5FWCA

Human spectrin sh3 domain d48g, e7a, k60a
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
KALVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNGRQGFVPAAYVKALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPECTRIN ALPHA CHAIN, NON-ERYTHROCYTIC 1
publication title Human Spectrin SH3 Domain D48G, E7A, K60A
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5fwcA00
2KYMA 1MV3A 1S1NA 1GRIA 2LQNA 4RTYA 3VS6A 1X2QA 3U23A 3EHRA 4AG2C 1VA7A 2KE9A 4Z88A 2VVKA 3EG3A 2AZVA 3LH5A 4RTXA 2MCNA 1I07A 1MV0B 2DRKA 2I0NA 4JZ4A 1U3OA 1PNJA 3QWXX 1AD5A 1UECA 2CSIA 2GBQA 2LJ0A 3KFVA 1ARKA 2GGRA 1VYTA 2GQIA 2A37A 2BTTA 4F17A 2DA9A 1SEMA 1AWJA 2DLPA 1X6GA 1XOVA 2RNAA 1M3AA 2NUZA 2HDAA 2F2VA 2C0OA 2W0ZA 1UUEA 2DL7A 2K79A 2GTOA 3M0PA 4HXJA 1W1FA 1SHGA 2CDTA 1UJYA 4JJBA 3GBQA 2FPFA 4OMMA 1U5SA 3NPFA 4OMQA 1GL5A 2RN8A 2D1XA 2EVRA 1BBZA 1K0SA 1ZBJA 1ZUYA 1JEGA 1VYUA 1X2KA 2LJ1A 2M0YA 1RI9A 2J6FA 2KXCA 1HD3A 5FWCA 1T3LA 2CT4A 1GFDA 2VKNA 2D8JA 1AEYA 2ROTA 2YUNA 4QT7A 4JZ3A 1QWEA 1QWFA 1TG0A 1K0XA 2YSQA 2A36A 4HVUA 4OMNA 2KYBA 1E6GA 2CSQA 4RTWA 2SEMA 1OV3A 1BB9A 3M0QA 1K9AA 1VYVA 3H0FA 4OMOA 1Y0MA 1KJWA 4J9HA 1AWXA 1T0JA 2J6KA 1M3CA 2L2PA 2DL8A 1V1CA 2C0IA 1Z9ZA 4IIMA 4OMPA 2L3PA 2J6OA 4JJDA 2FPDA 2HBWA 2EYWA 3VS7A 2M51A 2LCSA 2XMFA 2O9VA 1EFNA 2RF0A 2CUBA 4CC2A 1YN8A 4DEYA 5FW9A 1OOTA 2DF6A 4RTTA 2QDLA 1SRLA 3PVQA 2EGAA 3EG2A 4HCKA 1X69A 2AZSA 2V1QA 1PHTA 2J7IA 2DL5A 2DRMA 2J06A 2EW3A 2KT1A 1KFZA 1OPLA 3UA7A 1H8KA 3REBB 1PWTA 1B07A 5IHKA 1WIEA 1WYXA 3C0CA 2KR3A 1I1JA 2EYYA 4OMLA 1AWWA 3M0SA 1PKTA 1M27C 1SPKA 1WDXA 2YUPA 1K1ZA 2RQVA 2CT3A 1E7OA 1UFFA 2VWFA 4LN2A 2FEIA 4ORZA 2V1RA 4CC4B 1RUWA 1BU1A 2FRWA 1G83A 4ESRA 2ENMA 2P4RA 2W10A 4JJCA 2BZXA 2O2OA 5IXFA 2HEQA 2X3WD 3SEMA 3VS5A 1GBRA 1WXUA 4AFZC 1HSQA 4K11A 1TUDA 4F14A 4M4ZA 1LCKA 1ZUUA 2DM1A 1WI7A 3I5RA 5IH2A 2K7AA 1NEBA 3VS0A 2YDLA 1KIKA 2FG0A 2KRSA 1QKWA 4FSSA 3H0HA 3UF4A 4KRTA 2CREA 1ZUKA 3QWYA 1ZLMA 2LJ3A 2FRYA 2JM8A 1ZSGA 3A98A 3ZL7C 4HVVA 1SSHA 2L3QA 3SHWA 1RLQC 1U06A 2BZYA 3VS4A 4D8KA 4AFSC 2G6FX 2K3BA 2LNHB 1RLPC 2B86A 2DL3A 2YUQA 2RQRA 1WLPB 5L23A 1WX6A 2JM9A 2DX1A 3IQLA 4A63B 2L0AA 2FO0A 1HJDA 1JQQA 1SRMA 1OEBA 2RPNA 2EYZA 3NGPA 1NEGA 1B3QA 1NG2A 2A28A 5IHIA 5GJWB 1W70A 4RTVA 1GFCA 2CH4W 3PE0A 1M30A 1N5ZA 1K76A 2GNCA 2K2MA 1GCQA 2FPEA 2JXBA 4HVWA 4AFUC 5I22A 4RUGA 1T3SA 1A0NB 1W6XA 4IIOA 3M0TA 3TSZA 4JPBW 1H3HA 2DL4A 2LX7A 1AOJA 2EGCA 1UHFA 1Z9QA 5EC7A 1YNZA 2MOXA 2EGEA 1UHCA 4J9EA 1PRMC 2AK5A 3VS3A 2DNUA 1YCSB 4GLMA 3H41A 1QCFA 4GBQA 2D0NA 2LMJA 2EQIA 3JV3A 2JTEA 1AZGB 2AKLA 2D8HA 2KNBB 2MIOA 1NM7A 1Y57A 1YWOA 2CH4A 3VS1A 4EIKA 2K6DA 1WXBA 1CSKA 3M0UA 1BK2A 1E6HA 1MUZA 3I5SA 1M8MA 4LUDA 4CC3A 1NYGA 2DBKA 2AKKA 2BZ8A 1H92A 2KEAA 3VS2A 1X43A 1AVZC 2F2XA 2O31A 2K9GA 2JMCA 1ABOA 1GCPA 2KGTA 1ZX6A 1QLYA 1IO6A 2JS0A 2HSPA 3EHQA 1AWOA 3I9QA 2PTKA 2DE0X 2KBTA 2EBPA 2LP5A 2LZ6B 1KSWA 3EGUA 1X6BA 1FYNA 5ECAA 1WFWA 1G2BA 4D8DA 5HCKA 1UJ0A 4CC7A 4DEXA 1UTIA 3ULRB 1UG1A 2PNIA 5I11A 2YT6A 3UATA 1NLPC 2ESWA 4LNPA 3H0IA 2EKHA 1YP5A 2KROA 1X27A 1OPKA 3TVTA 4ZNXA 3VRYA 1FMKA 1AZEA 4LUEA 2J05A 3NHNA 2X3XD 1SHFA 1QKXA 2OI3A 1JO8A 1I0CA 1NYFA 1JXMA 2KXDA 4J9BA 4LE9A 4J9CA 1JXOA 2DYBA 2DILA 1TUCA 2RQTA 2DJQA 1PRLC 2OAWA 3THKA 1UGVA 2KRNA 2SRCA 2ABLA 3UA6A 1J3TA 2DVJA 4Z89A 1K4US 2ECZA 1UDLA 1T0HA 4J9GA 2NWMA 4R0KA 2KT8A 2O88A 3R6NA 3REAB 2RQWA 4E6RA 3I35A 1WA7A 2KRMA 3FJ5A 1CKAA 3EG0A 4F16A 3EG1A 2O9SA 2EPDA 4Y92A 1UE9A 4X1VA 2F2WA 2LQWA 3PVLA 5IHNA 2E5KA 1PKSA 5IXBA 2PZ1A 2C0TA 4J9DA 2HCKA 1GBQA 2ED0A 4AG1C 2OJ2A 2EYXA 2RQUA 2JW4A 5FWBA 4RTZA 4J9IA 4Z8AA 2CUDA 5GJVB 1GCQC 1M3BA 2L3SA 2GTJA 1NLOC 2RMOA 1YWPA 2JMAA 2DMOA 3NMZC 3RNJA 3M0RA 3O5ZA 2JT4A 3VRZA 1JU5C 2JS2A 2ED1A 3TSWA 3RBBB 4J9FA 2YUOA 2DBMA 2IIMA 4AFQC 4RTUA 1WXTA 2A08A 4WCIA 1ABQA 2ROLA 3CQTA 2H8HA 1CKBA
chains in the Genus database with same CATH superfamily
2V8JA 1PC0A 3QUIA 4BE2A 3OYEA 1D09B 3OS5A 3INZA 1X2QA 3AHUA 1VA7A 3OBYA 2KE9A 2ZPFB 3QXEB 1ACMB 4M7AF 2NUTB 3RESA 1Q86C 3ZFJA 1MV0B 4HA8A 2X4WA 1R0BG 4LD9K 3QWXX 2EKOA 1OX8A 9ATCB 2LJ0A 1VQ8Q 3JB9J 2GGRA 2BTTA 4B9WA 3CPWA 2DA9A 2RD1A 3VUBA 1NBEB 4N0AC 2JJ9A 4C8QG 1X6GA 1M3AA 2FL7A 2F2VA 2QTXA 1YI2Q 2K57A 1UUEA 2DL7A 1Y96B 3ER0A 4DOWA 2GTOA 1SHGA 3G71T 5J26A 2LDMA 1RAHB 4M78D 1K8AC 1M1FA 1QCNA 1BCMA 3JCMV 5GAMe 3X24B 2ZPHB 1BBZA 1M90R 5HY6A 1LJOA 3CXCP 1WHHA 2M0YA 1G3TA 1HD3A 1W2BP 4B9XA 5C6SA 1GFDA 3CCRT 1YJWQ 2VKNA 2D8JA 1AEYA 2YUNA 3CC7T 4RG8A 2LNVA 1RACB 1C6VX 1BI3A 1QWFA 3CMEQ 1UGSB 3ME9A 5L8RE 4OMNA 2CSQA 4RTWA 2QG9B 2SEMA 1OV3A 2PU9B 4RCBA 4M75D 5DLOA 3GPLA 1KQSS 1QW1A 4JS5A 4EMGA 4OMOA 1KJWA 4J7IA 4JUVA 2DL8A 1Z9ZA 2RM4A 2HBWA 5GAMj 4AMCA 2M51A 2KVQG 2Y4YA 5CQXA 4EDUA 3S6WA 4PKCC 2RF0A 4BI4A 1WZOA 1ZBXA 3C95A 3QO3A 2DF6A 3EGDA 4RTTA 1M2OA 3PGGA 2EGAA 3A8OB 5LJ3e 3OYBA 1PD1A 4HCKA 4M78G 1X69A 2V1QA 2VYTA 5GAOm 1VQNA 3JCMd 1R77A 1KQ2A 2DD5A 2J06A 4OGCA 1OPLA 3REBB 3TCJA 4IUQA 5CIUA 1C1AA 4MMLA 4MDWA 3C0CA 4C92D 1AWWA 1YHQA 1U8RA 1TH7A 1O9SA 2YUPA 3JCMJ 4M7AC 2CT3A 3CCUT 2VWFA 2HQXA 3J80E 4ORZA 5CKHA 5LJ5g 1M90U 1NE8A 2I2LA 2XICA 2CZ7B 3OYKA 5GMKl 1PSEA 3BDUA 1U1TA 3CPFA 2GFAA 2QQBA 4M75G 3LLRA 4M4ZA 1LCKA 5IH2A 5LJ3j 2FYKA 3VYHB 4M78B 4J6WA 2E64A 1ZUKA 4C0FA 3CCVT 4ZTJA 4HVVA 2KQWA 2M0OA 3SHWA 3OW2S 5GAOp 3JSCA 5HK3A 4PK4A 1SG5A 3X28B 3CD6A 2K3BA 1IRXA 3OS0A 2B86A 4KH0B 1VQNQ 3EG9A 2EQUA 2P0PA 3VJPA 1I5LA 3V8JA 1B34A 4ZTFA 2FO0A 4R56A 3CMAT 2BKDN 1WPYA 1YJ9T 3NGPA 1NEGA 2RI2A 2RI5A 3QDRB 5GJWB 4M75B 4ZGDB 2VB6A 1PSFA 1X01A 1YHQQ 3PE0A 3HRTA 1K76A 3I56T 3C94A 3ZEHA 4PLIA 1A0NB 2V8KA 2LT1A 3L2VA 1K9MR 2LX7A 1AOJA 3OMCA 1XJWB 1Z9QA 3I55A 2HMAA 1YNZA 2MOXA 2HAXA 3R6OA 4V2SA 3VS3A 3SWNC 2E6ZA 1VQ8T 2FZKB 3H41A 4PJOG 2XHCA 3M55A 1Q81R 2D0NA 2LMJA 2DJZA 3JV3A 4BY6C 2D8HA 2MIOA 1YI2T 3VS1A 1WXBA 3JB9F 1M8MA 3QZ5B 4LUDA 4MZTA 4C92B 