5FWBA

Human spectrin sh3 domain d48g, e7f, k60f
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
DETGKFLVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNGRQGFVPAAYVKFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human Spectrin SH3 Domain D48G, E7F, K60F
rcsb
molecule keywords SPECTRIN ALPHA CHAIN, NON-ERYTHROCYTIC 1
source organism Homo sapiens
molecule tags Structural protein
total genus 13
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5fwbA00
1ZUUA 2KEAA 2ECZA 4OMPA 2GTOA 1JEGA 2LNHB 2J6FA 2EQIA 1GFDA 2P4RA 3H41A 2CT4A 3QWXX 2W10A 2JTEA 1W1FA 2DE0X 3VS6A 2CSIA 2O88A 2KROA 1VA7A 1VYVA 4OMNA 1UHCA 1M8MA 2L3QA 3I5SA 2FRWA 2QDLA 5I22A 2CH4A 2D0NA 2B86A 1M27C 1BK2A 2JXBA 1UFFA 4J9IA 3UA6A 3VS3A 1NYFA 2BZ8A 4EIKA 3EG3A 2HBWA 5IHNA 5EC7A 4RTXA 1NLPC 1VYUA 3PVQA 3VS2A 2JW4A 1K0SA 3I35A 2LZ6B 1IO6A 5HCKA 1XOVA 2EYXA 2KE9A 2DLPA 2KRMA 4LN2A 4RUGA 2KXDA 1I0CA 4J9FA 2KYMA 2YUPA 4ORZA 1HD3A 2YDLA 2I0NA 1YN8A 2L3PA 3SEMA 2C0OA 2F2VA 1G2BA 5FWCA 3EHQA 3TSWA 1H92A 1LCKA 4RTYA 2A37A 1QWFA 2SRCA 1BU1A 4RTUA 2EYYA 1TUCA 2LX7A 2CUBA 2DF6A 2BZYA 2J06A 2NUZA 3RNJA 3NGPA 2EYWA 1SEMA 2JMAA 1UECA 2KXCA 2CUDA 2D8HA 1UTIA 2DILA 1JXOA 1X69A 1X6GA 5FWBA 1UHFA 4HVUA 2JM9A 4FSSA 4AFUC 1U3OA 2V1QA 3ZL7C 2ED1A 1UE9A 2J6KA 4X1VA 4F14A 4DEXA 1T0HA 4J9CA 2CDTA 1AWWA 4GBQA 2LJ0A 1CSKA 1Y0MA 2EGAA 1EFNA 4J9BA 1VYTA 2HCKA 4D8KA 2EYZA 1GCQA 2AK5A 1KFZA 4J9GA 1H3HA 1GCQC 2RMOA 1UG1A 3EGUA 4F16A 2C0IA 2L0AA 5ECAA 1SRLA 4AG2C 2EPDA 2LQNA 1Z9ZA 2CSQA 1TG0A 3PVLA 1MV3A 1AWXA 4RTTA 2KT8A 1SRMA 2XMFA 3LH5A 2K3BA 4LE9A 5L23A 1YCSB 2CT3A 2M0YA 2DBMA 2HEQA 2HSPA 2NWMA 3JV3A 4JJCA 1AVZC 1OEBA 1WA7A 3M0TA 1AZGB 2X3WD 2BZXA 2AKKA 2V1RA 1PRMC 1T0JA 4LUEA 2D1XA 1T3LA 1WFWA 5FW9A 2O31A 2L3SA 3GBQA 1YWPA 2DL5A 4HCKA 3ULRB 3VS0A 2GQIA 1RUWA 1FMKA 2K7AA 5IXFA 1ZBJA 4AG1C 2FRYA 2KBTA 1E7OA 1KJWA 2A28A 4OMLA 2KRNA 3VRYA 2DL7A 1SHFA 3EG2A 3VS7A 1WI7A 1E6HA 5GJVB 4LUDA 3UATA 2F2WA 2JM8A 1AZEA 1UJ0A 2YT6A 4HXJA 3VS4A 3R6NA 1NLOC 2YUQA 4QT7A 2GTJA 1GRIA 1N5ZA 2AZVA 3I5RA 2DNUA 1UGVA 2X3XD 1K9AA 1WXTA 2DVJA 1GBRA 1WX6A 2GGRA 2CH4W 2GBQA 4JJBA 2YUOA 2D8JA 2L2PA 1BB9A 3EHRA 2RQRA 2DBKA 1CKBA 4KRTA 2C0TA 2KT1A 2DL3A 1E6GA 1GBQA 4CC3A 1JQQA 4F17A 1RLQC 1ZUYA 2IIMA 4J9EA 1WXUA 1J3TA 1WIEA 2RQTA 1UDLA 3O5ZA 4RTWA 3VRZA 1PKTA 1K76A 1GCPA 2LCSA 1UJYA 1X2KA 2DL8A 1M3AA 1KSWA 2VKNA 4GLMA 2FEIA 3C0CA 3EG0A 1X43A 4OMMA 2FPDA 2EKHA 4IIOA 3NMZC 3VS1A 1YP5A 3I9QA 5IHIA 1RI9A 2DYBA 1RLPC 2ROTA 2AZSA 4R0KA 2LJ1A 2RN8A 2KNBB 2O2OA 1G83A 1GL5A 2CREA 2A36A 4J9DA 1NEBA 4Z88A 1ZX6A 2RNAA 4Z8AA 2FPEA 3TVTA 1PNJA 3IQLA 2RF0A 3CQTA 1NEGA 4ESRA 2KR3A 5GJWB 1YNZA 1I07A 1S1NA 3SHWA 1WXBA 1SSHA 2GNCA 1FYNA 4JJDA 2EGCA 3U23A 2LQWA 1UUEA 1W70A 2MCNA 1M3BA 2DJQA 2FO0A 1HJDA 1V1CA 1A0NB 3M0UA 4JZ4A 3RBBB 4AFQC 1ABQA 1W6XA 2JS0A 1AD5A 3M0QA 4JZ3A 2J05A 1M30A 3REBB 1JO8A 2PZ1A 1ZUKA 1PHTA 4Y92A 1PWTA 2J6OA 2ABLA 2EBPA 1I1JA 1NYGA 1ARKA 1AWJA 1B07A 1K1ZA 3M0PA 2KGTA 2DMOA 1Z9QA 4AFSC 2PNIA 1QKXA 4HVVA 4HVWA 1PKSA 2PTKA 4OMOA 1JU5C 1WYXA 2DRKA 2DM1A 1WDXA 1NG2A 3THKA 5I11A 1QWEA 3NHNA 2LMJA 2K9GA 4D8DA 1U5SA 2YSQA 1QKWA 2VWFA 2DRMA 1X27A 1MV0B 2O9VA 4CC4B 1QLYA 4Z89A 2EGEA 1B3QA 2O9SA 2AKLA 4CC2A 2FG0A 3NPFA 2DL4A 1OPKA 2OJ2A 1QCFA 1HSQA 3EG1A 4K11A 2M51A 1ZLMA 2VVKA 3PE0A 2K6DA 2W0ZA 2E5KA 3KFVA 2KYBA 1PRLC 4E6RA 1KIKA 1AOJA 4ZNXA 4J9HA 2KRSA 3UA7A 1H8KA 1OV3A 2LP5A 4IIMA 2OI3A 2DA9A 3H0FA 1M3CA 4LNPA 4CC7A 1JXMA 1OOTA 3A98A 3M0SA 4OMQA 3QWYA 4M4ZA 2RQWA 1K4US 2JS2A 1X6BA 4RTVA 2J7IA 3VS5A 2H8HA 2DX1A 1AWOA 2RQUA 1BBZA 1X2QA 1ABOA 3REAB 1YWOA 2HDAA 2EW3A 1SPKA 4WCIA 1U06A 2YUNA 2SEMA 2LJ3A 1Y57A 2A08A 2ENMA 1CKAA 5IH2A 1AEYA 1ZSGA 3H0IA 1SHGA 2OAWA 3H0HA 3UF4A 2JT4A 2ESWA 2ROLA 2RQVA 3TSZA 1WLPB 3M0RA 1TUDA 2G6FX 5IHKA 5IXBA 4DEYA 2K79A 2RPNA 2JMCA 3FJ5A 2MIOA 4JPBW 2EVRA 2F2XA 4RTZA 2MOXA 4AFZC 2K2MA 1NM7A 4A63B 2BTTA 1K0XA 2FPFA 1GFCA 1OPLA 1MUZA 2ED0A 1T3SA
chains in the Genus database with same CATH superfamily
1IZ6A 4EMGA 5CKHA 5HK3A 1KQ1A 1HK9A 4LDXA 1YJNT 1JJ2A 5CKEA 4M75G 2J6FA 5GAN8 3H41A 1QW1A 2CT4A 1VQ5T 2P0KA 2JTEA 4M7DC 1PM3A 3JCMe 2E12A 2O88A 3RMSA 1VA7A 1VYVA 4OMNA 2DIQA 4PJOF 4N4IA 1YITQ 2B86A 4C92B 1BK2A 1U1SA 3UA6A 4KBMB 1IB8A 3OY9A 3AT1B 2BIVA 4EIKA 4XTUA 1S72Q 4RTXA 3CC7A 1NLPC 2VUBA 1K9MU 2ZPBB 1R8OB 2LZ6B 2AIRB 3OS0A 1S72T 5HCKA 1VQMA 3P8HA 3RKXA 2KE9A 2O01E 4C0DC 1JBMA 4RUGA 4XTZA 3RKWA 4C8QA 1SF9A 1UGQB 2X51A 2QYZA 3M56A 2YUPA 4ORZA 3CCLA 3LLRA 2L3PA 2FVUA 1YBYA 2F2VA 2HQXA 3OS1A 2E4HA 1LOJA 2HNIA 3EHQA 4C92D 2FYKA 1QCOA 3CC2T 1EIFA 2QQAA 1I5OB 5LJ5h 1OYXA 3E1SA 4PLLA 2CUBA 2NUTA 3OYJA 2J06A 2NUZA 3SWNC 1SEMA 2JMAA 2E5QA 1W2BA 3O8VA 4B6MA 1RACB 3L2WA 1KK7A 1VQLT 1YIJQ 4II1A 5GAOq 4HT9A 4HVUA 2JM9A 4AFUC 3CCEQ 1U3OA 4X1VA 2J6KA 4PLIA 4VUBA 4J9CA 4A53A 5GAMh 3CCET 2GQVA 2CP5A 2FZGB 2XDBA 3OYIA 2L8DA 2F1LA 4LDYA 1CSKA 3BDUA 1GCQA 4BI8B 4IUVA 1KFZA 5GANj 1NJIR 3EG9B 2C06A 1VQKQ 2E10A 4BY6B 3G71A 1EX4A 1VIEA 1SRLA 1Y71A 2KVQG 2EPDA 2KAFA 2X9HA 5EG2A 1VQ8A 3EFRA 4R56A 3DKMA 5GAMe 2K3BA 2K5FA 3V7RA 2VYTA 3GLXA 1M2OA 4XTVA 4KH1B 1V76A 4M77C 2DBMA 2NWMA 3JV3A 3M0TA 5D6YA 2AKKA 2DIGA 2V1RA 1WFWA 3EGXB 3A8GB 5FU7B 2L3SA 1K73C 3ULRB 2WSFE 2K7AA 5IXFA 1ZBJA 4QQ6A 3G4SA 4EDUA 4QKUA 4AG1C 5C6SA 2KBTA 1E7OA 3CPWA 4OMLA 3VS7A 2D9TA 4IUQA 2G3RA 3QPHA 1PD0A 1FMVA 2HL5C 4C5IA 4C92A 2VASA 2LQKA 2Z0WA 4C8QC 4FCYA 1QVFS 2LTOA 4ELYC 2O4XB 2YT6A 3VS4A 4KUDK 3G7ZA 1NLOC 5A0GA 3CCMT 1GRIA 2E65A 1M8VA 4ZN3A 2XDDA 1IGUA 1K9AA 3RMQA 2GGRA 3QUIA 2GBQA 4PJOC 2L2PA 1X01A 4XK8E 5FU6B 1IRXA 1TS9A 2HMAA 3TQ7P 2K3XA 2P0QA 2C0TA 1VQPA 2KT1A 2DL3A 1KHIA 4EMHA 3BDLA 2IIMA 3OBYA 3DB3A 1ZSZB 2RQTA 4LD6A 1UDLA 3O5ZA 3JCMQ 2L89A 4GLKA 3S6WA 4EMKB 2DL8A 1Q86U 1MNEA 3QDFA 1Q95G 3EG0A 1VQ4Q 2YLCA 2DXTA 1M90C 2GFAA 2H3EB 3MJXA 1RI9A 4E2FB 1VQ4T 2ROTA 2RM4A 3MP1A 2EJFA 4R0KA 4IUUA 3OMCA 1YJWQ 2LRQA 2A36A 3CCVA 1ZX6A 4AT1B 4Z8AA 1ZA1B 2QTVA 1YJWT 1NEGA 1KQSA 2EJGA 4M7DB 1C1AA 2KR3A 1N9RA 1YNZA 2DFUA 2QDYB 3SHWA 2GNCA 4JJDA 1TH7A 3JB9J 4O6JA 2CP2A 2CP3A 3JCMP 2LX9A 2XK0A 1WHKA 2RHYA 3EG9A 3OMGA 1K73R 