5FWBA

Human spectrin sh3 domain d48g, e7f, k60f
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
b'DETGKFLVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNGRQGFVPAAYVKFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPECTRIN ALPHA CHAIN, NON-ERYTHROCYTIC 1
publication title Human Spectrin SH3 Domain D48G, E7F, K60F
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 13
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5fwbA00
2RQVA 1E7OA 1M3AA 1AZGB 2IIMA 4LNPA 2EGCA 2EBPA 1PWTA 2AK5A 1UGVA 4QT7A 1SRMA 4J9FA 2RQRA 4IIOA 2EVRA 1GCQC 2LMJA 3UATA 1WYXA 4J9IA 2JMAA 1TUCA 4RUGA 1M30A 2LCSA 3GBQA 2FRWA 2CUBA 3VS2A 3RBBB 2GGRA 3EHRA 3EG0A 1YP5A 5IHKA 4OMOA 4FSSA 2O9SA 1U06A 4E6RA 1VYUA 2J05A 2KT8A 1X2KA 3H41A 1GFDA 2DBMA 3M0TA 1NEBA 4J9DA 2JXBA 4LUDA 2KBTA 2D0NA 1UECA 3EGUA 1RLPC 5FW9A 2GQIA 1RI9A 5L23A 1IO6A 1UFFA 1E6GA 2KYMA 2D1XA 2ABLA 3I9QA 2JTEA 2O2OA 2LJ1A 2FPEA 3NHNA 2DX1A 2L3QA 1PRMC 1WX6A 2PZ1A 2W10A 1AEYA 1X27A 2KRSA 2D8JA 2SRCA 4JZ4A 2KYBA 2OAWA 5FWCA 2K9GA 1B3QA 1GL5A 2I0NA 1I1JA 2EW3A 1YCSB 1H3HA 2H8HA 2CT4A 2CREA 3M0UA 4X1VA 3NMZC 1NYGA 1SRLA 3VS5A 4D8DA 1ABOA 2AZVA 1UE9A 1WFWA 3VS4A 2K3BA 3VRYA 1W6XA 1T3SA 4RTVA 3RNJA 4D8KA 2CSQA 1K9AA 1WA7A 2EGAA 4IIMA 1LCKA 2JM8A 2F2XA 2KRNA 2FO0A 1JXMA 3EG3A 2ROLA 1RUWA 4HCKA 2YUPA 1K0XA 1OOTA 1KSWA 4CC4B 5GJWB 2GTOA 3LH5A 1M3BA 1NLPC 3EHQA 1SSHA 1PNJA 1HSQA 1VYVA 1YN8A 3O5ZA 2L2PA 3EG2A 2DM1A 2JS2A 4KRTA 3ULRB 1Y57A 2MOXA 1AZEA 1FYNA 5IXFA 1JO8A 2FPFA 2XMFA 3VS3A 4JZ3A 3M0PA 3H0HA 2KRMA 2MIOA 4RTTA 1VYTA 2KEAA 2J6KA 2DE0X 2DL4A 4A63B 1OV3A 3H0IA 2QDLA 1U5SA 4HVWA 1YWPA 3THKA 1QLYA 1U3OA 2L3SA 2M0YA 1VA7A 2GBQA 4AFSC 1K1ZA 2GNCA 3A98A 1OPKA 2RMOA 4RTYA 4J9GA 1A0NB 4AG1C 2CT3A 2C0TA 2AKKA 2K2MA 5EC7A 1G83A 4AFQC 5FWBA 1ARKA 4LUEA 2MCNA 2LJ3A 2F2VA 2YT6A 2A08A 1PRLC 2ROTA 2DBKA 1K76A 2AKLA 2NWMA 3UA6A 4GLMA 1M3CA 2O31A 1JQQA 4HXJA 1BK2A 1RLQC 3TVTA 5ECAA 1W1FA 2BZ8A 2LJ0A 1UG1A 2RF0A 1KIKA 2KXDA 2DL7A 3I5RA 1W70A 3SHWA 1TG0A 2LP5A 2KROA 4RTUA 1QWEA 2D8HA 2DRKA 4ORZA 2CH4W 3ZL7C 2VVKA 1K0SA 2JM9A 2ED1A 1CKAA 1NEGA 3FJ5A 3I35A 3KFVA 2M51A 2CDTA 3QWYA 1X43A 3VS1A 3IQLA 1X6BA 1YNZA 2DVJA 2PNIA 2KNBB 2HCKA 3REBB 1JU5C 4Z88A 1G2BA 2CUDA 2NUZA 2LX7A 3PE0A 1UHFA 3JV3A 1WI7A 4HVUA 1WXTA 2KE9A 4OMPA 2ESWA 2OI3A 3I5SA 2DRMA 2YUOA 2AZSA 1XOVA 4RTWA 1MV0B 1Y0MA 1H8KA 1KJWA 5IHIA 3VS0A 2HSPA 2A37A 1OEBA 1ZSGA 3U23A 2KT1A 2RQWA 2VWFA 2DILA 2YUNA 1JEGA 1ZUYA 5IXBA 3R6NA 1SHFA 1E6HA 1UDLA 2DA9A 4CC3A 2PTKA 2RQTA 1TUDA 2EQIA 3SEMA 3TSWA 3NPFA 4WCIA 1K4US 2VKNA 1ZBJA 1AWJA 4JPBW 4K11A 1ZLMA 1SHGA 2DLPA 2JMCA 2DF6A 4F17A 1OPLA 3CQTA 1QWFA 2K79A 2RPNA 2DYBA 4HVVA 4OMQA 1WXUA 3C0CA 1PHTA 1ZX6A 1SEMA 4AG2C 2JS0A 4AFUC 4J9CA 1MUZA 2OJ2A 4R0KA 1NM7A 2V1QA 2RNAA 2SEMA 2JT4A 4EIKA 3PVLA 1UJYA 1T0JA 2LNHB 1QKWA 2FRYA 3EG1A 2EKHA 2EGEA 1N5ZA 4JJBA 3VS7A 4LE9A 3UA7A 2HBWA 2V1RA 2G6FX 1UHCA 4OMLA 1JXOA 1I07A 2DL5A 2KXCA 2JW4A 3TSZA 1FMKA 2CH4A 2DL8A 2EYYA 1GBQA 1AVZC 2CSIA 3M0RA 2J7IA 1CSKA 1ZUUA 1HD3A 1B07A 2EYXA 2X3XD 5I22A 1GRIA 3PVQA 2J06A 1NG2A 1AWWA 2RN8A 2X3WD 2YDLA 1J3TA 3VRZA 2KGTA 4RTZA 1CKBA 2EPDA 1NLOC 4ZNXA 1WIEA 2DL3A 5GJVB 2J6OA 2HDAA 2LQWA 5IH2A 4RTXA 3VS6A 1GBRA 4Z8AA 2O88A 2GTJA 2L0AA 2LQNA 1NYFA 2DJQA 3NGPA 1WLPB 2L3PA 2E5KA 2BZXA 2HEQA 2J6FA 4OMNA 4CC2A 2A28A 1BBZA 2DNUA 1SPKA 1BU1A 5I11A 2EYZA 1AWOA 2ENMA 1M8MA 1Z9ZA 2RQUA 2FPDA 2FG0A 1H92A 1V1CA 1AOJA 2C0OA 2BTTA 1X6GA 3M0SA 1GCPA 2K7AA 1PKSA 1X69A 1UTIA 1QCFA 1ABQA 3QWXX 1WXBA 2ECZA 1ZUKA 4GBQA 1Z9QA 2EYWA 3UF4A 4OMMA 1MV3A 3M0QA 1KFZA 1QKXA 4JJCA 4Y92A 2KR3A 1HJDA 1PKTA 4J9EA 4F14A 5HCKA 1UJ0A 4ESRA 1I0CA 2P4RA 3REAB 2W0ZA 2K6DA 2BZYA 2DMOA 1T0HA 4DEYA 1GCQA 2B86A 1AWXA 4CC7A 2O9VA 4Z89A 3H0FA 1WDXA 2C0IA 1YWOA 1UUEA 2FEIA 1BB9A 1T3LA 1S1NA 1EFNA 4DEXA 4M4ZA 1M27C 2ED0A 1AD5A 2YSQA 2LZ6B 2YUQA 4J9BA 4J9HA 4JJDA 4F16A 1X2QA 2A36A 4LN2A 5IHNA 2F2WA 4AFZC 1GFCA
chains in the Genus database with same CATH superfamily
2DERA 1E7OA 5GANe 1X01A 1AZGB 2Y4XA 1PWTA 2AK5A 4PJOG 1UGVA 1SRMA 4O6JA 2RQRA 2LMJA 3VU3C 3UATA 4J9IA 2JMAA 1AT1B 2LCSA 4F7UE 1IHVA 1VQ7Q 3VS2A 3MHXA 1WQ7A 1WHJA 4N0AC 2P4TA 2E70A 2PU9B 2F69A 2HBPA 1QVFA 5CQXA 4AMCA 5IHKA 4FSSA 1VQKT 2KT8A 3G6EQ 1GFDA 4QVZA 3M4GA 2QEXT 4HA8A 3M0TA 1NEBA 4J9DA 1VQ6A 5GAOl 3RDVA 2RHYA 2DXTA 2D0NA 3GP8A 1LNXA 3OY9A 3CMEA 2XU8A 4EMKB 1UFFA 2K5IA 2KYMA 1BI2A 1WX6A 4QVDA 3KUFA 3QUIA 1IB8A 2NUPB 1KG1A 3X24B 1M1KU 2HZYA 5CIUA 1VQ9Q 3OYKA 4MDXA 4PNOA 2I0NA 3EFOB 5KYXB 3WVEB 3OYCA 1WPYA 3CCEA 2K3YA 3SFMA 1NJIC 4J6YA 1NE8A 1ABOA 1WFWA 2K3BA 3HHTB 1T3SA 5KYUB 3RNJA 1TS9A 4BDYA 2VGMA 3LX7A 4IIMA 1VQLT 4OB1B 4M77B 4HCKA 5GJWB 3C4SA 2GTOA 1KD1U 2E1HA 4N4IA 1NLPC 3QHSA 1SSHA 4NL2A 3CMAA 1G3SA 3P8BB 2KDSA 5D6YA 1YN8A 2COWA 3CCMT 1I5OB 2JS2A 4KRTA 2MOXA 9ATCB 1FYNA 1JRIA 2E41A 1WHHA 5GAMg 1JO8A 2FPFA 2MK5A 4C5EA 2XMFA 3VS3A 1KC8U 4JZ3A 1FWZA 5GAOr 3BDUA 2DEUA 4KH0B 5DY9A 2ZPEB 4MMLA 4RTTA 2RK2A 2ZPIB 4KUIA 3H0IA 4XU2A 3NTIA 5GAN6 4A54A 3FIFA 4M75G 5FU7C 1VQ8T 2L3SA 1I8FA 4PL6A 3CC2T 3UWNA 4AG1C 2K2MA 2B8AA 1Q7YC 3S3MA 4DBFA 2RJFA 2QA4Q 2ZZDA 2LJ3A 3OYGA 3MO8A 3PTAA 1JB0E 5D7UA 4CI0C 1QQJA 2DBKA 2NWMA 3TVTA 4FYWB 3L1AA 4M78B 5ECAA 3V8JA 4ELZC 2EQJA 1H3ZA 2PVGB 5D6WA 4BE1A 1ZQ1A 4M78D 2DL7A 4M7AG 4M7DC 1TG0A 2LP5A 2KI7A 2CS7A 2DRKA 1BYMA 2CH4W 4X34A 2KQWA 2JM9A 1NEGA 1VQKQ 4C8QE 1TOVA 3QYHB 3I35A 2DZ9A 4TVRA 3RMQA 3CCJA 1C6VX 3KFVA 2E6ZA 1YJNQ 3H6ZA 3LGFA 2HSEB 1X43A 2V8JA 3VS1A 3SB2A 1X6BA 4MDWA 2DVJA 2DD4A 4XQ3A 2NUZA 5GAMe 3EH2A 3META 1TSFA 1Q82C 3JV3A 1WI7A 3DLMA 3CC4T 2KE9A 2OI3A 5GAN2 2DRMA 2LCCA 2JOYA 3HRUA 2X4JA 1MV0B 1YIJA 4PJOF 1VQMA 5CK9A 4E7IA 3EAEA 2DETA 2KT1A 1VQOA 2EJ9A 1IXDA 7AT1B 1PSFA 4QKUA 3PNWC 1R0BG 1XTDA 3JAME 1JEGA 1IGUA 5IXBA 3FB9A 1H641 1O9SA 1SHFA 2DO3A 2IVWA 1KK7A 1U1SA 5CKDA 2PVOB 4VUBA 3GIBA 1E6HA 1VQLQ 2ZAEA 3HRTA 2BIVA 3JCMd 1KHIA 1X6OA 2GCXA 2VKNA 2QTXA 3QDRB 1YI2T 4JPBW 3CCMQ 4K11A 1ZLMA 2XI9A 2OX7A 4M78F 1QWFA 2LC4A 1K8AU 2K79A 3PIPA 2RPNA 1VQ4T 3I56A 4OMQA 3C0CA 4AG2C 1SEMA 2YXYA 5GMKi 4J6WA 4AFUC 3QJ6A 3EFSA 3LLRA 2HKNA 1GXIE 2ZPFB 