4IUUA 3KXTA 2BZ8A 4XK8E 2NUPB 2P0KA 4XU2A 4FU6A 1X43A 3TU4K 2O31A 5GAN5 2K9GA 2JMCA 3RDVA 3UDCA 2KGTA 1HXDA 4N4IA 4VUBA 2HSPA 1KK7A 4FW2A 5GANh 3I9QA 3MKDA 3JCMQ 4P5NA 4IKFA 2LP5A 8AT1B 4C5HA 3G71A 1YJWT 4C92F 1JJ2A 4OF1A 4NS5A 1X6BA 2WSFE 1N9SA 3MO8A 2CYZB 4D8DA 3CMET 2FVUA 1UGQB 1N8RC 2EJ9A 4CC7A 1YBYA 2WSCE 1UTIA 4C0GA 5J39A 4BUGA 1Q86R 2QI2A 3CCRA 3I55Q 1VIFA 2YT6A 5A0LA 2E10A 3UATA 2LQ8A 2K3XA 3CC7A 1QVPA 3TVTA 4F7UE 2CP6A 1QKXA 2ZGWA 3UPUA 1I0CA 1K9MU 1MMAA 1OU9A 4ZGJB 3HRUA 1JXMA 5CAIA 4J9BA 4C5EA 1JXOA 5HKCA 5GAN4 3VYGA 4IURA 1PRLC 3THKA 2KRNA 2SRCA 3JRZA 3WVDB 1K8AR 2RJCA 1MMGA 3F70A 1Q81U 3JCMP 4EMHA 1UDLA 1MGQA 1M2VA 2NWMA 4JLGA 2F69A 2HQHA 2KT8A 3LWIA 3SD4A 5CQYA 3PIPA 1WA7A 3FJ5A 3EG0A 5GAN7 4PFOA 2KI7A 1BI1A 3QDFA 3M9QA 2DXTA 3LGLA 3G71Q 4DQ2A 1DJ7B 3V8LA 5KYYA 4M77G 4BE0A 1B7TA 2E5KA 1PKSA 5IXBA 4HCZA 4Y91A 4IUVA 3RIRA 1GBQA 4F04B 4QQ6A 3CBPA 4AG1C 3EFOB 2ZPEB 2DYIA 2JW4A 3V7RA 1GCQC 3CC7Q 1M3BA 1O75A 5GAMg 1VQ4T 3DLMA 2YWWA 2JUFA 2VV5A 1R0CB 2JS2A 2MPXC 2QQRA 2LX9A 4RTUA 3TREA 2A08A 4X34A 1ABQA 2NUTA 3CQTA 2H8HA 1CKBA 1BCOA 5GMKi 2OX7A 1MV3A 3C12A 2LQNA 4L5GA 3VS6A 4E7LA 4M7AE 3U23A 4AG2C 5DLQE 5GANe 1Y07A 1VIEA 2AZVA 1I07A 4XTYA 4M7DD 2DRKA 1ZHIA 5FU7C 2E12A 1KD1C 1MHNA 2GBQA 1K8AU 2EYQA 2DLPA 1XOVA 4OGEA 2RNAA 2NUZA 4RG2A 1RAEB 5KYNA 2Y4XA 2W0ZA 3GP8A 2K79A 3M0PA 1W1FA 4EMKB 4KBMB 5LJ3g 1YJ9A 5KH6A 1AHJB 3MP1A 4HCCA 2OTLQ 4OMMA 1U5SA 3M53A 3HTRA 3ZBDA 3ASKA 3VUZA 1GL5A 3CXCA 3CCUQ 2HKQB 4KGZB 1ZBJA 2YRDA 1MMDA 2CP0A 1Q82C 5GANj 1VYUA 1X2KA 2LJ1A 3PNWC 5DY9A 5FWCA 5IT9E 1VQKT 3CPWS 2RK1A 3CCST 1QWEA 2ATCB 3JCMf 2XG8D 1ZSZB 3X26B 2XKOC 4HVUA 1VQ8A 1N6AA 2F5KA 1VQPT 1E6GA 4C8QD 1BB9A 3M0QA 3CCVQ 1QP3A 1K9AA 1YI2A 4HT9A 3FLGA 1VYVA 2A3LA 1Y0MA 4J9HA 4PL6A 1T0JA 2JOYA 3CCLQ 1M3CA 2L2PA 2C0IA 3PT9A 4IIMA 3URGA 2L3PA 1I81A 4JJDA 2EYWA 3VS7A 3SDZA 3JCMc 2DZCA 3RUXA 1LVKA 1OOTA 2QDLA 1TOVA 3PVQA 3CMAQ 2EAYA 3EG2A 3QBYA 1YJWA 3JCMb 4Z02A 2PUOB 1WGSA 2EW3A 4ELZC 3I56Q 1BIBA 1VQOT 3O8VA 2MWOA 2QQAA 3CMEA 2E41A 1AT1B 1IZ6A 1WYXA 1YCYA 1TS9A 4OMLA 3FRNA 3M0SA 1PKTA 1WJQA 1SPKA 4PJMA 4M7DB 1GXIE 4UC4A 3OYAA 3RKXA 4PJLA 2V1RA 1D0ZA 1EIFA 2P4RA 2BZXA 4M78A 4N4HA 2X3WD 1GBRA 3UWNA 1WHLA 1HSQA 4FYVB 5CK9A 1D1AA 1ZUUA 4M7DF 3I5RA 5CR2A 2HQEA 4A4KA 4BDZA 3QJYA 3HP9A 5IAYA 3M57A 3OQ5A 3A5ZB 2CS7A 3H0HA 3UF4A 4KRTA 2CREA 1QVFS 4WF2A 2LJ3A 2DK3A 2FRYA 1N8RR 3RERA 2RH2A 3S3NA 4RCCA 1YFNA 3DLLA 5KE2A 4AT1B 1U06A 2KY9A 2KK4A 1RL2A 4AFSC 5GAN2 1VQ5T 4FYXB 2KMTA 2QK0A 4JS4A 3S3OA 2DO3A 2DL3A 5KYWB 4J8OA 2V8IA 1UGPB 4M75A 4E7HA 2VASA 3IQLA 4A63B 2L0AA 2LTOA 1HJDA 1JQQA 2EYZA 2RA2A 4C8QB 2P0QA 2X35A 2EIFA 2XK0A 5CVIA 4A4FA 4E7KA 1JB0E 3HRSA 2MI6A 2QGFB 1GFCA 2CH4W 4KGXB 2RB6A 3OYNA 5FRNA 1GCQA 4JLIA 3S3MA 4KUDK 2FPEA 1ZQ1A 1FXXA 2CZ0B 5C0MA 2QTVA 3M0TA 4JPBW 3QPHA 1G3SA 2DL4A 4JJNK 3Q1JA 1UB4A 3J7AF 4C8QF 5EC7A 3HPWA 4XU3A 1P92A 4C5GA 1PRMC 2AK5A 1TTHB 3META 1YCSB 2M02A 1OULA 2EFIA 4C92A 2D6FA 5GAN3 2NUPA 1WHMA 3JB9I 2KNBB 1VQMT 2LCLA 1IGQA 3M0UA 2FB7A 1UGRB 1MUZA 3I5SA 4CC3A 3FDRA 2VXFA 2DETA 3MP6A 1VQ7Q 2OTLT 1R8OB 4FIBA 2L8DA 3L2ZA 1AVZC 2F2XA 2XU8A 3A1PA 2ZAEA 3NTIA 4JRIA 5LL6S 1N8RU 4L59A 2JS0A 2KAFA 1RAFB 5D6XA 1VQ9Q 4C92E 2EBPA 3GF5A 3OS1A 1KSWA 2L5QA 3MEAA 1YIJQ 1M4ZA 4E7ZA 1M1GA 5KYXB 1YJNQ 2KSSA 4X9CA 2QXFA 3SFMA 5HCKA 5KE3A 1UJ0A 1VQ4Q 1VQ6Q 4PJOD 4DEXA 1QCOA 1BIAA 1TU0B 1D3BB 5I11A 1VQKA 4LNPA 3CCSA 1KD1R 3CCLT 1OPKA 2QYZA 1FMKA 1PM3A 3M54A 3NHNA 2X3XD 4M78F 1QVGS 1WNLA 1VQPA 3A8HB 3PFSA 1JJ2S 2KXDA 3D7SB 4C0DB 1G3YA 2DJQA 2RQTA 2ZPBB 2OAWA 3G4ST 1D0XA 3L2RA 1KG1A 3HL8A 4Z89A 3QHSA 1T0HA 2RHYA 3H6ZA 5GANg 4R0KA 3CCQT 1Q82R 4QQDA 3I35A 1WHKA 5FLXE 1IREB 4OB1B 1N9RA 2DXBA 3QIIA 4Y92A 1JBMA 1UE9A 4X1VA 3CCJT 5GAMd 5LJ5h 4C8QC 2GQVA 3EFOA 4M75F 3A8MB 1H3ZA 4ATOA 2C0TA 4J9DA 5A0GA 4LDXA 3BDLA 1QQJA 4E7SA 4MZPA 2EJFA 2L3RA 2YHTA 2DTOA 2OJ2A 2EYXA 1VQKQ 5FWBA 1OYXA 3FEOA 5D6WA 3CCSQ 5GJVB 2L3SA 2GTJA 2RMOA 5CO7A 1YWPA 2JMAA 2DMOA 3RNJA 3M0RA 2MWPA 1OI1A 3LWHA 1JU5C 3TSWA 3RBBB 1RAIB 4XU0A 5GAN8 3QJ6A 1VQPQ 1IHVA 1YITQ 2RHXA 1KD1U 3BY7A 2KYMA 3OYYA 4MMKA 1GRIA 4RTYA 4M77D 3E1SA 3L2WA 4L6V5 1ZA1B 4JRPA 4RTXA 1QVFP 1OZ2A 5LJ3d 4PJOB 2IVWA 4CRIA 2RI3A 3OW2A 2D0QB 4Q5WA 1PNJA 3SB2A 4OB3B 1AD5A 2P4TA 1UECA 5AYFA 3KFVA 1VQ5A 1VYTA 2GQIA 4EMKA 2A37A 1WQ7A 3P8BB 2RJEA 4NL2A 1Q82U 2C0OA 1VQOQ 5CKBA 2YLCA 4PJOF 3DB3A 3G6ET 3BW1A 4M78C 4JJBA 1UJYA 2F5TX 5EG2A 4DBHA 2H3EB 4NL3A 2HL3A 3PMTA 4OMQA 4PFPA 2RN8A 2D1XA 2DD4A 2EVRA 1KQSP 1WJSA 1JEGA 1K73C 1RI9A 2KXCA 1HYOA 4FT2A 1ZSZA 5KCHA 5GMKh 2CT4A 2E3HA 2DERA 2MAMA 3VV0A 2ROTA 4O5VA 4XAXB 1VOMA 4JZ3A 3MEUA 3TQ7P 5LJ5f 4DA4A 2HL5C 1VQ7T 1NJIC 4HKEA 2A36A 4D6WA 4E7IA 3EG9B 4IUTA 1WQWA 2P84A 4J7FA 3JCMh 4FYWB 3KUFA 2BUDA 2JVVA 4M75C 1VQMA 1VQ9T 2K3YA 3RR6A 3H0FA 5GAOl 1AWXA 5HK0A 5LJ5e 3MPUB 1W2BS 3QKJA 1YIJT 5KCOA 3H8ZA 5FU6B 2O4XB 3GIBA 2NYSA 3L2QA 2J6OA 1VQ5Q 8ATCB 2OTLA 1YJNT 3E9FA 1SSFA 2LCSA 2LC4A 2XMFA 2O9VA 1EFNA 4CC2A 1YN8A 3GOXA 1RI0A 3CCUA 5FW9A 1VQ6T 2DKGA 1TXQA 4F7UG 1WHGA 1Q86U 1Q7YC 1TUGB 3OYJA 2J7IA 1OX9A 4Y28E 2DRMA 3OBWA 3V7SA 2KT1A 1KFZA 3HKSA 3UA7A 4M7DA 2XDPA 1EX4A 3TEEA 1H8KA 4M77B 1PWTA 4TVRA 5IHKA 2YRCA 1I1JA 2EYYA 4C92C 1RAAB 2JN0A 2Y90A 5I2SA 2YRVA 1WDXA 4M7AD 2MMPA 1K1ZA 5GAOn 3CCVA 2Z0WA 4LN2A 3EFSA 4PJJA 2FEIA 1RUWA 3CCLA 2MK5A 1W4SA 2FRWA 1Y96A 3OW2P 4QVDA 2HEQA 3RKWA 3SEMA 3VS5A 1WXUA 4M77F 4AFZC 1QVGP 4M7DE 2EQMA 2DXCA 2L89A 4DBQA 2LVMA 1KHCA 1TUDA 2R5AA 1VQMQ 4F14A 4E2FB 2K5FA 2DM1A 1WI7A 4OP0A 4BI3A 3VS0A 4HCBA 4F7UB 3G1JA 3G4SA 3CMAA 4E7JA 4PJOC 2HNIA 1TWBA 2IG0A 5M9OA 3OYIA 3QWYA 3VU3C 3I56A 2JM8A 1ZSGA 3A98A 5KYWA 3CCQA 1SSHA 2L3QA 1TSFA 4PFZA 2BZYA 2DEQA 4D8KA 2G6FX 3GNFB 2LNHB 3X25B 4C8QA 2RQRA 4ZN3A 1WX6A 2JM9A 3OA6A 5GMKe 1SRMA 1OEBA 4QW2A 2RPNA 4BE1A 4ELYC 1I4K1 1W70A 3EH2A 4M7AG 1YITT 2K2MA 3H9NA 5AT1B 4O6JA 1IXDA 