3OYAA 3OYNA 3MCAB 3FEOA 2COYA 3OW2P 4BB7A 1ZUKA 1PHTA 3TCJA 1HYOA 2ABLA 4C0DB 3Q1JA 1NYGA 4M7DD 4TVRA 8AT1B 3M0PA 1Z9QA 2MMPA 3CXCP 4HVWA 4HVVA 2DM1A 1WYXA 1QVGS 2HAXA 4QQGA 3THKA 3DLMA 4A54A 2LMJA 5CQYA 4J5YA 4MZTA 1QKWA 2FB7A 3EGXA 1XJWB 4JLGA 4C92C 4ZGJB 1TUGB 5GMKm 3SWNB 4CC2A 1QVPA 3NPFA 2KDSA 1RAEB 2QG9B 1KC8C 1HSQA 3R6OA 4K11A 1LNXA 3CC4Q 2K6DA 3PIPA 2E5KA 4PFOA 3JB9G 2KYBA 4FL6A 4QW2A 1QP3A 1AOJA 3CC4T 2O4XA 2KRSA 1M90R 3HPWA 1RAGB 3VV0A 3H0FA 1M3CA 3LGLA 4LNPA 2YRCA 4CC7A 2PVGB 3FDRA 1N8RR 1OZ3A 1TXQA 2H8HA 1BBZA 1X2QA 1FX7A 2E41A 3C4SA 3REAB 1LPLA 3BE3A 4WCIA 5GMKh 1UGSB 4JRPA 5GANd 1ZSZA 5IH2A 1ZSGA 2OTLA 2LC4A 2V8KA 3H0IA 2NUPB 5D6XA 4EMKA 2OAWA 3UF4A 3EH1A 3FC3A 2JTFA 1TUDA 2G6FX 4RMOA 4DEYA 5CCAA 2JMCA 1M2VB 2MIOA 4M77B 2EVRA 3QHSA 2DTIA 3EFOB 5GAN2 3HSBA 4FT4A 3CMEQ 3CMAQ 1NM7A 4PL6A 4UC4A 1X6OA 1OI1A 2K3YA 5A0DA 3CMAT 1M1KR 1ZUUA 5GMKe 1UB4A 3CCRQ 3A5ZB 3KXTA 3QIIA 2ECZA 4OMPA 4M7DA 1KG1A 1UGPB 2OTJA 1JEGA 2RHXA 1MHNA 1MGQA 1VQOT 4E7SA 1PD1A 2CSIA 2RK2A 3S3NA 4KT0E 2RO0A 4FYYB 1UHCA 2HL3A 2L3QA 3I5SA 1Q82R 1TWBA 3CD6Q 1UFFA 3M54A 2MYSA 1D1BA 2BZ8A 4E47A 3QG1A 3EG3A 2HBWA 1KC8R 1EZZB 5EC7A 4PJOB 3PVQA 4E7ZA 3OYDA 1YCYA 1NJIU 3I35A 1D0XA 1BKBA 2DK3A 2KRMA 4LN2A 2DJZA 5C0MA 2DD5A 3QBYA 1MNDA 4JJNK 1YI2A 1HD3A 2CZ1B 2YDLA 3L1AA 3QYGB 2NYSA 5FWCA 4DBQA 4MMLA 3G6EA 1WGSA 5FRMA 3CXCS 1VQ6T 2A3LA 1O75A 2AHJB 5GAN6 1LJOA 4WF2A 2EFIA 3SWNA 3D7SB 4PK4A 2MF2A 5LJ3j 4WTOB 3L2RA 3A8OB 2QQBA 3M4YA 1PG5B 2CUDA 3M55A 2DILA 3OYYA 2DO3A 1JXOA 1X69A 1X6GA 3P8DA 2OX7A 5FWBA 4C5EA 3ME9A 2V1QA 2ED1A 1JRIA 1T0HA 4NOYA 3JCMh 4L59A 2LJ0A 5CKFA 4BE1A 1YITA 2QEXQ 2EGAA 2KY9A 4J9BA 2CP0A 2EYZA 2DPPB 4N4HA 1S72A 4J9GA 4FYVB 2EQMA 1UG1A 4BACA 5HKCA 2XI9A 4F16A 5KYNA 2L0AA 1YJNQ 2NUPA 2QK0A 3PFSA 1VQ5Q 2CSQA 1MV3A 2ZAEA 1WJSA 4RTTA 1D0ZA 2R5MA 1G3TA 2XMFA 3LH5A 1YFNA 1M2VA 1QVFP 4M77A 3EFOA 5L23A 2FL7A 4PJMA 1RADB 2DAQA 2DEQA 5CIUA 4KH0B 1AVZC 1WA7A 2QQSA 4BE0A 1Q7YR 4F7UF 2X3WD 2BZXA 2HBPA 3RERA 1T0JA 4LUEA 2D1XA 5FW9A 3OS2A 2E1HA 1YWPA 2DL5A 4HCKA 3RUXA 1FMWA 3VS0A 3I56T 2EAYA 2DXUA 2PQWA 5GANg 4NL3A 3M4GA 3QDRB 4OGCA 2KRNA 3VRYA 3TEEA 1YIJA 4M7DE 3OYLA 1SHFA 3EG2A 1OU9A 2HQEA 1E6HA 3QJYA 3CCEA 4LUDA 4J6XA 2F2WA 3EAEA 3CC2Q 3SDZA 1LVKA 4ZGEB 3OQ5A 3MEAA 4ZTFA 5J26A 2YUQA 2GTJA 4PJOA 2AZVA 5LJ5j 5KYXB 1WX6A 2CH4W 2KQWA 2D8JA 3JB9I 5J39A 3JCMW 5FRNA 1BB9A 3EHRA 1K8AU 2RQRA 1VQLQ 1VQKA 1C0MA 1WHGA 2EQJA 2RI5A 2X35A 3CPFA 1KD1U 2K5LA 2CKKA 4M7AD 4F17A 1JQQA 1ZUYA 4J9EA 3ASKA 1J3TA 4X9CA 3VUBA 1C6VX 3CBMA 1X2KA 3KBGA 1M3AA 2VKNA 3QZ5B 1D0YA 4GLMA 4HKEA 2FEIA 3C0CA 5GAMj 5CQXA 5A0LA 2MWOA 1WHJA 1U1TA 4J6WA 4LXCA 2QGGA 4MDWA 3OA6A 5IHIA 3SD4A 5I2MA 2DYBA 3CC7T 2OAUA 1BIBA 1RLPC 4OVAA 2RN8A 4M7DG 3E9FA 1UGRB 2KI7A 2KNBB 3EH2A 1GL5A 3OYHA 4DOWA 2BKDN 1Q81U 3TVTA 1WHHA 3IQLA 1QVGP 1WJQA 5HK0A 5GJWB 7AT1B 2DERA 1S1NA 1FYNA 3I55Q 3U23A 1W70A 3OB9A 1M3BA 2DJQA 1A0NB 4OB1B 3I55T 4JZ4A 3RBBB 4JLIA 4KGVB 1N8RU 3CBOA 3V8LA 1K9MC 3REBB 4M78D 4MDXA 1O9SA 3LGFA 3JCMV 2QXFA 2PUKB 5LJ5f 2LT1A 3MHXA 2EBPA 4M7AF 4OB3B 4JS4A 1B07A 4HT8A 1D3BB 3E9GA 2KGTA 1MMDA 4AFSC 1QKXA 4JRIA 1JU5C 1N9SA 2DTOA 4A4FA 3L2ZA 5GANe 2K9GA 4M77E 4FM4B 2DD4A 3GP8A 3VYHB 5IT9E 3CCMQ 1YJ9Q 3LW5E 2ZPIB 1VQ4A 1X27A 1MV0B 2ZPHB 3N5BB 4CC4B 3OW2A 4YTLA 1YJ9T 1SSFA 1U8RA 3X24B 1I4K1 1OPKA 2OJ2A 3JCMc 2BE9B 2XDPA 1M1KU 3A8HB 1VQ8Q 2ZGWA 1ZLMA 4X9DA 4M75D 3PE0A 3KFVA 3CXCA 2D6FA 3L2VA 3H6ZA 1VQ8T 4Y28E 4E6RA 5GANf 1H8KA 4C8QE 4IIMA 1PSEA 2DZCA 1Q82U 2OI3A 3FIFA 5KYXA 2DYIA 3G1JA 3A98A 4OMQA 4PJOE 3QWYA 5GAOl 4M78F 4XU1A 1X6BA 4EPCA 2J7IA 1SKUB 3ER0A 3OSSC 4OF1A 1ABOA 3HFOA 4OGEA 4MZPA 2L3RA 1MMNA 3FJPA 3G4ST 2NLUA 4CRIA 3VJPA 1ZA2B 3NTKA 2YUNA 4BDZA 2A08A 1CKAA 4HA8A 1SHGA 3UDCA 2JT4A 4M77G 2RHIA 1HXDA 2A0FB 2HQHA 2RQVA 3M0RA 1N27A 5I21A 2RPNA 2I2LA 3OYBA 3FJ5A 2F2XA 4RTZA 2LCLA 4A4KA 3SB2A 2E6NA 1K0XA 1BIAA 3QYHB 4MZMA 2ZPEB 3CPWP 2XIDA 4M75F 1BI0A 1VQ9A 3PMIA 2YWWA 1GFDA 3CC4A 2WACA 4C8QG 3VKIA 4OB0B 3J7AF 2KROA 2JVVA 2FRWA 1WPYA 2FZKB 4XTYA 4BD3A 2D0NA 5I22A 1NE8A 1OQKA 4PJOG 4DOVA 1M27C 1XNIA 3OYGA 2P0PA 4J9IA 3M58A 5GMKi 1JB0E 1ZBXA 1WJRA 5IHNA 5DLOA 3CCQA 2M1HA 4RCCA 2IG0A 1BCOA 3CCVQ 4ZTJA 3VS2A 2JW4A 3M9QA 2IVWA 1IO6A 5LJ5d 1XOVA 1D3BA 3CCVT 2HZYA 4E7IA 1I0CA 4J9FA 2DEUA 2EWNA 3GIBA 2DKGA 2I0NA 5CKDA 4D6WA 2C0OA 3JSCA 2Y90A 3TSWA 1H92A 3RESA 3HRSA 1Q86C 4M7AC 2QTXA 3C94A 2A37A 4RTYA 3QXEB 2SRCA 1BU1A 1RAFB 2CGHA 4P5NA 2XD0A 2EYYA 4F04B 4C92E 4Z02A 2HSEB 1Q7YU 2DF6A 3CMEA 5CKBA 3CMAA 2BZYA 3RNJA 3GF5A 5GAMd 2RJDA 3MP8A 2D8HA 1UTIA 3MKDA 3CCRA 1W2BS 1GXIE 1KQSP 5GMKj 1UHFA 3X26B 2JTMA 4FSSA 2FHDA 2D0QB 5GAN7 3CCSA 1UE9A 3PT9A 3HKSA 4DEXA 5AYFA 2JZ2A 2RA2A 1IREB 3HL8A 4BDYA 3GNGA 2CDTA 2HD0A 4N4GA 1AWWA 4GBQA 1VQNQ 1RABB 1KHCA 1IGQA 3CD6A 1Y0MA 1EFNA 1VYTA 2HCKA 4X34A 3GPLA 1I81A 1VQNT 4PNOA 4PJLA 1VUBA 1H3HA 3WVEB 4J7IA 2RMOA 1OZ2A 4LDWA 5LJ3g 3NTIA 5IN1A 2C0IA 2XHCA 5GAOr 1OX9A 5ECAA 3MP6A 1YHQQ 4NL2A 1VQOQ 4M78C 2Y4YA 1AWXA 3HHTB 1M5Q1 1YHQT 4C92G 2RB6A 3AHUA 5KE2A 4ZGDB 1YCSB 1IHVA 2LNVA 2CT3A 2M0YA 2HSPA 1OEBA 3JCMg 1PRMC 2MPXC 2K2VA 3GBQA 5HY6A 2QA4Q 2M9UA 4R55A 1RUWA 1FMKA 2CP6A 2FRYA 4A4GA 4F7UB 4IKFA 2YRDA 2QA4T 1KJWA 2A28A 5KCHA 2RI2A 1Y96B 1FWZA 2RJFA 1Y7XA 1TTHB 1Q86R 3CPWS 4N0AA 5GJVB 1QVFA 3JCMX 3UATA 1BCMA 4E7JA 1F1BB 4M75C 2JM8A 3VUZA 1AZEA 1XQHA 3A1PA 4ATOA 1VQ6Q 4HXJA 2DZ9A 3R6NA 5DY9A 9ATCB 2P4TA 1QMCA 5M9OA 2R57A 3I5RA 2QEXA 2DNUA 1UGVA 1D09B 2HKNA 1WXTA 2X3XD 1GBRA 2E64A 4QVDA 1B34B 2PVOB 2YUOA 5DLQE 1VQ7Q 2DBKA 1ZHIA 3V8JA 1CKBA 1YJNA 1N6AA 4KRTA 3MEVA 2OTJT 4FT2A 1E6GA 2RHZA 3H8ZA 1OX8A 1VQ7T 1VQ5A 4E7HA 1RLQC 2RI3A 5FLXE 1K76A 1GCPA 2LCSA 2V8IA 1UJYA 1KSWA 2ZPFB 2QGFB 3PGGA 3UT1A 3M53A 2FPDA 3OSVA 4IIOA 3NMZC 4GY5A 3VS1A 2X4WA 4PJNA 3I9QA 2VXEA 1WZOA 3LH0A 3CCUQ 3QSUA 5LJ5g 2LJ1A 3PTAA 1H641 1G83A 3S3MA 1I5LA 2DXBA 4E7LA 4Z88A 2BUDA 3CCUT 3UWNA 2RF0A 3CQTA 1YI2T 3JB9D 3WVDB 1I07A 2CYZB 1WXBA 1SSHA 1G3WA 2WSCE 1KQSS 3G6ET 1UUEA 3CCJQ 4PJJA 4DA4A 4JRQA 3CC2A 4C5GA 1WHLA 2RH2A 3V7CA 1ACMB 3M5AA 3H9NA 5KYUB 1BI2A 1ABQA 3CCJT 2JS0A 4A4EA 3M0QA 