5FWBA

Human spectrin sh3 domain d48g, e7f, k60f
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
DETGKFLVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNGRQGFVPAAYVKFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human Spectrin SH3 Domain D48G, E7F, K60F
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords SPECTRIN ALPHA CHAIN, NON-ERYTHROCYTIC 1
total genus 13
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5fwbA00
2EYYA 1V1CA 4RTUA 2LMJA 3TVTA 1SRMA 1ABOA 1WYXA 2DL5A 1E6GA 2EW3A 1VA7A 4JZ4A 2J6FA 4J9CA 1KFZA 2HEQA 4IIMA 2HCKA 4ORZA 1OPKA 4F16A 1CKAA 2VVKA 2EKHA 4FSSA 2KT1A 2LQNA 1JXOA 1NEBA 1SHFA 2O2OA 1S1NA 2FRYA 3H0FA 2GBQA 2M51A 4LUDA 2K2MA 1E6HA 2DL4A 1ZSGA 2GTJA 4AFUC 2O88A 1QWFA 2YT6A 4X1VA 2V1RA 4F17A 1RLQC 2CUDA 1AWXA 2ECZA 3TSZA 2CSIA 2ROLA 2RQRA 1U5SA 2YUQA 1JQQA 3H0HA 2J7IA 2DL3A 3PVQA 1G83A 4LE9A 2CSQA 2IIMA 2L0AA 1PRLC 2FEIA 2GQIA 1M30A 1KSWA 1X6GA 2EGAA 2VKNA 2KXDA 4J9IA 1GRIA 4J9FA 1J3TA 2BZ8A 2X3WD 4RTZA 2DVJA 3THKA 1PHTA 1W1FA 5FWCA 4EIKA 3M0UA 2D8JA 3I5SA 1AZGB 5EC7A 3TSWA 1MV0B 1OEBA 2DE0X 2W0ZA 1GCPA 1HSQA 1M3CA 2EYZA 4QT7A 1VYVA 2LZ6B 1ZBJA 4OMQA 1PRMC 2L2PA 2KXCA 1X2QA 2A37A 3KFVA 4J9HA 4RTVA 2KRMA 2KYBA 3VRYA 1NG2A 2LCSA 2J6OA 4CC2A 5IH2A 2MIOA 1AEYA 1NYGA 1UE9A 2EGCA 1UG1A 2KE9A 2JW4A 4R0KA 2J06A 3PE0A 2A08A 2K7AA 3IQLA 1I1JA 5I11A 2PNIA 3EG2A 4J9DA 4M4ZA 3VS0A 2DJQA 2GNCA 1H92A 3R6NA 2KBTA 4D8KA 2D8HA 1QLYA 2NWMA 4RTYA 2DNUA 2BZXA 1X27A 2DBKA 2EBPA 2EYXA 2FO0A 2XMFA 4AG2C 1N5ZA 4LN2A 3I35A 5HCKA 2CREA 2YDLA 2OAWA 4RTXA 5IHNA 1IO6A 3M0PA 1B3QA 4A63B 1GL5A 2CH4A 1KJWA 4Y92A 1FYNA 1UJ0A 2EPDA 4AFZC 4JJBA 4K11A 2LQWA 3GBQA 2HSPA 1XOVA 2MCNA 4HVWA 2V1QA 1WXBA 1QKXA 4OMNA 2JT4A 2KRNA 4RTTA 4CC3A 5FW9A 1HD3A 2QDLA 2JXBA 2ESWA 2F2VA 1FMKA 1GCQC 2KEAA 2ED1A 4AFSC 2D0NA 2B86A 2K79A 4J9BA 2JM8A 4ESRA 2CH4W 2LJ3A 2DILA 4RTWA 2OI3A 1GFDA 2ABLA 1SEMA 1WDXA 3UA6A 4OMOA 2BZYA 4OMPA 2KR3A 5GJVB 3JV3A 3M0RA 3VS7A 3VS6A 1QWEA 1I0CA 4DEYA 1X69A 3I9QA 2HBWA 1AWJA 2CT4A 2DF6A 3EHRA 1UHCA 2C0IA 2FPEA 1G2BA 4J9EA 3EHQA 1BB9A 3CQTA 1UFFA 2PZ1A 4OMLA 5IHKA 1T3LA 1Y0MA 1T3SA 1K9AA 1UHFA 2BTTA 2G6FX 5ECAA 1HJDA 1GBRA 1RLPC 2KYMA 1H3HA 4LUEA 2K9GA 1QCFA 3I5RA 1U3OA 1GFCA 2JS2A 3NGPA 4WCIA 1U06A 2M0YA 3ZL7C 2RN8A 3O5ZA 3H0IA 2FRWA 2RQWA 1NLPC 1K0SA 1TUCA 4CC4B 1LCKA 2JS0A 5IXFA 2AZVA 1NYFA 2O9SA 1WLPB 2LJ0A 1ZUYA 1WX6A 4HVUA 1JO8A 1CKBA 2YSQA 1RUWA 2KRSA 1WI7A 1M3AA 1ABQA 4DEXA 1GBQA 1MV3A 2MOXA 1OOTA 3M0QA 1ZUKA 1SRLA 2HDAA 2DA9A 2FPFA 2DM1A 4D8DA 1PWTA 2E5KA 2DLPA 4J9GA 4HXJA 4AG1C 4LNPA 1UGVA 2K3BA 2YUNA 1T0JA 2CUBA 2CDTA 3SHWA 3H41A 3EGUA 3C0CA 1RI9A 4JJDA 2DMOA 3REBB 4Z88A 2L3SA 1T0HA 1K76A 3ULRB 2DYBA 1VYUA 1YNZA 2DL8A 1A0NB 2ED0A 1W70A 2C0TA 2LJ1A 1UDLA 3RBBB 1AOJA 1BK2A 1SPKA 1K4US 2L3PA 3VS5A 1CSKA 2FG0A 1JU5C 1M27C 1QKWA 2J6KA 1E7OA 1JEGA 1YCSB 1M3BA 3UF4A 2O31A 2A28A 2SRCA 1Z9ZA 2DX1A 2X3XD 1ARKA 4F14A 2P4RA 4E6RA 1JXMA 1PKSA 2JMCA 2L3QA 1TG0A 3SEMA 1YWOA 2W10A 2PTKA 2FPDA 1WXUA 1H8KA 2GTOA 1UECA 3NMZC 2RNAA 2ROTA 4GBQA 3VRZA 3U23A 2F2XA 1NEGA 2ENMA 1X43A 1OPLA 2JMAA 1KIKA 2KT8A 2YUPA 3NHNA 1SHGA 1AWOA 1M8MA 1WIEA 1VYTA 2AZSA 1I07A 3M0SA 4RUGA 5I22A 1AWWA 2CT3A 2DRKA 2EQIA 1Z9QA 3VS2A 1W6XA 2RPNA 1UTIA 3LH5A 1K1ZA 1BU1A 4OMMA 2DBMA 2H8HA 1AZEA 3VS4A 2O9VA 3UA7A 1GCQA 3NPFA 3QWXX 3QWYA 5FWBA 1WA7A 2C0OA 5GJWB 1WFWA 2AK5A 4KRTA 2EVRA 1YP5A 2YUOA 4HVVA 2RF0A 1EFNA 1B07A 3FJ5A 1YWPA 3VS3A 2EGEA 2K6DA 1NLOC 1K0XA 2I0NA 4IIOA 4AFQC 1AD5A 2GGRA 4ZNXA 2OJ2A 1AVZC 1SSHA 1ZUUA 1WXTA 2VWFA 1ZLMA 2LP5A 4GLMA 2KNBB 3EG1A 2JTEA 1X2KA 2KGTA 4CC7A 4JJCA 2RQVA 3EG3A 3PVLA 2AKLA 2LNHB 1UJYA 2NUZA 3EG0A 1PKTA 3RNJA 1YN8A 2KROA 5L23A 3REAB 2DL7A 4Z89A 2AKKA 2RQTA 1NM7A 1OV3A 2SEMA 4JZ3A 1PNJA 3VS1A 2RQUA 3UATA 1ZX6A 3M0TA 5IHIA 4HCKA 4Z8AA 2A36A 2DRMA 2F2WA 1TUDA 2J05A 2LX7A 4JPBW 1MUZA 5IXBA 1UUEA 1Y57A 2D1XA 1BBZA 3A98A 2JM9A 1X6BA 2EYWA 2RMOA
chains in the Genus database with same CATH superfamily
2EYYA 2DVEA 4M7AF 2LMJA 2EAYA 1TU0B 4ORZA 5GAOr 1H3ZA 3H8ZA 4A53A 1SKUB 1B7TA 3HP9A 4M7AC 2KT1A 1FMWA 1JXOA 4MMLA 5KE3A 2KMTA 1NEBA 5GAMg 1VQ6Q 2QQRA 4C5IA 4V2SA 3HFNA 5I21A 2KDSA 3META 1AWXA 3A8HB 4KGVB 3CCQQ 5KYWB 2EQKA 2ECZA 3QZ9B 2YUQA 1JQQA 1KHIA 2V8IA 2L0AA 3CD6Q 3C95A 3OYNA 1KSWA 5GAMe 4JRIA 4E7JA 1OX9A 1KQ1A 2ZPIB 3MHXA 5KYYA 4JUVA 3SB2A 2QXFA 2R58A 1W1FA 3E2UA 3M0UA 4EIKA 2DEUA 1NJIR 3PT9A 3TSWA 2DE0X 2QK0A 4E7SA 1GCPA 3VU3C 1PSEA 1M3CA 2H3EB 1PD1A 4QT7A 2ZPHB 4M7AB 4N4GA 2LZ6B 1PC0A 1QVGS 2O4XA 4RG8A 1VQ8Q 4HCCA 2E4HA 5IH2A 2FYKA 1W4SA 1NYGA 1UE9A 1K9MR 3CBOA 1UG1A 1VQKQ 4DOWA 4KH0B 2KE9A 2JW4A 3PE0A 2E3IA 4C0ZA 4BI3A 3MCAB 2DJQA 2KBTA 2F5KA 2YLCA 3PIPA 1BCMA 3TCJA 4IUUA 5LJ5d 4M7DE 2RA2A 3JCMV 2K5LA 1IREB 3S3NA 3OA6A 2BZXA 3FLGA 1X27A 2EBPA 2FO0A 4AG2C 2GFAA 3I35A 4RCBA 5HCKA 1EZZB 1VQNT 3CCUQ 3GNFB 4NL2A 3TREA 1Q86U 2MWOA 5IHNA 1IO6A 3M0PA 3VJPA 3EGDB 1VQ6A 2CP3A 4A63B 7AT1B 4DBFA 3JB9D 2P0QA 2LNVA 1VQ9Q 5GMKh 4QQGA 3GIBA 4IURA 2JT4A 4RTTA 2K3YA 4CC3A 5FW9A 1VQ4Q 1VQ7T 4OB1B 4GY5A 3FRNA 3NTIA 4AFSC 2D0NA 4M7AA 4J9BA 1OU8A 2Z0WA 1C6VX 3JCMX 4NL3A 5GAN4 3D7SB 4OMOA 2QA4Q 3VS6A 1QWEA 3I55A 2JOYA 1X69A 2LC4A 3MO8A 3I9QA 2OTJT 5FU7B 2DXBA 1UGPB 2DF6A 2GFUA 1D3BA 2LVMA 2FPEA 3EHQA 4II1A 1KHCA 1U1SA 3HRTA 3G6EA 4KUIA 2LT4A 1PCXA 2G6FX 4B9XA 1GBRA 3JCMh 4R56A 3CCRT 3QUIA 4LUEA 5CKHA 1WZOA 4XTYA 1U3OA 1X75C 2KY9A 1OYXA 2JUFA 4WCIA 4R55A 3EH2A 1OZ3A 3O5ZA 2AIRB 1ZSZC 4M77C 4PFPA 3CC2Q 1VQOQ 2D0QB 2X4YA 8ATCB 2LJ0A 1ZUYA 1RAFB 1I81A 1WX6A 2EQUA 2RD1A 3VYHB 1VQ5Q 3GPLA 2COWA 1YJNQ 1M1KU 4HA8A 3LH0A 2FB7A 4N0AC 4M77D 5C6SA 3L2VA 2KK4A 5FROA 1D3BB 1VQ9A 3M0QA 3JCMd 1SRLA 4L6V5 2DA9A 4OP0A 1KK7A 2DM1A 4D8DA 1PWTA 2DLPA 3CD6A 3KXTA 4HXJA 2K3BA 1JJ2S 3J81E 1T0JA 5GAOn 2CDTA 4BB7A 2LCLA 3EGUA 3C0CA 1FMVA 4JJDA 3REBB 3CCJA 3PMTA 2F1LA 2NLUA 1MMGA 1BI3A 3ULRB 2DERA 3QG1A 4B9WA 3JCMc 4C92D 4OGEA 5GAOq 3BE3A 2PUKB 3M9QA 1AOJA 1M1KC 2HKQB 5KCOA 1Q7YU 1ZHIA 2L3PA 3M58A 2DIQA 2FG0A 3SWNC 3CXCS 1M27C 3X24B 1TWBA 1M3BA 3I55T 2XDDA 4BE0A 1R8OB 5CO7A 1RI0A 2DX1A 1D0ZA 4LDUA 1PKSA 1VQKT 2DK3A 2W10A 3CBMA 