2JXBA 4A4EA 1KQ1A 3N5BB 3G7ZA 5I22A 3JCMe 4RUGA 1T3SA 1W6XA 4R55A 3TSZA 4C8QE 3M5AA 2X51A 1UHFA 1XQHA 2ZPIB 2X9HA 4J6YA 4KULA 4MZMA 1UHCA 2PVGB 3RKYA 4J83A 4ME7A 1FX7A 3EH1A 3G4SQ 3M56A 4GBQA 1AZGB 2O01E 3EGXB 2QGGA 5GMKj 2AKLA 1NM7A 1YWOA 4XTXA 3M4GA 4NOYA 3CCQQ 1BK2A 1E6HA 1NYGA 2DBKA 3CC2T 1H92A 1RADB 3KBGA 1M9SA 4M7AB 3VS2A 3CCET 1IHWA 1PCXA 2QDYB 2VGMA 4J6XA 3CCJQ 1ABOA 1GCPA 1ZX6A 1QLYA 1IO6A 2FZGB 2AIRB 5CCAA 1I5OB 2YLBA 5KYXA 3EHQA 1IGUA 3HFNA 3OYMA 2DE0X 4FSXA 2EWNA 3G6EA 4OB2B 3EGUA 2VGNA 3LYIA 4M77C 4GLKA 1FYNA 1BI2A 3MCAB 3L2UA 2RO0A 1D3BA 2XDDA 2JTFA 3X20B 2EJGA 3ULRB 2QQSA 3CCMQ 2PNIA 2DTIA 3M58A 1IB8A 2COYA 2ESWA 3H0IA 4JDSA 1YP5A 2KROA 5CKFA 5GAMf 1X27A 4ZNXA 2RJFA 4M78E 2J05A 5GANd 2ZCFB 1VQ7A 1SHFA 2OI3A 1JO8A 2K5LA 3CBMA 1WHJA 4EMKC 3VKIA 5DM7R 1NPRA 5KYUB 1H641 2DYBA 2DILA 1TUCA 1VQ9A 2MF2A 3UA6A 2QEXT 1X6OA 1YIJA 2DVJA 1J3TA 1K4US 3QYHB 4J9GA 1YJNA 4XU1A 3PTAA 3R6NA 2DFUA 4KH1B 3REAB 1K73R 2KRMA 3FIFA 4F16A 1VQ4A 1VQ6A 1D0YA 2K2VA 1RABB 2VXEA 2EPDA 3G6EQ 1ZSZC 4M75E 3QZ9B 2QAZA 3PVLA 5IHNA 4FYYB 2PUKB 2M9UA 3SWNB 4BI8B 3NTHA 1NJIR 3EFRA 2DAQA 2ED0A 4BY6B 4QVZA 5LJ3f 1M1KC 4YTLA 1JRIA 2LQKA 4LD6A 2M1HA 1G8XA 2K5IA 2GF7A 3FB9A 4Z8AA 1UEBA 1Y7XA 4BD3A 3JB9D 2K4YA 3WXMB 2JZ2A 4RKUE 2E3IA 3NMZC 3O5ZA 3BE3A 1QP2A 3MHXA 1OZ3A 2RJDA 3EAEA 2FHDA 1PG5B 5D7UA 4KGVB 1WXTA 4FT4A 1KC8C 2QA4T 2A0FB 4EPCA 2R5MA 4PJOA 1S1NA 1Q7YR 3V7CA 1G5VA 3CBOA 3EHRA 1OU8A 4Z88A 2VVKA 3EG3A 1QVFA 2OTJT 3LH5A 1BYMA 3WVEB 2HZYA 2DTHA 2MCNA 4M7DC 3RMSA 2I0NA 4RMOA 4JZ4A 1U3OA 1F1BB 2BIVA 2CSIA 1ARKA 2CP5A 1VQLT 4F17A 1SEMA 1AWJA 3CPWP 2HDAA 3LH0A 4X9DA 4PJOE 3E2UA 1K73U 2COZA 4HXJA 4IUPA 4OMFB 2CDTA 3T9NA 3GBQA 2FPFA 2LRQA 1LNXA 3OYGA 1S72T 2E65A 2XD0A 3NPFA 1KQSA 1YITA 3JB9G 1K0SA 3DKMA 1NJIU 1ZUYA 1OQKA 2J6FA 1T3LA 2HKNA 1U1SA 2LCCA 4LDUA 2DIQA 3L1AA 4QT7A 5D6YA 4FCYA 1TG0A 1K0XA 4MDXA 3J81E 2YSQA 3CC4T 2KYBA 4C92G 1NZ9A 2O4XA 3LGFA 3E9GA 1VQOA 1FMVA 2J6KA 2R57A 3CC2A 1V1CA 5J3BA 4OMPA 1FWZA 1Q7YU 3OYDA 2FPDA 3CCEA 3P8HA 4FM4B 3DB4A 2DZ9A 2CUBA 2EQJA 4LXCA 4DEYA 1SRLA 3CCMT 4M77A 2AZSA 2COWA 3A8GB 1PHTA 1V29B 2DL5A 1QMCA 4ZGEB 4FW1A 1V76A 3A8LB 3EGDB 5GAN6 2CKKA 1B07A 1WIEA 2KR3A 3CD6Q 2IPOB 1XNIA 2AHJB 1M27C 4N0AA 1MNDA 4OVAA 2RQVA 3PIOA 4XTZA 5FU7B 1E7OA 1UFFA 4BACA 4A53A 4A4HA 4CC4B 1BU1A 2DIGA 3JCMg 1G83A 4M77E 4ESRA 2ENMA 2X4JA 2W10A 4FL6A 4F7UA 4JJCA 2O2OA 5IXFA 1QVGA 1N27A 2V26A 1SF9A 4K11A 2CP3A 2K7AA 1NEBA 2E70A 3HFOA 2YDLA 4KT0E 3CC2Q 1KIKA 2FG0A 2CZ6B 2KRSA 1QKWA 2RHUA 4FSSA 1Y71A 1M90C 3LW5E 2QEXA 3CCEQ 5GAOq 2DEUA 5FROA 4PNOA 1ZLMA 2E6NA 1ZA2B 2E5QA 3ZL7C 5CKEA 3LX7A 3OMGA 1LPLA 3M4YA 1RLQC 3VS4A 1KHIA 3L42A 1EZZB 7AT1B 1RLPC 3E19A 2YUQA 3QYGB 3MP8A 1WLPB 2PVOB 3HHTB 5L23A 5GAOr 1BKBA 1LOJA 2DX1A 2WACA 1HK9A 2MYSA 1Q95G 4QVCA 2GFUA 1D1BA 4C0DC 1B3QA 1NG2A 2A28A 5IHIA 4N4GA 2FZCB 4RTVA 2QQ9A 3OY9A 1M30A 1N5ZA 1BI0A 3GLXA 1B34B 2GNCA 3CEYA 3AT1B 4LDWA 3MEVA 3OB9A 3CXCS 4HVWA 1SKUB 2CGHA 4AFUC 2AT1B 2ZZDA 3PMIA 4IIOA 1M5Q1 1H3HA 4XQ3A 2EGCA 2HSEB 1C0MA 2EGEA 2JNGA 3EGXA 4J9EA 3NTKA 2DNUA 2KDSA 5IN1A 3V8KA 2QA4A 4GLMA 1QCFA 2X4XA 2D9TA 2EQIA 4JRKA 2QEXQ 2JTEA 2DXUA 2BE9B 2E4HA 4M7AA 2DVEA 3CCRQ 1WJRA 1Y57A 2CH4A 3OSSC 4EIKA 2OTJA 2K6DA 2G3RA 2H3JA 1CSKA 1M1KR 2AKKA 4PLLA 2WSEE 2HBPA 4C5IA 2KEAA 4DBFA 4QQGA 5GANf 1VQLA 5LJ5j 2X4YA 2CP2A 2ZPGB 1AWOA 2PTKA 4BDYA 3OYHA 3GNGA 2KBTA 2LZ6B 2RHZA 3OYFA 1VQNT 2CP7A 2RK2A 1KC8R 1MNEA 3P8DA 1S72A 1JJ2P 4OB0B 5ECAA 1WFWA 1PD0A 4KUIA 1G2BA 1NPPA 5A2QE 3JCMW 1I8FA 2E1HA 4J5YA 2XIDA 3RMQA 1UG1A 5I21A 2LT4A 2NLUA 1YHQT 2B8AA 3FC3A 2BE7D 4B6MA 1NLPC 3NFCA 2C06A 4A54A 2EKHA 4LDVA 2GCXA 5KYUA 5GMKm 3QSUA 3VRYA 1AZEA 4LUEA 2QA4Q 4F7UF 6AT1B 5GAMh 3CC4A 4XTUA 3CCJA 1NYFA 2R58A 4LE9A 4J9CA 2OTJQ 1RAGB 3JAME 5I2MA 1VUBA 2VC8A 2JTMA 4QKUA 4DBRA 1UGVA 1M8VA 4PJNA 1W2BA 2ABLA 4DOVA 1MMNA 2ECZA 2OAUA 1VQLQ 2XI9A 1K9MC 3BFMA 1D1CA 4XTVA 3OSVA 2O88A 2RQWA 4C0ZA 4E6RA 2CZ1B 5A0DA 1CKAA 2PQWA 3SWNA 3EG1A 2O9SA 3OYCA 1M1KU 4II1A 3CD6T 4BB7A 1M2VB 3CCMA 2YXYA 2F2WA 3M59A 1Q81C 2M16A 3OYLA 1G3WA 2LQWA 1S72Q 4E47A 4GY5A 3OS2A 2RHIA 4CI0C 2QASA 4M7DG 2PZ1A 2HCKA 4XTWA 5CKDA 3C4SA 4JRQA 5KYYB 4LDYA 2HD0A 2VUBA 3UT1A 3FJPA 2EQKA 2RQUA 5FU6C 1KC8U 2PVDB 4RTZA 4J9IA 5LJ3h 3JB9H 4HT8A 2CUDA 3HSBA 4ZN1A 2A7YA 1NLOC 4WTOB 2JT4A 3MEWA 3VRZA 2ED1A 3JCMX 4A4GA 3QG1A 2DPPB 5FRMA 1YJ9Q 4J9FA 3CC4Q 2YUOA 2DBMA 3I55T 2IIMA 5LJ5d 1X75C 3MJXA 1XTDA 1FMWA 4AFQC 2F1LA 4ANJA 4WCIA 2ROLA 2XDBA
chains in the Genus database with same CATH topology
2KYMA 1MV3A 1S1NA 1GRIA 2LQNA 4RTYA 3VS6A 1X2QA 3U23A 3EHRA 4AG2C 1VA7A 2KE9A 4Z88A 2VVKA 3EG3A 2AZVA 3LH5A 4RTXA 2MCNA 1I07A 1MV0B 2DRKA 2I0NA 4JZ4A 1U3OA 1PNJA 3QWXX 1AD5A 1UECA 2CSIA 2GBQA 2LJ0A 3KFVA 1ARKA 2GGRA 1VYTA 2GQIA 2A37A 2BTTA 4F17A 2DA9A 1SEMA 1AWJA 2DLPA 1X6GA 1XOVA 2RNAA 1M3AA 2NUZA 2HDAA 2F2VA 2C0OA 2W0ZA 1UUEA 2DL7A 2K79A 2GTOA 3M0PA 4HXJA 1W1FA 1SHGA 2CDTA 1UJYA 4JJBA 3GBQA 2FPFA 4OMMA 1U5SA 3NPFA 4OMQA 1GL5A 2RN8A 2D1XA 2EVRA 1BBZA 1K0SA 1ZBJA 1ZUYA 1JEGA 1VYUA 1X2KA 2LJ1A 2M0YA 1RI9A 2J6FA 2KXCA 1HD3A 5FWCA 1T3LA 2CT4A 1GFDA 2VKNA 2D8JA 1AEYA 2ROTA 2YUNA 4QT7A 4JZ3A 1QWEA 1QWFA 1TG0A 1K0XA 2YSQA 2A36A 4HVUA 4OMNA 2KYBA 1E6GA 2CSQA 4RTWA 2SEMA 1OV3A 1BB9A 3M0QA 1K9AA 1VYVA 3H0FA 4OMOA 1Y0MA 1KJWA 4J9HA 1AWXA 1T0JA 2J6KA 1M3CA 2L2PA 2DL8A 1V1CA 2C0IA 1Z9ZA 4IIMA 4OMPA 2L3PA 2J6OA 4JJDA 2FPDA 2HBWA 2EYWA 3VS7A 2M51A 2LCSA 2XMFA 2O9VA 1EFNA 2RF0A 2CUBA 4CC2A 1YN8A 4DEYA 5FW9A 1OOTA 2DF6A 4RTTA 2QDLA 1SRLA 3PVQA 2EGAA 3EG2A 4HCKA 1X69A 2AZSA 2V1QA 1PHTA 2J7IA 2DL5A 2DRMA 2J06A 2EW3A 2KT1A 1KFZA 1OPLA 3UA7A 1H8KA 3REBB 1PWTA 1B07A 5IHKA 1WIEA 1WYXA 3C0CA 2KR3A 1I1JA 2EYYA 4OMLA 1AWWA 3M0SA 1PKTA 1M27C 1SPKA 1WDXA 2YUPA 1K1ZA 2RQVA 2CT3A 1E7OA 1UFFA 2VWFA 4LN2A 2FEIA 4ORZA 2V1RA 4CC4B 1RUWA 1BU1A 2FRWA 1G83A 4ESRA 2ENMA 2P4RA 2W10A 