2AHJB 2RNAA 3N5BB 1VQ8Q 2OTLT 1PD1A 3OYMA 2LNHB 3AT1B 1YJWA 5CKBA 3CC2Q 1N9SA 5HK0A 1BI1A 3JCMg 4FM4B 4OMLA 1I07A 3VV0A 1PCXA 2CH4A 2DL8A 3FRNA 1AVZC 3PGGA 2FZKB 2CKKA 1HD3A 3CCLT 1SG5A 1GRIA 2YLBA 2C06A 1AWWA 4KGVB 4E7HA 4BY6B 3CD6A 3A8HB 1WHMA 1FXXA 3E9FA 5A0DA 2DL3A 2LQWA 3JCMW 3HSBA 2H3JA 4PFPA 2ZPBB 1NYFA 2DJQA 3M58A 1WLPB 4FYVB 2J6FA 4OMNA 3KBGA 1SPKA 1BU1A 2YRDA 2ENMA 1Z9ZA 4C92A 1VQ5T 2FPDA 2P0QA 2FG0A 5HKCA 1H92A 3MP8A 1QVFS 1X6GA 3CCRA 4OMFB 2K7AA 2R5AA 1X69A 5FRNA 3QZ5B 1YHQA 4E7LA 3QWXX 2FHDA 1UGQB 1ZUKA 2DVEA 3M9QA 1MHNA 1UB4A 1S72T 4M7DG 3I55A 3JRZA 3A8LB 4F7UB 3CC4Q 1V76A 1HJDA 1PKTA 1MNDA 2MYSA 4EMKA 4ESRA 3PMTA 4ZGJB 2JVVA 2VYTA 3REAB 2DKGA 2RI5A 1T0HA 2KMTA 2X4WA 3FEOA 3RERA 2O9VA 3H0FA 1QCNA 3TU4K 3C12A 2V8IA 1T3LA 3EFOA 1VQ7T 1EFNA 4DEXA 4M4ZA 1M27C 3MEVA 4AT1B 4ELYC 2YSQA 2YUQA 3JCMe 5HY6A 4M78C 5KCOA 3CPWP 2A36A 1N8RR 1OYXA 1GFCA 2RQVA 3C94A 1W2BP 2IIMA 2CZ6B 1R0CB 2EBPA 3V7SA 4J9FA 4IIOA 1GCQC 2OTJA 1SF9A 4J8OA 4QQDA 2QQBA 4RMOA 4XK8E 4M77A 1OZ2A 2CUBA 2CP2A 4Z02A 3RBBB 2RHZA 2K5FA 3M56A 1OU8A 2XG8D 5DLOA 1VQ4Q 2FB7A 1WGSA 4OMOA 2CP0A 4J6XA 2Y90A 3OYYA 1RAEB 2A7YA 1X2KA 4OF1A 8AT1B 1VQ9T 5IAYA 1C0MA 4KGZB 4XU1A 2EIFA 3EGUA 1RLPC 5FW9A 2GQIA 1RI9A 5L23A 3L42A 4JS4A 2OTLQ 3BY7A 4C0DB 2CP6A 2ABLA 4L5GA 2LJ1A 2ZPHB 4M75E 2D9TA 3M55A 4A4FA 1YITA 2XICA 1AEYA 2DXBA 4C0ZA 1M2VB 2D8JA 3CMET 4OB3B 1N27A 3G4ST 2KYBA 2OAWA 2MWPA 1B3QA 1Q7YR 1GL5A 2NYSA 1EX4A 3X25B 1QVGA 1BCMA 2HMAA 1YCSB 3F70A 3CCSA 2H8HA 4JDSA 2CT4A 3CCLQ 2M0OA 4HT9A 5GMKj 3CXCA 3VS5A 3CCQA 2BE9B 3V8LA 4N4HA 4D8DA 3VS4A 1QW1A 4N4GA 1M5Q1 4XTWA 4BI4A 4J7FA 1WA7A 3GNGA 1EZZB 1HYOA 4M7AE 2KVQG 2Z0WA 2KRNA 1UGPB 1Y7XA 2QXFA 3A8GB 1K0XA 2X51A 1OOTA 3GF5A 2LX9A 4BDZA 1RAGB 3VJPA 3LH5A 1M3BA 3L2UA 3EHQA 2E10A 1PNJA 1PC0A 2RJEA 3FC3A 2L2PA 2DM1A 1D3BA 1VUBA 4BI8B 1AZEA 3URGA 1Q82R 1S72Q 3CMAT 5FRMA 1N6AA 2LQ8A 3EG9B 1K9MC 4DBRA 3M0PA 5LJ5j 1NJIU 2J6KA 4MZMA 3VYGA 2QA4T 2DL4A 4A63B 3M5AA 1TTHB 1U5SA 3CEYA 1YWPA 2HL5C 1VQNA 1M1FA 4C8QB 1N8RU 1QMCA 3EFRA 5A0GA 3RUXA 1VA7A 4C8QD 4FYXB 2GNCA 2QTVA 4RTYA 1D1BA 1A0NB 4BY6C 2CT3A 2AKKA 1G83A 4BACA 1Q81C 4C92B 3A8MB 2KY9A 5KYNA 1M2OA 3SWNB 3FJPA 4AFQC 4C92D 2F1LA 4LUEA 2F2VA 3ZEHA 2YT6A 1YJNT 1PRLC 4R56A 3TCJA 4GLMA 1RLQC 1W1FA 2BZ8A 1MGQA 4FW1A 4ATOA 2HQEA 2LJ0A 2LNVA 4XTUA 2JJ9A 1HK9A 3A1PA 1M8VA 1UGSB 5AT1B 4M7DF 2VC8A 4NS5A 2D8HA 4M78G 2XIDA 2HKQB 4ORZA 1RADB 5LL6S 2ED1A 3Q1JA 2RD1A 1LOJA 2K4YA 3JB9D 5KH6A 2PVDB 4JUVA 2ZCFB 5J3BA 2DAQA 3CCJT 2OAUA 1NPRA 1JU5C 1G2BA 1Q7YU 5CKEA 2CZ7B 2E6NA 1JBMA 3CMEQ 3JCMc 3G4SQ 1XOVA 1N8RC 4L59A 2DFUA 2WSEE 4RTWA 4QW2A 1H8KA 5IHIA 3VS0A 3PMIA 4A4HA 4M77D 2KAFA 4FW2A 4ZGEB 4LD6A 3L2WA 1QCOA 1ZUYA 1F1BB 2RHIA 3SD4A 4E2FB 2LT1A 1ZBXA 4BE0A 1VQOT 1D09B 2K5LA 5HK3A 3H9NA 2DA9A 2PTKA 3RESA 2RQTA 4DA4A 4C92F 3SEMA 3TSWA 4LDWA 1XJWB 4E7KA 1Q82U 3QPHA 6AT1B 2FVUA 1XNIA 3VUZA 1ZBJA 3OW2A 4E7ZA 2AT1B 2COZA 5M9OA 5CAIA 2DXUA 5I21A 3HKSA 1PSEA 4C0GA 5LJ3j 3CMAQ 4C0DC 4V2SA 3V7CA 3OYHA 2JS0A 3JCMX 2EWNA 3CBMA 1RAAB 1AHJB 2EQMA 4GY5A 1MUZA 5LJ5d 1I4K1 3I56T 4F7UA 2LCLA 5FROA 3L2QA 3E1SA 4UC4A 1VQKA 4BI3A 3O8VA 4YTLA 3OYAA 2QEXA 4FT2A 3EGDB 2FRYA 3EG1A 3VS7A 2LRQA 5CR2A 1BKBA 4LE9A 2HBWA 3PT9A 2V1RA 3QG1A 3T9NA 1JXOA 2DL5A 2KXCA 3V8KA 2M16A 3QO3A 2EYYA 2E5QA 3E19A 2CSIA 3M0RA 5L8RE 2WACA 3QKJA 3S3OA 1D3BB 2EYXA 5I22A 4M77F 3PVQA 1YFNA 2HD0A 2J06A 1NG2A 2X3WD 2IG0A 3ASKA 2EPDA 4B9WA 2HDAA 1M90R 1UGRB 1ZSZB 2FYKA 2QG9B 3MP1A 2O88A 1OI1A 3TEEA 3NGPA 2L3PA 3CBPA 3SDZA 3G1JA 2E5KA 3L2ZA 1LVKA 2DNUA 2WSCE 1KQSA 1ZA1B 1AWOA 1M8MA 3NTHA 1RAIB 1V1CA 4DBQA 3OBWA 3QJYA 2JZ2A 1GCPA 1PKSA 3CCVT 5GMKh 1OQKA 2YRVA 3CCJQ 2RI3A 1VQPA 1RACB 2V8KA 3JCMb 2RA2A 3GNFB 1Y07A 4FSXA 3GLXA 3M0QA 4Y92A 1N9RA 2KR3A 1YCYA 1YHQT 4LXCA 2DTOA 4HKEA 2ZPGB 3BW1A 5HCKA 3MCAB 2PUOB 4ZTFA 5I2MA 5GANj 3I55T 5KYWB 4JS5A 2K6DA 2DMOA 4C92C 1M2VA 1AWXA 2HQXA 1WDXA 3P8HA 1QP3A 1UUEA 2FEIA 3HP9A 1RL2A 2CGHA 4QQGA 1TH7A 2E65A 2ED0A 2LZ6B 4JJDA 2GQVA 1IGQA 1VQOQ 1X2QA 1P92A 4WF2A 3BE3A 2F2WA 4EMKC 4O5VA 2CP5A 1XQHA 1M3AA 2LT4A 3QSUA 2BE7D 4JRQA 5LJ5h 3CC2A 2XD0A 2EVRA 1WYXA 5CCAA 4RUGA 1OX8A 4IUTA 4LDXA 2E12A 2EYQA 3CCUA 2GGRA 1R8OB 3EHRA 2DPPB 3EG0A 3FDRA 4EMGA 2VXEA 3E2UA 2O9SA 5LJ3d 1K9MR 2J05A 3H41A 2DBMA 3MEWA 4IUPA 1FMVA 4LUDA 2NUTB 3CPWS 2A0FB 3DB3A 5C0MA 3I56Q 1UECA 4IUQA 3EG9A 4M77C 1W2BS 4PJOE 1IO6A 5AYFA 2D1XA 1E6GA 3I9QA 2VUBA 2O2OA 4A53A 2DX1A 2MF2A 1YJ9T 1PRMC 4NOYA 4CRIA 3NTKA 5J39A 1K73C 2KRSA 2SRCA 5J26A 4C8QA 4JZ4A 1Q81R 5FWCA 3LYIA 2MMPA 1YITT 2IPOB 3RKXA 3JCMP 3DLLA 2CREA 5GAN3 4ANJA 3OS0A 4FCYA 3CC4A 1QVGP 3MJXA 3CC7A 1OZ3A 2MWOA 3SWNA 2V26A 1MMAA 2AZVA 1W6XA 4RTVA 4OB0B 3CXCP 4D8KA 2CSQA 1Q86C 1K9AA 1JXMA 5KE2A 2ROLA 4M78E 2YUPA 2R5MA 1MNEA 2QQSA 3QBYA 4CC4B 2LQKA 3G71T 2CP7A 2BKDN 2LTOA 1HSQA 4P5NA 4BUGA 3JB9I 3O5ZA 3EG2A 3CCVQ 1Y57A 1I5LA 2QGGA 3X28B 2O01E 4PJNA 4FU6A 1KHCA 3LWHA 3CCRQ 3ZBDA 5CKFA 1YHQQ 1YI2A 3LH0A 2DXCA 2MIOA 3HL8A 1VYTA 2X35A 4D6WA 2DIGA 3I55Q 2P84A 4RKUE 3LW5E 1OV3A 1VQ4A 3M57A 2RH2A 4HVWA 1TU0B 3RKWA 1U3OA 2PUKB 4QVCA 2M0YA 4PKCC 4AFSC 3OYNA 1K1ZA 1OPKA 3TREA 1OULA 4J9GA 4C8QG 1M90C 2C0TA 1I81A 5LJ3h 2X4YA 4FT4A 2OTLA 1HXDA 3OSSC 5LJ5f 1M1GA 5FWBA 2A3LA 5GAOn 4C92G 4C5IA 3UPUA 2RM4A 2ROTA 1K76A 3UA6A 1MMDA 4MZTA 2O31A 4HXJA 2YLCA 2P0PA 3OS1A 2EQKA 1K9MU 4DBHA 1UG1A 1G8XA 2RF0A 1KIKA 2FL7A 2KXDA 1VQ6T 3CCLA 5GAMj 4RTUA 1JJ2P 2RK1A 4C0FA 2X9HA 2XDBA 1CKAA 4LDUA 3OW2S 5GAN7 4F7UF 2G3RA 2DJZA 1M1KR 2M51A 5DM7R 3QWYA 4OGEA 3JB9G 3IQLA 3HTRA 5IT9E 4HCZA 3REBB 1G3WA 1Q81U 3PE0A 2VV5A 4XU0A 1FX7A 1RAFB 1YJ9Q 1B34A 1VQ5A 4OMPA 3CCET 4RG2A 1R77A 4WTOB 2YUOA 4PLIA 1U1TA 2RI2A 2L3RA 1Y0MA 4XTXA 3EGDA 1YITQ 2FZGB 2HSPA 3OS5A 1UEBA 5KYYA 1S72A 1OEBA 2E3IA 5C6SA 1ZSGA 3U23A 2VWFA 4M77G 2DILA 1KD1R 3CCSQ 2GF7A 1D1AA 3DKMA 5GMKm 1RABB 1VIFA 3CCQQ 3OYDA 2O4XB 5CO7A 3M53A 4CC3A 3MPUB 2H3EB 1VQ7A 1TUDA 2EQIA 2L89A 1KC8R 2P0KA 5GANh 3NPFA 1ZSZA 2QASA 1K4US 3G71Q 1Y96B 1IZ6A 4C5HA 2QK0A 5CQYA 1AWJA 4HCCA 1SHGA 2JMCA 3CBOA 3OYFA 3G6EA 2GFUA 3R6OA 2HL3A 4A4GA 3CQTA 3PIOA 1ACMB 1D1CA 3OW2P 