2PTKA 1N8RU 1WXUA 4J5YA 4HCBA 3JCMf 1NPRA 4LD6A 3WVEB 2EFIA 4GBQA 2ROTA 3U23A 1WHJA 2ENMA 2LDMA 5GAN6 3M56A 1SHGA 1Q82U 1M8MA 3CMEA 4PJOC 1WIEA 1VYTA 1RAGB 1K9MU 3MP6A 1I07A 3OYBA 4M7DD 2DO3A 4EMGA 4E7ZA 5GANf 2HQXA 5FU6C 2EQIA 1X6OA 3GP8A 3VS2A 3S3MA 3VYGA 3EG9B 2XKOC 1UTIA 4YTLA 3VS4A 3CCLA 1GCQA 4PJOD 2DXTA 1WFWA 2PUOB 3MEVA 3V8LA 1JJ2P 2EVRA 2YUOA 2QGFB 2RF0A 2K57A 1YWPA 5GAOl 4WF2A 4MDWA 4DQ2A 2RJEA 3P8BB 4HCZA 5D6YA 4FYWB 2GGRA 1K8AU 2QG9B 3CCMT 1ZQ1A 2MWPA 2VWFA 4M77E 1WHGA 4OVAA 3NTHA 4GLMA 2KNBB 1TS9A 3CCST 2FZCB 5HKCA 3A5ZB 3PVLA 1WHHA 3RNJA 2JJ9A 2KROA 1XNIA 1AT1B 5L23A 4M77A 6AT1B 3OMCA 4M7DB 2CP2A 4OF1A 2AKKA 2LQKA 4RCCA 3C12A 1NM7A 4FW2A 4PJNA 1QCNA 4CRIA 2RQUA 1M90U 1QP3A 2FZGB 4C92E 4TVRA 5IHIA 1LNXA 3OY9A 3M55A 4HCKA 2JZ2A 2A36A 2OTLT 2A3LA 2E6NA 5A2QE 1TUDA 2LX7A 1XQHA 1Y57A 2DYIA 1OI1A 4X9CA 1U8RA 2WSCE 2JM9A 4C92A 1UGRB 1RAIB 4J7FA 3V7SA 4RTUA 3M54A 5LJ3h 1V76A 1ABOA 1WYXA 2OTLA 4JZ4A 2IPOB 4E7LA 2RO0A 3H9NA 4M78G 1KFZA 2DXCA 4IIMA 5CQYA 2L89A 2HCKA 4BY6C 1D0YA 4GLKA 1WQWA 4F16A 1G3YA 3QHSA 4E47A 1SHFA 4UC4A 2O2OA 2RK1A 3RDVA 3OS2A 2K2MA 4AFUC 3QXEB 3CPWP 5GAN5 1RLQC 2CUDA 2CP5A 3AT1B 3CMEQ 3TSZA 2ROLA 3QJ6A 2XICA 3FIFA 1VQPT 2BIVA 2CSQA 2CS7A 4M7AD 5KYXB 2IIMA 3L1AA 3QYHB 3OW2A 3V7CA 2VKNA 2WSFE 2QAZA 4PNOA 1J3TA 3E9GA 4IUPA 1G5VA 4FW1A 3JB9J 5FWCA 4EDUA 5EC7A 1MV0B 4PJOE 2B8AA 1HSQA 1UGQB 2EYZA 1YJ9A 5DLOA 1WPYA 5CK9A 4JRKA 4CI0C 2DFUA 2CZ1B 1SF9A 2HAXA 2E41A 2ZPBB 1VYVA 5FLXE 2LTOA 4FU6A 3INZA 4PKCC 4PJOA 4OMQA 3JCMW 1I5OB 2VV5A 1X2QA 2A37A 4J9HA 5GAN8 2QQAA 4M75C 1VIFA 4PFZA 4M78B 4CC2A 1YJWA 1YI2Q 2BKDN 1PG5B 4N4HA 1TH7A 1BYMA 2K7AA 3WVDB 3G1JA 1B34B 2PNIA 2RHUA 4M4ZA 3BDUA 1H92A 4LDWA 1MMNA 3M59A 4BDZA 4M75D 1VQ5T 3E1SA 1VQMT 2JNGA 2DNUA 2VASA 3A8OB 2EYXA 3TQ7P 1WGSA 1M1GA 2MAMA 2QEXQ 1KC8C 1BIAA 3G7ZA 4Q5WA 1M1KR 4OB0B 4A54A 1P92A 3I56T 4LDYA 4EMKA 4RMOA 1VQNA 3SWNB 1B3QA 2RJFA 1GL5A 2ZPFB 5KYWA 2CH4A 3QDRB 1KJWA 1YHQQ 5GMKe 3OYCA 3OB9A 4AFZC 5KYXA 2ZGWA 1YJ9Q 4K11A 2LQWA 2H3JA 3CC7T 2CZ0B 1VQOA 2I2LA 1JJ2A 2ZPGB 4L59A 2KRNA 2OX7A 3CCRQ 2RH2A 3V8JA 2QTVA 2O01E 1SSFA 3JCMe 2QDLA 2JXBA 2F2VA 5IT9E 1FMKA 1GCQC 2KEAA 2ED1A 2P84A 2V8KA 2B86A 5D6XA 2VUBA 2JM8A 4ESRA 3G6EQ 2DILA 1V29B 2OAUA 2HMAA 2ZZDA 2ABLA 1NZ9A 4M75B 3ZEHA 2OTJQ 1D1AA 1XTDA 4OMPA 3M0RA 3CCLT 4PJOF 1JB0E 2NYSA 3FB9A 5GAMh 3CMAQ 2QDYB 1VQ7A 1I0CA 4DEYA 1M2VA 1UEBA 3BY7A 5M9OA 2CT4A 1HK9A 1UHCA 2C0IA 4F7UE 1G2BA 1NE8A 2G3RA 1Q81U 1QCOA 2D9TA 2XDPA 2XK0A 1W2BP 1BB9A 4EPCA 4FL6A 4BD3A 1UFFA 1YBYA 5IHKA 3CCMA 3QBYA 5KYUA 2F69A 1RLPC 4BACA 2KYMA 4PJMA 2K9GA 2QASA 1QCFA 3I5RA 1R77A 4L5GA 2VC8A 4FYYB 3X25B 2DETA 2OTLQ 5GMKl 3EH1A 2FRWA 2Y4YA 1NJIC 1M4ZA 2RI5A 3L2UA 5GAMd 4IUVA 3CCMQ 1NYFA 2O9SA 1RADB 4M75E 4FM4B 2EJ9A 4C8QC 3CD6T 3OBWA 5LJ3e 2O4XB 3T9NA 3CPWS 1RUWA 4M75A 3CCET 1WI7A 9ATCB 1YFNA 4N0AA 1IXDA 1GBQA 1VIEA 1MV3A 1KQ2A 1D1CA 3G71T 2HDAA 3OYIA 2E5KA 2CP0A 5GMKm 1I4K1 4LNPA 3LLRA 3CXCP 3M53A 2E1HA 2FHDA 1KD1U 5GANd 5C0MA 2ZAEA 2X9HA 1Y96A 4KULA 4M7AE 2DKGA 1WNLA 1WHKA 4EMKC 2LJ1A 1VQ9T 4P5NA 3RBBB 1H641 4QW2A 1SPKA 4M77F 1YCYA 4VUBA 1CSKA 2GQVA 1ZA2B 4PK4A 3SWNA 3I56Q 3EGDA 2CKKA 2A7YA 2BUDA 3RKYA 1E7OA 2VGMA 1JEGA 3AHUA 4C8QB 3LGLA 2A0FB 2O31A 1TUGB 2A28A 4ME7A 3JB9F 1N9SA 5FRMA 2E70A 4M7DF 2SRCA 4OGCA 1AHJB 1JXMA 3DKMA 2L3QA 1YWOA 3I56A 2MMPA 4F7UF 2NUPA 3FDRA 2ZPEB 1W2BA 3QSUA 1D0XA 3P8HA 1ZA1B 2M0OA 4C92G 4ZGDB 2KSSA 1NEGA 3DB3A 3PIOA 5FRNA 1KIKA 2KT8A 2YUPA 3NHNA 3CC7A 2QEXA 3GLXA 5I22A 5GMKj 2DRKA 1Y96B 1Z9QA 1JBMA 3LH5A 2DPPB 4A4KA 3EG9A 4ZTJA 4E7KA 3WXMB 3LYIA 3OW2S 2O9VA 5FWBA 4HT9A 1IHWA 3GNGA 5GJWB 3QDFA 2QA4A 4ZGJB 4KGZB 5LJ5f 1YP5A 1YIJA 3UPUA 3FJ5A 3VS3A 2EGEA 2HL5C 3JCMQ 2K6DA 1NLOC 3CBPA 1VQNQ 1VQLA 3RERA 1AD5A 1KG1A 1MMAA 3X28B 5I2MA 2RK2A 1VQLT 3RKXA 4Z02A 2LP5A 2KGTA 5LJ3j 3CCSQ 3EG3A 4XTWA 2CGHA 2AKLA 2LNHB 4M75G 4F04B 2NUZA 1PKTA 1YN8A 4ZN1A 5CR2A 3JAME 3HTRA 4Z89A 2X35A 1RACB 3JB9G 1TXQA 1OV3A 2SEMA 1KD1C 2HNIA 3HRSA 3M0TA 5LJ5g 2DTHA 3OS1A 3Q1JA 4RKUE 2DRMA 2F2WA 4JPBW 2J05A 1MUZA 4QKUA 5IXBA 2D1XA 3A98A 3QZ5B 2DZCA 2RQVA 2PVDB 1SRMA 1D09B 2XU8A 2MPXC 2J6FA 4OB3B 3UT1A 3MKDA 3VUZA 3VUBA 4PJOB 2QYZA 1U1TA 4BY6B 2VVKA 4MZPA 2DD4A 1VQPA 1PM3A 5DM7R 4M78D 2LQNA 3M5AA 3L2QA 4PJLA 1S1NA 2MK5A 2GBQA 3H0FA 4LUDA 4C0DC 3SFMA 2DL4A 1YJNT 2EJFA 1QVPA 3X20B 2YXYA 2YT6A 3MPUB 2YRCA 3JB9H 3FJPA 3G6ET 4JDSA 2DIGA 2DEQA 3H0HA 2J7IA 4LE9A 4C8QA 4D6WA 5KYUB 2FEIA 1BI1A 3CCJT 3OYAA 3QKJA 1M30A 4XU3A 3JCMJ 1QW1A 2EGAA 1FX7A 4MMKA 2KAFA 4J9IA 1GRIA 4J9FA 3JCMb 2BZ8A 4C8QE 2X3WD 5HY6A 4O5VA 2D8JA 2BE9B 2D6FA 1AZGB 4IUQA 5AT1B 1KQSA 4M7AG 1YHQT 5LL6S 1YJ9T 5GAOp 3TU4K 1UGSB 1PRMC 2KXCA 3KFVA 4RTVA 2E64A 3VRYA 2LCSA 1ZBXA 2J6OA 4C5EA 1M2VB 2E12A 4J6YA 1QVFA 4PL6A 2J06A 3CCUA 3A1PA 1I1JA 5I11A 3JCMP 3CMAA 4J9DA 3VS0A 3R6NA 2YHTA 2D8HA 2HL3A 1QLYA 2JTFA 2JTMA 3CC2A 1VQ6T 4XTVA 4RTYA 3UWNA 4FCYA 2CP7A 4MZMA 1EIFA 1QMCA 3CPFA 2X4XA 1IHVA 4QVZA 2DBKA 1N5ZA 1DJ7B 4C92C 2RHYA 3F70A 2CREA 2YDLA 1YIJT 3CPWA 1VQ4T 3MEWA 3L42A 1VQ8T 2QQSA 4AT1B 1TOVA 4KUDK 1Q86C 1IB8A 2HSPA 1XOVA 2GCXA 2NUPB 4HVWA 1QKXA 4OMNA 5A0GA 2XDBA 4BI4A 2E3HA 5GANe 2CZ6B 4DBRA 4WTOB 2ESWA 3G71A 5CQXA 4F7UA 4J7IA 2K79A 3VKIA 3UDCA 3HHTB 2LJ3A 2NUTB 4RTWA 2OI3A 3CCVQ 1BI0A 2P0KA 2K4YA 1M1FA 1VQMQ 3CC4T 1R0BG 1HXDA 4F7UG 4E7IA 3CCSA 2WACA 3VS7A 2EQMA 1VQOT 3CCRA 3EFSA 3M4YA 4MZTA 4XU1A 1BI2A 1K9MC 2HQEA 5CKDA 1QVGA 2L8DA 4XQ3A 2WSEE 5DLQE 1K73U 4AMCA 4OMLA 1G3SA 1W2BS 2HBPA 1Y0MA 1T3SA 2BTTA 1RAEB 2E65A 1QVFP 1H3HA 3FEOA 2VB6A 1OULA 2JS2A 1U06A 5J3BA 3EAEA 3ZL7C 5I2SA 1TUCA 2MYSA 1K0SA 1VQPQ 5KH6A 4J6XA 2DJZA 5IXFA 1WLPB 2NUTA 1JO8A 1CKBA 1PSFA 1Q82R 1YITT 2YSQA 1C1AA 2DTIA 2KRSA 1KC8U 3CCLQ 1M3AA 1ABQA 4DEXA 5CCAA 2MOXA 1OOTA 1SG5A 3N5BB 1I8FA 1ZUKA 2COYA 3CEYA 4ELZC 3GOXA 2FPFA 4FT2A 5CIUA 2DXUA 4J9GA 2VYTA 4NOYA 4IKFA 5LJ3d 3ASKA 2CUBA 5A0DA 3BDLA 3SHWA 1RI9A 4JS5A 2L3SA 1Y7XA 2DYBA 1YI2T 2DD5A 4JS4A 2ED0A 3MEUA 1W70A 1WQ7A 1XJWB 2FVUA 2C0TA 3PNWC 1M90R 4X9DA 2C06A 1KC8R 1UDLA 5D6WA 3A8GB 1K73R 4ZN3A 2QTXA 3JSCA 4J83A 1JU5C 2J6KA 3FC3A 2QGGA 4PFOA 