5GAMg 1OU8A 2VXFA 3F70A 2J05A 3OYCA 2RJCA 3I56Q 1NJIC 3HRTA 4C8QF 3UPUA 4Y92A 1PWTA 3BY7A 2J6OA 4ANJA 2YRVA 3MEWA 1VQLA 1AWJA 1QVGA 3OYFA 5LJ3f 2DMOA 1R77A 2PNIA 2EQKA 3ZBDA 1PKSA 1RAHB 3JAME 2DRKA 5I11A 3DLLA 3NHNA 2LVMA 2M02A 2VV5A 4D8DA 1U5SA 4M7AB 2LQ8A 2YSQA 3V8KA 4OP0A 1YITT 3TREA 4N0AC 2VWFA 2DRMA 2IPOB 2O9VA 1QLYA 3ZFJA 1B3QA 2B8AA 4DBHA 1WHMA 2O9SA 2AKLA 1IXDA 4F7UA 2DL4A 1K73U 3JCMf 2MK5A 1Y96A 3EG1A 2COZA 3JB9H 4KULA 5A2QE 1RI0A 2VVKA 3JB9F 4QQDA 3X20B 2W0ZA 2P84A 2VGNA 1PRLC 1KIKA 1MMAA 5GMKl 3LX7A 1OV3A 3I55A 1BI3A 2K57A 2DA9A 2QI2A 1B34A 5KE3A 4IUTA 3L2QA 1JXMA 3CC7Q 4M4ZA 1R0CB 1XTDA 2EJ9A 4FW1A 4RTVA 3VS5A 3FRNA 1OULA 1VQMQ 4BI3A 1U06A 2YXYA 3MO8A 4ZN1A 2BE7D 2SEMA 1JJ2P 2ENMA 1VQMT 1YIJT 1B7TA 1AEYA 2H3JA 3CCLQ 4M78B 2JOYA 2XICA 3QKJA 2ESWA 2E6ZA 2JNGA 3QO3A 4J8OA 5LJ5e 3CCLT 1WLPB 4XAXB 4QVCA 3FLGA 3MEUA 2A7YA 5IHKA 5IXBA 3L42A 2K79A 2HKQB 4LDUA 3CCMA 1YJ9A 2K2MA 2JN0A 5GANh 4A63B 1M90U 2MI6A 2FPFA 1OPLA 1MUZA 1D1CA 1M9SA 1VOMA 1VQKT 2KEAA 4FIBA 2GTOA 2LNHB 4C92F 2EQIA 2JJ9A 2P4RA 3QWXX 2W10A 1W1FA 4XU3A 2DE0X 2K5IA 2LDMA 5AT1B 3VS6A 1M4ZA 4FSXA 5D6WA 2E70A 3QZ9B 1M8MA 1X75C 2ZPGB 4M75B 4XU0A 2QDLA 5KYUA 3A8MB 2CH4A 1PC0A 4HCBA 2XKOC 5FROA 2JXBA 1I8FA 3VS3A 5KYWB 1NYFA 1NBEB 3E2UA 1BI1A 1VYUA 1K8AC 3EFSA 1K0SA 3G71Q 2CZ7B 1W2BP 4FW2A 4CI0C 2EYXA 2DLPA 1KD1C 5GAMf 4KGXB 2KXDA 3G71T 4DQ2A 5LJ3d 3NTHA 2KYMA 1YJWA 4BUGA 3QJ6A 1YN8A 4M7AA 1NPRA 1TOVA 3SEMA 1G2BA 3RKYA 1LCKA 1NPPA 3T9NA 2YHTA 1QWFA 4RTUA 1TUCA 1G8XA 2GF7A 2LX7A 2V26A 1FXXA 3NGPA 2EYWA 2KMTA 5DM7R 5GAN5 1UECA 2VB6A 2KXCA 3JCMd 3G4SQ 2DVEA 2Y4XA 4F7UE 1NZ9A 1KC8U 5KYYB 1Q81C 5KH6A 4LD9K 2GCXA 2DXCA 3VU3C 3META 5L8RE 4BE2A 3ZL7C 4F14A 3E19A 3GNFB 5GAOp 2VGMA 3PNWC 1RL2A 4D8KA 3S3OA 4KGZB 1SG5A 1N8RC 3HP9A 2AK5A 3FB9A 5GAN4 3EGDB 1K9MR 1M1FA 3JRZA 1TSFA 1GCQC 1PSFA 3NFCA 3EGUA 4LDVA 1RAAB 5J3BA 4M78A 2RK1A 1VQPQ 2CZ6B 4AG2C 2LQNA 2DETA 1Z9ZA 1TU0B 1TG0A 3PVLA 2M16A 3RIRA 4KUIA 1VQPT 1WNLA 2KT8A 3HRUA 3SFMA 1SRMA 4OMFB 3V7SA 3L2UA 3HTRA 1JJ2S 4LE9A 2VC8A 2QQ9A 3OS5A 3ZEHA 2MAMA 2HEQA 3OYKA 4JJCA 3OBWA 4XTWA 1AZGB 1K8AR 2ZZDA 3KUFA 4F7UG 2KK4A 1T3LA 2COWA 2O31A 1KD1R 2EKOA 3TU4K 1M1KC 2GQIA 4B9WA 3CEYA 2X4JA 3OYEA 2PU9B 4JRKA 2DL7A 4J6YA 4M75A 1WI7A 2E3IA 1R0BG 4J83A 1M1GA 4XTXA 2XG8D 1UJ0A 4O5VA 5KYWA 1Q82C 1VIFA 2K4YA 4QT7A 1VQNA 1N5ZA 1H3ZA 5CR2A 2QAZA 3JCMJ 2DVJA 2ZCFB 2R58A 4JJBA 4IUPA 1RAIB 1VQ9Q 3RDVA 4MMKA 4L5GA 1KQ2A 2RJEA 4PFPA 1Q81R 4RKUE 4IURA 3M57A 4V2SA 1VQ9T 3PMTA 2E3HA 2F5KA 4C0GA 2X4XA 1GBQA 1BYMA 4CC3A 1YHQA 1VQOA 3X28B 3LWHA 1WXUA 1WIEA 4JS5A 5IAYA 4RTWA 3VRZA 1PKTA 3M59A 4M7AE 2CP7A 4PFZA 3C95A 4C0FA 1V29B 3CCQQ 1X43A 4OMMA 1WQWA 2EKHA 3WXMB 1AT1B 2JUFA 1YP5A 2GFUA 4B9XA 2KSSA 4A4HA 3CCQT 4E7KA 2F5TX 2PVDB 3JCMb 4M7DF 5KYYA 2AZSA 4DBRA 2DTHA 2PUOB 3LWIA 2QA4A 3CBPA 5I2SA 2O2OA 4QVZA 2CREA 3DB4A 3OYMA 4J9DA 1NEBA 2RNAA 3HFNA 2FPEA 1PNJA 4ESRA 4DBFA 2V8JA 3VYGA 5CO7A 5GAN3 2X4YA 1MMGA 2EGCA 2LQWA 2MCNA 2FO0A 4C5HA 1HJDA 1QP2A 1V1CA 3C12A 3M0UA 3EGDA 1VQ6A 4NS5A 4AFQC 2RD1A 1W6XA 3CMET 1AD5A 4JZ3A 4J7FA 4HCCA 3BW1A 1M30A 1JO8A 4BY6C 2PZ1A 3PIOA 3CCRT 1PCXA 4PKCC 3CCSQ 1VQ7A 5CAIA 2OTLQ 2YLBA 1I1JA 4M78E 1ARKA 1G3YA 1K1ZA 4FYWB 3J81E 4M7AG 4ELZC 3CCST 2QASA 4M77D 2OTLT 2PTKA 4C8QB 4OMOA 4Q5WA 1WDXA 1NG2A 1QWEA 1WQ7A 3LYIA 3CD6T 3P8BB 2CZ0B 1DJ7B 1IHWA 1Q7YC 2RHUA 4XQ3A 4Z89A 3RR6A 2EGEA 2F69A 2ATCB 1QQJA 4JDSA 5FU7C 4JUVA 2FG0A 2EQUA 2NUTB 4RCBA 3OW2S 1QCFA 4Y91A 3CCUA 2OTJQ 2M51A 4RG2A 5GAOm 3J80E 2M0OA 3MPUB 4C8QD 2XU8A 3INZA 8ATCB 2LT4A 4ZNXA 1P92A 5GAOn 1Y07A 4J9HA 1ZQ1A 4M75E 4L6V5 3UA7A 3X25B 2LP5A 4BI4A 5CK9A 3CCJA 4PJOD 2QQRA 5LJ3h 1UEBA 1OOTA 3A8LB 4FU6A 3M0SA 3URGA 2MWPA 2FZCB 2RQWA 2JS2A 1K4US 2DX1A 1AWOA 2RQUA 2EYQA 5FU6C 4M78G 5LL6S 4AMCA 1YWOA 3I56A 2HDAA 2EIFA 2EW3A 1SPKA 2L5QA 4RG8A 4FYXB 2AT1B 2LJ3A 1G5VA 1Y57A 1YI2Q 1AHJB 2CS7A 4M77F 3H0HA 1ZSZC 2ROLA 1QCNA 3G6EQ 3TSZA 2R5AA 5CVIA 4EMKC 3BFMA 6AT1B 5LJ3e 4ME7A 3GOXA 4JPBW 1D1AA 4OB2B 2LCCA 4XU2A 2MOXA 5D7UA 4AFZC 1W4SA 5KCOA 2QEXT 1G3SA 2BTTA 1GFCA 4HCZA 2WSEE 4C0ZA 2ED0A 1T3SA
chains in the Genus database with same CATH topology
1ZUUA 2KEAA 2ECZA 4OMPA 2GTOA 1JEGA 2LNHB 2J6FA 2EQIA 1GFDA 2P4RA 3H41A 2CT4A 3QWXX 2W10A 2JTEA 1W1FA 2DE0X 3VS6A 2CSIA 2O88A 2KROA 1VA7A 1VYVA 4OMNA 1UHCA 1M8MA 2L3QA 3I5SA 2FRWA 2QDLA 5I22A 2CH4A 2D0NA 2B86A 1M27C 1BK2A 2JXBA 1UFFA 4J9IA 3UA6A 3VS3A 1NYFA 2BZ8A 4EIKA 3EG3A 2HBWA 5IHNA 5EC7A 4RTXA 1NLPC 1VYUA 3PVQA 3VS2A 2JW4A 1K0SA 3I35A 2LZ6B 1IO6A 5HCKA 1XOVA 2EYXA 2KE9A 2DLPA 2KRMA 4LN2A 4RUGA 2KXDA 1I0CA 4J9FA 2KYMA 2YUPA 4ORZA 1HD3A 2YDLA 2I0NA 1YN8A 2L3PA 3SEMA 2C0OA 2F2VA 1G2BA 5FWCA 3EHQA 3TSWA 1H92A 1LCKA 4RTYA 2A37A 1QWFA 2SRCA 1BU1A 4RTUA 2EYYA 1TUCA 2LX7A 2CUBA 2DF6A 2BZYA 2J06A 2NUZA 3RNJA 3NGPA 2EYWA 1SEMA 2JMAA 1UECA 2KXCA 2CUDA 2D8HA 1UTIA 2DILA 1JXOA 1X69A 1X6GA 5FWBA 1UHFA 4HVUA 2JM9A 4FSSA 4AFUC 1U3OA 2V1QA 3ZL7C 2ED1A 1UE9A 2J6KA 4X1VA 4F14A 4DEXA 1T0HA 4J9CA 2CDTA 1AWWA 4GBQA 2LJ0A 1CSKA 1Y0MA 2EGAA 1EFNA 4J9BA 1VYTA 2HCKA 4D8KA 2EYZA 1GCQA 2AK5A 1KFZA 4J9GA 1H3HA 1GCQC 2RMOA 1UG1A 3EGUA 4F16A 2C0IA 2L0AA 5ECAA 1SRLA 4AG2C 2EPDA 2LQNA 1Z9ZA 2CSQA 1TG0A 3PVLA 1MV3A 1AWXA 4RTTA 2KT8A 1SRMA 2XMFA 3LH5A 2K3BA 4LE9A 5L23A 1YCSB 2CT3A 2M0YA 2DBMA 2HEQA 2HSPA 2NWMA 3JV3A 4JJCA 1AVZC 1OEBA 1WA7A 3M0TA 1AZGB 2X3WD 2BZXA 2AKKA 2V1RA 1PRMC 1T0JA 4LUEA 2D1XA 1T3LA 1WFWA 5FW9A 2O31A 2L3SA 3GBQA 1YWPA 2DL5A 4HCKA 3ULRB 3VS0A 2GQIA 1RUWA 1FMKA 2K7AA 5IXFA 1ZBJA 4AG1C 2FRYA 2KBTA 1E7OA 1KJWA 2A28A 4OMLA 2KRNA 3VRYA 2DL7A 1SHFA 3EG2A 3VS7A 1WI7A 1E6HA 5GJVB 4LUDA 3UATA 2F2WA 2JM8A 1AZEA 1UJ0A 2YT6A 4HXJA 3VS4A 3R6NA 1NLOC 2YUQA 4QT7A 2GTJA 1GRIA 1N5ZA 2AZVA 3I5RA 2DNUA 1UGVA 2X3XD 1K9AA 1WXTA 2DVJA 1GBRA 1WX6A 2GGRA 2CH4W 2GBQA 4JJBA 2YUOA 2D8JA 2L2PA 1BB9A 3EHRA 2RQRA 2DBKA 1CKBA 4KRTA 2C0TA 2KT1A 2DL3A 1E6GA 1GBQA 4CC3A 1JQQA 4F17A 1RLQC 1ZUYA 2IIMA 4J9EA 1WXUA 1J3TA 1WIEA 2RQTA 1UDLA 3O5ZA 4RTWA 3VRZA 1PKTA 1K76A 1GCPA 2LCSA 1UJYA 1X2KA 2DL8A 1M3AA 1KSWA 2VKNA 4GLMA 2FEIA 3C0CA 3EG0A 1X43A 4OMMA 2FPDA 2EKHA 4IIOA 