3QXEB 2EFIA 1G3TA 1RAHB 2WSFE 3M4YA 1PHTA 1ZX6A 2X4XA 4PJMA 1O75A 2L8DA 2V1QA 3OYJA 2SEMA 2JT4A 4NL3A 1VQ9A 2R57A 4EIKA 1Q95G 4JLIA 1JJ2A 1UJYA 5KYWA 2K3XA 4JJBA 2EGEA 1N5ZA 3G7ZA 5LJ3f 1VQNQ 4IKFA 1UHCA 2JW4A 2K57A 1GBQA 1RI0A 2R58A 1ZUUA 1B07A 1D0ZA 4PFZA 3G4SA 2RHUA 3JB9J 2YDLA 4LD9K 2XK0A 4M75A 1V29B 1J3TA 3VRZA 4RTZA 1CKBA 1LJOA 4ZNXA 2XDDA 1WIEA 3VKIA 2RJDA 2J6OA 5GJVB 1VQ6Q 5IH2A 2QDYB 3QZ9B 3OYEA 5GAMd 3UT1A 1IREB 4HT8A 2GTJA 4PJLA 2L0AA 2LQNA 3HRSA 4JRKA 3J81E 1MMNA 3M54A 4CC2A 1BBZA 5GMKl 2YRCA 4XTVA 2RQUA 1WJSA 1TWBA 2C0OA 2BTTA 1PM3A 1M9SA 2QQAA 1KQSP 1UTIA 1ABQA 5KE3A 1YIJT 1ZA2B 1WXBA 1VQMT 2DYIA 2QAZA 2NUTA 4M7AA 1BI3A 4C8QF 1KFZA 1K73R 1QKXA 3CCEQ 2PQWA 2COYA 4J9EA 1VQPT 4F14A 1UJ0A 2DIQA 2W0ZA 2BZYA 1OU9A 2B86A 4IUVA 4Z89A 1OX9A 2EJGA 2C0IA 1LPLA 5CVIA 1KQ2A 1S1NA 3S3NA 2JTMA 4E7JA 1WHGA 4N0AA 1AD5A 2QA4A 4HCBA 1C1AA 4F16A 1Q86R 4PJOB 4II1A 2RB6A 5IHNA 3JCMJ 4AFZC 2LDMA 2QDLA 1QVPA 4OGCA 4PJOD 2XHCA 4F04B 2HNIA 2YHTA 4J5YA 1K8AR 4M7DE 5GANf 4LNPA 2EGCA 4QT7A 3UDCA 5I2SA 1G5VA 3KXTA 2DZCA 1M1KC 3JB9F 3OMGA 4A4EA 1TUCA 1BI0A 1M30A 3GBQA 3QYGB 1B34B 2FRWA 3QDFA 3GPLA 4DOWA 3BDLA 1YP5A 4JLGA 1YJNA 2K2VA 5KYYB 3E9GA 3CCUT 3M59A 1U06A 4E6RA 1VYUA 3LWIA 2JUFA 1M4ZA 2QYZA 4ZGDB 4XTYA 2M9UA 2JXBA 1YJWT 2KBTA 3EGXA 3RMSA 1X75C 4KH1B 4J83A 2D0QB 3OYIA 2JTEA 3H8ZA 4RCCA 4B6MA 2FPEA 3NHNA 1KD1C 2L3QA 2PZ1A 2W10A 2DTHA 4JJNK 1WNLA 1X27A 4MMKA 5GAMh 2K9GA 1SSFA 3CD6T 2QEXQ 5LJ5g 1I1JA 3MEAA 2EW3A 1H3HA 1IRXA 4OB2B 4EMHA 1KC8C 2VXFA 3M0UA 4X1VA 3NMZC 2HQHA 1BIAA 1NYGA 3BFMA 1SRLA 4C92E 1VQLA 3OYLA 4XU3A 3OQ5A 1UE9A 4PFOA 3VRYA 1IHWA 3WXMB 5FU6B 2QQ9A 2ZGWA 3QIIA 4JRPA 2EKOA 3OYBA 3CC7T 2EGAA 4C8QC 1LCKA 2JM8A 2F2XA 2FO0A 3CCRT 3EG3A 1FMWA 1RUWA 1KSWA 2DTIA 3CCMA 4F7UG 5GMKe 2MI6A 4KGXB 3HFNA 3SWNC 3WVDB 1VYVA 3HPWA 1K73U 2F5KA 2L5QA 3OA6A 3ULRB 4DQ2A 4BB7A 1YIJQ 2E3HA 1VQMQ 2ATCB 1D0YA 2QGFB 1QVGS 2VASA 5IXFA 5GAN8 3S6WA 3TQ7P 1VOMA 5CKHA 2Y4YA 3VYHB 1VQPQ 3H0HA 3CXCS 1VQ8A 2KRMA 4M75B 2KEAA 2LVMA 4FYYB 2DE0X 4M75D 4BE2A 3D7SB 3THKA 1D0XA 1QLYA 1Q86U 1WQWA 1WHLA 3DB4A 4E47A 5A2QE 2GBQA 4M77E 3A98A 3OS2A 4Y91A 2RMOA 2BUDA 2OTJT 4M7DA 5EC7A 3AHUA 3MKDA 2KK4A 5LJ5e 1KQ1A 4E7SA 4EPCA 2M1HA 4XAXB 3OMCA 1QP2A 1ARKA 3ME9A 4KULA 4XTZA 2MCNA 3NFCA 2EAYA 5EG2A 4A4KA 2A08A 2O4XA 2AKLA 4M7AB 1M3CA 5A0LA 1BIBA 1JQQA 1BK2A 3L2VA 1YBYA 4M7AD 3OSVA 2EJFA 3I5RA 1W70A 3SHWA 5DLQE 2E64A 2KROA 2AIRB 1QWEA 4DOVA 3L2RA 2CYZB 1Y96A 1U8RA 4MZPA 3ZL7C 3CCUQ 1WJRA 2VVKA 2MAMA 1K0SA 2DD5A 2DEQA 3FJ5A 3MP6A 3ZFJA 4PLLA 5GAOq 1YJWQ 2CDTA 1SKUB 1M90U 1TUGB 1YNZA 2PNIA 2KNBB 2HCKA 2CZ0B 4Z88A 2CUDA 2LX7A 1UHFA 3CCST 5GAMf 4HVUA 3RR6A 3J7AF 1WXTA 2QQRA 5LJ3g 2ESWA 2JNGA 3X20B 3I5SA 2MPXC 2AZSA 3CCQT 1NPPA 3CCVA 3CD6Q 3PFSA 5GAOp 4BD3A 4PJOC 1K8AC 1KJWA 1JJ2S 2A37A 3FLGA 1VIEA 4OVAA 4M75F 4PJJA 4KBMB 2HAXA 4KT0E 2RQWA 3INZA 3MEUA 2M02A 4RG8A 2YUNA 3V7RA 1W4SA 4R55A 4FL6A 2RHXA 1WJQA 3R6NA 2DK3A 3CC7Q 4KUDK 3EGXB 3JCMh 1UDLA 2VGNA 2CP3A 2NUPA 5GAN4 4WCIA 5GANd 3OB9A 1NJIR 4C5GA 5KYXA 2GFAA 4M7AF 4RCBA 2DLPA 2DF6A 4F17A 4ZTJA 1OPLA 3CPFA 1DJ7B 3RIRA 3OBYA 2DYBA 4HVVA 1VQNT 1PG5B 1WZOA 1WXUA 2XDPA 3G6ET 5KYUA 3JSCA 3A8OB 3J80E 4J9CA 4Q5WA 1ZSZC 2OJ2A 4R0KA 5IN1A 2KSSA 5FLXE 1NM7A 4IUUA 4LDYA 1YI2Q 3RKYA 4EDUA 2QI2A 3PVLA 2YWWA 1T0JA 4OP0A 1QKWA 2EKHA 5LJ3e 3GOXA 3UA7A 2OTJQ 4ZN3A 4L6V5 4ZN1A 2G6FX 5GAN5 4IURA 5FU6C 1FMKA 3TSZA 1QVFP 3ER0A 2EQUA 4QQ6A 5GANg 1YJ9A 2J7IA 5FU7B 1CSKA 1PD0A 4ME7A 4GLKA 4J7IA 2X3XD 4PJOA 1WHKA 8ATCB 2RN8A 2RO0A 2KGTA 1BCOA 4JRIA 1NLOC 2JTFA 4FIBA 2JN0A 3X26B 1NBEB 4RTXA 3VS6A 1GBRA 4Z8AA 5GAOm 5D6XA 2BZXA 2HEQA 2A28A 4X9CA 1EIFA 2XKOC 5I11A 2EYZA 1Y71A 3JCMQ 1AOJA 4M75C 4M7DB 3M0SA 4B9XA 1QCFA 3JCMV 4M7DD 2ECZA 4GBQA 1Z9QA 1TXQA 2EYWA 3UF4A 4OMMA 1MV3A 1G3YA 1MMGA 3G71A 4M78A 4JJCA 2NLUA 4LDVA 3EH1A 1ZHIA 1I0CA 2P4RA 2I2LA 5KCHA 3LGLA 3P8DA 1VQ5Q 2VB6A 4DEYA 1GCQA 4CC7A 4X9DA 2CZ1B 1NZ9A 2RJCA 1YWOA 4PK4A 1BB9A 3CPWA 4Y28E 3JB9H 2D6FA 4M7AC 3C95A 4J9HA 4J9BA 1B7TA 3HFOA 1W2BA 3JCMf 2FZCB 4LN2A 1KQSS 2E4HA 2F5TX 3VUBA 3A5ZB
chains in the Genus database with same CATH topology
2RQVA 1E7OA 1M3AA 1AZGB 2IIMA 4LNPA 2EGCA 2EBPA 1PWTA 2AK5A 1UGVA 4QT7A 1SRMA 4J9FA 2RQRA 4IIOA 2EVRA 1GCQC 2LMJA 3UATA 1WYXA 4J9IA 2JMAA 1TUCA 4RUGA 1M30A 2LCSA 3GBQA 2FRWA 2CUBA 3VS2A 3RBBB 2GGRA 3EHRA 3EG0A 1YP5A 5IHKA 4OMOA 4FSSA 2O9SA 1U06A 4E6RA 1VYUA 2J05A 2KT8A 1X2KA 3H41A 1GFDA 2DBMA 3M0TA 1NEBA 4J9DA 2JXBA 4LUDA 2KBTA 2D0NA 1UECA 3EGUA 1RLPC 5FW9A 2GQIA 1RI9A 5L23A 1IO6A 1UFFA 1E6GA 2KYMA 2D1XA 2ABLA 3I9QA 2JTEA 2O2OA 2LJ1A 2FPEA 3NHNA 2DX1A 2L3QA 1PRMC 1WX6A 2PZ1A 2W10A 1AEYA 1X27A 2KRSA 2D8JA 2SRCA 4JZ4A 2KYBA 2OAWA 5FWCA 2K9GA 1B3QA 1GL5A 2I0NA 1I1JA 2EW3A 1YCSB 1H3HA 2H8HA 2CT4A 2CREA 3M0UA 4X1VA 3NMZC 1NYGA 1SRLA 3VS5A 4D8DA 1ABOA 2AZVA 1UE9A 1WFWA 3VS4A 2K3BA 3VRYA 1W6XA 1T3SA 4RTVA 3RNJA 4D8KA 2CSQA 1K9AA 1WA7A 2EGAA 4IIMA 1LCKA 2JM8A 2F2XA 2KRNA 2FO0A 1JXMA 3EG3A 2ROLA 1RUWA 4HCKA 2YUPA 1K0XA 1OOTA 1KSWA 4CC4B 5GJWB 2GTOA 3LH5A 1M3BA 1NLPC 3EHQA 1SSHA 1PNJA 1HSQA 1VYVA 1YN8A 3O5ZA 2L2PA 3EG2A 2DM1A 2JS2A 4KRTA 3ULRB 1Y57A 2MOXA 1AZEA 1FYNA 5IXFA 1JO8A 2FPFA 2XMFA 3VS3A 4JZ3A 3M0PA 3H0HA 2KRMA 2MIOA 4RTTA 1VYTA 2KEAA 2J6KA 2DE0X 2DL4A 4A63B 1OV3A 3H0IA 2QDLA 1U5SA 4HVWA 1YWPA 3THKA 1QLYA 1U3OA 2L3SA 2M0YA 1VA7A 2GBQA 4AFSC 1K1ZA 2GNCA 3A98A 1OPKA 2RMOA 4RTYA 4J9GA 1A0NB 4AG1C 2CT3A 2C0TA 2AKKA 2K2MA 5EC7A 1G83A 4AFQC 5FWBA 1ARKA 4LUEA 2MCNA 2LJ3A 2F2VA 2YT6A 2A08A 1PRLC 2ROTA 2DBKA 1K76A 2AKLA 2NWMA 3UA6A 4GLMA 1M3CA 2O31A 1JQQA 4HXJA 1BK2A 1RLQC 3TVTA 5ECAA 1W1FA 2BZ8A 2LJ0A 1UG1A 2RF0A 1KIKA 2KXDA 2DL7A 3I5RA 1W70A 3SHWA 1TG0A 2LP5A 2KROA 4RTUA 1QWEA 2D8HA 2DRKA 4ORZA 2CH4W 3ZL7C 2VVKA 1K0SA 2JM9A 2ED1A 1CKAA 1NEGA 3FJ5A 3I35A 3KFVA 2M51A 2CDTA 3QWYA 1X43A 3VS1A 3IQLA 1X6BA 1YNZA 2DVJA 2PNIA 2KNBB 2HCKA 3REBB 1JU5C 4Z88A 1G2BA 2CUDA 2NUZA 2LX7A 3PE0A 1UHFA 3JV3A 1WI7A 4HVUA 1WXTA 2KE9A 4OMPA 2ESWA 2OI3A 3I5SA 2DRMA 2YUOA 2AZSA 1XOVA 4RTWA 1MV0B 1Y0MA 1H8KA 1KJWA 5IHIA 3VS0A 2HSPA 2A37A 1OEBA 1ZSGA 3U23A 2KT1A 2RQWA 