3CMAT 1K8AC 2EJGA 1YCSB 1N8RC 3CCEQ 4M78E 2ZCFB 1Z9ZA 3RMQA 2X3XD 4E6RA 2JMCA 2K5IA 3HFOA 3DLMA 1TG0A 3SEMA 1O9SA 4M78A 1QQJA 2HKNA 3KBGA 1LJOA 1Q81C 5AYFA 5GAN7 3A8MB 1UECA 3DB4A 4JLIA 4EMKB 2RNAA 3VRZA 3E19A 4N4IA 2M9UA 1X43A 2Y4XA 3V8KA 3LX7A 4HT8A 5KYNA 5LJ5j 1MGQA 4ANJA 4IUTA 1G8XA 1AWOA 2EIFA 2E10A 4BI8B 2QI2A 2E6ZA 2AZSA 3CC7Q 3J80E 3M0SA 4RUGA 1AWWA 2CT3A 4C8QD 3EFOB 1M2OA 1VQ4A 5FU7C 3MEAA 4A4FA 3X26B 5LJ3g 1UB4A 4OMMA 1VQ5A 1AZEA 3OYHA 1BKBA 1OX8A 3UA7A 3PGGA 5IN1A 1WA7A 2C0OA 4JRPA 2FL7A 1B07A 2R5MA 1YIJQ 4C0GA 4LD9K 3G71Q 2KQWA 1YJWT 2X51A 4AFQC 2HD0A 1FWZA 3L2RA 2HZYA 2OJ2A 2PQWA 1ZUUA 2LRQA 3CC4A 1WJSA 2LCCA 3G4ST 4Y28E 2VGNA 4CC7A 3EG1A 2JTEA 2LT1A 3OYMA 4C5GA 1VQ7Q 1ACMB 2QQBA 4XTUA 2PVOB 1S72A 2RQTA 3DLLA 3A8LB 1KD1R 1QVFS 3QO3A 1NJIU 5D7UA 1MNEA 2EKOA 4JZ3A 3CCVT 1PNJA 3QIIA 4C0DB 3VS1A 1G3TA 3PTAA 3CXCA 1Q82C 2EWNA 1F1BB 2YWWA 2EYQA 3PMIA 2EYWA 3QJYA 4C92F 1V1CA 3TVTA 1MMDA 3CCUT 2DL5A 1E6GA 2EW3A 1M9SA 1VA7A 4XAXB 1ZSZB 4J9CA 1PD0A 2HEQA 4JLGA 5J26A 5GAMj 1Y07A 1OPKA 1CKAA 2MI6A 2EKHA 4FSSA 4PLLA 3TEEA 2P4TA 3OYEA 4BE1A 2FRYA 2M51A 3RIRA 1E6HA 2AT1B 3ME9A 1GXIE 4KGXB 1N6AA 1ZSGA 2GTJA 2O88A 1QWFA 4M7DC 4X1VA 2V1RA 4PLIA 4F17A 5KCHA 3CCQT 1VQLQ 1YJNA 2CSIA 2RQRA 1U5SA 2XIDA 5A0LA 2DL3A 5CKBA 3PVQA 1K8AR 1G83A 3CCQA 4X34A 4M78C 3P8DA 1RAHB 1LVKA 1PRLC 3E9FA 1MNDA 4A4GA 2GQIA 1NPPA 1R0CB 1RAAB 1X6GA 2KXDA 5GAN2 2YLBA 2RB6A 4RTZA 1YJWQ 2DVJA 2QQ9A 4ZGEB 1VOMA 3THKA 4QVCA 5GANj 1PHTA 4B6MA 4LDXA 3I5SA 3RKWA 2V8JA 1OEBA 2W0ZA 4XU2A 1TTHB 3QPHA 3URGA 4XK8E 3CCEA 3L2ZA 1ZBJA 5HK3A 3OYFA 2L2PA 4NS5A 5DY9A 3OSVA 1I5LA 2KRMA 2KYBA 1NG2A 5J39A 4FYVB 1OU9A 2MIOA 1AEYA 3CMET 1VQ8A 3HSBA 2EGCA 2XI9A 4R0KA 2A08A 2ATCB 4C8QF 3IQLA 2EQJA 1WJRA 3CCVA 3EG2A 3I55Q 3OYYA 4OB2B 2GNCA 3OMGA 1ZSZA 5KE2A 4D8KA 4J8OA 2NWMA 1TSFA 1EX4A 3OS5A 1LOJA 3OQ5A 4BE2A 4HKEA 5GANh 2CP6A 3ZFJA 2E5QA 2XMFA 3HKSA 4LN2A 1K73C 3CC2T 2CZ7B 2RJCA 1YITQ 1IGQA 4FT4A 2OAWA 3OYKA 4RTXA 1RL2A 5CKFA 4M7DA 3RMSA 4PJOG 4DBHA 4Y92A 1FYNA 2L5QA 1UJ0A 2RHIA 3OYLA 4MDXA 2RHZA 2EPDA 4M75F 4XU0A 5LJ3f 4JJBA 2RJDA 5FU6B 3GBQA 2VXEA 2RHXA 2DZ9A 2AHJB 3EGXB 2MCNA 2PVGB 5HK0A 4JRQA 4KBMB 4FYXB 2V1QA 1WXBA 4ZTFA 2QEXT 4DOVA 1HD3A 3G4SA 4BUGA 1X01A 2MF2A 5LJ5h 1NBEB 1JRIA 2R5AA 4EMHA 2CH4W 3CCJQ 4PJJA 1GFDA 4A4HA 1SEMA 3RUXA 1WDXA 3G4SQ 3UA6A 2BZYA 2KR3A 2KVQG 5GJVB 3JV3A 4JJNK 4M7DG 4LXCA 2HBWA 1AWJA 3EHRA 1VQKA 5IAYA 1O75A 4J9EA 1N27A 1LPLA 3CQTA 2PZ1A 1Q86R 1T3LA 1OZ2A 3EFRA 3KUFA 1M5Q1 2IG0A 1D1BA 2XHCA 3ER0A 1K9AA 1UHFA 3PFSA 4OMFB 5ECAA 1HJDA 4LDVA 5EG2A 2COZA 4RG2A 3OYJA 3JB9I 3RESA 1MHNA 1GFCA 3NGPA 5CKEA 2M0YA 5KYYB 1YI2A 1IZ6A 4Y91A 2RN8A 3LGFA 3MJXA 5CAIA 3H0IA 3QYGB 2RQWA 1NLPC 1VUBA 5GAMf 4CC4B 5GAOm 1LCKA 3M4GA 2YRDA 2JS0A 2AZVA 1M8VA 2X4JA 1N8RR 4FIBA 4HVUA 1IRXA 4FSXA 1IGUA 4M77G 2JVVA 3S6WA 4QQ6A 3EFOA 1QP2A 3OW2P 3CC4Q 1YITA 2FZKB 4F7UB 4E2FB 1S72T 3OYDA 4J6WA 1HYOA 2XG8D 4AG1C 3LWHA 1UGVA 3JCMg 2YUNA 1WHMA 3H41A 3MP8A 3LWIA 2DMOA 4Z88A 1YHQA 3HPWA 1T0HA 1K76A 2RM4A 1VYUA 3L2WA 1YNZA 2DL8A 2HSEB 3HL8A 3SD4A 4ELYC 1A0NB 2R57A 4BDYA 3OSSC 1M90C 1BK2A 1K4US 3VS5A 3BFMA 1QKWA 2BE7D 3O8VA 3OS0A 4C8QG 3H6ZA 3V7RA 3UF4A 1BIBA 1ARKA 4F14A 2P4RA 2PU9B 2YRVA 8AT1B 2FPDA 3M57A 2QA4T 1N9RA 2M1HA 4XTZA 2HQHA 1H8KA 2GTOA 1Q81R 4C92B 1QVGP 3OYGA 3NMZC 2P0PA 2K3XA 4M77B 2X4WA 2F2XA 2GF7A 1C0MA 1B34A 4E7HA 1OPLA 2JMAA 3C4SA 3HRUA 3NTKA 5LJ5e 4A4EA 3ZBDA 2V26A 4DBQA 3EGXA 3NFCA 2CYZB 2XD0A 1W6XA 2RPNA 3R6OA 1RABB 4DA4A 2M02A 1K1ZA 5GMKi 1BU1A 2M16A 3BW1A 1Q7YC 4C0FA 2IVWA 5L8RE 2DBMA 2H8HA 2KI7A 3JRZA 3S3OA 3NPFA 3QWXX 3QWYA 3J7AF 2AK5A 4KRTA 4HVVA 4C5HA 3C94A 1VQMA 1EFNA 4M78F 3OBYA 5GAN3 1S72Q 4QVDA 2LQ8A 1KQSS 1K0XA 2I0NA 2F5TX 4IIOA 2K5FA 4KT0E 4ZNXA 1AVZC 1SSHA 1WXTA 1G3WA 3GF5A 2DAQA 2JN0A 2RI2A 3MP1A 1ZLMA 1BCOA 1X2KA 2K2VA 4JJCA 4ATOA 4XTXA 1UJYA 3VV0A 3EG0A 2VXFA 3RR6A 1Q95G 2Y90A 5GANg 2OTJA 3REAB 4KH1B 2RI3A 2DL7A 4O6JA 1KQSP 1WHLA 3SDZA 1Y71A 2DTOA 1WJQA 5CVIA 3UATA 1ZX6A 2LX9A 4Z8AA 2L3RA 1FXXA 3LW5E 1Q7YR 1OQKA 1UUEA 4QQDA 1BBZA 1X6BA 2RMOA
chains in the Genus database with same CATH topology
2EYYA 1V1CA 4RTUA 2LMJA 3TVTA 1SRMA 1ABOA 1WYXA 2DL5A 1E6GA 2EW3A 1VA7A 4JZ4A 2J6FA 4J9CA 1KFZA 2HEQA 4IIMA 2HCKA 4ORZA 1OPKA 4F16A 1CKAA 2VVKA 2EKHA 4FSSA 2KT1A 2LQNA 1JXOA 1NEBA 1SHFA 2O2OA 1S1NA 2FRYA 3H0FA 2GBQA 2M51A 4LUDA 2K2MA 1E6HA 2DL4A 1ZSGA 2GTJA 4AFUC 2O88A 1QWFA 2YT6A 4X1VA 2V1RA 4F17A 1RLQC 2CUDA 1AWXA 2ECZA 3TSZA 2CSIA 2ROLA 2RQRA 1U5SA 2YUQA 1JQQA 3H0HA 2J7IA 2DL3A 3PVQA 1G83A 4LE9A 2CSQA 2IIMA 2L0AA 1PRLC 2FEIA 2GQIA 1M30A 1KSWA 1X6GA 2EGAA 2VKNA 2KXDA 4J9IA 1GRIA 4J9FA 1J3TA 2BZ8A 2X3WD 4RTZA 2DVJA 3THKA 1PHTA 1W1FA 5FWCA 4EIKA 3M0UA 2D8JA 3I5SA 1AZGB 5EC7A 3TSWA 1MV0B 1OEBA 2DE0X 2W0ZA 1GCPA 1HSQA 1M3CA 2EYZA 4QT7A 1VYVA 2LZ6B 1ZBJA 4OMQA 1PRMC 2L2PA 2KXCA 1X2QA 2A37A 3KFVA 4J9HA 4RTVA 2KRMA 2KYBA 3VRYA 1NG2A 2LCSA 2J6OA 4CC2A 5IH2A 2MIOA 1AEYA 1NYGA 1UE9A 2EGCA 1UG1A 2KE9A 2JW4A 4R0KA 2J06A 3PE0A 2A08A 2K7AA 3IQLA 1I1JA 5I11A 2PNIA 3EG2A 4J9DA 4M4ZA 3VS0A 2DJQA 2GNCA 1H92A 3R6NA 2KBTA 4D8KA 2D8HA 1QLYA 2NWMA 4RTYA 2DNUA 2BZXA 1X27A 2DBKA 2EBPA 2EYXA 2FO0A 2XMFA 4AG2C 1N5ZA 4LN2A 3I35A 5HCKA 2CREA 2YDLA 2OAWA 4RTXA 5IHNA 1IO6A 3M0PA 1B3QA 4A63B 1GL5A 2CH4A 1KJWA 4Y92A 1FYNA 1UJ0A 2EPDA 4AFZC 4JJBA 4K11A 2LQWA 3GBQA 2HSPA 1XOVA 2MCNA 4HVWA 2V1QA 1WXBA 1QKXA 4OMNA 2JT4A 2KRNA 4RTTA 4CC3A 5FW9A 1HD3A 2QDLA 2JXBA 2ESWA 2F2VA 1FMKA 1GCQC 2KEAA 2ED1A 4AFSC 2D0NA 2B86A 2K79A 4J9BA 2JM8A 4ESRA 2CH4W 2LJ3A 2DILA 4RTWA 2OI3A 1GFDA 2ABLA 1SEMA 1WDXA 3UA6A 4OMOA 2BZYA 4OMPA 2KR3A 5GJVB 3JV3A 3M0RA 3VS7A 3VS6A 1QWEA 1I0CA 4DEYA 1X69A 3I9QA 2HBWA 1AWJA 2CT4A 2DF6A 3EHRA 1UHCA 2C0IA 2FPEA 1G2BA 4J9EA 3EHQA 1BB9A 3CQTA 1UFFA 2PZ1A 4OMLA 5IHKA 1T3LA 1Y0MA 1T3SA 1K9AA 1UHFA 2BTTA 2G6FX 5ECAA 1HJDA 1GBRA 1RLPC 2KYMA 1H3HA 4LUEA 2K9GA 1QCFA 3I5RA 1U3OA 1GFCA 2JS2A 3NGPA 4WCIA 1U06A 2M0YA 3ZL7C 2RN8A 3O5ZA 3H0IA 2FRWA 2RQWA 1NLPC 1K0SA 1TUCA 4CC4B 1LCKA 2JS0A 5IXFA 2AZVA 1NYFA 2O9SA 1WLPB 2LJ0A 1ZUYA 1WX6A 4HVUA 1JO8A 1CKBA 2YSQA 1RUWA 2KRSA 