3NMZC 3VS1A 1YP5A 3I9QA 5IHIA 1RI9A 2DYBA 1RLPC 2ROTA 2AZSA 4R0KA 2LJ1A 2RN8A 2KNBB 2O2OA 1G83A 1GL5A 2CREA 2A36A 4J9DA 1NEBA 4Z88A 1ZX6A 2RNAA 4Z8AA 2FPEA 3TVTA 1PNJA 3IQLA 2RF0A 3CQTA 1NEGA 4ESRA 2KR3A 5GJWB 1YNZA 1I07A 1S1NA 3SHWA 1WXBA 1SSHA 2GNCA 1FYNA 4JJDA 2EGCA 3U23A 2LQWA 1UUEA 1W70A 2MCNA 1M3BA 2DJQA 2FO0A 1HJDA 1V1CA 1A0NB 3M0UA 4JZ4A 3RBBB 4AFQC 1ABQA 1W6XA 2JS0A 1AD5A 3M0QA 4JZ3A 2J05A 1M30A 3REBB 1JO8A 2PZ1A 1ZUKA 1PHTA 4Y92A 1PWTA 2J6OA 2ABLA 2EBPA 1I1JA 1NYGA 1ARKA 1AWJA 1B07A 1K1ZA 3M0PA 2KGTA 2DMOA 1Z9QA 4AFSC 2PNIA 1QKXA 4HVVA 4HVWA 1PKSA 2PTKA 4OMOA 1JU5C 1WYXA 2DRKA 2DM1A 1WDXA 1NG2A 3THKA 5I11A 1QWEA 3NHNA 2LMJA 2K9GA 4D8DA 1U5SA 2YSQA 1QKWA 2VWFA 2DRMA 1X27A 1MV0B 2O9VA 4CC4B 1QLYA 4Z89A 2EGEA 1B3QA 2O9SA 2AKLA 4CC2A 2FG0A 3NPFA 2DL4A 1OPKA 2OJ2A 1QCFA 1HSQA 3EG1A 4K11A 2M51A 1ZLMA 2VVKA 3PE0A 2K6DA 2W0ZA 2E5KA 3KFVA 2KYBA 1PRLC 4E6RA 1KIKA 1AOJA 4ZNXA 4J9HA 2KRSA 3UA7A 1H8KA 1OV3A 2LP5A 4IIMA 2OI3A 2DA9A 3H0FA 1M3CA 4LNPA 4CC7A 1JXMA 1OOTA 3A98A 3M0SA 4OMQA 3QWYA 4M4ZA 2RQWA 1K4US 2JS2A 1X6BA 4RTVA 2J7IA 3VS5A 2H8HA 2DX1A 1AWOA 2RQUA 1BBZA 1X2QA 1ABOA 3REAB 1YWOA 2HDAA 2EW3A 1SPKA 4WCIA 1U06A 2YUNA 2SEMA 2LJ3A 1Y57A 2A08A 2ENMA 1CKAA 5IH2A 1AEYA 1ZSGA 3H0IA 1SHGA 2OAWA 3H0HA 3UF4A 2JT4A 2ESWA 2ROLA 2RQVA 3TSZA 1WLPB 3M0RA 1TUDA 2G6FX 5IHKA 5IXBA 4DEYA 2K79A 2RPNA 2JMCA 3FJ5A 2MIOA 4JPBW 2EVRA 2F2XA 4RTZA 2MOXA 4AFZC 2K2MA 1NM7A 4A63B 2BTTA 1K0XA 2FPFA 1GFCA 1OPLA 1MUZA 2ED0A 1T3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZUU A;  2KEA A;  2ECZ A;  4OMP A;  2GTO A;  1JEG A;  2LNH B;  2J6F A;  2EQI A;  1GFD A;  2P4R A;  3H41 A;  2CT4 A;  3QWX X;  2W10 A;  2JTE A;  1W1F A;  2DE0 X;  3VS6 A;  2CSI A;  2O88 A;  2KRO A;  1VA7 A;  1VYV A;  4OMN A;  1UHC A;  1M8M A;  2L3Q A;  3I5S A;  2FRW A;  2QDL A;  5I22 A;  2CH4 A;  2D0N A;  2B86 A;  1M27 C;  1BK2 A;  2JXB A;  1UFF A;  4J9I A;  3UA6 A;  3VS3 A;  1NYF A;  2BZ8 A;  4EIK A;  3EG3 A;  2HBW A;  5IHN A;  5EC7 A;  4RTX A;  1NLP C;  1VYU A;  3PVQ A;  3VS2 A;  2JW4 A;  1K0S A;  3I35 A;  2LZ6 B;  1IO6 A;  5HCK A;  1XOV A;  2EYX A;  2KE9 A;  2DLP A;  2KRM A;  4LN2 A;  4RUG A;  2KXD A;  1I0C A;  4J9F A;  2KYM A;  2YUP A;  4ORZ A;  1HD3 A;  2YDL A;  2I0N A;  1YN8 A;  2L3P A;  3SEM A;  2C0O A;  2F2V A;  1G2B A;  5FWC A;  3EHQ A;  3TSW A;  1H92 A;  1LCK A;  4RTY A;  2A37 A;  1QWF A;  2SRC A;  1BU1 A;  4RTU A;  2EYY A;  1TUC A;  2LX7 A;  2CUB A;  2DF6 A;  2BZY A;  2J06 A;  2NUZ A;  3RNJ A;  3NGP A;  2EYW A;  1SEM A;  2JMA A;  1UEC A;  2KXC A;  2CUD A;  2D8H A;  1UTI A;  2DIL A;  1JXO A;  1X69 A;  1X6G A;  5FWB A;  1UHF A;  4HVU A;  2JM9 A;  4FSS A;  4AFU C;  1U3O A;  2V1Q A;  3ZL7 C;  2ED1 A;  1UE9 A;  2J6K A;  4X1V A;  4F14 A;  4DEX A;  1T0H A;  4J9C A;  2CDT A;  1AWW A;  4GBQ A;  2LJ0 A;  1CSK A;  1Y0M A;  2EGA A;  1EFN A;  4J9B A;  1VYT A;  2HCK A;  4D8K A;  2EYZ A;  1GCQ A;  2AK5 A;  1KFZ A;  4J9G A;  1H3H A;  1GCQ C;  2RMO A;  1UG1 A;  3EGU A;  4F16 A;  2C0I A;  2L0A A;  5ECA A;  1SRL A;  4AG2 C;  2EPD A;  2LQN A;  1Z9Z A;  2CSQ A;  1TG0 A;  3PVL A;  1MV3 A;  1AWX A;  4RTT A;  2KT8 A;  1SRM A;  2XMF A;  3LH5 A;  2K3B A;  4LE9 A;  5L23 A;  1YCS B;  2CT3 A;  2M0Y A;  2DBM A;  2HEQ A;  2HSP A;  2NWM A;  3JV3 A;  4JJC A;  1AVZ C;  1OEB A;  1WA7 A;  3M0T A;  1AZG B;  2X3W D;  2BZX A;  2AKK A;  2V1R A;  1PRM C;  1T0J A;  4LUE A;  2D1X A;  1T3L A;  1WFW A;  5FW9 A;  2O31 A;  2L3S A;  3GBQ A;  1YWP A;  2DL5 A;  4HCK A;  3ULR B;  3VS0 A;  2GQI A;  1RUW A;  1FMK A;  2K7A A;  5IXF A;  1ZBJ A;  4AG1 C;  2FRY A;  2KBT A;  1E7O A;  1KJW A;  2A28 A;  4OML A;  2KRN A;  3VRY A;  2DL7 A;  1SHF A;  3EG2 A;  3VS7 A;  1WI7 A;  1E6H A;  5GJV B;  4LUD A;  3UAT A;  2F2W A;  2JM8 A;  1AZE A;  1UJ0 A;  2YT6 A;  4HXJ A;  3VS4 A;  3R6N A;  1NLO C;  2YUQ A;  4QT7 A;  2GTJ A;  1GRI A;  1N5Z A;  2AZV A;  3I5R A;  2DNU A;  1UGV A;  2X3X D;  1K9A A;  1WXT A;  2DVJ A;  1GBR A;  1WX6 A;  2GGR A;  2CH4 W;  2GBQ A;  4JJB A;  2YUO A;  2D8J A;  2L2P A;  1BB9 A;  3EHR A;  2RQR A;  2DBK A;  1CKB A;  4KRT A;  2C0T A;  2KT1 A;  2DL3 A;  1E6G A;  1GBQ A;  4CC3 A;  1JQQ A;  4F17 A;  1RLQ C;  1ZUY A;  2IIM A;  4J9E A;  1WXU A;  1J3T A;  1WIE A;  2RQT A;  1UDL A;  3O5Z A;  4RTW A;  3VRZ A;  1PKT A;  1K76 A;  1GCP A;  2LCS A;  1UJY A;  1X2K A;  2DL8 A;  1M3A A;  1KSW A;  2VKN A;  4GLM A;  2FEI A;  3C0C A;  3EG0 A;  1X43 A;  4OMM A;  2FPD A;  2EKH A;  4IIO A;  3NMZ C;  3VS1 A;  1YP5 A;  3I9Q A;  5IHI A;  1RI9 A;  2DYB A;  1RLP C;  2ROT A;  2AZS A;  4R0K A;  2LJ1 A;  2RN8 A;  2KNB B;  2O2O A;  1G83 A;  1GL5 A;  2CRE A;  2A36 A;  4J9D A;  1NEB A;  4Z88 A;  1ZX6 A;  2RNA A;  4Z8A A;  2FPE A;  3TVT A;  1PNJ A;  3IQL A;  2RF0 A;  3CQT A;  1NEG A;  4ESR A;  2KR3 A;  5GJW B;  1YNZ A;  1I07 A;  1S1N A;  3SHW A;  1WXB A;  1SSH A;  2GNC A;  1FYN A;  4JJD A;  2EGC A;  3U23 A;  2LQW A;  1UUE A;  1W70 A;  2MCN A;  1M3B A;  2DJQ A;  2FO0 A;  1HJD A;  1V1C A;  1A0N B;  3M0U A;  4JZ4 A;  3RBB B;  4AFQ C;  1ABQ A;  1W6X A;  2JS0 A;  1AD5 A;  3M0Q A;  4JZ3 A;  2J05 A;  1M30 A;  3REB B;  1JO8 A;  2PZ1 A;  1ZUK A;  1PHT A;  4Y92 A;  1PWT A;  2J6O A;  2ABL A;  2EBP A;  1I1J A;  1NYG A;  1ARK A;  1AWJ A;  1B07 A;  1K1Z A;  3M0P A;  2KGT A;  2DMO A;  1Z9Q A;  4AFS C;  2PNI A;  1QKX A;  4HVV A;  4HVW A;  1PKS A;  2PTK A;  4OMO A;  1JU5 C;  1WYX A;  2DRK A;  2DM1 A;  1WDX A;  1NG2 A;  3THK A;  5I11 A;  1QWE A;  3NHN A;  2LMJ A;  2K9G A;  4D8D A;  1U5S A;  2YSQ A;  1QKW A;  2VWF A;  2DRM A;  1X27 A;  1MV0 B;  2O9V A;  4CC4 B;  1QLY A;  4Z89 A;  2EGE A;  1B3Q A;  2O9S A;  2AKL A;  4CC2 A;  2FG0 A;  3NPF A;  2DL4 A;  1OPK A;  2OJ2 A;  1QCF A;  1HSQ A;  3EG1 A;  4K11 A;  2M51 A;  1ZLM A;  2VVK A;  3PE0 A;  2K6D A;  2W0Z A;  2E5K A;  3KFV A;  2KYB A;  1PRL C;  4E6R A;  1KIK A;  1AOJ A;  4ZNX A;  4J9H A;  2KRS A;  3UA7 A;  1H8K A;  1OV3 A;  2LP5 A;  4IIM A;  2OI3 A;  2DA9 A;  3H0F A;  1M3C A;  4LNP A;  4CC7 A;  1JXM A;  1OOT A;  3A98 A;  3M0S A;  4OMQ A;  3QWY A;  4M4Z A;  2RQW A;  1K4U S;  2JS2 A;  1X6B A;  4RTV A;  2J7I A;  3VS5 A;  2H8H A;  2DX1 A;  1AWO A;  2RQU A;  1BBZ A;  1X2Q A;  1ABO A;  3REA B;  1YWO A;  2HDA A;  2EW3 A;  1SPK A;  4WCI A;  1U06 A;  2YUN A;  2SEM A;  2LJ3 A;  1Y57 A;  2A08 A;  2ENM A;  1CKA A;  5IH2 A;  1AEY A;  1ZSG A;  3H0I A;  1SHG A;  2OAW A;  3H0H A;  3UF4 A;  2JT4 A;  2ESW A;  2ROL A;  2RQV A;  3TSZ A;  1WLP B;  3M0R A;  1TUD A;  2G6F X;  5IHK A;  5IXB A;  4DEY A;  2K79 A;  2RPN A;  2JMC A;  3FJ5 A;  2MIO A;  4JPB W;  2EVR A;  2F2X A;  4RTZ A;  2MOX A;  4AFZ C;  2K2M A;  1NM7 A;  4A63 B;  2BTT A;  1K0X A;  2FPF A;  1GFC A;  1OPL A;  1MUZ A;  2ED0 A;  1T3S A; 