2VWFA 2DILA 2YUNA 1JEGA 1ZUYA 5IXBA 3R6NA 1SHFA 1E6HA 1UDLA 2DA9A 4CC3A 2PTKA 2RQTA 1TUDA 2EQIA 3SEMA 3TSWA 3NPFA 4WCIA 1K4US 2VKNA 1ZBJA 1AWJA 4JPBW 4K11A 1ZLMA 1SHGA 2DLPA 2JMCA 2DF6A 4F17A 1OPLA 3CQTA 1QWFA 2K79A 2RPNA 2DYBA 4HVVA 4OMQA 1WXUA 3C0CA 1PHTA 1ZX6A 1SEMA 4AG2C 2JS0A 4AFUC 4J9CA 1MUZA 2OJ2A 4R0KA 1NM7A 2V1QA 2RNAA 2SEMA 2JT4A 4EIKA 3PVLA 1UJYA 1T0JA 2LNHB 1QKWA 2FRYA 3EG1A 2EKHA 2EGEA 1N5ZA 4JJBA 3VS7A 4LE9A 3UA7A 2HBWA 2V1RA 2G6FX 1UHCA 4OMLA 1JXOA 1I07A 2DL5A 2KXCA 2JW4A 3TSZA 1FMKA 2CH4A 2DL8A 2EYYA 1GBQA 1AVZC 2CSIA 3M0RA 2J7IA 1CSKA 1ZUUA 1HD3A 1B07A 2EYXA 2X3XD 5I22A 1GRIA 3PVQA 2J06A 1NG2A 1AWWA 2RN8A 2X3WD 2YDLA 1J3TA 3VRZA 2KGTA 4RTZA 1CKBA 2EPDA 1NLOC 4ZNXA 1WIEA 2DL3A 5GJVB 2J6OA 2HDAA 2LQWA 5IH2A 4RTXA 3VS6A 1GBRA 4Z8AA 2O88A 2GTJA 2L0AA 2LQNA 1NYFA 2DJQA 3NGPA 1WLPB 2L3PA 2E5KA 2BZXA 2HEQA 2J6FA 4OMNA 4CC2A 2A28A 1BBZA 2DNUA 1SPKA 1BU1A 5I11A 2EYZA 1AWOA 2ENMA 1M8MA 1Z9ZA 2RQUA 2FPDA 2FG0A 1H92A 1V1CA 1AOJA 2C0OA 2BTTA 1X6GA 3M0SA 1GCPA 2K7AA 1PKSA 1X69A 1UTIA 1QCFA 1ABQA 3QWXX 1WXBA 2ECZA 1ZUKA 4GBQA 1Z9QA 2EYWA 3UF4A 4OMMA 1MV3A 3M0QA 1KFZA 1QKXA 4JJCA 4Y92A 2KR3A 1HJDA 1PKTA 4J9EA 4F14A 5HCKA 1UJ0A 4ESRA 1I0CA 2P4RA 3REAB 2W0ZA 2K6DA 2BZYA 2DMOA 1T0HA 4DEYA 1GCQA 2B86A 1AWXA 4CC7A 2O9VA 4Z89A 3H0FA 1WDXA 2C0IA 1YWOA 1UUEA 2FEIA 1BB9A 1T3LA 1S1NA 1EFNA 4DEXA 4M4ZA 1M27C 2ED0A 1AD5A 2YSQA 2LZ6B 2YUQA 4J9BA 4J9HA 4JJDA 4F16A 1X2QA 2A36A 4LN2A 5IHNA 2F2WA 4AFZC 1GFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQV A;  1E7O A;  1M3A A;  1AZG B;  2IIM A;  4LNP A;  2EGC A;  2EBP A;  1PWT A;  2AK5 A;  1UGV A;  4QT7 A;  1SRM A;  4J9F A;  2RQR A;  4IIO A;  2EVR A;  1GCQ C;  2LMJ A;  3UAT A;  1WYX A;  4J9I A;  2JMA A;  1TUC A;  4RUG A;  1M30 A;  2LCS A;  3GBQ A;  2FRW A;  2CUB A;  3VS2 A;  3RBB B;  2GGR A;  3EHR A;  3EG0 A;  1YP5 A;  5IHK A;  4OMO A;  4FSS A;  2O9S A;  1U06 A;  4E6R A;  1VYU A;  2J05 A;  2KT8 A;  1X2K A;  3H41 A;  1GFD A;  2DBM A;  3M0T A;  1NEB A;  4J9D A;  2JXB A;  4LUD A;  2KBT A;  2D0N A;  1UEC A;  3EGU A;  1RLP C;  5FW9 A;  2GQI A;  1RI9 A;  5L23 A;  1IO6 A;  1UFF A;  1E6G A;  2KYM A;  2D1X A;  2ABL A;  3I9Q A;  2JTE A;  2O2O A;  2LJ1 A;  2FPE A;  3NHN A;  2DX1 A;  2L3Q A;  1PRM C;  1WX6 A;  2PZ1 A;  2W10 A;  1AEY A;  1X27 A;  2KRS A;  2D8J A;  2SRC A;  4JZ4 A;  2KYB A;  2OAW A;  5FWC A;  2K9G A;  1B3Q A;  1GL5 A;  2I0N A;  1I1J A;  2EW3 A;  1YCS B;  1H3H A;  2H8H A;  2CT4 A;  2CRE A;  3M0U A;  4X1V A;  3NMZ C;  1NYG A;  1SRL A;  3VS5 A;  4D8D A;  1ABO A;  2AZV A;  1UE9 A;  1WFW A;  3VS4 A;  2K3B A;  3VRY A;  1W6X A;  1T3S A;  4RTV A;  3RNJ A;  4D8K A;  2CSQ A;  1K9A A;  1WA7 A;  2EGA A;  4IIM A;  1LCK A;  2JM8 A;  2F2X A;  2KRN A;  2FO0 A;  1JXM A;  3EG3 A;  2ROL A;  1RUW A;  4HCK A;  2YUP A;  1K0X A;  1OOT A;  1KSW A;  4CC4 B;  5GJW B;  2GTO A;  3LH5 A;  1M3B A;  1NLP C;  3EHQ A;  1SSH A;  1PNJ A;  1HSQ A;  1VYV A;  1YN8 A;  3O5Z A;  2L2P A;  3EG2 A;  2DM1 A;  2JS2 A;  4KRT A;  3ULR B;  1Y57 A;  2MOX A;  1AZE A;  1FYN A;  5IXF A;  1JO8 A;  2FPF A;  2XMF A;  3VS3 A;  4JZ3 A;  3M0P A;  3H0H A;  2KRM A;  2MIO A;  4RTT A;  1VYT A;  2KEA A;  2J6K A;  2DE0 X;  2DL4 A;  4A63 B;  1OV3 A;  3H0I A;  2QDL A;  1U5S A;  4HVW A;  1YWP A;  3THK A;  1QLY A;  1U3O A;  2L3S A;  2M0Y A;  1VA7 A;  2GBQ A;  4AFS C;  1K1Z A;  2GNC A;  3A98 A;  1OPK A;  2RMO A;  4RTY A;  4J9G A;  1A0N B;  4AG1 C;  2CT3 A;  2C0T A;  2AKK A;  2K2M A;  5EC7 A;  1G83 A;  4AFQ C;  5FWB A;  1ARK A;  4LUE A;  2MCN A;  2LJ3 A;  2F2V A;  2YT6 A;  2A08 A;  1PRL C;  2ROT A;  2DBK A;  1K76 A;  2AKL A;  2NWM A;  3UA6 A;  4GLM A;  1M3C A;  2O31 A;  1JQQ A;  4HXJ A;  1BK2 A;  1RLQ C;  3TVT A;  5ECA A;  1W1F A;  2BZ8 A;  2LJ0 A;  1UG1 A;  2RF0 A;  1KIK A;  2KXD A;  2DL7 A;  3I5R A;  1W70 A;  3SHW A;  1TG0 A;  2LP5 A;  2KRO A;  4RTU A;  1QWE A;  2D8H A;  2DRK A;  4ORZ A;  2CH4 W;  3ZL7 C;  2VVK A;  1K0S A;  2JM9 A;  2ED1 A;  1CKA A;  1NEG A;  3FJ5 A;  3I35 A;  3KFV A;  2M51 A;  2CDT A;  3QWY A;  1X43 A;  3VS1 A;  3IQL A;  1X6B A;  1YNZ A;  2DVJ A;  2PNI A;  2KNB B;  2HCK A;  3REB B;  1JU5 C;  4Z88 A;  1G2B A;  2CUD A;  2NUZ A;  2LX7 A;  3PE0 A;  1UHF A;  3JV3 A;  1WI7 A;  4HVU A;  1WXT A;  2KE9 A;  4OMP A;  2ESW A;  2OI3 A;  3I5S A;  2DRM A;  2YUO A;  2AZS A;  1XOV A;  4RTW A;  1MV0 B;  1Y0M A;  1H8K A;  1KJW A;  5IHI A;  3VS0 A;  2HSP A;  2A37 A;  1OEB A;  1ZSG A;  3U23 A;  2KT1 A;  2RQW A;  2VWF A;  2DIL A;  2YUN A;  1JEG A;  1ZUY A;  5IXB A;  3R6N A;  1SHF A;  1E6H A;  1UDL A;  2DA9 A;  4CC3 A;  2PTK A;  2RQT A;  1TUD A;  2EQI A;  3SEM A;  3TSW A;  3NPF A;  4WCI A;  1K4U S;  2VKN A;  1ZBJ A;  1AWJ A;  4JPB W;  4K11 A;  1ZLM A;  1SHG A;  2DLP A;  2JMC A;  2DF6 A;  4F17 A;  1OPL A;  3CQT A;  1QWF A;  2K79 A;  2RPN A;  2DYB A;  4HVV A;  4OMQ A;  1WXU A;  3C0C A;  1PHT A;  1ZX6 A;  1SEM A;  4AG2 C;  2JS0 A;  4AFU C;  4J9C A;  1MUZ A;  2OJ2 A;  4R0K A;  1NM7 A;  2V1Q A;  2RNA A;  2SEM A;  2JT4 A;  4EIK A;  3PVL A;  1UJY A;  1T0J A;  2LNH B;  1QKW A;  2FRY A;  3EG1 A;  2EKH A;  2EGE A;  1N5Z A;  4JJB A;  3VS7 A;  4LE9 A;  3UA7 A;  2HBW A;  2V1R A;  2G6F X;  1UHC A;  4OML A;  1JXO A;  1I07 A;  2DL5 A;  2KXC A;  2JW4 A;  3TSZ A;  1FMK A;  2CH4 A;  2DL8 A;  2EYY A;  1GBQ A;  1AVZ C;  2CSI A;  3M0R A;  2J7I A;  1CSK A;  1ZUU A;  1HD3 A;  1B07 A;  2EYX A;  2X3X D;  5I22 A;  1GRI A;  3PVQ A;  2J06 A;  1NG2 A;  1AWW A;  2RN8 A;  2X3W D;  2YDL A;  1J3T A;  3VRZ A;  2KGT A;  4RTZ A;  1CKB A;  2EPD A;  1NLO C;  4ZNX A;  1WIE A;  2DL3 A;  5GJV B;  2J6O A;  2HDA A;  2LQW A;  5IH2 A;  4RTX A;  3VS6 A;  1GBR A;  4Z8A A;  2O88 A;  2GTJ A;  2L0A A;  2LQN A;  1NYF A;  2DJQ A;  3NGP A;  1WLP B;  2L3P A;  2E5K A;  2BZX A;  2HEQ A;  2J6F A;  4OMN A;  4CC2 A;  2A28 A;  1BBZ A;  2DNU A;  1SPK A;  1BU1 A;  5I11 A;  2EYZ A;  1AWO A;  2ENM A;  1M8M A;  1Z9Z A;  2RQU A;  2FPD A;  2FG0 A;  1H92 A;  1V1C A;  1AOJ A;  2C0O A;  2BTT A;  1X6G A;  3M0S A;  1GCP A;  2K7A A;  1PKS A;  1X69 A;  1UTI A;  1QCF A;  1ABQ A;  3QWX X;  1WXB A;  2ECZ A;  1ZUK A;  4GBQ A;  1Z9Q A;  2EYW A;  3UF4 A;  4OMM A;  1MV3 A;  3M0Q A;  1KFZ A;  1QKX A;  4JJC A;  4Y92 A;  2KR3 A;  1HJD A;  1PKT A;  4J9E A;  4F14 A;  5HCK A;  1UJ0 A;  4ESR A;  1I0C A;  2P4R A;  3REA B;  2W0Z A;  2K6D A;  2BZY A;  2DMO A;  1T0H A;  4DEY A;  1GCQ A;  2B86 A;  1AWX A;  4CC7 A;  2O9V A;  4Z89 A;  3H0F A;  1WDX A;  2C0I A;  1YWO A;  1UUE A;  2FEI A;  1BB9 A;  1T3L A;  1S1N A;  1EFN A;  4DEX A;  4M4Z A;  1M27 C;  2ED0 A;  1AD5 A;  2YSQ A;  2LZ6 B;  2YUQ A;  4J9B A;  4J9H A;  4JJD A;  4F16 A;  1X2Q A;  2A36 A;  4LN2 A;  5IHN A;  2F2W A;  4AFZ C;  1GFC A; 