1WI7A 1M3AA 1ABQA 4DEXA 1GBQA 1MV3A 2MOXA 1OOTA 3M0QA 1ZUKA 1SRLA 2HDAA 2DA9A 2FPFA 2DM1A 4D8DA 1PWTA 2E5KA 2DLPA 4J9GA 4HXJA 4AG1C 4LNPA 1UGVA 2K3BA 2YUNA 1T0JA 2CUBA 2CDTA 3SHWA 3H41A 3EGUA 3C0CA 1RI9A 4JJDA 2DMOA 3REBB 4Z88A 2L3SA 1T0HA 1K76A 3ULRB 2DYBA 1VYUA 1YNZA 2DL8A 1A0NB 2ED0A 1W70A 2C0TA 2LJ1A 1UDLA 3RBBB 1AOJA 1BK2A 1SPKA 1K4US 2L3PA 3VS5A 1CSKA 2FG0A 1JU5C 1M27C 1QKWA 2J6KA 1E7OA 1JEGA 1YCSB 1M3BA 3UF4A 2O31A 2A28A 2SRCA 1Z9ZA 2DX1A 2X3XD 1ARKA 4F14A 2P4RA 4E6RA 1JXMA 1PKSA 2JMCA 2L3QA 1TG0A 3SEMA 1YWOA 2W10A 2PTKA 2FPDA 1WXUA 1H8KA 2GTOA 1UECA 3NMZC 2RNAA 2ROTA 4GBQA 3VRZA 3U23A 2F2XA 1NEGA 2ENMA 1X43A 1OPLA 2JMAA 1KIKA 2KT8A 2YUPA 3NHNA 1SHGA 1AWOA 1M8MA 1WIEA 1VYTA 2AZSA 1I07A 3M0SA 4RUGA 5I22A 1AWWA 2CT3A 2DRKA 2EQIA 1Z9QA 3VS2A 1W6XA 2RPNA 1UTIA 3LH5A 1K1ZA 1BU1A 4OMMA 2DBMA 2H8HA 1AZEA 3VS4A 2O9VA 3UA7A 1GCQA 3NPFA 3QWXX 3QWYA 5FWBA 1WA7A 2C0OA 5GJWB 1WFWA 2AK5A 4KRTA 2EVRA 1YP5A 2YUOA 4HVVA 2RF0A 1EFNA 1B07A 3FJ5A 1YWPA 3VS3A 2EGEA 2K6DA 1NLOC 1K0XA 2I0NA 4IIOA 4AFQC 1AD5A 2GGRA 4ZNXA 2OJ2A 1AVZC 1SSHA 1ZUUA 1WXTA 2VWFA 1ZLMA 2LP5A 4GLMA 2KNBB 3EG1A 2JTEA 1X2KA 2KGTA 4CC7A 4JJCA 2RQVA 3EG3A 3PVLA 2AKLA 2LNHB 1UJYA 2NUZA 3EG0A 1PKTA 3RNJA 1YN8A 2KROA 5L23A 3REAB 2DL7A 4Z89A 2AKKA 2RQTA 1NM7A 1OV3A 2SEMA 4JZ3A 1PNJA 3VS1A 2RQUA 3UATA 1ZX6A 3M0TA 5IHIA 4HCKA 4Z8AA 2A36A 2DRMA 2F2WA 1TUDA 2J05A 2LX7A 4JPBW 1MUZA 5IXBA 1UUEA 1Y57A 2D1XA 1BBZA 3A98A 2JM9A 1X6BA 2EYWA 2RMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYY A;  1V1C A;  4RTU A;  2LMJ A;  3TVT A;  1SRM A;  1ABO A;  1WYX A;  2DL5 A;  1E6G A;  2EW3 A;  1VA7 A;  4JZ4 A;  2J6F A;  4J9C A;  1KFZ A;  2HEQ A;  4IIM A;  2HCK A;  4ORZ A;  1OPK A;  4F16 A;  1CKA A;  2VVK A;  2EKH A;  4FSS A;  2KT1 A;  2LQN A;  1JXO A;  1NEB A;  1SHF A;  2O2O A;  1S1N A;  2FRY A;  3H0F A;  2GBQ A;  2M51 A;  4LUD A;  2K2M A;  1E6H A;  2DL4 A;  1ZSG A;  2GTJ A;  4AFU C;  2O88 A;  1QWF A;  2YT6 A;  4X1V A;  2V1R A;  4F17 A;  1RLQ C;  2CUD A;  1AWX A;  2ECZ A;  3TSZ A;  2CSI A;  2ROL A;  2RQR A;  1U5S A;  2YUQ A;  1JQQ A;  3H0H A;  2J7I A;  2DL3 A;  3PVQ A;  1G83 A;  4LE9 A;  2CSQ A;  2IIM A;  2L0A A;  1PRL C;  2FEI A;  2GQI A;  1M30 A;  1KSW A;  1X6G A;  2EGA A;  2VKN A;  2KXD A;  4J9I A;  1GRI A;  4J9F A;  1J3T A;  2BZ8 A;  2X3W D;  4RTZ A;  2DVJ A;  3THK A;  1PHT A;  1W1F A;  5FWC A;  4EIK A;  3M0U A;  2D8J A;  3I5S A;  1AZG B;  5EC7 A;  3TSW A;  1MV0 B;  1OEB A;  2DE0 X;  2W0Z A;  1GCP A;  1HSQ A;  1M3C A;  2EYZ A;  4QT7 A;  1VYV A;  2LZ6 B;  1ZBJ A;  4OMQ A;  1PRM C;  2L2P A;  2KXC A;  1X2Q A;  2A37 A;  3KFV A;  4J9H A;  4RTV A;  2KRM A;  2KYB A;  3VRY A;  1NG2 A;  2LCS A;  2J6O A;  4CC2 A;  5IH2 A;  2MIO A;  1AEY A;  1NYG A;  1UE9 A;  2EGC A;  1UG1 A;  2KE9 A;  2JW4 A;  4R0K A;  2J06 A;  3PE0 A;  2A08 A;  2K7A A;  3IQL A;  1I1J A;  5I11 A;  2PNI A;  3EG2 A;  4J9D A;  4M4Z A;  3VS0 A;  2DJQ A;  2GNC A;  1H92 A;  3R6N A;  2KBT A;  4D8K A;  2D8H A;  1QLY A;  2NWM A;  4RTY A;  2DNU A;  2BZX A;  1X27 A;  2DBK A;  2EBP A;  2EYX A;  2FO0 A;  2XMF A;  4AG2 C;  1N5Z A;  4LN2 A;  3I35 A;  5HCK A;  2CRE A;  2YDL A;  2OAW A;  4RTX A;  5IHN A;  1IO6 A;  3M0P A;  1B3Q A;  4A63 B;  1GL5 A;  2CH4 A;  1KJW A;  4Y92 A;  1FYN A;  1UJ0 A;  2EPD A;  4AFZ C;  4JJB A;  4K11 A;  2LQW A;  3GBQ A;  2HSP A;  1XOV A;  2MCN A;  4HVW A;  2V1Q A;  1WXB A;  1QKX A;  4OMN A;  2JT4 A;  2KRN A;  4RTT A;  4CC3 A;  5FW9 A;  1HD3 A;  2QDL A;  2JXB A;  2ESW A;  2F2V A;  1FMK A;  1GCQ C;  2KEA A;  2ED1 A;  4AFS C;  2D0N A;  2B86 A;  2K79 A;  4J9B A;  2JM8 A;  4ESR A;  2CH4 W;  2LJ3 A;  2DIL A;  4RTW A;  2OI3 A;  1GFD A;  2ABL A;  1SEM A;  1WDX A;  3UA6 A;  4OMO A;  2BZY A;  4OMP A;  2KR3 A;  5GJV B;  3JV3 A;  3M0R A;  3VS7 A;  3VS6 A;  1QWE A;  1I0C A;  4DEY A;  1X69 A;  3I9Q A;  2HBW A;  1AWJ A;  2CT4 A;  2DF6 A;  3EHR A;  1UHC A;  2C0I A;  2FPE A;  1G2B A;  4J9E A;  3EHQ A;  1BB9 A;  3CQT A;  1UFF A;  2PZ1 A;  4OML A;  5IHK A;  1T3L A;  1Y0M A;  1T3S A;  1K9A A;  1UHF A;  2BTT A;  2G6F X;  5ECA A;  1HJD A;  1GBR A;  1RLP C;  2KYM A;  1H3H A;  4LUE A;  2K9G A;  1QCF A;  3I5R A;  1U3O A;  1GFC A;  2JS2 A;  3NGP A;  4WCI A;  1U06 A;  2M0Y A;  3ZL7 C;  2RN8 A;  3O5Z A;  3H0I A;  2FRW A;  2RQW A;  1NLP C;  1K0S A;  1TUC A;  4CC4 B;  1LCK A;  2JS0 A;  5IXF A;  2AZV A;  1NYF A;  2O9S A;  1WLP B;  2LJ0 A;  1ZUY A;  1WX6 A;  4HVU A;  1JO8 A;  1CKB A;  2YSQ A;  1RUW A;  2KRS A;  1WI7 A;  1M3A A;  1ABQ A;  4DEX A;  1GBQ A;  1MV3 A;  2MOX A;  1OOT A;  3M0Q A;  1ZUK A;  1SRL A;  2HDA A;  2DA9 A;  2FPF A;  2DM1 A;  4D8D A;  1PWT A;  2E5K A;  2DLP A;  4J9G A;  4HXJ A;  4AG1 C;  4LNP A;  1UGV A;  2K3B A;  2YUN A;  1T0J A;  2CUB A;  2CDT A;  3SHW A;  3H41 A;  3EGU A;  3C0C A;  1RI9 A;  4JJD A;  2DMO A;  3REB B;  4Z88 A;  2L3S A;  1T0H A;  1K76 A;  3ULR B;  2DYB A;  1VYU A;  1YNZ A;  2DL8 A;  1A0N B;  2ED0 A;  1W70 A;  2C0T A;  2LJ1 A;  1UDL A;  3RBB B;  1AOJ A;  1BK2 A;  1SPK A;  1K4U S;  2L3P A;  3VS5 A;  1CSK A;  2FG0 A;  1JU5 C;  1M27 C;  1QKW A;  2J6K A;  1E7O A;  1JEG A;  1YCS B;  1M3B A;  3UF4 A;  2O31 A;  2A28 A;  2SRC A;  1Z9Z A;  2DX1 A;  2X3X D;  1ARK A;  4F14 A;  2P4R A;  4E6R A;  1JXM A;  1PKS A;  2JMC A;  2L3Q A;  1TG0 A;  3SEM A;  1YWO A;  2W10 A;  2PTK A;  2FPD A;  1WXU A;  1H8K A;  2GTO A;  1UEC A;  3NMZ C;  2RNA A;  2ROT A;  4GBQ A;  3VRZ A;  3U23 A;  2F2X A;  1NEG A;  2ENM A;  1X43 A;  1OPL A;  2JMA A;  1KIK A;  2KT8 A;  2YUP A;  3NHN A;  1SHG A;  1AWO A;  1M8M A;  1WIE A;  1VYT A;  2AZS A;  1I07 A;  3M0S A;  4RUG A;  5I22 A;  1AWW A;  2CT3 A;  2DRK A;  2EQI A;  1Z9Q A;  3VS2 A;  1W6X A;  2RPN A;  1UTI A;  3LH5 A;  1K1Z A;  1BU1 A;  4OMM A;  2DBM A;  2H8H A;  1AZE A;  3VS4 A;  2O9V A;  3UA7 A;  1GCQ A;  3NPF A;  3QWX X;  3QWY A;  5FWB A;  1WA7 A;  2C0O A;  5GJW B;  1WFW A;  2AK5 A;  4KRT A;  2EVR A;  1YP5 A;  2YUO A;  4HVV A;  2RF0 A;  1EFN A;  1B07 A;  3FJ5 A;  1YWP A;  3VS3 A;  2EGE A;  2K6D A;  1NLO C;  1K0X A;  2I0N A;  4IIO A;  4AFQ C;  1AD5 A;  2GGR A;  4ZNX A;  2OJ2 A;  1AVZ C;  1SSH A;  1ZUU A;  1WXT A;  2VWF A;  1ZLM A;  2LP5 A;  4GLM A;  2KNB B;  3EG1 A;  2JTE A;  1X2K A;  2KGT A;  4CC7 A;  4JJC A;  2RQV A;  3EG3 A;  3PVL A;  2AKL A;  2LNH B;  1UJY A;  2NUZ A;  3EG0 A;  1PKT A;  3RNJ A;  1YN8 A;  2KRO A;  5L23 A;  3REA B;  2DL7 A;  4Z89 A;  2AKK A;  2RQT A;  1NM7 A;  1OV3 A;  2SEM A;  4JZ3 A;  1PNJ A;  3VS1 A;  2RQU A;  3UAT A;  1ZX6 A;  3M0T A;  5IHI A;  4HCK A;  4Z8A A;  2A36 A;  2DRM A;  2F2W A;  1TUD A;  2J05 A;  2LX7 A;  4JPB W;  1MUZ A;  5IXB A;  1UUE A;  1Y57 A;  2D1X A;  1BBZ A;  3A98 A;  2JM9 A;  1X6B A;  2EYW A;  2RMO A; 