4JJCA 2BZXA 2O2OA 5IXFA 2HEQA 2X3WD 3SEMA 3VS5A 1GBRA 1WXUA 4AFZC 1HSQA 4K11A 1TUDA 4F14A 4M4ZA 1LCKA 1ZUUA 2DM1A 1WI7A 3I5RA 5IH2A 2K7AA 1NEBA 3VS0A 2YDLA 1KIKA 2FG0A 2KRSA 1QKWA 4FSSA 3H0HA 3UF4A 4KRTA 2CREA 1ZUKA 3QWYA 1ZLMA 2LJ3A 2FRYA 2JM8A 1ZSGA 3A98A 3ZL7C 4HVVA 1SSHA 2L3QA 3SHWA 1RLQC 1U06A 2BZYA 3VS4A 4D8KA 4AFSC 2G6FX 2K3BA 2LNHB 1RLPC 2B86A 2DL3A 2YUQA 2RQRA 1WLPB 5L23A 1WX6A 2JM9A 2DX1A 3IQLA 4A63B 2L0AA 2FO0A 1HJDA 1JQQA 1SRMA 1OEBA 2RPNA 2EYZA 3NGPA 1NEGA 1B3QA 1NG2A 2A28A 5IHIA 5GJWB 1W70A 4RTVA 1GFCA 2CH4W 3PE0A 1M30A 1N5ZA 1K76A 2GNCA 2K2MA 1GCQA 2FPEA 2JXBA 4HVWA 4AFUC 5I22A 4RUGA 1T3SA 1A0NB 1W6XA 4IIOA 3M0TA 3TSZA 4JPBW 1H3HA 2DL4A 2LX7A 1AOJA 2EGCA 1UHFA 1Z9QA 5EC7A 1YNZA 2MOXA 2EGEA 1UHCA 4J9EA 1PRMC 2AK5A 3VS3A 2DNUA 1YCSB 4GLMA 3H41A 1QCFA 4GBQA 2D0NA 2LMJA 2EQIA 3JV3A 2JTEA 1AZGB 2AKLA 2D8HA 2KNBB 2MIOA 1NM7A 1Y57A 1YWOA 2CH4A 3VS1A 4EIKA 2K6DA 1WXBA 1CSKA 3M0UA 1BK2A 1E6HA 1MUZA 3I5SA 1M8MA 4LUDA 4CC3A 1NYGA 2DBKA 2AKKA 2BZ8A 1H92A 2KEAA 3VS2A 1X43A 1AVZC 2F2XA 2O31A 2K9GA 2JMCA 1ABOA 1GCPA 2KGTA 1ZX6A 1QLYA 1IO6A 2JS0A 2HSPA 3EHQA 1AWOA 3I9QA 2PTKA 2DE0X 2KBTA 2EBPA 2LP5A 2LZ6B 1KSWA 3EGUA 1X6BA 1FYNA 5ECAA 1WFWA 1G2BA 4D8DA 5HCKA 1UJ0A 4CC7A 4DEXA 1UTIA 3ULRB 1UG1A 2PNIA 5I11A 2YT6A 3UATA 1NLPC 2ESWA 4LNPA 3H0IA 2EKHA 1YP5A 2KROA 1X27A 1OPKA 3TVTA 4ZNXA 3VRYA 1FMKA 1AZEA 4LUEA 2J05A 3NHNA 2X3XD 1SHFA 1QKXA 2OI3A 1JO8A 1I0CA 1NYFA 1JXMA 2KXDA 4J9BA 4LE9A 4J9CA 1JXOA 2DYBA 2DILA 1TUCA 2RQTA 2DJQA 1PRLC 2OAWA 3THKA 1UGVA 2KRNA 2SRCA 2ABLA 3UA6A 1J3TA 2DVJA 4Z89A 1K4US 2ECZA 1UDLA 1T0HA 4J9GA 2NWMA 4R0KA 2KT8A 2O88A 3R6NA 3REAB 2RQWA 4E6RA 3I35A 1WA7A 2KRMA 3FJ5A 1CKAA 3EG0A 4F16A 3EG1A 2O9SA 2EPDA 4Y92A 1UE9A 4X1VA 2F2WA 2LQWA 3PVLA 5IHNA 2E5KA 1PKSA 5IXBA 2PZ1A 2C0TA 4J9DA 2HCKA 1GBQA 2ED0A 4AG1C 2OJ2A 2EYXA 2RQUA 2JW4A 5FWBA 4RTZA 4J9IA 4Z8AA 2CUDA 5GJVB 1GCQC 1M3BA 2L3SA 2GTJA 1NLOC 2RMOA 1YWPA 2JMAA 2DMOA 3NMZC 3RNJA 3M0RA 3O5ZA 2JT4A 3VRZA 1JU5C 2JS2A 2ED1A 3TSWA 3RBBB 4J9FA 2YUOA 2DBMA 2IIMA 4AFQC 4RTUA 1WXTA 2A08A 4WCIA 1ABQA 2ROLA 3CQTA 2H8HA 1CKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KYM A;  1MV3 A;  1S1N A;  1GRI A;  2LQN A;  4RTY A;  3VS6 A;  1X2Q A;  3U23 A;  3EHR A;  4AG2 C;  1VA7 A;  2KE9 A;  4Z88 A;  2VVK A;  3EG3 A;  2AZV A;  3LH5 A;  4RTX A;  2MCN A;  1I07 A;  1MV0 B;  2DRK A;  2I0N A;  4JZ4 A;  1U3O A;  1PNJ A;  3QWX X;  1AD5 A;  1UEC A;  2CSI A;  2GBQ A;  2LJ0 A;  3KFV A;  1ARK A;  2GGR A;  1VYT A;  2GQI A;  2A37 A;  2BTT A;  4F17 A;  2DA9 A;  1SEM A;  1AWJ A;  2DLP A;  1X6G A;  1XOV A;  2RNA A;  1M3A A;  2NUZ A;  2HDA A;  2F2V A;  2C0O A;  2W0Z A;  1UUE A;  2DL7 A;  2K79 A;  2GTO A;  3M0P A;  4HXJ A;  1W1F A;  1SHG A;  2CDT A;  1UJY A;  4JJB A;  3GBQ A;  2FPF A;  4OMM A;  1U5S A;  3NPF A;  4OMQ A;  1GL5 A;  2RN8 A;  2D1X A;  2EVR A;  1BBZ A;  1K0S A;  1ZBJ A;  1ZUY A;  1JEG A;  1VYU A;  1X2K A;  2LJ1 A;  2M0Y A;  1RI9 A;  2J6F A;  2KXC A;  1HD3 A;  5FWC A;  1T3L A;  2CT4 A;  1GFD A;  2VKN A;  2D8J A;  1AEY A;  2ROT A;  2YUN A;  4QT7 A;  4JZ3 A;  1QWE A;  1QWF A;  1TG0 A;  1K0X A;  2YSQ A;  2A36 A;  4HVU A;  4OMN A;  2KYB A;  1E6G A;  2CSQ A;  4RTW A;  2SEM A;  1OV3 A;  1BB9 A;  3M0Q A;  1K9A A;  1VYV A;  3H0F A;  4OMO A;  1Y0M A;  1KJW A;  4J9H A;  1AWX A;  1T0J A;  2J6K A;  1M3C A;  2L2P A;  2DL8 A;  1V1C A;  2C0I A;  1Z9Z A;  4IIM A;  4OMP A;  2L3P A;  2J6O A;  4JJD A;  2FPD A;  2HBW A;  2EYW A;  3VS7 A;  2M51 A;  2LCS A;  2XMF A;  2O9V A;  1EFN A;  2RF0 A;  2CUB A;  4CC2 A;  1YN8 A;  4DEY A;  5FW9 A;  1OOT A;  2DF6 A;  4RTT A;  2QDL A;  1SRL A;  3PVQ A;  2EGA A;  3EG2 A;  4HCK A;  1X69 A;  2AZS A;  2V1Q A;  1PHT A;  2J7I A;  2DL5 A;  2DRM A;  2J06 A;  2EW3 A;  2KT1 A;  1KFZ A;  1OPL A;  3UA7 A;  1H8K A;  3REB B;  1PWT A;  1B07 A;  5IHK A;  1WIE A;  1WYX A;  3C0C A;  2KR3 A;  1I1J A;  2EYY A;  4OML A;  1AWW A;  3M0S A;  1PKT A;  1M27 C;  1SPK A;  1WDX A;  2YUP A;  1K1Z A;  2RQV A;  2CT3 A;  1E7O A;  1UFF A;  2VWF A;  4LN2 A;  2FEI A;  4ORZ A;  2V1R A;  4CC4 B;  1RUW A;  1BU1 A;  2FRW A;  1G83 A;  4ESR A;  2ENM A;  2P4R A;  2W10 A;  4JJC A;  2BZX A;  2O2O A;  5IXF A;  2HEQ A;  2X3W D;  3SEM A;  3VS5 A;  1GBR A;  1WXU A;  4AFZ C;  1HSQ A;  4K11 A;  1TUD A;  4F14 A;  4M4Z A;  1LCK A;  1ZUU A;  2DM1 A;  1WI7 A;  3I5R A;  5IH2 A;  2K7A A;  1NEB A;  3VS0 A;  2YDL A;  1KIK A;  2FG0 A;  2KRS A;  1QKW A;  4FSS A;  3H0H A;  3UF4 A;  4KRT A;  2CRE A;  1ZUK A;  3QWY A;  1ZLM A;  2LJ3 A;  2FRY A;  2JM8 A;  1ZSG A;  3A98 A;  3ZL7 C;  4HVV A;  1SSH A;  2L3Q A;  3SHW A;  1RLQ C;  1U06 A;  2BZY A;  3VS4 A;  4D8K A;  4AFS C;  2G6F X;  2K3B A;  2LNH B;  1RLP C;  2B86 A;  2DL3 A;  2YUQ A;  2RQR A;  1WLP B;  5L23 A;  1WX6 A;  2JM9 A;  2DX1 A;  3IQL A;  4A63 B;  2L0A A;  2FO0 A;  1HJD A;  1JQQ A;  1SRM A;  1OEB A;  2RPN A;  2EYZ A;  3NGP A;  1NEG A;  1B3Q A;  1NG2 A;  2A28 A;  5IHI A;  5GJW B;  1W70 A;  4RTV A;  1GFC A;  2CH4 W;  3PE0 A;  1M30 A;  1N5Z A;  1K76 A;  2GNC A;  2K2M A;  1GCQ A;  2FPE A;  2JXB A;  4HVW A;  4AFU C;  5I22 A;  4RUG A;  1T3S A;  1A0N B;  1W6X A;  4IIO A;  3M0T A;  3TSZ A;  4JPB W;  1H3H A;  2DL4 A;  2LX7 A;  1AOJ A;  2EGC A;  1UHF A;  1Z9Q A;  5EC7 A;  1YNZ A;  2MOX A;  2EGE A;  1UHC A;  4J9E A;  1PRM C;  2AK5 A;  3VS3 A;  2DNU A;  1YCS B;  4GLM A;  3H41 A;  1QCF A;  4GBQ A;  2D0N A;  2LMJ A;  2EQI A;  3JV3 A;  2JTE A;  1AZG B;  2AKL A;  2D8H A;  2KNB B;  2MIO A;  1NM7 A;  1Y57 A;  1YWO A;  2CH4 A;  3VS1 A;  4EIK A;  2K6D A;  1WXB A;  1CSK A;  3M0U A;  1BK2 A;  1E6H A;  1MUZ A;  3I5S A;  1M8M A;  4LUD A;  4CC3 A;  1NYG A;  2DBK A;  2AKK A;  2BZ8 A;  1H92 A;  2KEA A;  3VS2 A;  1X43 A;  1AVZ C;  2F2X A;  2O31 A;  2K9G A;  2JMC A;  1ABO A;  1GCP A;  2KGT A;  1ZX6 A;  1QLY A;  1IO6 A;  2JS0 A;  2HSP A;  3EHQ A;  1AWO A;  