#chains in the Genus database with same CATH topology
 2DER A;  1E7O A;  5GAN e;  1X01 A;  1AZG B;  2Y4X A;  1PWT A;  2AK5 A;  4PJO G;  1UGV A;  1SRM A;  4O6J A;  2RQR A;  2LMJ A;  3VU3 C;  3UAT A;  4J9I A;  2JMA A;  1AT1 B;  2LCS A;  4F7U E;  1IHV A;  1VQ7 Q;  3VS2 A;  3MHX A;  1WQ7 A;  1WHJ A;  4N0A C;  2P4T A;  2E70 A;  2PU9 B;  2F69 A;  2HBP A;  1QVF A;  5CQX A;  4AMC A;  5IHK A;  4FSS A;  1VQK T;  2KT8 A;  3G6E Q;  1GFD A;  4QVZ A;  3M4G A;  2QEX T;  4HA8 A;  3M0T A;  1NEB A;  4J9D A;  1VQ6 A;  5GAO l;  3RDV A;  2RHY A;  2DXT A;  2D0N A;  3GP8 A;  1LNX A;  3OY9 A;  3CME A;  2XU8 A;  4EMK B;  1UFF A;  2K5I A;  2KYM A;  1BI2 A;  1WX6 A;  4QVD A;  3KUF A;  3QUI A;  1IB8 A;  2NUP B;  1KG1 A;  3X24 B;  1M1K U;  2HZY A;  5CIU A;  1VQ9 Q;  3OYK A;  4MDX A;  4PNO A;  2I0N A;  3EFO B;  5KYX B;  3WVE B;  3OYC A;  1WPY A;  3CCE A;  2K3Y A;  3SFM A;  1NJI C;  4J6Y A;  1NE8 A;  1ABO A;  1WFW A;  2K3B A;  3HHT B;  1T3S A;  5KYU B;  3RNJ A;  1TS9 A;  4BDY A;  2VGM A;  3LX7 A;  4IIM A;  1VQL T;  4OB1 B;  4M77 B;  4HCK A;  5GJW B;  3C4S A;  2GTO A;  1KD1 U;  2E1H A;  4N4I A;  1NLP C;  3QHS A;  1SSH A;  4NL2 A;  3CMA A;  1G3S A;  3P8B B;  2KDS A;  5D6Y A;  1YN8 A;  2COW A;  3CCM T;  1I5O B;  2JS2 A;  4KRT A;  2MOX A;  9ATC B;  1FYN A;  1JRI A;  2E41 A;  1WHH A;  5GAM g;  1JO8 A;  2FPF A;  2MK5 A;  4C5E A;  2XMF A;  3VS3 A;  1KC8 U;  4JZ3 A;  1FWZ A;  5GAO r;  3BDU A;  2DEU A;  4KH0 B;  5DY9 A;  2ZPE B;  4MML A;  4RTT A;  2RK2 A;  2ZPI B;  4KUI A;  3H0I A;  4XU2 A;  3NTI A;  5GAN 6;  4A54 A;  3FIF A;  4M75 G;  5FU7 C;  1VQ8 T;  2L3S A;  1I8F A;  4PL6 A;  3CC2 T;  3UWN A;  4AG1 C;  2K2M A;  2B8A A;  1Q7Y C;  3S3M A;  4DBF A;  2RJF A;  2QA4 Q;  2ZZD A;  2LJ3 A;  3OYG A;  3MO8 A;  3PTA A;  1JB0 E;  5D7U A;  4CI0 C;  1QQJ A;  2DBK A;  2NWM A;  3TVT A;  4FYW B;  3L1A A;  4M78 B;  5ECA A;  3V8J A;  4ELZ C;  2EQJ A;  1H3Z A;  2PVG B;  5D6W A;  4BE1 A;  1ZQ1 A;  4M78 D;  2DL7 A;  4M7A G;  4M7D C;  1TG0 A;  2LP5 A;  2KI7 A;  2CS7 A;  2DRK A;  1BYM A;  2CH4 W;  4X34 A;  2KQW A;  2JM9 A;  1NEG A;  1VQK Q;  4C8Q E;  1TOV A;  3QYH B;  3I35 A;  2DZ9 A;  4TVR A;  3RMQ A;  3CCJ A;  1C6V X;  3KFV A;  2E6Z A;  1YJN Q;  3H6Z A;  3LGF A;  2HSE B;  1X43 A;  2V8J A;  3VS1 A;  3SB2 A;  1X6B A;  4MDW A;  2DVJ A;  2DD4 A;  4XQ3 A;  2NUZ A;  5GAM e;  3EH2 A;  3MET A;  1TSF A;  1Q82 C;  3JV3 A;  1WI7 A;  3DLM A;  3CC4 T;  2KE9 A;  2OI3 A;  5GAN 2;  2DRM A;  2LCC A;  2JOY A;  3HRU A;  2X4J A;  1MV0 B;  1YIJ A;  4PJO F;  1VQM A;  5CK9 A;  4E7I A;  3EAE A;  2DET A;  2KT1 A;  1VQO A;  2EJ9 A;  1IXD A;  7AT1 B;  1PSF A;  4QKU A;  3PNW C;  1R0B G;  1XTD A;  3JAM E;  1JEG A;  1IGU A;  5IXB A;  3FB9 A;  1H64 1;  1O9S A;  1SHF A;  2DO3 A;  2IVW A;  1KK7 A;  1U1S A;  5CKD A;  2PVO B;  4VUB A;  3GIB A;  1E6H A;  1VQL Q;  2ZAE A;  3HRT A;  2BIV A;  3JCM d;  1KHI A;  1X6O A;  2GCX A;  2VKN A;  2QTX A;  3QDR B;  1YI2 T;  4JPB W;  3CCM Q;  4K11 A;  1ZLM A;  2XI9 A;  2OX7 A;  4M78 F;  1QWF A;  2LC4 A;  1K8A U;  2K79 A;  3PIP A;  2RPN A;  1VQ4 T;  3I56 A;  4OMQ A;  3C0C A;  4AG2 C;  1SEM A;  2YXY A;  5GMK i;  4J6W A;  4AFU C;  3QJ6 A;  3EFS A;  3LLR A;  2HKN A;  1GXI E;  2ZPF B;  2AHJ B;  2RNA A;  3N5B B;  1VQ8 Q;  2OTL T;  1PD1 A;  3OYM A;  2LNH B;  3AT1 B;  1YJW A;  5CKB A;  3CC2 Q;  1N9S A;  5HK0 A;  1BI1 A;  3JCM g;  4FM4 B;  4OML A;  1I07 A;  3VV0 A;  1PCX A;  2CH4 A;  2DL8 A;  3FRN A;  1AVZ C;  3PGG A;  2FZK B;  2CKK A;  1HD3 A;  3CCL T;  1SG5 A;  1GRI A;  2YLB A;  2C06 A;  1AWW A;  4KGV B;  4E7H A;  4BY6 B;  3CD6 A;  3A8H B;  1WHM A;  1FXX A;  3E9F A;  5A0D A;  2DL3 A;  2LQW A;  3JCM W;  3HSB A;  2H3J A;  4PFP A;  2ZPB B;  1NYF A;  2DJQ A;  3M58 A;  1WLP B;  4FYV B;  2J6F A;  4OMN A;  3KBG A;  1SPK A;  1BU1 A;  2YRD A;  2ENM A;  1Z9Z A;  4C92 A;  1VQ5 T;  2FPD A;  2P0Q A;  2FG0 A;  5HKC A;  1H92 A;  3MP8 A;  1QVF S;  1X6G A;  3CCR A;  4OMF B;  2K7A A;  2R5A A;  1X69 A;  5FRN A;  3QZ5 B;  1YHQ A;  4E7L A;  3QWX X;  2FHD A;  1UGQ B;  1ZUK A;  2DVE A;  3M9Q A;  1MHN A;  1UB4 A;  1S72 T;  4M7D G;  3I55 A;  3JRZ A;  3A8L B;  4F7U B;  3CC4 Q;  1V76 A;  1HJD A;  1PKT A;  1MND A;  2MYS A;  4EMK A;  4ESR A;  3PMT A;  4ZGJ B;  2JVV A;  2VYT A;  3REA B;  2DKG A;  2RI5 A;  1T0H A;  2KMT A;  2X4W A;  3FEO A;  3RER A;  2O9V A;  3H0F A;  1QCN A;  3TU4 K;  3C12 A;  2V8I A;  1T3L A;  3EFO A;  1VQ7 T;  1EFN A;  4DEX A;  4M4Z A;  1M27 C;  3MEV A;  4AT1 B;  4ELY C;  2YSQ A;  2YUQ A;  3JCM e;  5HY6 A;  4M78 C;  5KCO A;  3CPW P;  2A36 A;  1N8R R;  1OYX A;  1GFC A;  2RQV A;  3C94 A;  1W2B P;  2IIM A;  2CZ6 B;  1R0C B;  2EBP A;  3V7S A;  4J9F A;  4IIO A;  1GCQ C;  2OTJ A;  1SF9 A;  4J8O A;  4QQD A;  2QQB A;  4RMO A;  4XK8 E;  4M77 A;  1OZ2 A;  2CUB A;  2CP2 A;  4Z02 A;  3RBB B;  2RHZ A;  2K5F A;  3M56 A;  1OU8 A;  2XG8 D;  5DLO A;  1VQ4 Q;  2FB7 A;  1WGS A;  4OMO A;  2CP0 A;  4J6X A;  2Y90 A;  3OYY A;  1RAE B;  2A7Y A;  1X2K A;  4OF1 A;  8AT1 B;  1VQ9 T;  5IAY A;  1C0M A;  4KGZ B;  4XU1 A;  2EIF A;  3EGU A;  1RLP C;  5FW9 A;  2GQI A;  1RI9 A;  5L23 A;  3L42 A;  4JS4 A;  2OTL Q;  3BY7 A;  4C0D B;  2CP6 A;  2ABL A;  4L5G A;  2LJ1 A;  2ZPH B;  4M75 E;  2D9T A;  3M55 A;  4A4F A;  1YIT A;  2XIC A;  1AEY A;  2DXB A;  4C0Z A;  1M2V B;  2D8J A;  3CME T;  4OB3 B;  1N27 A;  3G4S T;  2KYB A;  2OAW A;  2MWP A;  1B3Q A;  1Q7Y R;  1GL5 A;  2NYS A;  1EX4 A;  3X25 B;  1QVG A;  1BCM A;  2HMA A;  1YCS B;  3F70 A;  3CCS A;  