#chains in the Genus database with same CATH topology
 2EYY A;  2DVE A;  4M7A F;  2LMJ A;  2EAY A;  1TU0 B;  4ORZ A;  5GAO r;  1H3Z A;  3H8Z A;  4A53 A;  1SKU B;  1B7T A;  3HP9 A;  4M7A C;  2KT1 A;  1FMW A;  1JXO A;  4MML A;  5KE3 A;  2KMT A;  1NEB A;  5GAM g;  1VQ6 Q;  2QQR A;  4C5I A;  4V2S A;  3HFN A;  5I21 A;  2KDS A;  3MET A;  1AWX A;  3A8H B;  4KGV B;  3CCQ Q;  5KYW B;  2EQK A;  2ECZ A;  3QZ9 B;  2YUQ A;  1JQQ A;  1KHI A;  2V8I A;  2L0A A;  3CD6 Q;  3C95 A;  3OYN A;  1KSW A;  5GAM e;  4JRI A;  4E7J A;  1OX9 A;  1KQ1 A;  2ZPI B;  3MHX A;  5KYY A;  4JUV A;  3SB2 A;  2QXF A;  2R58 A;  1W1F A;  3E2U A;  3M0U A;  4EIK A;  2DEU A;  1NJI R;  3PT9 A;  3TSW A;  2DE0 X;  2QK0 A;  4E7S A;  1GCP A;  3VU3 C;  1PSE A;  1M3C A;  2H3E B;  1PD1 A;  4QT7 A;  2ZPH B;  4M7A B;  4N4G A;  2LZ6 B;  1PC0 A;  1QVG S;  2O4X A;  4RG8 A;  1VQ8 Q;  4HCC A;  2E4H A;  5IH2 A;  2FYK A;  1W4S A;  1NYG A;  1UE9 A;  1K9M R;  3CBO A;  1UG1 A;  1VQK Q;  4DOW A;  4KH0 B;  2KE9 A;  2JW4 A;  3PE0 A;  2E3I A;  4C0Z A;  4BI3 A;  3MCA B;  2DJQ A;  2KBT A;  2F5K A;  2YLC A;  3PIP A;  1BCM A;  3TCJ A;  4IUU A;  5LJ5 d;  4M7D E;  2RA2 A;  3JCM V;  2K5L A;  1IRE B;  3S3N A;  3OA6 A;  2BZX A;  3FLG A;  1X27 A;  2EBP A;  2FO0 A;  4AG2 C;  2GFA A;  3I35 A;  4RCB A;  5HCK A;  1EZZ B;  1VQN T;  3CCU Q;  3GNF B;  4NL2 A;  3TRE A;  1Q86 U;  2MWO A;  5IHN A;  1IO6 A;  3M0P A;  3VJP A;  3EGD B;  1VQ6 A;  2CP3 A;  4A63 B;  7AT1 B;  4DBF A;  3JB9 D;  2P0Q A;  2LNV A;  1VQ9 Q;  5GMK h;  4QQG A;  3GIB A;  4IUR A;  2JT4 A;  4RTT A;  2K3Y A;  4CC3 A;  5FW9 A;  1VQ4 Q;  1VQ7 T;  4OB1 B;  4GY5 A;  3FRN A;  3NTI A;  4AFS C;  2D0N A;  4M7A A;  4J9B A;  1OU8 A;  2Z0W A;  1C6V X;  3JCM X;  4NL3 A;  5GAN 4;  3D7S B;  4OMO A;  2QA4 Q;  3VS6 A;  1QWE A;  3I55 A;  2JOY A;  1X69 A;  2LC4 A;  3MO8 A;  3I9Q A;  2OTJ T;  5FU7 B;  2DXB A;  1UGP B;  2DF6 A;  2GFU A;  1D3B A;  2LVM A;  2FPE A;  3EHQ A;  4II1 A;  1KHC A;  1U1S A;  3HRT A;  3G6E A;  4KUI A;  2LT4 A;  1PCX A;  2G6F X;  4B9X A;  1GBR A;  3JCM h;  4R56 A;  3CCR T;  3QUI A;  4LUE A;  5CKH A;  1WZO A;  4XTY A;  1U3O A;  1X75 C;  2KY9 A;  1OYX A;  2JUF A;  4WCI A;  4R55 A;  3EH2 A;  1OZ3 A;  3O5Z A;  2AIR B;  1ZSZ C;  4M77 C;  4PFP A;  3CC2 Q;  1VQO Q;  2D0Q B;  2X4Y A;  8ATC B;  2LJ0 A;  1ZUY A;  1RAF B;  1I81 A;  1WX6 A;  2EQU A;  2RD1 A;  3VYH B;  1VQ5 Q;  3GPL A;  2COW A;  1YJN Q;  1M1K U;  4HA8 A;  3LH0 A;  2FB7 A;  4N0A C;  4M77 D;  5C6S A;  3L2V A;  2KK4 A;  5FRO A;  1D3B B;  1VQ9 A;  3M0Q A;  3JCM d;  1SRL A;  4L6V 5;  2DA9 A;  4OP0 A;  1KK7 A;  2DM1 A;  4D8D A;  1PWT A;  2DLP A;  3CD6 A;  3KXT A;  4HXJ A;  2K3B A;  1JJ2 S;  3J81 E;  1T0J A;  5GAO n;  2CDT A;  4BB7 A;  2LCL A;  3EGU A;  3C0C A;  1FMV A;  4JJD A;  3REB B;  3CCJ A;  3PMT A;  2F1L A;  2NLU A;  1MMG A;  1BI3 A;  3ULR B;  2DER A;  3QG1 A;  4B9W A;  3JCM c;  4C92 D;  4OGE A;  5GAO q;  3BE3 A;  2PUK B;  3M9Q A;  1AOJ A;  1M1K C;  2HKQ B;  5KCO A;  1Q7Y U;  1ZHI A;  2L3P A;  3M58 A;  2DIQ A;  2FG0 A;  3SWN C;  3CXC S;  1M27 C;  3X24 B;  1TWB A;  1M3B A;  3I55 T;  2XDD A;  4BE0 A;  1R8O B;  5CO7 A;  1RI0 A;  2DX1 A;  1D0Z A;  4LDU A;  1PKS A;  1VQK T;  2DK3 A;  2W10 A;  3CBM A;  2PTK A;  1N8R U;  1WXU A;  4J5Y A;  4HCB A;  3JCM f;  1NPR A;  4LD6 A;  3WVE B;  2EFI A;  4GBQ A;  2ROT A;  3U23 A;  1WHJ A;  2ENM A;  2LDM A;  5GAN 6;  3M56 A;  1SHG A;  1Q82 U;  1M8M A;  3CME A;  4PJO C;  1WIE A;  1VYT A;  1RAG B;  1K9M U;  3MP6 A;  1I07 A;  3OYB A;  4M7D D;  2DO3 A;  4EMG A;  4E7Z A;  5GAN f;  2HQX A;  5FU6 C;  2EQI A;  1X6O A;  3GP8 A;  3VS2 A;  3S3M A;  3VYG A;  3EG9 B;  2XKO C;  1UTI A;  4YTL A;  3VS4 A;  3CCL A;  1GCQ A;  4PJO D;  2DXT A;  1WFW A;  2PUO B;  3MEV A;  3V8L A;  1JJ2 P;  2EVR A;  2YUO A;  2QGF B;  2RF0 A;  2K57 A;  1YWP A;  5GAO l;  4WF2 A;  4MDW A;  4DQ2 A;  2RJE A;  3P8B B;  4HCZ A;  5D6Y A;  4FYW B;  2GGR A;  1K8A U;  2QG9 B;  3CCM T;  1ZQ1 A;  2MWP A;  2VWF A;  4M77 E;  1WHG A;  4OVA A;  3NTH A;  4GLM A;  2KNB B;  1TS9 A;  3CCS T;  2FZC B;  5HKC A;  3A5Z B;  3PVL A;  1WHH A;  3RNJ A;  2JJ9 A;  2KRO A;  1XNI A;  1AT1 B;  5L23 A;  4M77 A;  6AT1 B;  3OMC A;  4M7D B;  2CP2 A;  4OF1 A;  2AKK A;  2LQK A;  4RCC A;  3C12 A;  1NM7 A;  4FW2 A;  4PJN A;  1QCN A;  4CRI A;  2RQU A;  1M90 U;  1QP3 A;  2FZG B;  4C92 E;  4TVR A;  5IHI A;  1LNX A;  3OY9 A;  3M55 A;  4HCK A;  2JZ2 A;  2A36 A;  2OTL T;  2A3L A;  2E6N A;  5A2Q E;  1TUD A;  2LX7 A;  1XQH A;  1Y57 A;  2DYI A;  1OI1 A;  4X9C A;  1U8R A;  2WSC E;  2JM9 A;  4C92 A;  1UGR B;  1RAI B;  4J7F A;  3V7S A;  4RTU A;  3M54 A;  5LJ3 h;  1V76 A;  1ABO A;  1WYX A;  2OTL A;  4JZ4 A;  2IPO B;  4E7L A;  2RO0 A;  3H9N A;  4M78 G;  1KFZ A;  2DXC A;  4IIM A;  5CQY A;  2L89 A;  2HCK A;  4BY6 C;  1D0Y A;  4GLK A;  1WQW A;  4F16 A;  1G3Y A;  3QHS A;  4E47 A;  1SHF A;  4UC4 A;  2O2O A;  2RK1 A;  3RDV A;  3OS2 A;  2K2M A;  4AFU C;  3QXE B;  3CPW P;  5GAN 5;  1RLQ C;  2CUD A;  2CP5 A;  3AT1 B;  3CME Q;  3TSZ A;  2ROL A;  3QJ6 A;  2XIC A;  3FIF A;  1VQP T;  2BIV A;  2CSQ A;  2CS7 A;  4M7A D;  5KYX B;  2IIM A;  3L1A A;  3QYH B;  3OW2 A;  3V7C A;  2VKN A;  2WSF E;  2QAZ A;  4PNO A;  1J3T A;  3E9G A;  4IUP A;  1G5V A;  4FW1 A;  3JB9 J;  5FWC A;  4EDU A;  5EC7 A;  1MV0 B;  4PJO E;  2B8A A;  1HSQ A;  1UGQ B;  2EYZ A;  1YJ9 A;  5DLO A;  1WPY A;  5CK9 A;  4JRK A;  4CI0 C;  2DFU A;  2CZ1 B;  1SF9 A;  2HAX A;  2E41 A;  2ZPB B;  1VYV A;  5FLX E;  2LTO A;  