3I9Q A;  2PTK A;  2DE0 X;  2KBT A;  2EBP A;  2LP5 A;  2LZ6 B;  1KSW A;  3EGU A;  1X6B A;  1FYN A;  5ECA A;  1WFW A;  1G2B A;  4D8D A;  5HCK A;  1UJ0 A;  4CC7 A;  4DEX A;  1UTI A;  3ULR B;  1UG1 A;  2PNI A;  5I11 A;  2YT6 A;  3UAT A;  1NLP C;  2ESW A;  4LNP A;  3H0I A;  2EKH A;  1YP5 A;  2KRO A;  1X27 A;  1OPK A;  3TVT A;  4ZNX A;  3VRY A;  1FMK A;  1AZE A;  4LUE A;  2J05 A;  3NHN A;  2X3X D;  1SHF A;  1QKX A;  2OI3 A;  1JO8 A;  1I0C A;  1NYF A;  1JXM A;  2KXD A;  4J9B A;  4LE9 A;  4J9C A;  1JXO A;  2DYB A;  2DIL A;  1TUC A;  2RQT A;  2DJQ A;  1PRL C;  2OAW A;  3THK A;  1UGV A;  2KRN A;  2SRC A;  2ABL A;  3UA6 A;  1J3T A;  2DVJ A;  4Z89 A;  1K4U S;  2ECZ A;  1UDL A;  1T0H A;  4J9G A;  2NWM A;  4R0K A;  2KT8 A;  2O88 A;  3R6N A;  3REA B;  2RQW A;  4E6R A;  3I35 A;  1WA7 A;  2KRM A;  3FJ5 A;  1CKA A;  3EG0 A;  4F16 A;  3EG1 A;  2O9S A;  2EPD A;  4Y92 A;  1UE9 A;  4X1V A;  2F2W A;  2LQW A;  3PVL A;  5IHN A;  2E5K A;  1PKS A;  5IXB A;  2PZ1 A;  2C0T A;  4J9D A;  2HCK A;  1GBQ A;  2ED0 A;  4AG1 C;  2OJ2 A;  2EYX A;  2RQU A;  2JW4 A;  5FWB A;  4RTZ A;  4J9I A;  4Z8A A;  2CUD A;  5GJV B;  1GCQ C;  1M3B A;  2L3S A;  2GTJ A;  1NLO C;  2RMO A;  1YWP A;  2JMA A;  2DMO A;  3NMZ C;  3RNJ A;  3M0R A;  3O5Z A;  2JT4 A;  3VRZ A;  1JU5 C;  2JS2 A;  2ED1 A;  3TSW A;  3RBB B;  4J9F A;  2YUO A;  2DBM A;  2IIM A;  4AFQ C;  4RTU A;  1WXT A;  2A08 A;  4WCI A;  1ABQ A;  2ROL A;  3CQT A;  2H8H A;  1CKB A; 
#chains in the Genus database with same CATH topology
 2V8J A;  1PC0 A;  3QUI A;  4BE2 A;  3OYE A;  1D09 B;  3OS5 A;  3INZ A;  1X2Q A;  3AHU A;  1VA7 A;  3OBY A;  2KE9 A;  2ZPF B;  3QXE B;  1ACM B;  4M7A F;  2NUT B;  3RES A;  1Q86 C;  3ZFJ A;  1MV0 B;  4HA8 A;  2X4W A;  1R0B G;  4LD9 K;  3QWX X;  2EKO A;  1OX8 A;  9ATC B;  2LJ0 A;  1VQ8 Q;  3JB9 J;  2GGR A;  2BTT A;  4B9W A;  3CPW A;  2DA9 A;  2RD1 A;  3VUB A;  1NBE B;  4N0A C;  2JJ9 A;  4C8Q G;  1X6G A;  1M3A A;  2FL7 A;  2F2V A;  2QTX A;  1YI2 Q;  2K57 A;  1UUE A;  2DL7 A;  1Y96 B;  3ER0 A;  4DOW A;  2GTO A;  1SHG A;  3G71 T;  5J26 A;  2LDM A;  1RAH B;  4M78 D;  1K8A C;  1M1F A;  1QCN A;  1BCM A;  3JCM V;  5GAM e;  3X24 B;  2ZPH B;  1BBZ A;  1M90 R;  5HY6 A;  1LJO A;  3CXC P;  1WHH A;  2M0Y A;  1G3T A;  1HD3 A;  1W2B P;  4B9X A;  5C6S A;  1GFD A;  3CCR T;  1YJW Q;  2VKN A;  2D8J A;  1AEY A;  2YUN A;  3CC7 T;  4RG8 A;  2LNV A;  1RAC B;  1C6V X;  1BI3 A;  1QWF A;  3CME Q;  1UGS B;  3ME9 A;  5L8R E;  4OMN A;  2CSQ A;  4RTW A;  2QG9 B;  2SEM A;  1OV3 A;  2PU9 B;  4RCB A;  4M75 D;  5DLO A;  3GPL A;  1KQS S;  1QW1 A;  4JS5 A;  4EMG A;  4OMO A;  1KJW A;  4J7I A;  4JUV A;  2DL8 A;  1Z9Z A;  2RM4 A;  2HBW A;  5GAM j;  4AMC A;  2M51 A;  2KVQ G;  2Y4Y A;  5CQX A;  4EDU A;  3S6W A;  4PKC C;  2RF0 A;  4BI4 A;  1WZO A;  1ZBX A;  3C95 A;  3QO3 A;  2DF6 A;  3EGD A;  4RTT A;  1M2O A;  3PGG A;  2EGA A;  3A8O B;  5LJ3 e;  3OYB A;  1PD1 A;  4HCK A;  4M78 G;  1X69 A;  2V1Q A;  2VYT A;  5GAO m;  1VQN A;  3JCM d;  1R77 A;  1KQ2 A;  2DD5 A;  2J06 A;  4OGC A;  1OPL A;  3REB B;  3TCJ A;  4IUQ A;  5CIU A;  1C1A A;  4MML A;  4MDW A;  3C0C A;  4C92 D;  1AWW A;  1YHQ A;  1U8R A;  1TH7 A;  1O9S A;  2YUP A;  3JCM J;  4M7A C;  2CT3 A;  3CCU T;  2VWF A;  2HQX A;  3J80 E;  4ORZ A;  5CKH A;  5LJ5 g;  1M90 U;  1NE8 A;  2I2L A;  2XIC A;  2CZ7 B;  3OYK A;  5GMK l;  1PSE A;  3BDU A;  1U1T A;  3CPF A;  2GFA A;  2QQB A;  4M75 G;  3LLR A;  4M4Z A;  1LCK A;  5IH2 A;  5LJ3 j;  2FYK A;  3VYH B;  4M78 B;  4J6W A;  2E64 A;  1ZUK A;  4C0F A;  3CCV T;  4ZTJ A;  4HVV A;  2KQW A;  2M0O A;  3SHW A;  3OW2 S;  5GAO p;  3JSC A;  5HK3 A;  4PK4 A;  1SG5 A;  3X28 B;  3CD6 A;  2K3B A;  1IRX A;  3OS0 A;  2B86 A;  4KH0 B;  1VQN Q;  3EG9 A;  2EQU A;  2P0P A;  3VJP A;  1I5L A;  3V8J A;  1B34 A;  4ZTF A;  2FO0 A;  4R56 A;  3CMA T;  2BKD N;  1WPY A;  1YJ9 T;  3NGP A;  1NEG A;  2RI2 A;  2RI5 A;  3QDR B;  5GJW B;  4M75 B;  4ZGD B;  2VB6 A;  1PSF A;  1X01 A;  1YHQ Q;  3PE0 A;  3HRT A;  1K76 A;  3I56 T;  3C94 A;  3ZEH A;  4PLI A;  1A0N B;  2V8K A;  2LT1 A;  3L2V A;  1K9M R;  2LX7 A;  1AOJ A;  3OMC A;  1XJW B;  1Z9Q A;  3I55 A;  2HMA A;  1YNZ A;  2MOX A;  2HAX A;  3R6O A;  4V2S A;  3VS3 A;  3SWN C;  2E6Z A;  1VQ8 T;  2FZK B;  3H41 A;  4PJO G;  2XHC A;  3M55 A;  1Q81 R;  2D0N A;  2LMJ A;  2DJZ A;  3JV3 A;  4BY6 C;  2D8H A;  2MIO A;  1YI2 T;  3VS1 A;  1WXB A;  3JB9 F;  1M8M A;  3QZ5 B;  4LUD A;  4MZT A;  4C92 B;  4IUU A;  3KXT A;  2BZ8 A;  4XK8 E;  2NUP B;  2P0K A;  4XU2 A;  4FU6 A;  1X43 A;  3TU4 K;  2O31 A;  5GAN 5;  2K9G A;  2JMC A;  3RDV A;  3UDC A;  2KGT A;  1HXD A;  4N4I A;  4VUB A;  2HSP A;  1KK7 A;  4FW2 A;  5GAN h;  3I9Q A;  3MKD A;  3JCM Q;  4P5N A;  4IKF A;  2LP5 A;  8AT1 B;  4C5H A;  3G71 A;  1YJW T;  4C92 F;  1JJ2 A;  4OF1 A;  4NS5 A;  1X6B A;  2WSF E;  1N9S A;  3MO8 A;  2CYZ B;  4D8D A;  3CME T;  2FVU A;  1UGQ B;  1N8R C;  2EJ9 A;  4CC7 A;  1YBY A;  2WSC E;  1UTI A;  4C0G A;  5J39 A;  4BUG A;  1Q86 R;  2QI2 A;  3CCR A;  3I55 Q;  1VIF A;  2YT6 A;  5A0L A;  2E10 A;  3UAT A;  2LQ8 A;  2K3X A;  3CC7 A;  1QVP A;  3TVT A;  4F7U E;  2CP6 A;  1QKX A;  2ZGW A;  3UPU A;  1I0C A;  1K9M U;  1MMA A;  1OU9 A;  4ZGJ B;  3HRU A;  1JXM A;  5CAI A;  4J9B A;  4C5E A;  1JXO A;  5HKC A;  5GAN 4;  3VYG A;  4IUR A;  1PRL C;  3THK A;  2KRN A;  2SRC A;  3JRZ A;  3WVD B;  1K8A R;  2RJC A;  1MMG A;  3F70 A;  1Q81 U;  3JCM P;  4EMH A;  1UDL A;  1MGQ A;  1M2V A;  2NWM A;  4JLG A;  2F69 A;  2HQH A;  2KT8 A;  3LWI A;  3SD4 A;  5CQY A;  3PIP A;  1WA7 A;  3FJ5 A;  3EG0 A;  5GAN 7;  4PFO A;  2KI7 A;  1BI1 A;  3QDF A;  3M9Q A;  2DXT A;  3LGL A;  3G71 Q;  4DQ2 A;  1DJ7 B;  3V8L A;  5KYY A;  4M77 G;  4BE0 A;  1B7T A;  2E5K A;  1PKS A;  5IXB A;  4HCZ A;  4Y91 A;  4IUV A;  3RIR A;  1GBQ A;  4F04 B;  4QQ6 A;  3CBP A;  4AG1 C;  3EFO B;  2ZPE B;  2DYI