2H8H A;  4JDS A;  2CT4 A;  3CCL Q;  2M0O A;  4HT9 A;  5GMK j;  3CXC A;  3VS5 A;  3CCQ A;  2BE9 B;  3V8L A;  4N4H A;  4D8D A;  3VS4 A;  1QW1 A;  4N4G A;  1M5Q 1;  4XTW A;  4BI4 A;  4J7F A;  1WA7 A;  3GNG A;  1EZZ B;  1HYO A;  4M7A E;  2KVQ G;  2Z0W A;  2KRN A;  1UGP B;  1Y7X A;  2QXF A;  3A8G B;  1K0X A;  2X51 A;  1OOT A;  3GF5 A;  2LX9 A;  4BDZ A;  1RAG B;  3VJP A;  3LH5 A;  1M3B A;  3L2U A;  3EHQ A;  2E10 A;  1PNJ A;  1PC0 A;  2RJE A;  3FC3 A;  2L2P A;  2DM1 A;  1D3B A;  1VUB A;  4BI8 B;  1AZE A;  3URG A;  1Q82 R;  1S72 Q;  3CMA T;  5FRM A;  1N6A A;  2LQ8 A;  3EG9 B;  1K9M C;  4DBR A;  3M0P A;  5LJ5 j;  1NJI U;  2J6K A;  4MZM A;  3VYG A;  2QA4 T;  2DL4 A;  4A63 B;  3M5A A;  1TTH B;  1U5S A;  3CEY A;  1YWP A;  2HL5 C;  1VQN A;  1M1F A;  4C8Q B;  1N8R U;  1QMC A;  3EFR A;  5A0G A;  3RUX A;  1VA7 A;  4C8Q D;  4FYX B;  2GNC A;  2QTV A;  4RTY A;  1D1B A;  1A0N B;  4BY6 C;  2CT3 A;  2AKK A;  1G83 A;  4BAC A;  1Q81 C;  4C92 B;  3A8M B;  2KY9 A;  5KYN A;  1M2O A;  3SWN B;  3FJP A;  4AFQ C;  4C92 D;  2F1L A;  4LUE A;  2F2V A;  3ZEH A;  2YT6 A;  1YJN T;  1PRL C;  4R56 A;  3TCJ A;  4GLM A;  1RLQ C;  1W1F A;  2BZ8 A;  1MGQ A;  4FW1 A;  4ATO A;  2HQE A;  2LJ0 A;  2LNV A;  4XTU A;  2JJ9 A;  1HK9 A;  3A1P A;  1M8V A;  1UGS B;  5AT1 B;  4M7D F;  2VC8 A;  4NS5 A;  2D8H A;  4M78 G;  2XID A;  2HKQ B;  4ORZ A;  1RAD B;  5LL6 S;  2ED1 A;  3Q1J A;  2RD1 A;  1LOJ A;  2K4Y A;  3JB9 D;  5KH6 A;  2PVD B;  4JUV A;  2ZCF B;  5J3B A;  2DAQ A;  3CCJ T;  2OAU A;  1NPR A;  1JU5 C;  1G2B A;  1Q7Y U;  5CKE A;  2CZ7 B;  2E6N A;  1JBM A;  3CME Q;  3JCM c;  3G4S Q;  1XOV A;  1N8R C;  4L59 A;  2DFU A;  2WSE E;  4RTW A;  4QW2 A;  1H8K A;  5IHI A;  3VS0 A;  3PMI A;  4A4H A;  4M77 D;  2KAF A;  4FW2 A;  4ZGE B;  4LD6 A;  3L2W A;  1QCO A;  1ZUY A;  1F1B B;  2RHI A;  3SD4 A;  4E2F B;  2LT1 A;  1ZBX A;  4BE0 A;  1VQO T;  1D09 B;  2K5L A;  5HK3 A;  3H9N A;  2DA9 A;  2PTK A;  3RES A;  2RQT A;  4DA4 A;  4C92 F;  3SEM A;  3TSW A;  4LDW A;  1XJW B;  4E7K A;  1Q82 U;  3QPH A;  6AT1 B;  2FVU A;  1XNI A;  3VUZ A;  1ZBJ A;  3OW2 A;  4E7Z A;  2AT1 B;  2COZ A;  5M9O A;  5CAI A;  2DXU A;  5I21 A;  3HKS A;  1PSE A;  4C0G A;  5LJ3 j;  3CMA Q;  4C0D C;  4V2S A;  3V7C A;  3OYH A;  2JS0 A;  3JCM X;  2EWN A;  3CBM A;  1RAA B;  1AHJ B;  2EQM A;  4GY5 A;  1MUZ A;  5LJ5 d;  1I4K 1;  3I56 T;  4F7U A;  2LCL A;  5FRO A;  3L2Q A;  3E1S A;  4UC4 A;  1VQK A;  4BI3 A;  3O8V A;  4YTL A;  3OYA A;  2QEX A;  4FT2 A;  3EGD B;  2FRY A;  3EG1 A;  3VS7 A;  2LRQ A;  5CR2 A;  1BKB A;  4LE9 A;  2HBW A;  3PT9 A;  2V1R A;  3QG1 A;  3T9N A;  1JXO A;  2DL5 A;  2KXC A;  3V8K A;  2M16 A;  3QO3 A;  2EYY A;  2E5Q A;  3E19 A;  2CSI A;  3M0R A;  5L8R E;  2WAC A;  3QKJ A;  3S3O A;  1D3B B;  2EYX A;  5I22 A;  4M77 F;  3PVQ A;  1YFN A;  2HD0 A;  2J06 A;  1NG2 A;  2X3W D;  2IG0 A;  3ASK A;  2EPD A;  4B9W A;  2HDA A;  1M90 R;  1UGR B;  1ZSZ B;  2FYK A;  2QG9 B;  3MP1 A;  2O88 A;  1OI1 A;  3TEE A;  3NGP A;  2L3P A;  3CBP A;  3SDZ A;  3G1J A;  2E5K A;  3L2Z A;  1LVK A;  2DNU A;  2WSC E;  1KQS A;  1ZA1 B;  1AWO A;  1M8M A;  3NTH A;  1RAI B;  1V1C A;  4DBQ A;  3OBW A;  3QJY A;  2JZ2 A;  1GCP A;  1PKS A;  3CCV T;  5GMK h;  1OQK A;  2YRV A;  3CCJ Q;  2RI3 A;  1VQP A;  1RAC B;  2V8K A;  3JCM b;  2RA2 A;  3GNF B;  1Y07 A;  4FSX A;  3GLX A;  3M0Q A;  4Y92 A;  1N9R A;  2KR3 A;  1YCY A;  1YHQ T;  4LXC A;  2DTO A;  4HKE A;  2ZPG B;  3BW1 A;  5HCK A;  3MCA B;  2PUO B;  4ZTF A;  5I2M A;  5GAN j;  3I55 T;  5KYW B;  4JS5 A;  2K6D A;  2DMO A;  4C92 C;  1M2V A;  1AWX A;  2HQX A;  1WDX A;  3P8H A;  1QP3 A;  1UUE A;  2FEI A;  3HP9 A;  1RL2 A;  2CGH A;  4QQG A;  1TH7 A;  2E65 A;  2ED0 A;  2LZ6 B;  4JJD A;  2GQV A;  1IGQ A;  1VQO Q;  1X2Q A;  1P92 A;  4WF2 A;  3BE3 A;  2F2W A;  4EMK C;  4O5V A;  2CP5 A;  1XQH A;  1M3A A;  2LT4 A;  3QSU A;  2BE7 D;  4JRQ A;  5LJ5 h;  3CC2 A;  2XD0 A;  2EVR A;  1WYX A;  5CCA A;  4RUG A;  1OX8 A;  4IUT A;  4LDX A;  2E12 A;  2EYQ A;  3CCU A;  2GGR A;  1R8O B;  3EHR A;  2DPP B;  3EG0 A;  3FDR A;  4EMG A;  2VXE A;  3E2U A;  2O9S A;  5LJ3 d;  1K9M R;  2J05 A;  3H41 A;  2DBM A;  3MEW A;  4IUP A;  1FMV A;  4LUD A;  2NUT B;  3CPW S;  2A0F B;  3DB3 A;  5C0M A;  3I56 Q;  1UEC A;  4IUQ A;  3EG9 A;  4M77 C;  1W2B S;  4PJO E;  1IO6 A;  5AYF A;  2D1X A;  1E6G A;  3I9Q A;  2VUB A;  2O2O A;  4A53 A;  2DX1 A;  2MF2 A;  1YJ9 T;  1PRM C;  4NOY A;  4CRI A;  3NTK A;  5J39 A;  1K73 C;  2KRS A;  2SRC A;  5J26 A;  4C8Q A;  4JZ4 A;  1Q81 R;  5FWC A;  3LYI A;  2MMP A;  1YIT T;  2IPO B;  3RKX A;  3JCM P;  3DLL A;  2CRE A;  5GAN 3;  4ANJ A;  3OS0 A;  4FCY A;  3CC4 A;  1QVG P;  3MJX A;  3CC7 A;  1OZ3 A;  2MWO A;  3SWN A;  2V26 A;  1MMA A;  2AZV A;  1W6X A;  4RTV A;  4OB0 B;  3CXC P;  4D8K A;  2CSQ A;  1Q86 C;  1K9A A;  1JXM A;  5KE2 A;  2ROL A;  4M78 E;  2YUP A;  2R5M A;  1MNE A;  2QQS A;  3QBY A;  4CC4 B;  2LQK A;  3G71 T;  2CP7 A;  2BKD N;  2LTO A;  1HSQ A;  4P5N A;  4BUG A;  3JB9 I;  3O5Z A;  3EG2 A;  3CCV Q;  1Y57 A;  1I5L A;  2QGG A;  3X28 B;  2O01 E;  4PJN A;  4FU6 A;  1KHC A;  3LWH A;  3CCR Q;  3ZBD A;  5CKF A;  1YHQ Q;  1YI2 A;  3LH0 A;  2DXC A;  2MIO A;  3HL8 A;  1VYT A;  2X35 A;  4D6W A;  2DIG A;  3I55 Q;  2P84 A;  4RKU E;  3LW5 E;  1OV3 A;  1VQ4 A;  3M57 A;  2RH2 A;  4HVW A;  1TU0 B;  3RKW A;  1U3O A;  2PUK B;  4QVC A;  2M0Y A;  4PKC C;  4AFS C;  3OYN A;  1K1Z A;  1OPK A;  3TRE A;  1OUL A;  4J9G A;  4C8Q G;  1M90 C;  2C0T A;  1I81 A;  5LJ3 h;  2X4Y A;  4FT4 A;  2OTL A;  1HXD A;  3OSS C;  5LJ5 f;  1M1G A;  5FWB A;  2A3L A;  5GAO n;  4C92 G;  4C5I A;  3UPU A;  2RM4 A;  2ROT A;  1K76 A;  3UA6 A;  1MMD A;  4MZT A;  2O31 A;  4HXJ A;  2YLC A;  2P0P A;  3OS1 A;  2EQK A;  1K9M U;  4DBH A;  1UG1 A;  1G8X A;  2RF0 A;  1KIK A;  2FL7 A;  2KXD A;  1VQ6 T;  3CCL A;  5GAM j;  4RTU A;  1JJ2 P;  2RK1 A;  4C0F A;  2X9H A;  2XDB A;  1CKA A;  4LDU A;  3OW2 S;  5GAN 7;  4F7U F;  2G3R A;  2DJZ A;  1M1K R;  2M51 A;  5DM7 R;  3QWY A;  4OGE A;  3JB9 G;  3IQL A;  3HTR A;  5IT9 E;  4HCZ A;  3REB B;  1G3W A;  1Q81 U;  3PE0 A;  