4FU6 A;  3INZ A;  4PKC C;  4PJO A;  4OMQ A;  3JCM W;  1I5O B;  2VV5 A;  1X2Q A;  2A37 A;  4J9H A;  5GAN 8;  2QQA A;  4M75 C;  1VIF A;  4PFZ A;  4M78 B;  4CC2 A;  1YJW A;  1YI2 Q;  2BKD N;  1PG5 B;  4N4H A;  1TH7 A;  1BYM A;  2K7A A;  3WVD B;  3G1J A;  1B34 B;  2PNI A;  2RHU A;  4M4Z A;  3BDU A;  1H92 A;  4LDW A;  1MMN A;  3M59 A;  4BDZ A;  4M75 D;  1VQ5 T;  3E1S A;  1VQM T;  2JNG A;  2DNU A;  2VAS A;  3A8O B;  2EYX A;  3TQ7 P;  1WGS A;  1M1G A;  2MAM A;  2QEX Q;  1KC8 C;  1BIA A;  3G7Z A;  4Q5W A;  1M1K R;  4OB0 B;  4A54 A;  1P92 A;  3I56 T;  4LDY A;  4EMK A;  4RMO A;  1VQN A;  3SWN B;  1B3Q A;  2RJF A;  1GL5 A;  2ZPF B;  5KYW A;  2CH4 A;  3QDR B;  1KJW A;  1YHQ Q;  5GMK e;  3OYC A;  3OB9 A;  4AFZ C;  5KYX A;  2ZGW A;  1YJ9 Q;  4K11 A;  2LQW A;  2H3J A;  3CC7 T;  2CZ0 B;  1VQO A;  2I2L A;  1JJ2 A;  2ZPG B;  4L59 A;  2KRN A;  2OX7 A;  3CCR Q;  2RH2 A;  3V8J A;  2QTV A;  2O01 E;  1SSF A;  3JCM e;  2QDL A;  2JXB A;  2F2V A;  5IT9 E;  1FMK A;  1GCQ C;  2KEA A;  2ED1 A;  2P84 A;  2V8K A;  2B86 A;  5D6X A;  2VUB A;  2JM8 A;  4ESR A;  3G6E Q;  2DIL A;  1V29 B;  2OAU A;  2HMA A;  2ZZD A;  2ABL A;  1NZ9 A;  4M75 B;  3ZEH A;  2OTJ Q;  1D1A A;  1XTD A;  4OMP A;  3M0R A;  3CCL T;  4PJO F;  1JB0 E;  2NYS A;  3FB9 A;  5GAM h;  3CMA Q;  2QDY B;  1VQ7 A;  1I0C A;  4DEY A;  1M2V A;  1UEB A;  3BY7 A;  5M9O A;  2CT4 A;  1HK9 A;  1UHC A;  2C0I A;  4F7U E;  1G2B A;  1NE8 A;  2G3R A;  1Q81 U;  1QCO A;  2D9T A;  2XDP A;  2XK0 A;  1W2B P;  1BB9 A;  4EPC A;  4FL6 A;  4BD3 A;  1UFF A;  1YBY A;  5IHK A;  3CCM A;  3QBY A;  5KYU A;  2F69 A;  1RLP C;  4BAC A;  2KYM A;  4PJM A;  2K9G A;  2QAS A;  1QCF A;  3I5R A;  1R77 A;  4L5G A;  2VC8 A;  4FYY B;  3X25 B;  2DET A;  2OTL Q;  5GMK l;  3EH1 A;  2FRW A;  2Y4Y A;  1NJI C;  1M4Z A;  2RI5 A;  3L2U A;  5GAM d;  4IUV A;  3CCM Q;  1NYF A;  2O9S A;  1RAD B;  4M75 E;  4FM4 B;  2EJ9 A;  4C8Q C;  3CD6 T;  3OBW A;  5LJ3 e;  2O4X B;  3T9N A;  3CPW S;  1RUW A;  4M75 A;  3CCE T;  1WI7 A;  9ATC B;  1YFN A;  4N0A A;  1IXD A;  1GBQ A;  1VIE A;  1MV3 A;  1KQ2 A;  1D1C A;  3G71 T;  2HDA A;  3OYI A;  2E5K A;  2CP0 A;  5GMK m;  1I4K 1;  4LNP A;  3LLR A;  3CXC P;  3M53 A;  2E1H A;  2FHD A;  1KD1 U;  5GAN d;  5C0M A;  2ZAE A;  2X9H A;  1Y96 A;  4KUL A;  4M7A E;  2DKG A;  1WNL A;  1WHK A;  4EMK C;  2LJ1 A;  1VQ9 T;  4P5N A;  3RBB B;  1H64 1;  4QW2 A;  1SPK A;  4M77 F;  1YCY A;  4VUB A;  1CSK A;  2GQV A;  1ZA2 B;  4PK4 A;  3SWN A;  3I56 Q;  3EGD A;  2CKK A;  2A7Y A;  2BUD A;  3RKY A;  1E7O A;  2VGM A;  1JEG A;  3AHU A;  4C8Q B;  3LGL A;  2A0F B;  2O31 A;  1TUG B;  2A28 A;  4ME7 A;  3JB9 F;  1N9S A;  5FRM A;  2E70 A;  4M7D F;  2SRC A;  4OGC A;  1AHJ B;  1JXM A;  3DKM A;  2L3Q A;  1YWO A;  3I56 A;  2MMP A;  4F7U F;  2NUP A;  3FDR A;  2ZPE B;  1W2B A;  3QSU A;  1D0X A;  3P8H A;  1ZA1 B;  2M0O A;  4C92 G;  4ZGD B;  2KSS A;  1NEG A;  3DB3 A;  3PIO A;  5FRN A;  1KIK A;  2KT8 A;  2YUP A;  3NHN A;  3CC7 A;  2QEX A;  3GLX A;  5I22 A;  5GMK j;  2DRK A;  1Y96 B;  1Z9Q A;  1JBM A;  3LH5 A;  2DPP B;  4A4K A;  3EG9 A;  4ZTJ A;  4E7K A;  3WXM B;  3LYI A;  3OW2 S;  2O9V A;  5FWB A;  4HT9 A;  1IHW A;  3GNG A;  5GJW B;  3QDF A;  2QA4 A;  4ZGJ B;  4KGZ B;  5LJ5 f;  1YP5 A;  1YIJ A;  3UPU A;  3FJ5 A;  3VS3 A;  2EGE A;  2HL5 C;  3JCM Q;  2K6D A;  1NLO C;  3CBP A;  1VQN Q;  1VQL A;  3RER A;  1AD5 A;  1KG1 A;  1MMA A;  3X28 B;  5I2M A;  2RK2 A;  1VQL T;  3RKX A;  4Z02 A;  2LP5 A;  2KGT A;  5LJ3 j;  3CCS Q;  3EG3 A;  4XTW A;  2CGH A;  2AKL A;  2LNH B;  4M75 G;  4F04 B;  2NUZ A;  1PKT A;  1YN8 A;  4ZN1 A;  5CR2 A;  3JAM E;  3HTR A;  4Z89 A;  2X35 A;  1RAC B;  3JB9 G;  1TXQ A;  1OV3 A;  2SEM A;  1KD1 C;  2HNI A;  3HRS A;  3M0T A;  5LJ5 g;  2DTH A;  3OS1 A;  3Q1J A;  4RKU E;  2DRM A;  2F2W A;  4JPB W;  2J05 A;  1MUZ A;  4QKU A;  5IXB A;  2D1X A;  3A98 A;  3QZ5 B;  2DZC A;  2RQV A;  2PVD B;  1SRM A;  1D09 B;  2XU8 A;  2MPX C;  2J6F A;  4OB3 B;  3UT1 A;  3MKD A;  3VUZ A;  3VUB A;  4PJO B;  2QYZ A;  1U1T A;  4BY6 B;  2VVK A;  4MZP A;  2DD4 A;  1VQP A;  1PM3 A;  5DM7 R;  4M78 D;  2LQN A;  3M5A A;  3L2Q A;  4PJL A;  1S1N A;  2MK5 A;  2GBQ A;  3H0F A;  4LUD A;  4C0D C;  3SFM A;  2DL4 A;  1YJN T;  2EJF A;  1QVP A;  3X20 B;  2YXY A;  2YT6 A;  3MPU B;  2YRC A;  3JB9 H;  3FJP A;  3G6E T;  4JDS A;  2DIG A;  2DEQ A;  3H0H A;  2J7I A;  4LE9 A;  4C8Q A;  4D6W A;  5KYU B;  2FEI A;  1BI1 A;  3CCJ T;  3OYA A;  3QKJ A;  1M30 A;  4XU3 A;  3JCM J;  1QW1 A;  2EGA A;  1FX7 A;  4MMK A;  2KAF A;  4J9I A;  1GRI A;  4J9F A;  3JCM b;  2BZ8 A;  4C8Q E;  2X3W D;  5HY6 A;  4O5V A;  2D8J A;  2BE9 B;  2D6F A;  1AZG B;  4IUQ A;  5AT1 B;  1KQS A;  4M7A G;  1YHQ T;  5LL6 S;  1YJ9 T;  5GAO p;  3TU4 K;  1UGS B;  1PRM C;  2KXC A;  3KFV A;  4RTV A;  2E64 A;  3VRY A;  2LCS A;  1ZBX A;  2J6O A;  4C5E A;  1M2V B;  2E12 A;  4J6Y A;  1QVF A;  4PL6 A;  2J06 A;  3CCU A;  3A1P A;  1I1J A;  5I11 A;  3JCM P;  3CMA A;  4J9D A;  3VS0 A;  3R6N A;  2YHT A;  2D8H A;  2HL3 A;  1QLY A;  2JTF A;  2JTM A;  3CC2 A;  1VQ6 T;  4XTV A;  4RTY A;  3UWN A;  4FCY A;  2CP7 A;  4MZM A;  1EIF A;  1QMC A;  3CPF A;  2X4X A;  1IHV A;  4QVZ A;  2DBK A;  1N5Z A;  1DJ7 B;  4C92 C;  2RHY A;  3F70 A;  2CRE A;  2YDL A;  1YIJ T;  3CPW A;  1VQ4 T;  3MEW A;  3L42 A;  1VQ8 T;  2QQS A;  4AT1 B;  1TOV A;  4KUD K;  1Q86 C;  1IB8 A;  2HSP A;  1XOV A;  2GCX A;  2NUP B;  4HVW A;  1QKX A;  4OMN A;  5A0G A;  2XDB A;  4BI4 A;  2E3H A;  5GAN e;  2CZ6 B;  4DBR A;  4WTO B;  2ESW A;  3G71 A;  5CQX A;  4F7U A;  4J7I A;  2K79 A;  3VKI A;  3UDC A;  3HHT B;  2LJ3 A;  2NUT B;  4RTW A;  2OI3 A;  3CCV Q;  1BI0 A;  2P0K A;  2K4Y A;  1M1F A;  1VQM Q;  3CC4 T;  1R0B G;  1HXD A;  4F7U G;  4E7I A;  3CCS A;  2WAC A;  3VS7 A;  2EQM A;  1VQO T;  3CCR A;  3EFS A;  3M4Y A;  4MZT A;  4XU1 A;  1BI2 A;  1K9M C;  2HQE A;  5CKD A;  1QVG A;  2L8D A;  4XQ3 A;  2WSE E;  5DLQ E;  1K73 U;  4AMC A;  4OML A;  1G3S A;  1W2B S;  2HBP A;  1Y0M A;  1T3S A;  2BTT A;  1RAE B;  2E65 A;  1QVF P;  1H3H A;  3FEO A;  2VB6 A;  1OUL A;  2JS2 A;  1U06 A;  5J3B A;  