A;  2JW4 A;  3V7R A;  1GCQ C;  3CC7 Q;  1M3B A;  1O75 A;  5GAM g;  1VQ4 T;  3DLM A;  2YWW A;  2JUF A;  2VV5 A;  1R0C B;  2JS2 A;  2MPX C;  2QQR A;  2LX9 A;  4RTU A;  3TRE A;  2A08 A;  4X34 A;  1ABQ A;  2NUT A;  3CQT A;  2H8H A;  1CKB A;  1BCO A;  5GMK i;  2OX7 A;  1MV3 A;  3C12 A;  2LQN A;  4L5G A;  3VS6 A;  4E7L A;  4M7A E;  3U23 A;  4AG2 C;  5DLQ E;  5GAN e;  1Y07 A;  1VIE A;  2AZV A;  1I07 A;  4XTY A;  4M7D D;  2DRK A;  1ZHI A;  5FU7 C;  2E12 A;  1KD1 C;  1MHN A;  2GBQ A;  1K8A U;  2EYQ A;  2DLP A;  1XOV A;  4OGE A;  2RNA A;  2NUZ A;  4RG2 A;  1RAE B;  5KYN A;  2Y4X A;  2W0Z A;  3GP8 A;  2K79 A;  3M0P A;  1W1F A;  4EMK B;  4KBM B;  5LJ3 g;  1YJ9 A;  5KH6 A;  1AHJ B;  3MP1 A;  4HCC A;  2OTL Q;  4OMM A;  1U5S A;  3M53 A;  3HTR A;  3ZBD A;  3ASK A;  3VUZ A;  1GL5 A;  3CXC A;  3CCU Q;  2HKQ B;  4KGZ B;  1ZBJ A;  2YRD A;  1MMD A;  2CP0 A;  1Q82 C;  5GAN j;  1VYU A;  1X2K A;  2LJ1 A;  3PNW C;  5DY9 A;  5FWC A;  5IT9 E;  1VQK T;  3CPW S;  2RK1 A;  3CCS T;  1QWE A;  2ATC B;  3JCM f;  2XG8 D;  1ZSZ B;  3X26 B;  2XKO C;  4HVU A;  1VQ8 A;  1N6A A;  2F5K A;  1VQP T;  1E6G A;  4C8Q D;  1BB9 A;  3M0Q A;  3CCV Q;  1QP3 A;  1K9A A;  1YI2 A;  4HT9 A;  3FLG A;  1VYV A;  2A3L A;  1Y0M A;  4J9H A;  4PL6 A;  1T0J A;  2JOY A;  3CCL Q;  1M3C A;  2L2P A;  2C0I A;  3PT9 A;  4IIM A;  3URG A;  2L3P A;  1I81 A;  4JJD A;  2EYW A;  3VS7 A;  3SDZ A;  3JCM c;  2DZC A;  3RUX A;  1LVK A;  1OOT A;  2QDL A;  1TOV A;  3PVQ A;  3CMA Q;  2EAY A;  3EG2 A;  3QBY A;  1YJW A;  3JCM b;  4Z02 A;  2PUO B;  1WGS A;  2EW3 A;  4ELZ C;  3I56 Q;  1BIB A;  1VQO T;  3O8V A;  2MWO A;  2QQA A;  3CME A;  2E41 A;  1AT1 B;  1IZ6 A;  1WYX A;  1YCY A;  1TS9 A;  4OML A;  3FRN A;  3M0S A;  1PKT A;  1WJQ A;  1SPK A;  4PJM A;  4M7D B;  1GXI E;  4UC4 A;  3OYA A;  3RKX A;  4PJL A;  2V1R A;  1D0Z A;  1EIF A;  2P4R A;  2BZX A;  4M78 A;  4N4H A;  2X3W D;  1GBR A;  3UWN A;  1WHL A;  1HSQ A;  4FYV B;  5CK9 A;  1D1A A;  1ZUU A;  4M7D F;  3I5R A;  5CR2 A;  2HQE A;  4A4K A;  4BDZ A;  3QJY A;  3HP9 A;  5IAY A;  3M57 A;  3OQ5 A;  3A5Z B;  2CS7 A;  3H0H A;  3UF4 A;  4KRT A;  2CRE A;  1QVF S;  4WF2 A;  2LJ3 A;  2DK3 A;  2FRY A;  1N8R R;  3RER A;  2RH2 A;  3S3N A;  4RCC A;  1YFN A;  3DLL A;  5KE2 A;  4AT1 B;  1U06 A;  2KY9 A;  2KK4 A;  1RL2 A;  4AFS C;  5GAN 2;  1VQ5 T;  4FYX B;  2KMT A;  2QK0 A;  4JS4 A;  3S3O A;  2DO3 A;  2DL3 A;  5KYW B;  4J8O A;  2V8I A;  1UGP B;  4M75 A;  4E7H A;  2VAS A;  3IQL A;  4A63 B;  2L0A A;  2LTO A;  1HJD A;  1JQQ A;  2EYZ A;  2RA2 A;  4C8Q B;  2P0Q A;  2X35 A;  2EIF A;  2XK0 A;  5CVI A;  4A4F A;  4E7K A;  1JB0 E;  3HRS A;  2MI6 A;  2QGF B;  1GFC A;  2CH4 W;  4KGX B;  2RB6 A;  3OYN A;  5FRN A;  1GCQ A;  4JLI A;  3S3M A;  4KUD K;  2FPE A;  1ZQ1 A;  1FXX A;  2CZ0 B;  5C0M A;  2QTV A;  3M0T A;  4JPB W;  3QPH A;  1G3S A;  2DL4 A;  4JJN K;  3Q1J A;  1UB4 A;  3J7A F;  4C8Q F;  5EC7 A;  3HPW A;  4XU3 A;  1P92 A;  4C5G A;  1PRM C;  2AK5 A;  1TTH B;  3MET A;  1YCS B;  2M02 A;  1OUL A;  2EFI A;  4C92 A;  2D6F A;  5GAN 3;  2NUP A;  1WHM A;  3JB9 I;  2KNB B;  1VQM T;  2LCL A;  1IGQ A;  3M0U A;  2FB7 A;  1UGR B;  1MUZ A;  3I5S A;  4CC3 A;  3FDR A;  2VXF A;  2DET A;  3MP6 A;  1VQ7 Q;  2OTL T;  1R8O B;  4FIB A;  2L8D A;  3L2Z A;  1AVZ C;  2F2X A;  2XU8 A;  3A1P A;  2ZAE A;  3NTI A;  4JRI A;  5LL6 S;  1N8R U;  4L59 A;  2JS0 A;  2KAF A;  1RAF B;  5D6X A;  1VQ9 Q;  4C92 E;  2EBP A;  3GF5 A;  3OS1 A;  1KSW A;  2L5Q A;  3MEA A;  1YIJ Q;  1M4Z A;  4E7Z A;  1M1G A;  5KYX B;  1YJN Q;  2KSS A;  4X9C A;  2QXF A;  3SFM A;  5HCK A;  5KE3 A;  1UJ0 A;  1VQ4 Q;  1VQ6 Q;  4PJO D;  4DEX A;  1QCO A;  1BIA A;  1TU0 B;  1D3B B;  5I11 A;  1VQK A;  4LNP A;  3CCS A;  1KD1 R;  3CCL T;  1OPK A;  2QYZ A;  1FMK A;  1PM3 A;  3M54 A;  3NHN A;  2X3X D;  4M78 F;  1QVG S;  1WNL A;  1VQP A;  3A8H B;  3PFS A;  1JJ2 S;  2KXD A;  3D7S B;  4C0D B;  1G3Y A;  2DJQ A;  2RQT A;  2ZPB B;  2OAW A;  3G4S T;  1D0X A;  3L2R A;  1KG1 A;  3HL8 A;  4Z89 A;  3QHS A;  1T0H A;  2RHY A;  3H6Z A;  5GAN g;  4R0K A;  3CCQ T;  1Q82 R;  4QQD A;  3I35 A;  1WHK A;  5FLX E;  1IRE B;  4OB1 B;  1N9R A;  2DXB A;  3QII A;  4Y92 A;  1JBM A;  1UE9 A;  4X1V A;  3CCJ T;  5GAM d;  5LJ5 h;  4C8Q C;  2GQV A;  3EFO A;  4M75 F;  3A8M B;  1H3Z A;  4ATO A;  2C0T A;  4J9D A;  5A0G A;  4LDX A;  3BDL A;  1QQJ A;  4E7S A;  4MZP A;  2EJF A;  2L3R A;  2YHT A;  2DTO A;  2OJ2 A;  2EYX A;  1VQK Q;  5FWB A;  1OYX A;  3FEO A;  5D6W A;  3CCS Q;  5GJV B;  2L3S A;  2GTJ A;  2RMO A;  5CO7 A;  1YWP A;  2JMA A;  2DMO A;  3RNJ A;  3M0R A;  2MWP A;  1OI1 A;  3LWH A;  1JU5 C;  3TSW A;  3RBB B;  1RAI B;  4XU0 A;  5GAN 8;  3QJ6 A;  1VQP Q;  1IHV A;  1YIT Q;  2RHX A;  1KD1 U;  3BY7 A;  2KYM A;  3OYY A;  4MMK A;  1GRI A;  4RTY A;  4M77 D;  3E1S A;  3L2W A;  4L6V 5;  1ZA1 B;  4JRP A;  4RTX A;  1QVF P;  1OZ2 A;  5LJ3 d;  4PJO B;  2IVW A;  4CRI A;  2RI3 A;  3OW2 A;  2D0Q B;  4Q5W A;  1PNJ A;  3SB2 A;  4OB3 B;  1AD5 A;  2P4T A;  1UEC A;  5AYF A;  3KFV A;  1VQ5 A;  1VYT A;  2GQI A;  4EMK A;  2A37 A;  1WQ7 A;  3P8B B;  2RJE A;  4NL2 A;  1Q82 U;  2C0O A;  1VQO Q;  5CKB A;  2YLC A;  4PJO F;  3DB3 A;  3G6E T;  3BW1 A;  4M78 C;  4JJB A;  1UJY A;  2F5T X;  5EG2 A;  4DBH A;  2H3E B;  4NL3 A;  2HL3 A;  3PMT A;  4OMQ A;  4PFP A;  2RN8 A;  2D1X A;  2DD4 A;  2EVR A;  1KQS P;  1WJS A;  1JEG A;  1K73 C;  1RI9 A;  2KXC A;  1HYO A;  4FT2 A;  1ZSZ A;  5KCH A;  5GMK h;  2CT4 A;  2E3H A;  2DER A;  2MAM A;  3VV0 A;  2ROT A;  4O5V A;  4XAX B;  1VOM A;  4JZ3 A;  3MEU A;  3TQ7 P;  5LJ5 f;  4DA4 A;  2HL5 C;  1VQ7 T;  1NJI C;  4HKE A;  2A36 A;  4D6W A;  4E7I A;  3EG9 B;  4IUT A;  1WQW A;  2P84 A;  4J7F A;  3JCM h;  4FYW B;  3KUF A;  2BUD A;  2JVV A;  4M75 C;  1VQM A;  1VQ9 T;  2K3Y A;  3RR6 A;  3H0F A;  5GAO l;  1AWX A;  5HK0 A;  5LJ5 e;  3MPU B;  1W2B S;  3QKJ A;  