#chains in the Genus database with same CATH topology
 1IZ6 A;  4EMG A;  5CKH A;  5HK3 A;  1KQ1 A;  1HK9 A;  4LDX A;  1YJN T;  1JJ2 A;  5CKE A;  4M75 G;  2J6F A;  5GAN 8;  3H41 A;  1QW1 A;  2CT4 A;  1VQ5 T;  2P0K A;  2JTE A;  4M7D C;  1PM3 A;  3JCM e;  2E12 A;  2O88 A;  3RMS A;  1VA7 A;  1VYV A;  4OMN A;  2DIQ A;  4PJO F;  4N4I A;  1YIT Q;  2B86 A;  4C92 B;  1BK2 A;  1U1S A;  3UA6 A;  4KBM B;  1IB8 A;  3OY9 A;  3AT1 B;  2BIV A;  4EIK A;  4XTU A;  1S72 Q;  4RTX A;  3CC7 A;  1NLP C;  2VUB A;  1K9M U;  2ZPB B;  1R8O B;  2LZ6 B;  2AIR B;  3OS0 A;  1S72 T;  5HCK A;  1VQM A;  3P8H A;  3RKX A;  2KE9 A;  2O01 E;  4C0D C;  1JBM A;  4RUG A;  4XTZ A;  3RKW A;  4C8Q A;  1SF9 A;  1UGQ B;  2X51 A;  2QYZ A;  3M56 A;  2YUP A;  4ORZ A;  3CCL A;  3LLR A;  2L3P A;  2FVU A;  1YBY A;  2F2V A;  2HQX A;  3OS1 A;  2E4H A;  1LOJ A;  2HNI A;  3EHQ A;  4C92 D;  2FYK A;  1QCO A;  3CC2 T;  1EIF A;  2QQA A;  1I5O B;  5LJ5 h;  1OYX A;  3E1S A;  4PLL A;  2CUB A;  2NUT A;  3OYJ A;  2J06 A;  2NUZ A;  3SWN C;  1SEM A;  2JMA A;  2E5Q A;  1W2B A;  3O8V A;  4B6M A;  1RAC B;  3L2W A;  1KK7 A;  1VQL T;  1YIJ Q;  4II1 A;  5GAO q;  4HT9 A;  4HVU A;  2JM9 A;  4AFU C;  3CCE Q;  1U3O A;  4X1V A;  2J6K A;  4PLI A;  4VUB A;  4J9C A;  4A53 A;  5GAM h;  3CCE T;  2GQV A;  2CP5 A;  2FZG B;  2XDB A;  3OYI A;  2L8D A;  2F1L A;  4LDY A;  1CSK A;  3BDU A;  1GCQ A;  4BI8 B;  4IUV A;  1KFZ A;  5GAN j;  1NJI R;  3EG9 B;  2C06 A;  1VQK Q;  2E10 A;  4BY6 B;  3G71 A;  1EX4 A;  1VIE A;  1SRL A;  1Y71 A;  2KVQ G;  2EPD A;  2KAF A;  2X9H A;  5EG2 A;  1VQ8 A;  3EFR A;  4R56 A;  3DKM A;  5GAM e;  2K3B A;  2K5F A;  3V7R A;  2VYT A;  3GLX A;  1M2O A;  4XTV A;  4KH1 B;  1V76 A;  4M77 C;  2DBM A;  2NWM A;  3JV3 A;  3M0T A;  5D6Y A;  2AKK A;  2DIG A;  2V1R A;  1WFW A;  3EGX B;  3A8G B;  5FU7 B;  2L3S A;  1K73 C;  3ULR B;  2WSF E;  2K7A A;  5IXF A;  1ZBJ A;  4QQ6 A;  3G4S A;  4EDU A;  4QKU A;  4AG1 C;  5C6S A;  2KBT A;  1E7O A;  3CPW A;  4OML A;  3VS7 A;  2D9T A;  4IUQ A;  2G3R A;  3QPH A;  1PD0 A;  1FMV A;  2HL5 C;  4C5I A;  4C92 A;  2VAS A;  2LQK A;  2Z0W A;  4C8Q C;  4FCY A;  1QVF S;  2LTO A;  4ELY C;  2O4X B;  2YT6 A;  3VS4 A;  4KUD K;  3G7Z A;  1NLO C;  5A0G A;  3CCM T;  1GRI A;  2E65 A;  1M8V A;  4ZN3 A;  2XDD A;  1IGU A;  1K9A A;  3RMQ A;  2GGR A;  3QUI A;  2GBQ A;  4PJO C;  2L2P A;  1X01 A;  4XK8 E;  5FU6 B;  1IRX A;  1TS9 A;  2HMA A;  3TQ7 P;  2K3X A;  2P0Q A;  2C0T A;  1VQP A;  2KT1 A;  2DL3 A;  1KHI A;  4EMH A;  3BDL A;  2IIM A;  3OBY A;  3DB3 A;  1ZSZ B;  2RQT A;  4LD6 A;  1UDL A;  3O5Z A;  3JCM Q;  2L89 A;  4GLK A;  3S6W A;  4EMK B;  2DL8 A;  1Q86 U;  1MNE A;  3QDF A;  1Q95 G;  3EG0 A;  1VQ4 Q;  2YLC A;  2DXT A;  1M90 C;  2GFA A;  2H3E B;  3MJX A;  1RI9 A;  4E2F B;  1VQ4 T;  2ROT A;  2RM4 A;  3MP1 A;  2EJF A;  4R0K A;  4IUU A;  3OMC A;  1YJW Q;  2LRQ A;  2A36 A;  3CCV A;  1ZX6 A;  4AT1 B;  4Z8A A;  1ZA1 B;  2QTV A;  1YJW T;  1NEG A;  1KQS A;  2EJG A;  4M7D B;  1C1A A;  2KR3 A;  1N9R A;  1YNZ A;  2DFU A;  2QDY B;  3SHW A;  2GNC A;  4JJD A;  1TH7 A;  3JB9 J;  4O6J A;  2CP2 A;  2CP3 A;  3JCM P;  2LX9 A;  2XK0 A;  1WHK A;  2RHY A;  3EG9 A;  3OMG A;  1K73 R;  3OYA A;  3OYN A;  3MCA B;  3FEO A;  2COY A;  3OW2 P;  4BB7 A;  1ZUK A;  1PHT A;  3TCJ A;  1HYO A;  2ABL A;  4C0D B;  3Q1J A;  1NYG A;  4M7D D;  4TVR A;  8AT1 B;  3M0P A;  1Z9Q A;  2MMP A;  3CXC P;  4HVW A;  4HVV A;  2DM1 A;  1WYX A;  1QVG S;  2HAX A;  4QQG A;  3THK A;  3DLM A;  4A54 A;  2LMJ A;  5CQY A;  4J5Y A;  4MZT A;  1QKW A;  2FB7 A;  3EGX A;  1XJW B;  4JLG A;  4C92 C;  4ZGJ B;  1TUG B;  5GMK m;  3SWN B;  4CC2 A;  1QVP A;  3NPF A;  2KDS A;  1RAE B;  2QG9 B;  1KC8 C;  1HSQ A;  3R6O A;  4K11 A;  1LNX A;  3CC4 Q;  2K6D A;  3PIP A;  2E5K A;  4PFO A;  3JB9 G;  2KYB A;  4FL6 A;  4QW2 A;  1QP3 A;  1AOJ A;  3CC4 T;  2O4X A;  2KRS A;  1M90 R;  3HPW A;  1RAG B;  3VV0 A;  3H0F A;  1M3C A;  3LGL A;  4LNP A;  2YRC A;  4CC7 A;  2PVG B;  3FDR A;  1N8R R;  1OZ3 A;  1TXQ A;  2H8H A;  1BBZ A;  1X2Q A;  1FX7 A;  2E41 A;  3C4S A;  3REA B;  1LPL A;  3BE3 A;  4WCI A;  5GMK h;  1UGS B;  4JRP A;  5GAN d;  1ZSZ A;  5IH2 A;  1ZSG A;  2OTL A;  2LC4 A;  2V8K A;  3H0I A;  2NUP B;  5D6X A;  4EMK A;  2OAW A;  3UF4 A;  3EH1 A;  3FC3 A;  2JTF A;  1TUD A;  2G6F X;  4RMO A;  4DEY A;  5CCA A;  2JMC A;  1M2V B;  2MIO A;  4M77 B;  2EVR A;  3QHS A;  2DTI A;  3EFO B;  5GAN 2;  3HSB A;  4FT4 A;  3CME Q;  3CMA Q;  1NM7 A;  4PL6 A;  4UC4 A;  1X6O A;  1OI1 A;  2K3Y A;  5A0D A;  3CMA T;  1M1K R;  1ZUU A;  5GMK e;  1UB4 A;  3CCR Q;  3A5Z B;  3KXT A;  3QII A;  2ECZ A;  4OMP A;  4M7D A;  1KG1 A;  1UGP B;  2OTJ A;  1JEG A;  2RHX A;  1MHN A;  1MGQ A;  1VQO T;  4E7S A;  1PD1 A;  2CSI A;  2RK2 A;  3S3N A;  4KT0 E;  2RO0 A;  4FYY B;  1UHC A;  2HL3 A;  2L3Q A;  3I5S A;  1Q82 R;  1TWB A;  3CD6 Q;  1UFF A;  3M54 A;  2MYS A;  1D1B A;  2BZ8 A;  4E47 A;  3QG1 A;  3EG3 A;  2HBW A;  1KC8 R;  1EZZ B;  5EC7 A;  4PJO B;  3PVQ A;  4E7Z A;  3OYD A;  1YCY A;  1NJI U;  3I35 A;  1D0X A;  1BKB A;  2DK3 A;  2KRM A;  4LN2 A;  2DJZ A;  5C0M A;  2DD5 A;  3QBY A;  1MND A;  4JJN K;  1YI2 A;  1HD3 A;  2CZ1 B;  2YDL A;  3L1A A;  3QYG B;  2NYS A;  5FWC A;  4DBQ A;  4MML A;  3G6E A;  1WGS A;  5FRM A;  3CXC S;  1VQ6 T;  2A3L A;  1O75 A;  2AHJ B;  5GAN 6;  1LJO A;  4WF2 A;  2EFI A;  3SWN A;  3D7S B;  4PK4 A;  2MF2 A;  5LJ3 j;  4WTO B;  3L2R A;  3A8O B;  2QQB A;  3M4Y A;  1PG5 B;  2CUD A;  3M55 A;  2DIL A;  