3EAE A;  3ZL7 C;  5I2S A;  1TUC A;  2MYS A;  1K0S A;  1VQP Q;  5KH6 A;  4J6X A;  2DJZ A;  5IXF A;  1WLP B;  2NUT A;  1JO8 A;  1CKB A;  1PSF A;  1Q82 R;  1YIT T;  2YSQ A;  1C1A A;  2DTI A;  2KRS A;  1KC8 U;  3CCL Q;  1M3A A;  1ABQ A;  4DEX A;  5CCA A;  2MOX A;  1OOT A;  1SG5 A;  3N5B B;  1I8F A;  1ZUK A;  2COY A;  3CEY A;  4ELZ C;  3GOX A;  2FPF A;  4FT2 A;  5CIU A;  2DXU A;  4J9G A;  2VYT A;  4NOY A;  4IKF A;  5LJ3 d;  3ASK A;  2CUB A;  5A0D A;  3BDL A;  3SHW A;  1RI9 A;  4JS5 A;  2L3S A;  1Y7X A;  2DYB A;  1YI2 T;  2DD5 A;  4JS4 A;  2ED0 A;  3MEU A;  1W70 A;  1WQ7 A;  1XJW B;  2FVU A;  2C0T A;  3PNW C;  1M90 R;  4X9D A;  2C06 A;  1KC8 R;  1UDL A;  5D6W A;  3A8G B;  1K73 R;  4ZN3 A;  2QTX A;  3JSC A;  4J83 A;  1JU5 C;  2J6K A;  3FC3 A;  2QGG A;  4PFO A;  3CMA T;  1K8A C;  2EJG A;  1YCS B;  1N8R C;  3CCE Q;  4M78 E;  2ZCF B;  1Z9Z A;  3RMQ A;  2X3X D;  4E6R A;  2JMC A;  2K5I A;  3HFO A;  3DLM A;  1TG0 A;  3SEM A;  1O9S A;  4M78 A;  1QQJ A;  2HKN A;  3KBG A;  1LJO A;  1Q81 C;  5AYF A;  5GAN 7;  3A8M B;  1UEC A;  3DB4 A;  4JLI A;  4EMK B;  2RNA A;  3VRZ A;  3E19 A;  4N4I A;  2M9U A;  1X43 A;  2Y4X A;  3V8K A;  3LX7 A;  4HT8 A;  5KYN A;  5LJ5 j;  1MGQ A;  4ANJ A;  4IUT A;  1G8X A;  1AWO A;  2EIF A;  2E10 A;  4BI8 B;  2QI2 A;  2E6Z A;  2AZS A;  3CC7 Q;  3J80 E;  3M0S A;  4RUG A;  1AWW A;  2CT3 A;  4C8Q D;  3EFO B;  1M2O A;  1VQ4 A;  5FU7 C;  3MEA A;  4A4F A;  3X26 B;  5LJ3 g;  1UB4 A;  4OMM A;  1VQ5 A;  1AZE A;  3OYH A;  1BKB A;  1OX8 A;  3UA7 A;  3PGG A;  5IN1 A;  1WA7 A;  2C0O A;  4JRP A;  2FL7 A;  1B07 A;  2R5M A;  1YIJ Q;  4C0G A;  4LD9 K;  3G71 Q;  2KQW A;  1YJW T;  2X51 A;  4AFQ C;  2HD0 A;  1FWZ A;  3L2R A;  2HZY A;  2OJ2 A;  2PQW A;  1ZUU A;  2LRQ A;  3CC4 A;  1WJS A;  2LCC A;  3G4S T;  4Y28 E;  2VGN A;  4CC7 A;  3EG1 A;  2JTE A;  2LT1 A;  3OYM A;  4C5G A;  1VQ7 Q;  1ACM B;  2QQB A;  4XTU A;  2PVO B;  1S72 A;  2RQT A;  3DLL A;  3A8L B;  1KD1 R;  1QVF S;  3QO3 A;  1NJI U;  5D7U A;  1MNE A;  2EKO A;  4JZ3 A;  3CCV T;  1PNJ A;  3QII A;  4C0D B;  3VS1 A;  1G3T A;  3PTA A;  3CXC A;  1Q82 C;  2EWN A;  1F1B B;  2YWW A;  2EYQ A;  3PMI A;  2EYW A;  3QJY A;  4C92 F;  1V1C A;  3TVT A;  1MMD A;  3CCU T;  2DL5 A;  1E6G A;  2EW3 A;  1M9S A;  1VA7 A;  4XAX B;  1ZSZ B;  4J9C A;  1PD0 A;  2HEQ A;  4JLG A;  5J26 A;  5GAM j;  1Y07 A;  1OPK A;  1CKA A;  2MI6 A;  2EKH A;  4FSS A;  4PLL A;  3TEE A;  2P4T A;  3OYE A;  4BE1 A;  2FRY A;  2M51 A;  3RIR A;  1E6H A;  2AT1 B;  3ME9 A;  1GXI E;  4KGX B;  1N6A A;  1ZSG A;  2GTJ A;  2O88 A;  1QWF A;  4M7D C;  4X1V A;  2V1R A;  4PLI A;  4F17 A;  5KCH A;  3CCQ T;  1VQL Q;  1YJN A;  2CSI A;  2RQR A;  1U5S A;  2XID A;  5A0L A;  2DL3 A;  5CKB A;  3PVQ A;  1K8A R;  1G83 A;  3CCQ A;  4X34 A;  4M78 C;  3P8D A;  1RAH B;  1LVK A;  1PRL C;  3E9F A;  1MND A;  4A4G A;  2GQI A;  1NPP A;  1R0C B;  1RAA B;  1X6G A;  2KXD A;  5GAN 2;  2YLB A;  2RB6 A;  4RTZ A;  1YJW Q;  2DVJ A;  2QQ9 A;  4ZGE B;  1VOM A;  3THK A;  4QVC A;  5GAN j;  1PHT A;  4B6M A;  4LDX A;  3I5S A;  3RKW A;  2V8J A;  1OEB A;  2W0Z A;  4XU2 A;  1TTH B;  3QPH A;  3URG A;  4XK8 E;  3CCE A;  3L2Z A;  1ZBJ A;  5HK3 A;  3OYF A;  2L2P A;  4NS5 A;  5DY9 A;  3OSV A;  1I5L A;  2KRM A;  2KYB A;  1NG2 A;  5J39 A;  4FYV B;  1OU9 A;  2MIO A;  1AEY A;  3CME T;  1VQ8 A;  3HSB A;  2EGC A;  2XI9 A;  4R0K A;  2A08 A;  2ATC B;  4C8Q F;  3IQL A;  2EQJ A;  1WJR A;  3CCV A;  3EG2 A;  3I55 Q;  3OYY A;  4OB2 B;  2GNC A;  3OMG A;  1ZSZ A;  5KE2 A;  4D8K A;  4J8O A;  2NWM A;  1TSF A;  1EX4 A;  3OS5 A;  1LOJ A;  3OQ5 A;  4BE2 A;  4HKE A;  5GAN h;  2CP6 A;  3ZFJ A;  2E5Q A;  2XMF A;  3HKS A;  4LN2 A;  1K73 C;  3CC2 T;  2CZ7 B;  2RJC A;  1YIT Q;  1IGQ A;  4FT4 A;  2OAW A;  3OYK A;  4RTX A;  1RL2 A;  5CKF A;  4M7D A;  3RMS A;  4PJO G;  4DBH A;  4Y92 A;  1FYN A;  2L5Q A;  1UJ0 A;  2RHI A;  3OYL A;  4MDX A;  2RHZ A;  2EPD A;  4M75 F;  4XU0 A;  5LJ3 f;  4JJB A;  2RJD A;  5FU6 B;  3GBQ A;  2VXE A;  2RHX A;  2DZ9 A;  2AHJ B;  3EGX B;  2MCN A;  2PVG B;  5HK0 A;  4JRQ A;  4KBM B;  4FYX B;  2V1Q A;  1WXB A;  4ZTF A;  2QEX T;  4DOV A;  1HD3 A;  3G4S A;  4BUG A;  1X01 A;  2MF2 A;  5LJ5 h;  1NBE B;  1JRI A;  2R5A A;  4EMH A;  2CH4 W;  3CCJ Q;  4PJJ A;  1GFD A;  4A4H A;  1SEM A;  3RUX A;  1WDX A;  3G4S Q;  3UA6 A;  2BZY A;  2KR3 A;  2KVQ G;  5GJV B;  3JV3 A;  4JJN K;  4M7D G;  4LXC A;  2HBW A;  1AWJ A;  3EHR A;  1VQK A;  5IAY A;  1O75 A;  4J9E A;  1N27 A;  1LPL A;  3CQT A;  2PZ1 A;  1Q86 R;  1T3L A;  1OZ2 A;  3EFR A;  3KUF A;  1M5Q 1;  2IG0 A;  1D1B A;  2XHC A;  3ER0 A;  1K9A A;  1UHF A;  3PFS A;  4OMF B;  5ECA A;  1HJD A;  4LDV A;  5EG2 A;  2COZ A;  4RG2 A;  3OYJ A;  3JB9 I;  3RES A;  1MHN A;  1GFC A;  3NGP A;  5CKE A;  2M0Y A;  5KYY B;  1YI2 A;  1IZ6 A;  4Y91 A;  2RN8 A;  3LGF A;  3MJX A;  5CAI A;  3H0I A;  3QYG B;  2RQW A;  1NLP C;  1VUB A;  5GAM f;  4CC4 B;  5GAO m;  1LCK A;  3M4G A;  2YRD A;  2JS0 A;  2AZV A;  1M8V A;  2X4J A;  1N8R R;  4FIB A;  4HVU A;  1IRX A;  4FSX A;  1IGU A;  4M77 G;  2JVV A;  3S6W A;  4QQ6 A;  3EFO A;  1QP2 A;  3OW2 P;  3CC4 Q;  1YIT A;  2FZK B;  4F7U B;  4E2F B;  1S72 T;  3OYD A;  4J6W A;  1HYO A;  2XG8 D;  4AG1 C;  3LWH A;  1UGV A;  3JCM g;  2YUN A;  1WHM A;  3H41 A;  3MP8 A;  3LWI A;  2DMO A;  4Z88 A;  1YHQ A;  3HPW A;  1T0H A;  1K76 A;  2RM4 A;  1VYU A;  3L2W A;  1YNZ A;  2DL8 A;  2HSE B;  3HL8 A;  3SD4 A;  4ELY C;  1A0N B;  2R57 A;  4BDY A;  3OSS C;  1M90 C;  1BK2 A;  1K4U S;  3VS5 A;  3BFM A;  1QKW A;  2BE7 D;  3O8V A;  3OS0 A;  4C8Q G;  3H6Z A;  3V7R A;  3UF4 A;  1BIB A;  1ARK A;  4F14 A;  2P4R A;  2PU9 B;  2YRV A;  8AT1 B;  2FPD A;  3M57 A;  2QA4 T;  1N9R A;  2M1H A;  4XTZ A;  2HQH A;  1H8K A;  2GTO A;  1Q81 R;  4C92 B;  1QVG P;  3OYG A;  3NMZ C;  2P0P A;  2K3X A;  4M77 B;  2X4W A;  2F2X A;  2GF7 A;  1C0M A;  1B34 A;  4E7H A;  1OPL A;  2JMA A;  3C4S A;  3HRU A;  3NTK A;  5LJ5 e;  4A4E A;  3ZBD A;  2V26 A;  4DBQ A;  3EGX A;  3NFC A;  2CYZ B;  2XD0 A;  1W6X A;  2RPN A;  3R6O A;  1RAB B;  4DA4 A;  2M02 A;  1K1Z A;  5GMK i;  1BU1 A;  2M16 A;  3BW1 A;  1Q7Y C;  4C0F A;  2IVW A;  5L8R E;  2DBM A;  2H8H A;  2KI7 A;  3JRZ A;  3S3O A;  3NPF A;  3QWX X;  3QWY A;  3J7A F;  2AK5 A;  4KRT A;  4HVV A;  4C5H A;  3C94 A;  1VQM A;  1EFN A;  4M78 F;  3OBY A;  5GAN 3;  1S72 Q;  4QVD A;  2LQ8 A;  1KQS S;  1K0X A;  2I0N A;  2F5T X;  4IIO A;  2K5F A;  4KT0 E;  4ZNX A;  1AVZ C;  1SSH A;  1WXT A;  1G3W A;  3GF5 A;  2DAQ A;  2JN0 A;  2RI2 A;  3MP1 A;  1ZLM A;  1BCO A;  1X2K A;  2K2V A;  4JJC A;  4ATO A;  4XTX A;  1UJY A;  3VV0 A;  3EG0 A;  2VXF A;  3RR6 A;  1Q95 G;  2Y90 A;  5GAN g;  2OTJ A;  3REA B;  4KH1 B;  2RI3 A;  2DL7 A;  4O6J A;  1KQS P;  1WHL A;  3SDZ A;  1Y71 A;  2DTO A;  1WJQ A;  5CVI A;  3UAT A;  1ZX6 A;  2LX9 A;  4Z8A A;  2L3R A;  1FXX A;  3LW5 E;  1Q7Y R;  1OQK A;  1UUE A;  4QQD A;  1BBZ A;  1X6B A;  2RMO A; 