1YIJ T;  5KCO A;  3H8Z A;  5FU6 B;  2O4X B;  3GIB A;  2NYS A;  3L2Q A;  2J6O A;  1VQ5 Q;  8ATC B;  2OTL A;  1YJN T;  3E9F A;  1SSF A;  2LCS A;  2LC4 A;  2XMF A;  2O9V A;  1EFN A;  4CC2 A;  1YN8 A;  3GOX A;  1RI0 A;  3CCU A;  5FW9 A;  1VQ6 T;  2DKG A;  1TXQ A;  4F7U G;  1WHG A;  1Q86 U;  1Q7Y C;  1TUG B;  3OYJ A;  2J7I A;  1OX9 A;  4Y28 E;  2DRM A;  3OBW A;  3V7S A;  2KT1 A;  1KFZ A;  3HKS A;  3UA7 A;  4M7D A;  2XDP A;  1EX4 A;  3TEE A;  1H8K A;  4M77 B;  1PWT A;  4TVR A;  5IHK A;  2YRC A;  1I1J A;  2EYY A;  4C92 C;  1RAA B;  2JN0 A;  2Y90 A;  5I2S A;  2YRV A;  1WDX A;  4M7A D;  2MMP A;  1K1Z A;  5GAO n;  3CCV A;  2Z0W A;  4LN2 A;  3EFS A;  4PJJ A;  2FEI A;  1RUW A;  3CCL A;  2MK5 A;  1W4S A;  2FRW A;  1Y96 A;  3OW2 P;  4QVD A;  2HEQ A;  3RKW A;  3SEM A;  3VS5 A;  1WXU A;  4M77 F;  4AFZ C;  1QVG P;  4M7D E;  2EQM A;  2DXC A;  2L89 A;  4DBQ A;  2LVM A;  1KHC A;  1TUD A;  2R5A A;  1VQM Q;  4F14 A;  4E2F B;  2K5F A;  2DM1 A;  1WI7 A;  4OP0 A;  4BI3 A;  3VS0 A;  4HCB A;  4F7U B;  3G1J A;  3G4S A;  3CMA A;  4E7J A;  4PJO C;  2HNI A;  1TWB A;  2IG0 A;  5M9O A;  3OYI A;  3QWY A;  3VU3 C;  3I56 A;  2JM8 A;  1ZSG A;  3A98 A;  5KYW A;  3CCQ A;  1SSH A;  2L3Q A;  1TSF A;  4PFZ A;  2BZY A;  2DEQ A;  4D8K A;  2G6F X;  3GNF B;  2LNH B;  3X25 B;  4C8Q A;  2RQR A;  4ZN3 A;  1WX6 A;  2JM9 A;  3OA6 A;  5GMK e;  1SRM A;  1OEB A;  4QW2 A;  2RPN A;  4BE1 A;  4ELY C;  1I4K 1;  1W70 A;  3EH2 A;  4M7A G;  1YIT T;  2K2M A;  3H9N A;  5AT1 B;  4O6J A;  1IXD A;  2JXB A;  4A4E A;  1KQ1 A;  3N5B B;  3G7Z A;  5I22 A;  3JCM e;  4RUG A;  1T3S A;  1W6X A;  4R55 A;  3TSZ A;  4C8Q E;  3M5A A;  2X51 A;  1UHF A;  1XQH A;  2ZPI B;  2X9H A;  4J6Y A;  4KUL A;  4MZM A;  1UHC A;  2PVG B;  3RKY A;  4J83 A;  4ME7 A;  1FX7 A;  3EH1 A;  3G4S Q;  3M56 A;  4GBQ A;  1AZG B;  2O01 E;  3EGX B;  2QGG A;  5GMK j;  2AKL A;  1NM7 A;  1YWO A;  4XTX A;  3M4G A;  4NOY A;  3CCQ Q;  1BK2 A;  1E6H A;  1NYG A;  2DBK A;  3CC2 T;  1H92 A;  1RAD B;  3KBG A;  1M9S A;  4M7A B;  3VS2 A;  3CCE T;  1IHW A;  1PCX A;  2QDY B;  2VGM A;  4J6X A;  3CCJ Q;  1ABO A;  1GCP A;  1ZX6 A;  1QLY A;  1IO6 A;  2FZG B;  2AIR B;  5CCA A;  1I5O B;  2YLB A;  5KYX A;  3EHQ A;  1IGU A;  3HFN A;  3OYM A;  2DE0 X;  4FSX A;  2EWN A;  3G6E A;  4OB2 B;  3EGU A;  2VGN A;  3LYI A;  4M77 C;  4GLK A;  1FYN A;  1BI2 A;  3MCA B;  3L2U A;  2RO0 A;  1D3B A;  2XDD A;  2JTF A;  3X20 B;  2EJG A;  3ULR B;  2QQS A;  3CCM Q;  2PNI A;  2DTI A;  3M58 A;  1IB8 A;  2COY A;  2ESW A;  3H0I A;  4JDS A;  1YP5 A;  2KRO A;  5CKF A;  5GAM f;  1X27 A;  4ZNX A;  2RJF A;  4M78 E;  2J05 A;  5GAN d;  2ZCF B;  1VQ7 A;  1SHF A;  2OI3 A;  1JO8 A;  2K5L A;  3CBM A;  1WHJ A;  4EMK C;  3VKI A;  5DM7 R;  1NPR A;  5KYU B;  1H64 1;  2DYB A;  2DIL A;  1TUC A;  1VQ9 A;  2MF2 A;  3UA6 A;  2QEX T;  1X6O A;  1YIJ A;  2DVJ A;  1J3T A;  1K4U S;  3QYH B;  4J9G A;  1YJN A;  4XU1 A;  3PTA A;  3R6N A;  2DFU A;  4KH1 B;  3REA B;  1K73 R;  2KRM A;  3FIF A;  4F16 A;  1VQ4 A;  1VQ6 A;  1D0Y A;  2K2V A;  1RAB B;  2VXE A;  2EPD A;  3G6E Q;  1ZSZ C;  4M75 E;  3QZ9 B;  2QAZ A;  3PVL A;  5IHN A;  4FYY B;  2PUK B;  2M9U A;  3SWN B;  4BI8 B;  3NTH A;  1NJI R;  3EFR A;  2DAQ A;  2ED0 A;  4BY6 B;  4QVZ A;  5LJ3 f;  1M1K C;  4YTL A;  1JRI A;  2LQK A;  4LD6 A;  2M1H A;  1G8X A;  2K5I A;  2GF7 A;  3FB9 A;  4Z8A A;  1UEB A;  1Y7X A;  4BD3 A;  3JB9 D;  2K4Y A;  3WXM B;  2JZ2 A;  4RKU E;  2E3I A;  3NMZ C;  3O5Z A;  3BE3 A;  1QP2 A;  3MHX A;  1OZ3 A;  2RJD A;  3EAE A;  2FHD A;  1PG5 B;  5D7U A;  4KGV B;  1WXT A;  4FT4 A;  1KC8 C;  2QA4 T;  2A0F B;  4EPC A;  2R5M A;  4PJO A;  1S1N A;  1Q7Y R;  3V7C A;  1G5V A;  3CBO A;  3EHR A;  1OU8 A;  4Z88 A;  2VVK A;  3EG3 A;  1QVF A;  2OTJ T;  3LH5 A;  1BYM A;  3WVE B;  2HZY A;  2DTH A;  2MCN A;  4M7D C;  3RMS A;  2I0N A;  4RMO A;  4JZ4 A;  1U3O A;  1F1B B;  2BIV A;  2CSI A;  1ARK A;  2CP5 A;  1VQL T;  4F17 A;  1SEM A;  1AWJ A;  3CPW P;  2HDA A;  3LH0 A;  4X9D A;  4PJO E;  3E2U A;  1K73 U;  2COZ A;  4HXJ A;  4IUP A;  4OMF B;  2CDT A;  3T9N A;  3GBQ A;  2FPF A;  2LRQ A;  1LNX A;  3OYG A;  1S72 T;  2E65 A;  2XD0 A;  3NPF A;  1KQS A;  1YIT A;  3JB9 G;  1K0S A;  3DKM A;  1NJI U;  1ZUY A;  1OQK A;  2J6F A;  1T3L A;  2HKN A;  1U1S A;  2LCC A;  4LDU A;  2DIQ A;  3L1A A;  4QT7 A;  5D6Y A;  4FCY A;  1TG0 A;  1K0X A;  4MDX A;  3J81 E;  2YSQ A;  3CC4 T;  2KYB A;  4C92 G;  1NZ9 A;  2O4X A;  3LGF A;  3E9G A;  1VQO A;  1FMV A;  2J6K A;  2R57 A;  3CC2 A;  1V1C A;  5J3B A;  4OMP A;  1FWZ A;  1Q7Y U;  3OYD A;  2FPD A;  3CCE A;  3P8H A;  4FM4 B;  3DB4 A;  2DZ9 A;  2CUB A;  2EQJ A;  4LXC A;  4DEY A;  1SRL A;  3CCM T;  4M77 A;  2AZS A;  2COW A;  3A8G B;  1PHT A;  1V29 B;  2DL5 A;  1QMC A;  4ZGE B;  4FW1 A;  1V76 A;  3A8L B;  3EGD B;  5GAN 6;  2CKK A;  1B07 A;  1WIE A;  2KR3 A;  3CD6 Q;  2IPO B;  1XNI A;  2AHJ B;  1M27 C;  4N0A A;  1MND A;  4OVA A;  2RQV A;  3PIO A;  4XTZ A;  5FU7 B;  1E7O A;  1UFF A;  4BAC A;  4A53 A;  4A4H A;  4CC4 B;  1BU1 A;  2DIG A;  3JCM g;  1G83 A;  4M77 E;  4ESR A;  2ENM A;  2X4J A;  2W10 A;  4FL6 A;  4F7U A;  4JJC A;  2O2O A;  5IXF A;  1QVG A;  1N27 A;  2V26 A;  1SF9 A;  4K11 A;  2CP3 A;  2K7A A;  1NEB A;  2E70 A;  3HFO A;  2YDL A;  4KT0 E;  3CC2 Q;  1KIK A;  2FG0 A;  2CZ6 B;  2KRS A;  1QKW A;  2RHU A;  4FSS A;  1Y71 A;  1M90 C;  3LW5 E;  2QEX A;  3CCE Q;  5GAO q;  2DEU A;  5FRO A;  4PNO A;  1ZLM A;  2E6N A;  1ZA2 B;  2E5Q A;  3ZL7 C;  5CKE A;  3LX7 A;  3OMG A;  1LPL A;  3M4Y A;  1RLQ C;  3VS4 A;  1KHI A;  3L42 A;  1EZZ B;  7AT1 B;  1RLP C;  3E19 A;  2YUQ A;  3QYG B;  3MP8 A;  1WLP B;  2PVO B;  3HHT B;  5L23 A;  5GAO r;  1BKB A;  1LOJ A;  2DX1 A;  2WAC A;  1HK9 A;  2MYS A;  1Q95 G;  4QVC A;  2GFU A;  1D1B A;  4C0D C;  1B3Q A;  1NG2 A;  2A28 A;  5IHI A;  4N4G A;  2FZC B;  4RTV A;  2QQ9 A;  3OY9 A;  1M30 