3OYY A;  2DO3 A;  1JXO A;  1X69 A;  1X6G A;  3P8D A;  2OX7 A;  5FWB A;  4C5E A;  3ME9 A;  2V1Q A;  2ED1 A;  1JRI A;  1T0H A;  4NOY A;  3JCM h;  4L59 A;  2LJ0 A;  5CKF A;  4BE1 A;  1YIT A;  2QEX Q;  2EGA A;  2KY9 A;  4J9B A;  2CP0 A;  2EYZ A;  2DPP B;  4N4H A;  1S72 A;  4J9G A;  4FYV B;  2EQM A;  1UG1 A;  4BAC A;  5HKC A;  2XI9 A;  4F16 A;  5KYN A;  2L0A A;  1YJN Q;  2NUP A;  2QK0 A;  3PFS A;  1VQ5 Q;  2CSQ A;  1MV3 A;  2ZAE A;  1WJS A;  4RTT A;  1D0Z A;  2R5M A;  1G3T A;  2XMF A;  3LH5 A;  1YFN A;  1M2V A;  1QVF P;  4M77 A;  3EFO A;  5L23 A;  2FL7 A;  4PJM A;  1RAD B;  2DAQ A;  2DEQ A;  5CIU A;  4KH0 B;  1AVZ C;  1WA7 A;  2QQS A;  4BE0 A;  1Q7Y R;  4F7U F;  2X3W D;  2BZX A;  2HBP A;  3RER A;  1T0J A;  4LUE A;  2D1X A;  5FW9 A;  3OS2 A;  2E1H A;  1YWP A;  2DL5 A;  4HCK A;  3RUX A;  1FMW A;  3VS0 A;  3I56 T;  2EAY A;  2DXU A;  2PQW A;  5GAN g;  4NL3 A;  3M4G A;  3QDR B;  4OGC A;  2KRN A;  3VRY A;  3TEE A;  1YIJ A;  4M7D E;  3OYL A;  1SHF A;  3EG2 A;  1OU9 A;  2HQE A;  1E6H A;  3QJY A;  3CCE A;  4LUD A;  4J6X A;  2F2W A;  3EAE A;  3CC2 Q;  3SDZ A;  1LVK A;  4ZGE B;  3OQ5 A;  3MEA A;  4ZTF A;  5J26 A;  2YUQ A;  2GTJ A;  4PJO A;  2AZV A;  5LJ5 j;  5KYX B;  1WX6 A;  2CH4 W;  2KQW A;  2D8J A;  3JB9 I;  5J39 A;  3JCM W;  5FRN A;  1BB9 A;  3EHR A;  1K8A U;  2RQR A;  1VQL Q;  1VQK A;  1C0M A;  1WHG A;  2EQJ A;  2RI5 A;  2X35 A;  3CPF A;  1KD1 U;  2K5L A;  2CKK A;  4M7A D;  4F17 A;  1JQQ A;  1ZUY A;  4J9E A;  3ASK A;  1J3T A;  4X9C A;  3VUB A;  1C6V X;  3CBM A;  1X2K A;  3KBG A;  1M3A A;  2VKN A;  3QZ5 B;  1D0Y A;  4GLM A;  4HKE A;  2FEI A;  3C0C A;  5GAM j;  5CQX A;  5A0L A;  2MWO A;  1WHJ A;  1U1T A;  4J6W A;  4LXC A;  2QGG A;  4MDW A;  3OA6 A;  5IHI A;  3SD4 A;  5I2M A;  2DYB A;  3CC7 T;  2OAU A;  1BIB A;  1RLP C;  4OVA A;  2RN8 A;  4M7D G;  3E9F A;  1UGR B;  2KI7 A;  2KNB B;  3EH2 A;  1GL5 A;  3OYH A;  4DOW A;  2BKD N;  1Q81 U;  3TVT A;  1WHH A;  3IQL A;  1QVG P;  1WJQ A;  5HK0 A;  5GJW B;  7AT1 B;  2DER A;  1S1N A;  1FYN A;  3I55 Q;  3U23 A;  1W70 A;  3OB9 A;  1M3B A;  2DJQ A;  1A0N B;  4OB1 B;  3I55 T;  4JZ4 A;  3RBB B;  4JLI A;  4KGV B;  1N8R U;  3CBO A;  3V8L A;  1K9M C;  3REB B;  4M78 D;  4MDX A;  1O9S A;  3LGF A;  3JCM V;  2QXF A;  2PUK B;  5LJ5 f;  2LT1 A;  3MHX A;  2EBP A;  4M7A F;  4OB3 B;  4JS4 A;  1B07 A;  4HT8 A;  1D3B B;  3E9G A;  2KGT A;  1MMD A;  4AFS C;  1QKX A;  4JRI A;  1JU5 C;  1N9S A;  2DTO A;  4A4F A;  3L2Z A;  5GAN e;  2K9G A;  4M77 E;  4FM4 B;  2DD4 A;  3GP8 A;  3VYH B;  5IT9 E;  3CCM Q;  1YJ9 Q;  3LW5 E;  2ZPI B;  1VQ4 A;  1X27 A;  1MV0 B;  2ZPH B;  3N5B B;  4CC4 B;  3OW2 A;  4YTL A;  1YJ9 T;  1SSF A;  1U8R A;  3X24 B;  1I4K 1;  1OPK A;  2OJ2 A;  3JCM c;  2BE9 B;  2XDP A;  1M1K U;  3A8H B;  1VQ8 Q;  2ZGW A;  1ZLM A;  4X9D A;  4M75 D;  3PE0 A;  3KFV A;  3CXC A;  2D6F A;  3L2V A;  3H6Z A;  1VQ8 T;  4Y28 E;  4E6R A;  5GAN f;  1H8K A;  4C8Q E;  4IIM A;  1PSE A;  2DZC A;  1Q82 U;  2OI3 A;  3FIF A;  5KYX A;  2DYI A;  3G1J A;  3A98 A;  4OMQ A;  4PJO E;  3QWY A;  5GAO l;  4M78 F;  4XU1 A;  1X6B A;  4EPC A;  2J7I A;  1SKU B;  3ER0 A;  3OSS C;  4OF1 A;  1ABO A;  3HFO A;  4OGE A;  4MZP A;  2L3R A;  1MMN A;  3FJP A;  3G4S T;  2NLU A;  4CRI A;  3VJP A;  1ZA2 B;  3NTK A;  2YUN A;  4BDZ A;  2A08 A;  1CKA A;  4HA8 A;  1SHG A;  3UDC A;  2JT4 A;  4M77 G;  2RHI A;  1HXD A;  2A0F B;  2HQH A;  2RQV A;  3M0R A;  1N27 A;  5I21 A;  2RPN A;  2I2L A;  3OYB A;  3FJ5 A;  2F2X A;  4RTZ A;  2LCL A;  4A4K A;  3SB2 A;  2E6N A;  1K0X A;  1BIA A;  3QYH B;  4MZM A;  2ZPE B;  3CPW P;  2XID A;  4M75 F;  1BI0 A;  1VQ9 A;  3PMI A;  2YWW A;  1GFD A;  3CC4 A;  2WAC A;  4C8Q G;  3VKI A;  4OB0 B;  3J7A F;  2KRO A;  2JVV A;  2FRW A;  1WPY A;  2FZK B;  4XTY A;  4BD3 A;  2D0N A;  5I22 A;  1NE8 A;  1OQK A;  4PJO G;  4DOV A;  1M27 C;  1XNI A;  3OYG A;  2P0P A;  4J9I A;  3M58 A;  5GMK i;  1JB0 E;  1ZBX A;  1WJR A;  5IHN A;  5DLO A;  3CCQ A;  2M1H A;  4RCC A;  2IG0 A;  1BCO A;  3CCV Q;  4ZTJ A;  3VS2 A;  2JW4 A;  3M9Q A;  2IVW A;  1IO6 A;  5LJ5 d;  1XOV A;  1D3B A;  3CCV T;  2HZY A;  4E7I A;  1I0C A;  4J9F A;  2DEU A;  2EWN A;  3GIB A;  2DKG A;  2I0N A;  5CKD A;  4D6W A;  2C0O A;  3JSC A;  2Y90 A;  3TSW A;  1H92 A;  3RES A;  3HRS A;  1Q86 C;  4M7A C;  2QTX A;  3C94 A;  2A37 A;  4RTY A;  3QXE B;  2SRC A;  1BU1 A;  1RAF B;  2CGH A;  4P5N A;  2XD0 A;  2EYY A;  4F04 B;  4C92 E;  4Z02 A;  2HSE B;  1Q7Y U;  2DF6 A;  3CME A;  5CKB A;  3CMA A;  2BZY A;  3RNJ A;  3GF5 A;  5GAM d;  2RJD A;  3MP8 A;  2D8H A;  1UTI A;  3MKD A;  3CCR A;  1W2B S;  1GXI E;  1KQS P;  5GMK j;  1UHF A;  3X26 B;  2JTM A;  4FSS A;  2FHD A;  2D0Q B;  5GAN 7;  3CCS A;  1UE9 A;  3PT9 A;  3HKS A;  4DEX A;  5AYF A;  2JZ2 A;  2RA2 A;  1IRE B;  3HL8 A;  4BDY A;  3GNG A;  2CDT A;  2HD0 A;  4N4G A;  1AWW A;  4GBQ A;  1VQN Q;  1RAB B;  1KHC A;  1IGQ A;  3CD6 A;  1Y0M A;  1EFN A;  1VYT A;  2HCK A;  4X34 A;  3GPL A;  1I81 A;  1VQN T;  4PNO A;  4PJL A;  1VUB A;  1H3H A;  3WVE B;  4J7I A;  2RMO A;  1OZ2 A;  4LDW A;  5LJ3 g;  3NTI A;  5IN1 A;  2C0I A;  2XHC A;  5GAO r;  1OX9 A;  5ECA A;  3MP6 A;  1YHQ Q;  4NL2 A;  1VQO Q;  4M78 C;  2Y4Y A;  1AWX A;  3HHT B;  1M5Q 1;  1YHQ T;  4C92 G;  2RB6 A;  3AHU A;  5KE2 A;  4ZGD B;  1YCS B;  1IHV A;  2LNV A;  2CT3 A;  2M0Y A;  2HSP A;  1OEB A;  3JCM g;  1PRM C;  2MPX C;  2K2V A;  3GBQ A;  5HY6 A;  2QA4 Q;  2M9U A;  4R55 A;  1RUW A;  1FMK A;  2CP6 A;  2FRY A;  4A4G A;  4F7U B;  4IKF A;  2YRD A;  2QA4 T;  1KJW A;  2A28 A;  5KCH A;  2RI2 A;  1Y96 B;  1FWZ A;  2RJF A;  1Y7X A;  1TTH B;  1Q86 R;  3CPW S;  4N0A A;  5GJV B;  1QVF A;  3JCM X;  3UAT A;  1BCM A;  4E7J A;  1F1B B;  4M75 C;  2JM8 A;  3VUZ A;  1AZE A;  1XQH A;  3A1P A;  4ATO A;  1VQ6 Q;  4HXJ A;  2DZ9 A;  3R6N A;  5DY9 A;  9ATC B;  2P4T A;  1QMC A;  5M9O A;  2R57 A;  3I5R A;  2QEX A;  2DNU A;  1UGV A;  1D09 B;  2HKN A;  1WXT A;  2X3X D;  1GBR A;  2E64 A;  4QVD A;  1B34 B;  2PVO B;  2YUO A;  5DLQ E;  1VQ7 Q;  2DBK A;  1ZHI A;  3V8J A;  1CKB A;  1YJN A;  1N6A A;  4KRT A;  3MEV A;  2OTJ T;  4FT2 