#chains in the Genus database with same CATH homology
 2EYY A;  1V1C A;  4RTU A;  2LMJ A;  3TVT A;  1SRM A;  1ABO A;  1WYX A;  2DL5 A;  1E6G A;  2EW3 A;  1VA7 A;  4JZ4 A;  2J6F A;  4J9C A;  1KFZ A;  2HEQ A;  4IIM A;  2HCK A;  4ORZ A;  1OPK A;  4F16 A;  1CKA A;  2VVK A;  2EKH A;  4FSS A;  2KT1 A;  2LQN A;  1JXO A;  1NEB A;  1SHF A;  2O2O A;  1S1N A;  2FRY A;  3H0F A;  2GBQ A;  2M51 A;  4LUD A;  2K2M A;  1E6H A;  2DL4 A;  1ZSG A;  2GTJ A;  4AFU C;  2O88 A;  1QWF A;  2YT6 A;  4X1V A;  2V1R A;  4F17 A;  1RLQ C;  2CUD A;  1AWX A;  2ECZ A;  3TSZ A;  2CSI A;  2ROL A;  2RQR A;  1U5S A;  2YUQ A;  1JQQ A;  3H0H A;  2J7I A;  2DL3 A;  3PVQ A;  1G83 A;  4LE9 A;  2CSQ A;  2IIM A;  2L0A A;  1PRL C;  2FEI A;  2GQI A;  1M30 A;  1KSW A;  1X6G A;  2EGA A;  2VKN A;  2KXD A;  4J9I A;  1GRI A;  4J9F A;  1J3T A;  2BZ8 A;  2X3W D;  4RTZ A;  2DVJ A;  3THK A;  1PHT A;  1W1F A;  5FWC A;  4EIK A;  3M0U A;  2D8J A;  3I5S A;  1AZG B;  5EC7 A;  3TSW A;  1MV0 B;  1OEB A;  2DE0 X;  2W0Z A;  1GCP A;  1HSQ A;  1M3C A;  2EYZ A;  4QT7 A;  1VYV A;  2LZ6 B;  1ZBJ A;  4OMQ A;  1PRM C;  2L2P A;  2KXC A;  1X2Q A;  2A37 A;  3KFV A;  4J9H A;  4RTV A;  2KRM A;  2KYB A;  3VRY A;  1NG2 A;  2LCS A;  2J6O A;  4CC2 A;  5IH2 A;  2MIO A;  1AEY A;  1NYG A;  1UE9 A;  2EGC A;  1UG1 A;  2KE9 A;  2JW4 A;  4R0K A;  2J06 A;  3PE0 A;  2A08 A;  2K7A A;  3IQL A;  1I1J A;  5I11 A;  2PNI A;  3EG2 A;  4J9D A;  4M4Z A;  3VS0 A;  2DJQ A;  2GNC A;  1H92 A;  3R6N A;  2KBT A;  4D8K A;  2D8H A;  1QLY A;  2NWM A;  4RTY A;  2DNU A;  2BZX A;  1X27 A;  2DBK A;  2EBP A;  2EYX A;  2FO0 A;  2XMF A;  4AG2 C;  1N5Z A;  4LN2 A;  3I35 A;  5HCK A;  2CRE A;  2YDL A;  2OAW A;  4RTX A;  5IHN A;  1IO6 A;  3M0P A;  1B3Q A;  4A63 B;  1GL5 A;  2CH4 A;  1KJW A;  4Y92 A;  1FYN A;  1UJ0 A;  2EPD A;  4AFZ C;  4JJB A;  4K11 A;  2LQW A;  3GBQ A;  2HSP A;  1XOV A;  2MCN A;  4HVW A;  2V1Q A;  1WXB A;  1QKX A;  4OMN A;  2JT4 A;  2KRN A;  4RTT A;  4CC3 A;  5FW9 A;  1HD3 A;  2QDL A;  2JXB A;  2ESW A;  2F2V A;  1FMK A;  1GCQ C;  2KEA A;  2ED1 A;  4AFS C;  2D0N A;  2B86 A;  2K79 A;  4J9B A;  2JM8 A;  4ESR A;  2CH4 W;  2LJ3 A;  2DIL A;  4RTW A;  2OI3 A;  1GFD A;  2ABL A;  1SEM A;  1WDX A;  3UA6 A;  4OMO A;  2BZY A;  4OMP A;  2KR3 A;  5GJV B;  3JV3 A;  3M0R A;  3VS7 A;  3VS6 A;  1QWE A;  1I0C A;  4DEY A;  1X69 A;  3I9Q A;  2HBW A;  1AWJ A;  2CT4 A;  2DF6 A;  3EHR A;  1UHC A;  2C0I A;  2FPE A;  1G2B A;  4J9E A;  3EHQ A;  1BB9 A;  3CQT A;  1UFF A;  2PZ1 A;  4OML A;  5IHK A;  1T3L A;  1Y0M A;  1T3S A;  1K9A A;  1UHF A;  2BTT A;  2G6F X;  5ECA A;  1HJD A;  1GBR A;  1RLP C;  2KYM A;  1H3H A;  4LUE A;  2K9G A;  1QCF A;  3I5R A;  1U3O A;  1GFC A;  2JS2 A;  3NGP A;  4WCI A;  1U06 A;  2M0Y A;  3ZL7 C;  2RN8 A;  3O5Z A;  3H0I A;  2FRW A;  2RQW A;  1NLP C;  1K0S A;  1TUC A;  4CC4 B;  1LCK A;  2JS0 A;  5IXF A;  2AZV A;  1NYF A;  2O9S A;  1WLP B;  2LJ0 A;  1ZUY A;  1WX6 A;  4HVU A;  1JO8 A;  1CKB A;  2YSQ A;  1RUW A;  2KRS A;  1WI7 A;  1M3A A;  1ABQ A;  4DEX A;  1GBQ A;  1MV3 A;  2MOX A;  1OOT A;  3M0Q A;  1ZUK A;  1SRL A;  2HDA A;  2DA9 A;  2FPF A;  2DM1 A;  4D8D A;  1PWT A;  2E5K A;  2DLP A;  4J9G A;  4HXJ A;  4AG1 C;  4LNP A;  1UGV A;  2K3B A;  2YUN A;  1T0J A;  2CUB A;  2CDT A;  3SHW A;  3H41 A;  3EGU A;  3C0C A;  1RI9 A;  4JJD A;  2DMO A;  3REB B;  4Z88 A;  2L3S A;  1T0H A;  1K76 A;  3ULR B;  2DYB A;  1VYU A;  1YNZ A;  2DL8 A;  1A0N B;  2ED0 A;  1W70 A;  2C0T A;  2LJ1 A;  1UDL A;  3RBB B;  1AOJ A;  1BK2 A;  1SPK A;  1K4U S;  2L3P A;  3VS5 A;  1CSK A;  2FG0 A;  1JU5 C;  1M27 C;  1QKW A;  2J6K A;  1E7O A;  1JEG A;  1YCS B;  1M3B A;  3UF4 A;  2O31 A;  2A28 A;  2SRC A;  1Z9Z A;  2DX1 A;  2X3X D;  1ARK A;  4F14 A;  2P4R A;  4E6R A;  1JXM A;  1PKS A;  2JMC A;  2L3Q A;  1TG0 A;  3SEM A;  1YWO A;  2W10 A;  2PTK A;  2FPD A;  1WXU A;  1H8K A;  2GTO A;  1UEC A;  3NMZ C;  2RNA A;  2ROT A;  4GBQ A;  3VRZ A;  3U23 A;  2F2X A;  1NEG A;  2ENM A;  1X43 A;  1OPL A;  2JMA A;  1KIK A;  2KT8 A;  2YUP A;  3NHN A;  1SHG A;  1AWO A;  1M8M A;  1WIE A;  1VYT A;  2AZS A;  1I07 A;  3M0S A;  4RUG A;  5I22 A;  1AWW A;  2CT3 A;  2DRK A;  2EQI A;  1Z9Q A;  3VS2 A;  1W6X A;  2RPN A;  1UTI A;  3LH5 A;  1K1Z A;  1BU1 A;  4OMM A;  2DBM A;  2H8H A;  1AZE A;  3VS4 A;  2O9V A;  3UA7 A;  1GCQ A;  3NPF A;  3QWX X;  3QWY A;  5FWB A;  1WA7 A;  2C0O A;  5GJW B;  1WFW A;  2AK5 A;  4KRT A;  2EVR A;  1YP5 A;  2YUO A;  4HVV A;  2RF0 A;  1EFN A;  1B07 A;  3FJ5 A;  1YWP A;  3VS3 A;  2EGE A;  2K6D A;  1NLO C;  1K0X A;  2I0N A;  4IIO A;  4AFQ C;  1AD5 A;  2GGR A;  4ZNX A;  2OJ2 A;  1AVZ C;  1SSH A;  1ZUU A;  1WXT A;  2VWF A;  1ZLM A;  2LP5 A;  4GLM A;  2KNB B;  3EG1 A;  2JTE A;  1X2K A;  2KGT A;  4CC7 A;  4JJC A;  2RQV A;  3EG3 A;  3PVL A;  2AKL A;  2LNH B;  1UJY A;  2NUZ A;  3EG0 A;  1PKT A;  3RNJ A;  1YN8 A;  2KRO A;  5L23 A;  3REA B;  2DL7 A;  4Z89 A;  2AKK A;  2RQT A;  1NM7 A;  1OV3 A;  2SEM A;  4JZ3 A;  1PNJ A;  3VS1 A;  2RQU A;  3UAT A;  1ZX6 A;  3M0T A;  5IHI A;  4HCK A;  4Z8A A;  2A36 A;  2DRM A;  2F2W A;  1TUD A;  2J05 A;  2LX7 A;  4JPB W;  1MUZ A;  5IXB A;  1UUE A;  1Y57 A;  2D1X A;  1BBZ A;  3A98 A;  2JM9 A;  1X6B A;  2EYW A;  2RMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...