2VV5 A;  4XU0 A;  1FX7 A;  1RAF B;  1YJ9 Q;  1B34 A;  1VQ5 A;  4OMP A;  3CCE T;  4RG2 A;  1R77 A;  4WTO B;  2YUO A;  4PLI A;  1U1T A;  2RI2 A;  2L3R A;  1Y0M A;  4XTX A;  3EGD A;  1YIT Q;  2FZG B;  2HSP A;  3OS5 A;  1UEB A;  5KYY A;  1S72 A;  1OEB A;  2E3I A;  5C6S A;  1ZSG A;  3U23 A;  2VWF A;  4M77 G;  2DIL A;  1KD1 R;  3CCS Q;  2GF7 A;  1D1A A;  3DKM A;  5GMK m;  1RAB B;  1VIF A;  3CCQ Q;  3OYD A;  2O4X B;  5CO7 A;  3M53 A;  4CC3 A;  3MPU B;  2H3E B;  1VQ7 A;  1TUD A;  2EQI A;  2L89 A;  1KC8 R;  2P0K A;  5GAN h;  3NPF A;  1ZSZ A;  2QAS A;  1K4U S;  3G71 Q;  1Y96 B;  1IZ6 A;  4C5H A;  2QK0 A;  5CQY A;  1AWJ A;  4HCC A;  1SHG A;  2JMC A;  3CBO A;  3OYF A;  3G6E A;  2GFU A;  3R6O A;  2HL3 A;  4A4G A;  3CQT A;  3PIO A;  1ACM B;  1D1C A;  3OW2 P;  3QXE B;  2EFI A;  1G3T A;  1RAH B;  2WSF E;  3M4Y A;  1PHT A;  1ZX6 A;  2X4X A;  4PJM A;  1O75 A;  2L8D A;  2V1Q A;  3OYJ A;  2SEM A;  2JT4 A;  4NL3 A;  1VQ9 A;  2R57 A;  4EIK A;  1Q95 G;  4JLI A;  1JJ2 A;  1UJY A;  5KYW A;  2K3X A;  4JJB A;  2EGE A;  1N5Z A;  3G7Z A;  5LJ3 f;  1VQN Q;  4IKF A;  1UHC A;  2JW4 A;  2K57 A;  1GBQ A;  1RI0 A;  2R58 A;  1ZUU A;  1B07 A;  1D0Z A;  4PFZ A;  3G4S A;  2RHU A;  3JB9 J;  2YDL A;  4LD9 K;  2XK0 A;  4M75 A;  1V29 B;  1J3T A;  3VRZ A;  4RTZ A;  1CKB A;  1LJO A;  4ZNX A;  2XDD A;  1WIE A;  3VKI A;  2RJD A;  2J6O A;  5GJV B;  1VQ6 Q;  5IH2 A;  2QDY B;  3QZ9 B;  3OYE A;  5GAM d;  3UT1 A;  1IRE B;  4HT8 A;  2GTJ A;  4PJL A;  2L0A A;  2LQN A;  3HRS A;  4JRK A;  3J81 E;  1MMN A;  3M54 A;  4CC2 A;  1BBZ A;  5GMK l;  2YRC A;  4XTV A;  2RQU A;  1WJS A;  1TWB A;  2C0O A;  2BTT A;  1PM3 A;  1M9S A;  2QQA A;  1KQS P;  1UTI A;  1ABQ A;  5KE3 A;  1YIJ T;  1ZA2 B;  1WXB A;  1VQM T;  2DYI A;  2QAZ A;  2NUT A;  4M7A A;  1BI3 A;  4C8Q F;  1KFZ A;  1K73 R;  1QKX A;  3CCE Q;  2PQW A;  2COY A;  4J9E A;  1VQP T;  4F14 A;  1UJ0 A;  2DIQ A;  2W0Z A;  2BZY A;  1OU9 A;  2B86 A;  4IUV A;  4Z89 A;  1OX9 A;  2EJG A;  2C0I A;  1LPL A;  5CVI A;  1KQ2 A;  1S1N A;  3S3N A;  2JTM A;  4E7J A;  1WHG A;  4N0A A;  1AD5 A;  2QA4 A;  4HCB A;  1C1A A;  4F16 A;  1Q86 R;  4PJO B;  4II1 A;  2RB6 A;  5IHN A;  3JCM J;  4AFZ C;  2LDM A;  2QDL A;  1QVP A;  4OGC A;  4PJO D;  2XHC A;  4F04 B;  2HNI A;  2YHT A;  4J5Y A;  1K8A R;  4M7D E;  5GAN f;  4LNP A;  2EGC A;  4QT7 A;  3UDC A;  5I2S A;  1G5V A;  3KXT A;  2DZC A;  1M1K C;  3JB9 F;  3OMG A;  4A4E A;  1TUC A;  1BI0 A;  1M30 A;  3GBQ A;  3QYG B;  1B34 B;  2FRW A;  3QDF A;  3GPL A;  4DOW A;  3BDL A;  1YP5 A;  4JLG A;  1YJN A;  2K2V A;  5KYY B;  3E9G A;  3CCU T;  3M59 A;  1U06 A;  4E6R A;  1VYU A;  3LWI A;  2JUF A;  1M4Z A;  2QYZ A;  4ZGD B;  4XTY A;  2M9U A;  2JXB A;  1YJW T;  2KBT A;  3EGX A;  3RMS A;  1X75 C;  4KH1 B;  4J83 A;  2D0Q B;  3OYI A;  2JTE A;  3H8Z A;  4RCC A;  4B6M A;  2FPE A;  3NHN A;  1KD1 C;  2L3Q A;  2PZ1 A;  2W10 A;  2DTH A;  4JJN K;  1WNL A;  1X27 A;  4MMK A;  5GAM h;  2K9G A;  1SSF A;  3CD6 T;  2QEX Q;  5LJ5 g;  1I1J A;  3MEA A;  2EW3 A;  1H3H A;  1IRX A;  4OB2 B;  4EMH A;  1KC8 C;  2VXF A;  3M0U A;  4X1V A;  3NMZ C;  2HQH A;  1BIA A;  1NYG A;  3BFM A;  1SRL A;  4C92 E;  1VQL A;  3OYL A;  4XU3 A;  3OQ5 A;  1UE9 A;  4PFO A;  3VRY A;  1IHW A;  3WXM B;  5FU6 B;  2QQ9 A;  2ZGW A;  3QII A;  4JRP A;  2EKO A;  3OYB A;  3CC7 T;  2EGA A;  4C8Q C;  1LCK A;  2JM8 A;  2F2X A;  2FO0 A;  3CCR T;  3EG3 A;  1FMW A;  1RUW A;  1KSW A;  2DTI A;  3CCM A;  4F7U G;  5GMK e;  2MI6 A;  4KGX B;  3HFN A;  3SWN C;  3WVD B;  1VYV A;  3HPW A;  1K73 U;  2F5K A;  2L5Q A;  3OA6 A;  3ULR B;  4DQ2 A;  4BB7 A;  1YIJ Q;  2E3H A;  1VQM Q;  2ATC B;  1D0Y A;  2QGF B;  1QVG S;  2VAS A;  5IXF A;  5GAN 8;  3S6W A;  3TQ7 P;  1VOM A;  5CKH A;  2Y4Y A;  3VYH B;  1VQP Q;  3H0H A;  3CXC S;  1VQ8 A;  2KRM A;  4M75 B;  2KEA A;  2LVM A;  4FYY B;  2DE0 X;  4M75 D;  4BE2 A;  3D7S B;  3THK A;  1D0X A;  1QLY A;  1Q86 U;  1WQW A;  1WHL A;  3DB4 A;  4E47 A;  5A2Q E;  2GBQ A;  4M77 E;  3A98 A;  3OS2 A;  4Y91 A;  2RMO A;  2BUD A;  2OTJ T;  4M7D A;  5EC7 A;  3AHU A;  3MKD A;  2KK4 A;  5LJ5 e;  1KQ1 A;  4E7S A;  4EPC A;  2M1H A;  4XAX B;  3OMC A;  1QP2 A;  1ARK A;  3ME9 A;  4KUL A;  4XTZ A;  2MCN A;  3NFC A;  2EAY A;  5EG2 A;  4A4K A;  2A08 A;  2O4X A;  2AKL A;  4M7A B;  1M3C A;  5A0L A;  1BIB A;  1JQQ A;  1BK2 A;  3L2V A;  1YBY A;  4M7A D;  3OSV A;  2EJF A;  3I5R A;  1W70 A;  3SHW A;  5DLQ E;  2E64 A;  2KRO A;  2AIR B;  1QWE A;  4DOV A;  3L2R A;  2CYZ B;  1Y96 A;  1U8R A;  4MZP A;  3ZL7 C;  3CCU Q;  1WJR A;  2VVK A;  2MAM A;  1K0S A;  2DD5 A;  2DEQ A;  3FJ5 A;  3MP6 A;  3ZFJ A;  4PLL A;  5GAO q;  1YJW Q;  2CDT A;  1SKU B;  1M90 U;  1TUG B;  1YNZ A;  2PNI A;  2KNB B;  2HCK A;  2CZ0 B;  4Z88 A;  2CUD A;  2LX7 A;  1UHF A;  3CCS T;  5GAM f;  4HVU A;  3RR6 A;  3J7A F;  1WXT A;  2QQR A;  5LJ3 g;  2ESW A;  2JNG A;  3X20 B;  3I5S A;  2MPX C;  2AZS A;  3CCQ T;  1NPP A;  3CCV A;  3CD6 Q;  3PFS A;  5GAO p;  4BD3 A;  4PJO C;  1K8A C;  1KJW A;  1JJ2 S;  2A37 A;  3FLG A;  1VIE A;  4OVA A;  4M75 F;  4PJJ A;  4KBM B;  2HAX A;  4KT0 E;  2RQW A;  3INZ A;  3MEU A;  2M02 A;  4RG8 A;  2YUN A;  3V7R A;  1W4S A;  4R55 A;  4FL6 A;  2RHX A;  1WJQ A;  3R6N A;  2DK3 A;  3CC7 Q;  4KUD K;  3EGX B;  3JCM h;  1UDL A;  2VGN A;  2CP3 A;  2NUP A;  5GAN 4;  4WCI A;  5GAN d;  3OB9 A;  1NJI R;  4C5G A;  5KYX A;  2GFA A;  4M7A F;  4RCB A;  2DLP A;  2DF6 A;  4F17 A;  4ZTJ A;  1OPL A;  3CPF A;  1DJ7 B;  3RIR A;  3OBY A;  2DYB A;  4HVV A;  1VQN T;  1PG5 B;  1WZO A;  1WXU A;  2XDP A;  3G6E T;  5KYU A;  3JSC A;  3A8O B;  3J80 E;  4J9C A;  4Q5W A;  1ZSZ C;  2OJ2 A;  4R0K A;  5IN1 A;  2KSS A;  5FLX E;  1NM7 A;  4IUU A;  4LDY A;  1YI2 Q;  3RKY A;  4EDU A;  2QI2 A;  3PVL A;  2YWW A;  1T0J A;  4OP0 A;  1QKW A;  2EKH A;  5LJ3 e;  3GOX A;  3UA7 A;  2OTJ Q;  4ZN3 A;  4L6V 5;  4ZN1 A;  2G6F X;  5GAN 5;  4IUR A;  5FU6 C;  1FMK A;  3TSZ A;  1QVF P;  3ER0 A;  2EQU A;  4QQ6 A;  5GAN g;  1YJ9 A;  2J7I A;  5FU7 B;  1CSK A;  1PD0 A;  4ME7 A;  4GLK A;  4J7I A;  2X3X D;  4PJO A;  1WHK A;  8ATC B;  2RN8 A;  2RO0 A;  2KGT A;  1BCO A;  4JRI A;  1NLO C;  2JTF A;  4FIB A;  2JN0 A;  3X26 B;  1NBE B;  4RTX A;  3VS6 A;  1GBR A;  4Z8A A;  5GAO m;  5D6X A;  2BZX A;  2HEQ A;  2A28 A;  4X9C A;  1EIF A;  2XKO C;  5I11 A;  2EYZ A;  1Y71 A;  3JCM Q;  1AOJ A;  4M75 C;  4M7D B;  3M0S A;  4B9X A;  1QCF A;  3JCM V;  4M7D D;  2ECZ A;  4GBQ A;  1Z9Q A;  1TXQ A;  2EYW A;  3UF4 A;  4OMM A;  1MV3 A;  1G3Y A;  1MMG A;  3G71 A;  4M78 A;  4JJC A;  2NLU A;  4LDV A;  3EH1 A;  1ZHI A;  1I0C A;  2P4R A;  2I2L A;  5KCH A;  3LGL A;  3P8D A;  1VQ5 Q;  2VB6 A;  4DEY A;  1GCQ A;  4CC7 A;  4X9D A;  2CZ1 B;  1NZ9 A;  2RJC A;  1YWO A;  4PK4 A;  1BB9 A;  3CPW A;  4Y28 E;  3JB9 H;  2D6F A;  4M7A C;  3C95 A;  4J9H A;  4J9B A;  1B7T A;  3HFO A;  1W2B A;  3JCM f;  2FZC B;  4LN2 A;  1KQS S;  2E4H A;  2F5T X;  3VUB A;  3A5Z B; 