A;  1E6G A;  2RHZ A;  3H8Z A;  1OX8 A;  1VQ7 T;  1VQ5 A;  4E7H A;  1RLQ C;  2RI3 A;  5FLX E;  1K76 A;  1GCP A;  2LCS A;  2V8I A;  1UJY A;  1KSW A;  2ZPF B;  2QGF B;  3PGG A;  3UT1 A;  3M53 A;  2FPD A;  3OSV A;  4IIO A;  3NMZ C;  4GY5 A;  3VS1 A;  2X4W A;  4PJN A;  3I9Q A;  2VXE A;  1WZO A;  3LH0 A;  3CCU Q;  3QSU A;  5LJ5 g;  2LJ1 A;  3PTA A;  1H64 1;  1G83 A;  3S3M A;  1I5L A;  2DXB A;  4E7L A;  4Z88 A;  2BUD A;  3CCU T;  3UWN A;  2RF0 A;  3CQT A;  1YI2 T;  3JB9 D;  3WVD B;  1I07 A;  2CYZ B;  1WXB A;  1SSH A;  1G3W A;  2WSC E;  1KQS S;  3G6E T;  1UUE A;  3CCJ Q;  4PJJ A;  4DA4 A;  4JRQ A;  3CC2 A;  4C5G A;  1WHL A;  2RH2 A;  3V7C A;  1ACM B;  3M5A A;  3H9N A;  5KYU B;  1BI2 A;  1ABQ A;  3CCJ T;  2JS0 A;  4A4E A;  3M0Q A;  5GAM g;  1OU8 A;  2VXF A;  3F70 A;  2J05 A;  3OYC A;  2RJC A;  3I56 Q;  1NJI C;  3HRT A;  4C8Q F;  3UPU A;  4Y92 A;  1PWT A;  3BY7 A;  2J6O A;  4ANJ A;  2YRV A;  3MEW A;  1VQL A;  1AWJ A;  1QVG A;  3OYF A;  5LJ3 f;  2DMO A;  1R77 A;  2PNI A;  2EQK A;  3ZBD A;  1PKS A;  1RAH B;  3JAM E;  2DRK A;  5I11 A;  3DLL A;  3NHN A;  2LVM A;  2M02 A;  2VV5 A;  4D8D A;  1U5S A;  4M7A B;  2LQ8 A;  2YSQ A;  3V8K A;  4OP0 A;  1YIT T;  3TRE A;  4N0A C;  2VWF A;  2DRM A;  2IPO B;  2O9V A;  1QLY A;  3ZFJ A;  1B3Q A;  2B8A A;  4DBH A;  1WHM A;  2O9S A;  2AKL A;  1IXD A;  4F7U A;  2DL4 A;  1K73 U;  3JCM f;  2MK5 A;  1Y96 A;  3EG1 A;  2COZ A;  3JB9 H;  4KUL A;  5A2Q E;  1RI0 A;  2VVK A;  3JB9 F;  4QQD A;  3X20 B;  2W0Z A;  2P84 A;  2VGN A;  1PRL C;  1KIK A;  1MMA A;  5GMK l;  3LX7 A;  1OV3 A;  3I55 A;  1BI3 A;  2K57 A;  2DA9 A;  2QI2 A;  1B34 A;  5KE3 A;  4IUT A;  3L2Q A;  1JXM A;  3CC7 Q;  4M4Z A;  1R0C B;  1XTD A;  2EJ9 A;  4FW1 A;  4RTV A;  3VS5 A;  3FRN A;  1OUL A;  1VQM Q;  4BI3 A;  1U06 A;  2YXY A;  3MO8 A;  4ZN1 A;  2BE7 D;  2SEM A;  1JJ2 P;  2ENM A;  1VQM T;  1YIJ T;  1B7T A;  1AEY A;  2H3J A;  3CCL Q;  4M78 B;  2JOY A;  2XIC A;  3QKJ A;  2ESW A;  2E6Z A;  2JNG A;  3QO3 A;  4J8O A;  5LJ5 e;  3CCL T;  1WLP B;  4XAX B;  4QVC A;  3FLG A;  3MEU A;  2A7Y A;  5IHK A;  5IXB A;  3L42 A;  2K79 A;  2HKQ B;  4LDU A;  3CCM A;  1YJ9 A;  2K2M A;  2JN0 A;  5GAN h;  4A63 B;  1M90 U;  2MI6 A;  2FPF A;  1OPL A;  1MUZ A;  1D1C A;  1M9S A;  1VOM A;  1VQK T;  2KEA A;  4FIB A;  2GTO A;  2LNH B;  4C92 F;  2EQI A;  2JJ9 A;  2P4R A;  3QWX X;  2W10 A;  1W1F A;  4XU3 A;  2DE0 X;  2K5I A;  2LDM A;  5AT1 B;  3VS6 A;  1M4Z A;  4FSX A;  5D6W A;  2E70 A;  3QZ9 B;  1M8M A;  1X75 C;  2ZPG B;  4M75 B;  4XU0 A;  2QDL A;  5KYU A;  3A8M B;  2CH4 A;  1PC0 A;  4HCB A;  2XKO C;  5FRO A;  2JXB A;  1I8F A;  3VS3 A;  5KYW B;  1NYF A;  1NBE B;  3E2U A;  1BI1 A;  1VYU A;  1K8A C;  3EFS A;  1K0S A;  3G71 Q;  2CZ7 B;  1W2B P;  4FW2 A;  4CI0 C;  2EYX A;  2DLP A;  1KD1 C;  5GAM f;  4KGX B;  2KXD A;  3G71 T;  4DQ2 A;  5LJ3 d;  3NTH A;  2KYM A;  1YJW A;  4BUG A;  3QJ6 A;  1YN8 A;  4M7A A;  1NPR A;  1TOV A;  3SEM A;  1G2B A;  3RKY A;  1LCK A;  1NPP A;  3T9N A;  2YHT A;  1QWF A;  4RTU A;  1TUC A;  1G8X A;  2GF7 A;  2LX7 A;  2V26 A;  1FXX A;  3NGP A;  2EYW A;  2KMT A;  5DM7 R;  5GAN 5;  1UEC A;  2VB6 A;  2KXC A;  3JCM d;  3G4S Q;  2DVE A;  2Y4X A;  4F7U E;  1NZ9 A;  1KC8 U;  5KYY B;  1Q81 C;  5KH6 A;  4LD9 K;  2GCX A;  2DXC A;  3VU3 C;  3MET A;  5L8R E;  4BE2 A;  3ZL7 C;  4F14 A;  3E19 A;  3GNF B;  5GAO p;  2VGM A;  3PNW C;  1RL2 A;  4D8K A;  3S3O A;  4KGZ B;  1SG5 A;  1N8R C;  3HP9 A;  2AK5 A;  3FB9 A;  5GAN 4;  3EGD B;  1K9M R;  1M1F A;  3JRZ A;  1TSF A;  1GCQ C;  1PSF A;  3NFC A;  3EGU A;  4LDV A;  1RAA B;  5J3B A;  4M78 A;  2RK1 A;  1VQP Q;  2CZ6 B;  4AG2 C;  2LQN A;  2DET A;  1Z9Z A;  1TU0 B;  1TG0 A;  3PVL A;  2M16 A;  3RIR A;  4KUI A;  1VQP T;  1WNL A;  2KT8 A;  3HRU A;  3SFM A;  1SRM A;  4OMF B;  3V7S A;  3L2U A;  3HTR A;  1JJ2 S;  4LE9 A;  2VC8 A;  2QQ9 A;  3OS5 A;  3ZEH A;  2MAM A;  2HEQ A;  3OYK A;  4JJC A;  3OBW A;  4XTW A;  1AZG B;  1K8A R;  2ZZD A;  3KUF A;  4F7U G;  2KK4 A;  1T3L A;  2COW A;  2O31 A;  1KD1 R;  2EKO A;  3TU4 K;  1M1K C;  2GQI A;  4B9W A;  3CEY A;  2X4J A;  3OYE A;  2PU9 B;  4JRK A;  2DL7 A;  4J6Y A;  4M75 A;  1WI7 A;  2E3I A;  1R0B G;  4J83 A;  1M1G A;  4XTX A;  2XG8 D;  1UJ0 A;  4O5V A;  5KYW A;  1Q82 C;  1VIF A;  2K4Y A;  4QT7 A;  1VQN A;  1N5Z A;  1H3Z A;  5CR2 A;  2QAZ A;  3JCM J;  2DVJ A;  2ZCF B;  2R58 A;  4JJB A;  4IUP A;  1RAI B;  1VQ9 Q;  3RDV A;  4MMK A;  4L5G A;  1KQ2 A;  2RJE A;  4PFP A;  1Q81 R;  4RKU E;  4IUR A;  3M57 A;  4V2S A;  1VQ9 T;  3PMT A;  2E3H A;  2F5K A;  4C0G A;  2X4X A;  1GBQ A;  1BYM A;  4CC3 A;  1YHQ A;  1VQO A;  3X28 B;  3LWH A;  1WXU A;  1WIE A;  4JS5 A;  5IAY A;  4RTW A;  3VRZ A;  1PKT A;  3M59 A;  4M7A E;  2CP7 A;  4PFZ A;  3C95 A;  4C0F A;  1V29 B;  3CCQ Q;  1X43 A;  4OMM A;  1WQW A;  2EKH A;  3WXM B;  1AT1 B;  2JUF A;  1YP5 A;  2GFU A;  4B9X A;  2KSS A;  4A4H A;  3CCQ T;  4E7K A;  2F5T X;  2PVD B;  3JCM b;  4M7D F;  5KYY A;  2AZS A;  4DBR A;  2DTH A;  2PUO B;  3LWI A;  2QA4 A;  3CBP A;  5I2S A;  2O2O A;  4QVZ A;  2CRE A;  3DB4 A;  3OYM A;  4J9D A;  1NEB A;  2RNA A;  3HFN A;  2FPE A;  1PNJ A;  4ESR A;  4DBF A;  2V8J A;  3VYG A;  5CO7 A;  5GAN 3;  2X4Y A;  1MMG A;  2EGC A;  2LQW A;  2MCN A;  2FO0 A;  4C5H A;  1HJD A;  1QP2 A;  1V1C A;  3C12 A;  3M0U A;  3EGD A;  1VQ6 A;  4NS5 A;  4AFQ C;  2RD1 A;  1W6X A;  3CME T;  1AD5 A;  4JZ3 A;  4J7F A;  4HCC A;  3BW1 A;  1M30 A;  1JO8 A;  4BY6 C;  2PZ1 A;  3PIO A;  3CCR T;  1PCX A;  4PKC C;  3CCS Q;  1VQ7 A;  5CAI A;  2OTL Q;  2YLB A;  1I1J A;  4M78 E;  1ARK A;  1G3Y A;  1K1Z A;  4FYW B;  3J81 E;  4M7A G;  4ELZ C;  3CCS T;  2QAS A;  4M77 D;  2OTL T;  2PTK A;  4C8Q B;  4OMO A;  4Q5W A;  1WDX A;  1NG2 A;  1QWE A;  1WQ7 A;  3LYI A;  3CD6 T;  3P8B B;  2CZ0 B;  1DJ7 B;  1IHW A;  1Q7Y C;  2RHU A;  4XQ3 A;  4Z89 A;  3RR6 A;  2EGE A;  2F69 A;  2ATC B;  1QQJ A;  4JDS A;  5FU7 C;  4JUV A;  2FG0 A;  2EQU A;  2NUT B;  4RCB A;  3OW2 S;  1QCF A;  4Y91 A;  3CCU A;  2OTJ Q;  2M51 A;  4RG2 A;  5GAO m;  3J80 E;  2M0O A;  3MPU B;  4C8Q D;  2XU8 A;  3INZ A;  8ATC B;  2LT4 A;  4ZNX A;  1P92 A;  5GAO n;  1Y07 A;  4J9H A;  1ZQ1 A;  4M75 E;  4L6V 5;  3UA7 A;  3X25 B;  2LP5 A;  4BI4 A;  5CK9 A;  3CCJ A;  4PJO D;  2QQR A;  5LJ3 h;  1UEB A;  1OOT A;  3A8L B;  4FU6 A;  3M0S A;  3URG A;  2MWP A;  2FZC B;  2RQW A;  2JS2 A;  1K4U S;  2DX1 A;  1AWO A;  2RQU A;  2EYQ A;  5FU6 C;  4M78 G;  5LL6 S;  4AMC A;  1YWO A;  3I56 A;  2HDA A;  2EIF A;  2EW3 A;  1SPK A;  2L5Q A;  4RG8 A;  4FYX B;  2AT1 B;  2LJ3 A;  1G5V A;  1Y57 A;  1YI2 Q;  1AHJ B;  2CS7 A;  4M77 F;  3H0H A;  1ZSZ C;  2ROL A;  1QCN A;  3G6E Q;  3TSZ A;  2R5A A;  5CVI A;  4EMK C;  3BFM A;  6AT1 B;  5LJ3 e;  4ME7 A;  3GOX A;  4JPB W;  1D1A A;  4OB2 B;  2LCC A;  4XU2 A;  2MOX A;  5D7U A;  4AFZ C;  1W4S A;  5KCO A;  2QEX T;  1G3S A;  2BTT A;  1GFC A;  4HCZ A;  2WSE E;  4C0Z A;  2ED0 A;  1T3S A; 
