CSQ A;  1AWW A;  4OMN A;  2K79 A;  1UHC A;  4CC2 A;  1I0C A;  2EYZ A;  3VS7 A;  1GCQ A;  4RTT A;  3NHN A;  1E7O A;  4F14 A;  4AFQ C;  4IIM A;  5FWB A;  2KRS A;  5EC7 A;  2EGE A;  1U5S A;  1I07 A;  2ENM A;  3LH5 A;  3EG2 A;  4WCI A;  1EFN A;  2HDA A;  1YCS B;  2EQI A;  3I35 A;  4AG1 C;  2BZ8 A;  2LJ1 A;  5IHI A;  1Y0M A;  1X43 A;  2CRE A;  1WX6 A;  3A98 A;  1KSW A;  2JS0 A;  4HVU A;  2RPN A;  4JJC A;  1GCQ C;  3TVT A;  1JO8 A;  1PNJ A;  2EPD A;  2KT8 A;  1H3H A;  4JJB A;  1FYN A;  1MV3 A;  2RQR A;  2HBW A;  1OOT A;  2AZS A;  2JM9 A;  2CT3 A;  2F2W A;  2KGT A;  1YN8 A;  1BU1 A;  2EYW A;  2I0N A;  2BZX A;  1K0X A;  2AK5 A;  2NUZ A;  3U23 A;  1KFZ A;  1NYG A;  1PWT A;  3VRY A;  4J9G A;  2CT4 A;  2KYM A;  1E6H A;  2K7A A;  5IH2 A;  5HCK A;  4CC4 B;  1UTI A;  2OJ2 A;  2PZ1 A;  4EIK A;  1CKB A;  3QWY A;  1WIE A;  3M0U A;  2AKL A;  4GBQ A;  2W10 A;  3SEM A;  4LE9 A;  2D8H A;  1UG1 A;  1ABQ A;  2KYB A;  2O31 A;  1ZLM A;  1SRL A;  1RLQ C;  2KEA A;  1RLP C;  1QKW A;  1GRI A;  2YUP A;  4HVV A;  4RTU A;  2K3B A;  1X2Q A;  1XOV A;  1BK2 A;  4IIO A;  1ZUY A;  1NEB A;  3VS5 A;  1UE9 A;  1I1J A;  1HJD A;  3EG0 A;  4JZ3 A;  1PRL C;  4AFS C;  1CKA A;  1UJY A;  1K9A A;  1OEB A;  2BZY A;  1X6G A;  1ZBJ A;  4HCK A;  1WA7 A;  1K1Z A;  2YDL A;  3VS6 A;  4Z89 A;  2K9G A;  1JU5 C;  2MIO A;  1UFF A;  2LNH B;  2DL3 A;  2FEI A;  2GTJ A;  2DM1 A;  1BBZ A;  4CC3 A;  1HSQ A;  1NG2 A;  1KJW A;  3EHR A;  2X3X D;  3NMZ C;  1HD3 A;  2F2V A;  4QT7 A;  4D8D A;  1G83 A;  2PNI A;  1AWO A;  2O88 A;  2AKK A;  1RUW A;  4RTW A;  4E6R A;  2M0Y A;  1SSH A;  4F16 A;  2K6D A;  1Y57 A;  4RTX A;  2DBM A;  2C0O A;  2A28 A;  4OML A;  4RUG A;  1AD5 A;  4R0K A;  1QWE A;  1LCK A;  1PKS A;  3EG3 A;  3UA7 A;  2A08 A;  2LZ6 B;  2GBQ A;  3M0R A;  2B86 A;  2L3Q A;  1AWX A;  2JM8 A;  2F2X A;  1RI9 A;  1WLP B;  4GLM A;  1M8M A;  4FSS A;  1WDX A;  1SEM A;  1UJ0 A;  2DIL A;  1VYT A;  4Z8A A;  5IHN A;  2V1R A;  2KXC A;  4OMQ A;  1IO6 A;  3RBB B;  1X27 A;  4LNP A;  2LCS A;  1T3L A;  2DMO A;  2DRK A;  1JEG A;  4J9D A;  2YUO A;  3ULR B;  5I11 A;  3CQT A;  5FWC A;  1TG0 A;  3VS0 A;  2YT6 A;  2SEM A;  2FPE A;  2KXD A;  2KRN A;  1G2B A;  2LJ3 A;  3NGP A;  1KIK A;  1PRM C;  2LQW A;  1GCP A;  1Z9Z A;  2DRM A;  3GBQ A;  1OPL A;  2ROL A;  3ZL7 C;  3IQL A;  1B07 A;  1JXM A;  2EBP A;  5GJW B;  4HVW A;  1AZG B;  2KNB B;  2P4R A;  2LX7 A;  4J9H A;  3REA B;  2FPF A;  2J6O A;  1U3O A;  2LP5 A;  4F17 A;  1AOJ A;  4M4Z A;  2NWM A;  1H8K A;  4J9B A;  1M27 C;  2LMJ A;  2L0A A;  1A0N B;  2MOX A;  2D1X A;  2XMF A;  3M0S A;  2J06 A;  3JV3 A;  1OV3 A;  1YNZ A;  3TSZ A;  3UF4 A;  4AG2 C;  3I5S A;  1WXB A;  2H8H A;  1GBR A;  1FMK A;  1W6X A;  2JT4 A;  1B3Q A;  4DEY A;  1JXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...