#chains in the Genus database with same CATH homology
 2RQV A;  1E7O A;  1M3A A;  1AZG B;  2IIM A;  4LNP A;  2EGC A;  2EBP A;  1PWT A;  2AK5 A;  1UGV A;  4QT7 A;  1SRM A;  4J9F A;  2RQR A;  4IIO A;  2EVR A;  1GCQ C;  2LMJ A;  3UAT A;  1WYX A;  4J9I A;  2JMA A;  1TUC A;  4RUG A;  1M30 A;  2LCS A;  3GBQ A;  2FRW A;  2CUB A;  3VS2 A;  3RBB B;  2GGR A;  3EHR A;  3EG0 A;  1YP5 A;  5IHK A;  4OMO A;  4FSS A;  2O9S A;  1U06 A;  4E6R A;  1VYU A;  2J05 A;  2KT8 A;  1X2K A;  3H41 A;  1GFD A;  2DBM A;  3M0T A;  1NEB A;  4J9D A;  2JXB A;  4LUD A;  2KBT A;  2D0N A;  1UEC A;  3EGU A;  1RLP C;  5FW9 A;  2GQI A;  1RI9 A;  5L23 A;  1IO6 A;  1UFF A;  1E6G A;  2KYM A;  2D1X A;  2ABL A;  3I9Q A;  2JTE A;  2O2O A;  2LJ1 A;  2FPE A;  3NHN A;  2DX1 A;  2L3Q A;  1PRM C;  1WX6 A;  2PZ1 A;  2W10 A;  1AEY A;  1X27 A;  2KRS A;  2D8J A;  2SRC A;  4JZ4 A;  2KYB A;  2OAW A;  5FWC A;  2K9G A;  1B3Q A;  1GL5 A;  2I0N A;  1I1J A;  2EW3 A;  1YCS B;  1H3H A;  2H8H A;  2CT4 A;  2CRE A;  3M0U A;  4X1V A;  3NMZ C;  1NYG A;  1SRL A;  3VS5 A;  4D8D A;  1ABO A;  2AZV A;  1UE9 A;  1WFW A;  3VS4 A;  2K3B A;  3VRY A;  1W6X A;  1T3S A;  4RTV A;  3RNJ A;  4D8K A;  2CSQ A;  1K9A A;  1WA7 A;  2EGA A;  4IIM A;  1LCK A;  2JM8 A;  2F2X A;  2KRN A;  2FO0 A;  1JXM A;  3EG3 A;  2ROL A;  1RUW A;  4HCK A;  2YUP A;  1K0X A;  1OOT A;  1KSW A;  4CC4 B;  5GJW B;  2GTO A;  3LH5 A;  1M3B A;  1NLP C;  3EHQ A;  1SSH A;  1PNJ A;  1HSQ A;  1VYV A;  1YN8 A;  3O5Z A;  2L2P A;  3EG2 A;  2DM1 A;  2JS2 A;  4KRT A;  3ULR B;  1Y57 A;  2MOX A;  1AZE A;  1FYN A;  5IXF A;  1JO8 A;  2FPF A;  2XMF A;  3VS3 A;  4JZ3 A;  3M0P A;  3H0H A;  2KRM A;  2MIO A;  4RTT A;  1VYT A;  2KEA A;  2J6K A;  2DE0 X;  2DL4 A;  4A63 B;  1OV3 A;  3H0I A;  2QDL A;  1U5S A;  4HVW A;  1YWP A;  3THK A;  1QLY A;  1U3O A;  2L3S A;  2M0Y A;  1VA7 A;  2GBQ A;  4AFS C;  1K1Z A;  2GNC A;  3A98 A;  1OPK A;  2RMO A;  4RTY A;  4J9G A;  1A0N B;  4AG1 C;  2CT3 A;  2C0T A;  2AKK A;  2K2M A;  5EC7 A;  1G83 A;  4AFQ C;  5FWB A;  1ARK A;  4LUE A;  2MCN A;  2LJ3 A;  2F2V A;  2YT6 A;  2A08 A;  1PRL C;  2ROT A;  2DBK A;  1K76 A;  2AKL A;  2NWM A;  3UA6 A;  4GLM A;  1M3C A;  2O31 A;  1JQQ A;  4HXJ A;  1BK2 A;  1RLQ C;  3TVT A;  5ECA A;  1W1F A;  2BZ8 A;  2LJ0 A;  1UG1 A;  2RF0 A;  1KIK A;  2KXD A;  2DL7 A;  3I5R A;  1W70 A;  3SHW A;  1TG0 A;  2LP5 A;  2KRO A;  4RTU A;  1QWE A;  2D8H A;  2DRK A;  4ORZ A;  2CH4 W;  3ZL7 C;  2VVK A;  1K0S A;  2JM9 A;  2ED1 A;  1CKA A;  1NEG A;  3FJ5 A;  3I35 A;  3KFV A;  2M51 A;  2CDT A;  3QWY A;  1X43 A;  3VS1 A;  3IQL A;  1X6B A;  1YNZ A;  2DVJ A;  2PNI A;  2KNB B;  2HCK A;  3REB B;  1JU5 C;  4Z88 A;  1G2B A;  2CUD A;  2NUZ A;  2LX7 A;  3PE0 A;  1UHF A;  3JV3 A;  1WI7 A;  4HVU A;  1WXT A;  2KE9 A;  4OMP A;  2ESW A;  2OI3 A;  3I5S A;  2DRM A;  2YUO A;  2AZS A;  1XOV A;  4RTW A;  1MV0 B;  1Y0M A;  1H8K A;  1KJW A;  5IHI A;  3VS0 A;  2HSP A;  2A37 A;  1OEB A;  1ZSG A;  3U23 A;  2KT1 A;  2RQW A;  2VWF A;  2DIL A;  2YUN A;  1JEG A;  1ZUY A;  5IXB A;  3R6N A;  1SHF A;  1E6H A;  1UDL A;  2DA9 A;  4CC3 A;  2PTK A;  2RQT A;  1TUD A;  2EQI A;  3SEM A;  3TSW A;  3NPF A;  4WCI A;  1K4U S;  2VKN A;  1ZBJ A;  1AWJ A;  4JPB W;  4K11 A;  1ZLM A;  1SHG A;  2DLP A;  2JMC A;  2DF6 A;  4F17 A;  1OPL A;  3CQT A;  1QWF A;  2K79 A;  2RPN A;  2DYB A;  4HVV A;  4OMQ A;  1WXU A;  3C0C A;  1PHT A;  1ZX6 A;  1SEM A;  4AG2 C;  2JS0 A;  4AFU C;  4J9C A;  1MUZ A;  2OJ2 A;  4R0K A;  1NM7 A;  2V1Q A;  2RNA A;  2SEM A;  2JT4 A;  4EIK A;  3PVL A;  1UJY A;  1T0J A;  2LNH B;  1QKW A;  2FRY A;  3EG1 A;  2EKH A;  2EGE A;  1N5Z A;  4JJB A;  3VS7 A;  4LE9 A;  3UA7 A;  2HBW A;  2V1R A;  2G6F X;  1UHC A;  4OML A;  1JXO A;  1I07 A;  2DL5 A;  2KXC A;  2JW4 A;  3TSZ A;  1FMK A;  2CH4 A;  2DL8 A;  2EYY A;  1GBQ A;  1AVZ C;  2CSI A;  3M0R A;  2J7I A;  1CSK A;  1ZUU A;  1HD3 A;  1B07 A;  2EYX A;  2X3X D;  5I22 A;  1GRI A;  3PVQ A;  2J06 A;  1NG2 A;  1AWW A;  2RN8 A;  2X3W D;  2YDL A;  1J3T A;  3VRZ A;  2KGT A;  4RTZ A;  1CKB A;  2EPD A;  1NLO C;  4ZNX A;  1WIE A;  2DL3 A;  5GJV B;  2J6O A;  2HDA A;  2LQW A;  5IH2 A;  4RTX A;  3VS6 A;  1GBR A;  4Z8A A;  2O88 A;  2GTJ A;  2L0A A;  2LQN A;  1NYF A;  2DJQ A;  3NGP A;  1WLP B;  2L3P A;  2E5K A;  2BZX A;  2HEQ A;  2J6F A;  4OMN A;  4CC2 A;  2A28 A;  1BBZ A;  2DNU A;  1SPK A;  1BU1 A;  5I11 A;  2EYZ A;  1AWO A;  2ENM A;  1M8M A;  1Z9Z A;  2RQU A;  2FPD A;  2FG0 A;  1H92 A;  1V1C A;  1AOJ A;  2C0O A;  2BTT A;  1X6G A;  3M0S A;  1GCP A;  2K7A A;  1PKS A;  1X69 A;  1UTI A;  1QCF A;  1ABQ A;  3QWX X;  1WXB A;  2ECZ A;  1ZUK A;  4GBQ A;  1Z9Q A;  2EYW A;  3UF4 A;  4OMM A;  1MV3 A;  3M0Q A;  1KFZ A;  1QKX A;  4JJC A;  4Y92 A;  2KR3 A;  1HJD A;  1PKT A;  4J9E A;  4F14 A;  5HCK A;  1UJ0 A;  4ESR A;  1I0C A;  2P4R A;  3REA B;  2W0Z A;  2K6D A;  2BZY A;  2DMO A;  1T0H A;  4DEY A;  1GCQ A;  2B86 A;  1AWX A;  4CC7 A;  2O9V A;  4Z89 A;  3H0F A;  1WDX A;  2C0I A;  1YWO A;  1UUE A;  2FEI A;  1BB9 A;  1T3L A;  1S1N A;  1EFN A;  4DEX A;  4M4Z A;  1M27 C;  2ED0 A;  1AD5 A;  2YSQ A;  2LZ6 B;  2YUQ A;  4J9B A;  4J9H A;  4JJD A;  4F16 A;  1X2Q A;  2A36 A;  4LN2 A;  5IHN A;  2F2W A;  4AFZ C;  1GFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...