#chains in the Genus database with same CATH homology
 1ZUU A;  2KEA A;  2ECZ A;  4OMP A;  2GTO A;  1JEG A;  2LNH B;  2J6F A;  2EQI A;  1GFD A;  2P4R A;  3H41 A;  2CT4 A;  3QWX X;  2W10 A;  2JTE A;  1W1F A;  2DE0 X;  3VS6 A;  2CSI A;  2O88 A;  2KRO A;  1VA7 A;  1VYV A;  4OMN A;  1UHC A;  1M8M A;  2L3Q A;  3I5S A;  2FRW A;  2QDL A;  5I22 A;  2CH4 A;  2D0N A;  2B86 A;  1M27 C;  1BK2 A;  2JXB A;  1UFF A;  4J9I A;  3UA6 A;  3VS3 A;  1NYF A;  2BZ8 A;  4EIK A;  3EG3 A;  2HBW A;  5IHN A;  5EC7 A;  4RTX A;  1NLP C;  1VYU A;  3PVQ A;  3VS2 A;  2JW4 A;  1K0S A;  3I35 A;  2LZ6 B;  1IO6 A;  5HCK A;  1XOV A;  2EYX A;  2KE9 A;  2DLP A;  2KRM A;  4LN2 A;  4RUG A;  2KXD A;  1I0C A;  4J9F A;  2KYM A;  2YUP A;  4ORZ A;  1HD3 A;  2YDL A;  2I0N A;  1YN8 A;  2L3P A;  3SEM A;  2C0O A;  2F2V A;  1G2B A;  5FWC A;  3EHQ A;  3TSW A;  1H92 A;  1LCK A;  4RTY A;  2A37 A;  1QWF A;  2SRC A;  1BU1 A;  4RTU A;  2EYY A;  1TUC A;  2LX7 A;  2CUB A;  2DF6 A;  2BZY A;  2J06 A;  2NUZ A;  3RNJ A;  3NGP A;  2EYW A;  1SEM A;  2JMA A;  1UEC A;  2KXC A;  2CUD A;  2D8H A;  1UTI A;  2DIL A;  1JXO A;  1X69 A;  1X6G A;  5FWB A;  1UHF A;  4HVU A;  2JM9 A;  4FSS A;  4AFU C;  1U3O A;  2V1Q A;  3ZL7 C;  2ED1 A;  1UE9 A;  2J6K A;  4X1V A;  4F14 A;  4DEX A;  1T0H A;  4J9C A;  2CDT A;  1AWW A;  4GBQ A;  2LJ0 A;  1CSK A;  1Y0M A;  2EGA A;  1EFN A;  4J9B A;  1VYT A;  2HCK A;  4D8K A;  2EYZ A;  1GCQ A;  2AK5 A;  1KFZ A;  4J9G A;  1H3H A;  1GCQ C;  2RMO A;  1UG1 A;  3EGU A;  4F16 A;  2C0I A;  2L0A A;  5ECA A;  1SRL A;  4AG2 C;  2EPD A;  2LQN A;  1Z9Z A;  2CSQ A;  1TG0 A;  3PVL A;  1MV3 A;  1AWX A;  4RTT A;  2KT8 A;  1SRM A;  2XMF A;  3LH5 A;  2K3B A;  4LE9 A;  5L23 A;  1YCS B;  2CT3 A;  2M0Y A;  2DBM A;  2HEQ A;  2HSP A;  2NWM A;  3JV3 A;  4JJC A;  1AVZ C;  1OEB A;  1WA7 A;  3M0T A;  1AZG B;  2X3W D;  2BZX A;  2AKK A;  2V1R A;  1PRM C;  1T0J A;  4LUE A;  2D1X A;  1T3L A;  1WFW A;  5FW9 A;  2O31 A;  2L3S A;  3GBQ A;  1YWP A;  2DL5 A;  4HCK A;  3ULR B;  3VS0 A;  2GQI A;  1RUW A;  1FMK A;  2K7A A;  5IXF A;  1ZBJ A;  4AG1 C;  2FRY A;  2KBT A;  1E7O A;  1KJW A;  2A28 A;  4OML A;  2KRN A;  3VRY A;  2DL7 A;  1SHF A;  3EG2 A;  3VS7 A;  1WI7 A;  1E6H A;  5GJV B;  4LUD A;  3UAT A;  2F2W A;  2JM8 A;  1AZE A;  1UJ0 A;  2YT6 A;  4HXJ A;  3VS4 A;  3R6N A;  1NLO C;  2YUQ A;  4QT7 A;  2GTJ A;  1GRI A;  1N5Z A;  2AZV A;  3I5R A;  2DNU A;  1UGV A;  2X3X D;  1K9A A;  1WXT A;  2DVJ A;  1GBR A;  1WX6 A;  2GGR A;  2CH4 W;  2GBQ A;  4JJB A;  2YUO A;  2D8J A;  2L2P A;  1BB9 A;  3EHR A;  2RQR A;  2DBK A;  1CKB A;  4KRT A;  2C0T A;  2KT1 A;  2DL3 A;  1E6G A;  1GBQ A;  4CC3 A;  1JQQ A;  4F17 A;  1RLQ C;  1ZUY A;  2IIM A;  4J9E A;  1WXU A;  1J3T A;  1WIE A;  2RQT A;  1UDL A;  3O5Z A;  4RTW A;  3VRZ A;  1PKT A;  1K76 A;  1GCP A;  2LCS A;  1UJY A;  1X2K A;  2DL8 A;  1M3A A;  1KSW A;  2VKN A;  4GLM A;  2FEI A;  3C0C A;  3EG0 A;  1X43 A;  4OMM A;  2FPD A;  2EKH A;  4IIO A;  3NMZ C;  3VS1 A;  1YP5 A;  3I9Q A;  5IHI A;  1RI9 A;  2DYB A;  1RLP C;  2ROT A;  2AZS A;  4R0K A;  2LJ1 A;  2RN8 A;  2KNB B;  2O2O A;  1G83 A;  1GL5 A;  2CRE A;  2A36 A;  4J9D A;  1NEB A;  4Z88 A;  1ZX6 A;  2RNA A;  4Z8A A;  2FPE A;  3TVT A;  1PNJ A;  3IQL A;  2RF0 A;  3CQT A;  1NEG A;  4ESR A;  2KR3 A;  5GJW B;  1YNZ A;  1I07 A;  1S1N A;  3SHW A;  1WXB A;  1SSH A;  2GNC A;  1FYN A;  4JJD A;  2EGC A;  3U23 A;  2LQW A;  1UUE A;  1W70 A;  2MCN A;  1M3B A;  2DJQ A;  2FO0 A;  1HJD A;  1V1C A;  1A0N B;  3M0U A;  4JZ4 A;  3RBB B;  4AFQ C;  1ABQ A;  1W6X A;  2JS0 A;  1AD5 A;  3M0Q A;  4JZ3 A;  2J05 A;  1M30 A;  3REB B;  1JO8 A;  2PZ1 A;  1ZUK A;  1PHT A;  4Y92 A;  1PWT A;  2J6O A;  2ABL A;  2EBP A;  1I1J A;  1NYG A;  1ARK A;  1AWJ A;  1B07 A;  1K1Z A;  3M0P A;  2KGT A;  2DMO A;  1Z9Q A;  4AFS C;  2PNI A;  1QKX A;  4HVV A;  4HVW A;  1PKS A;  2PTK A;  4OMO A;  1JU5 C;  1WYX A;  2DRK A;  2DM1 A;  1WDX A;  1NG2 A;  3THK A;  5I11 A;  1QWE A;  3NHN A;  2LMJ A;  2K9G A;  4D8D A;  1U5S A;  2YSQ A;  1QKW A;  2VWF A;  2DRM A;  1X27 A;  1MV0 B;  2O9V A;  4CC4 B;  1QLY A;  4Z89 A;  2EGE A;  1B3Q A;  2O9S A;  2AKL A;  4CC2 A;  2FG0 A;  3NPF A;  2DL4 A;  1OPK A;  2OJ2 A;  1QCF A;  1HSQ A;  3EG1 A;  4K11 A;  2M51 A;  1ZLM A;  2VVK A;  3PE0 A;  2K6D A;  2W0Z A;  2E5K A;  3KFV A;  2KYB A;  1PRL C;  4E6R A;  1KIK A;  1AOJ A;  4ZNX A;  4J9H A;  2KRS A;  3UA7 A;  1H8K A;  1OV3 A;  2LP5 A;  4IIM A;  2OI3 A;  2DA9 A;  3H0F A;  1M3C A;  4LNP A;  4CC7 A;  1JXM A;  1OOT A;  3A98 A;  3M0S A;  4OMQ A;  3QWY A;  4M4Z A;  2RQW A;  1K4U S;  2JS2 A;  1X6B A;  4RTV A;  2J7I A;  3VS5 A;  2H8H A;  2DX1 A;  1AWO A;  2RQU A;  1BBZ A;  1X2Q A;  1ABO A;  3REA B;  1YWO A;  2HDA A;  2EW3 A;  1SPK A;  4WCI A;  1U06 A;  2YUN A;  2SEM A;  2LJ3 A;  1Y57 A;  2A08 A;  2ENM A;  1CKA A;  5IH2 A;  1AEY A;  1ZSG A;  3H0I A;  1SHG A;  2OAW A;  3H0H A;  3UF4 A;  2JT4 A;  2ESW A;  2ROL A;  2RQV A;  3TSZ A;  1WLP B;  3M0R A;  1TUD A;  2G6F X;  5IHK A;  5IXB A;  4DEY A;  2K79 A;  2RPN A;  2JMC A;  3FJ5 A;  2MIO A;  4JPB W;  2EVR A;  2F2X A;  4RTZ A;  2MOX A;  4AFZ C;  2K2M A;  1NM7 A;  4A63 B;  2BTT A;  1K0X A;  2FPF A;  1GFC A;  1OPL A;  1MUZ A;  2ED0 A;  1T3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...