A;  1N5Z A;  1BI0 A;  3GLX A;  1B34 B;  2GNC A;  3CEY A;  3AT1 B;  4LDW A;  3MEV A;  3OB9 A;  3CXC S;  4HVW A;  1SKU B;  2CGH A;  4AFU C;  2AT1 B;  2ZZD A;  3PMI A;  4IIO A;  1M5Q 1;  1H3H A;  4XQ3 A;  2EGC A;  2HSE B;  1C0M A;  2EGE A;  2JNG A;  3EGX A;  4J9E A;  3NTK A;  2DNU A;  2KDS A;  5IN1 A;  3V8K A;  2QA4 A;  4GLM A;  1QCF A;  2X4X A;  2D9T A;  2EQI A;  4JRK A;  2QEX Q;  2JTE A;  2DXU A;  2BE9 B;  2E4H A;  4M7A A;  2DVE A;  3CCR Q;  1WJR A;  1Y57 A;  2CH4 A;  3OSS C;  4EIK A;  2OTJ A;  2K6D A;  2G3R A;  2H3J A;  1CSK A;  1M1K R;  2AKK A;  4PLL A;  2WSE E;  2HBP A;  4C5I A;  2KEA A;  4DBF A;  4QQG A;  5GAN f;  1VQL A;  5LJ5 j;  2X4Y A;  2CP2 A;  2ZPG B;  1AWO A;  2PTK A;  4BDY A;  3OYH A;  3GNG A;  2KBT A;  2LZ6 B;  2RHZ A;  3OYF A;  1VQN T;  2CP7 A;  2RK2 A;  1KC8 R;  1MNE A;  3P8D A;  1S72 A;  1JJ2 P;  4OB0 B;  5ECA A;  1WFW A;  1PD0 A;  4KUI A;  1G2B A;  1NPP A;  5A2Q E;  3JCM W;  1I8F A;  2E1H A;  4J5Y A;  2XID A;  3RMQ A;  1UG1 A;  5I21 A;  2LT4 A;  2NLU A;  1YHQ T;  2B8A A;  3FC3 A;  2BE7 D;  4B6M A;  1NLP C;  3NFC A;  2C06 A;  4A54 A;  2EKH A;  4LDV A;  2GCX A;  5KYU A;  5GMK m;  3QSU A;  3VRY A;  1AZE A;  4LUE A;  2QA4 Q;  4F7U F;  6AT1 B;  5GAM h;  3CC4 A;  4XTU A;  3CCJ A;  1NYF A;  2R58 A;  4LE9 A;  4J9C A;  2OTJ Q;  1RAG B;  3JAM E;  5I2M A;  1VUB A;  2VC8 A;  2JTM A;  4QKU A;  4DBR A;  1UGV A;  1M8V A;  4PJN A;  1W2B A;  2ABL A;  4DOV A;  1MMN A;  2ECZ A;  2OAU A;  1VQL Q;  2XI9 A;  1K9M C;  3BFM A;  1D1C A;  4XTV A;  3OSV A;  2O88 A;  2RQW A;  4C0Z A;  4E6R A;  2CZ1 B;  5A0D A;  1CKA A;  2PQW A;  3SWN A;  3EG1 A;  2O9S A;  3OYC A;  1M1K U;  4II1 A;  3CD6 T;  4BB7 A;  1M2V B;  3CCM A;  2YXY A;  2F2W A;  3M59 A;  1Q81 C;  2M16 A;  3OYL A;  1G3W A;  2LQW A;  1S72 Q;  4E47 A;  4GY5 A;  3OS2 A;  2RHI A;  4CI0 C;  2QAS A;  4M7D G;  2PZ1 A;  2HCK A;  4XTW A;  5CKD A;  3C4S A;  4JRQ A;  5KYY B;  4LDY A;  2HD0 A;  2VUB A;  3UT1 A;  3FJP A;  2EQK A;  2RQU A;  5FU6 C;  1KC8 U;  2PVD B;  4RTZ A;  4J9I A;  5LJ3 h;  3JB9 H;  4HT8 A;  2CUD A;  3HSB A;  4ZN1 A;  2A7Y A;  1NLO C;  4WTO B;  2JT4 A;  3MEW A;  3VRZ A;  2ED1 A;  3JCM X;  4A4G A;  3QG1 A;  2DPP B;  5FRM A;  1YJ9 Q;  4J9F A;  3CC4 Q;  2YUO A;  2DBM A;  3I55 T;  2IIM A;  5LJ5 d;  1X75 C;  3MJX A;  1XTD A;  1FMW A;  4AFQ C;  2F1L A;  4ANJ A;  4WCI A;  2ROL A;  2XDB A; 
#chains in the Genus database with same CATH homology
 2KYM A;  1MV3 A;  1S1N A;  1GRI A;  2LQN A;  4RTY A;  3VS6 A;  1X2Q A;  3U23 A;  3EHR A;  4AG2 C;  1VA7 A;  2KE9 A;  4Z88 A;  2VVK A;  3EG3 A;  2AZV A;  3LH5 A;  4RTX A;  2MCN A;  1I07 A;  1MV0 B;  2DRK A;  2I0N A;  4JZ4 A;  1U3O A;  1PNJ A;  3QWX X;  1AD5 A;  1UEC A;  2CSI A;  2GBQ A;  2LJ0 A;  3KFV A;  1ARK A;  2GGR A;  1VYT A;  2GQI A;  2A37 A;  2BTT A;  4F17 A;  2DA9 A;  1SEM A;  1AWJ A;  2DLP A;  1X6G A;  1XOV A;  2RNA A;  1M3A A;  2NUZ A;  2HDA A;  2F2V A;  2C0O A;  2W0Z A;  1UUE A;  2DL7 A;  2K79 A;  2GTO A;  3M0P A;  4HXJ A;  1W1F A;  1SHG A;  2CDT A;  1UJY A;  4JJB A;  3GBQ A;  2FPF A;  4OMM A;  1U5S A;  3NPF A;  4OMQ A;  1GL5 A;  2RN8 A;  2D1X A;  2EVR A;  1BBZ A;  1K0S A;  1ZBJ A;  1ZUY A;  1JEG A;  1VYU A;  1X2K A;  2LJ1 A;  2M0Y A;  1RI9 A;  2J6F A;  2KXC A;  1HD3 A;  5FWC A;  1T3L A;  2CT4 A;  1GFD A;  2VKN A;  2D8J A;  1AEY A;  2ROT A;  2YUN A;  4QT7 A;  4JZ3 A;  1QWE A;  1QWF A;  1TG0 A;  1K0X A;  2YSQ A;  2A36 A;  4HVU A;  4OMN A;  2KYB A;  1E6G A;  2CSQ A;  4RTW A;  2SEM A;  1OV3 A;  1BB9 A;  3M0Q A;  1K9A A;  1VYV A;  3H0F A;  4OMO A;  1Y0M A;  1KJW A;  4J9H A;  1AWX A;  1T0J A;  2J6K A;  1M3C A;  2L2P A;  2DL8 A;  1V1C A;  2C0I A;  1Z9Z A;  4IIM A;  4OMP A;  2L3P A;  2J6O A;  4JJD A;  2FPD A;  2HBW A;  2EYW A;  3VS7 A;  2M51 A;  2LCS A;  2XMF A;  2O9V A;  1EFN A;  2RF0 A;  2CUB A;  4CC2 A;  1YN8 A;  4DEY A;  5FW9 A;  1OOT A;  2DF6 A;  4RTT A;  2QDL A;  1SRL A;  3PVQ A;  2EGA A;  3EG2 A;  4HCK A;  1X69 A;  2AZS A;  2V1Q A;  1PHT A;  2J7I A;  2DL5 A;  2DRM A;  2J06 A;  2EW3 A;  2KT1 A;  1KFZ A;  1OPL A;  3UA7 A;  1H8K A;  3REB B;  1PWT A;  1B07 A;  5IHK A;  1WIE A;  1WYX A;  3C0C A;  2KR3 A;  1I1J A;  2EYY A;  4OML A;  1AWW A;  3M0S A;  1PKT A;  1M27 C;  1SPK A;  1WDX A;  2YUP A;  1K1Z A;  2RQV A;  2CT3 A;  1E7O A;  1UFF A;  2VWF A;  4LN2 A;  2FEI A;  4ORZ A;  2V1R A;  4CC4 B;  1RUW A;  1BU1 A;  2FRW A;  1G83 A;  4ESR A;  2ENM A;  2P4R A;  2W10 A;  4JJC A;  2BZX A;  2O2O A;  5IXF A;  2HEQ A;  2X3W D;  3SEM A;  3VS5 A;  1GBR A;  1WXU A;  4AFZ C;  1HSQ A;  4K11 A;  1TUD A;  4F14 A;  4M4Z A;  1LCK A;  1ZUU A;  2DM1 A;  1WI7 A;  3I5R A;  5IH2 A;  2K7A A;  1NEB A;  3VS0 A;  2YDL A;  1KIK A;  2FG0 A;  2KRS A;  1QKW A;  4FSS A;  3H0H A;  3UF4 A;  4KRT A;  2CRE A;  1ZUK A;  3QWY A;  1ZLM A;  2LJ3 A;  2FRY A;  2JM8 A;  1ZSG A;  3A98 A;  3ZL7 C;  4HVV A;  1SSH A;  2L3Q A;  3SHW A;  1RLQ C;  1U06 A;  2BZY A;  3VS4 A;  4D8K A;  4AFS C;  2G6F X;  2K3B A;  2LNH B;  1RLP C;  2B86 A;  2DL3 A;  2YUQ A;  2RQR A;  1WLP B;  5L23 A;  1WX6 A;  2JM9 A;  2DX1 A;  3IQL A;  4A63 B;  2L0A A;  2FO0 A;  1HJD A;  1JQQ A;  1SRM A;  1OEB A;  2RPN A;  2EYZ A;  3NGP A;  1NEG A;  1B3Q A;  1NG2 A;  2A28 A;  5IHI A;  5GJW B;  1W70 A;  4RTV A;  1GFC A;  2CH4 W;  3PE0 A;  1M30 A;  1N5Z A;  1K76 A;  2GNC A;  2K2M A;  1GCQ A;  2FPE A;  2JXB A;  4HVW A;  4AFU C;  5I22 A;  4RUG A;  1T3S A;  1A0N B;  1W6X A;  4IIO A;  3M0T A;  3TSZ A;  4JPB W;  1H3H A;  2DL4 A;  2LX7 A;  1AOJ A;  2EGC A;  1UHF A;  1Z9Q A;  5EC7 A;  1YNZ A;  2MOX A;  2EGE A;  1UHC A;  4J9E A;  1PRM C;  2AK5 A;  3VS3 A;  2DNU A;  1YCS B;  4GLM A;  3H41 A;  1QCF A;  4GBQ A;  2D0N A;  2LMJ A;  2EQI A;  3JV3 A;  2JTE A;  1AZG B;  2AKL A;  2D8H A;  2KNB B;  2MIO A;  1NM7 A;  1Y57 A;  1YWO A;  2CH4 A;  3VS1 A;  4EIK A;  2K6D A;  1WXB A;  1CSK A;  3M0U A;  1BK2 A;  1E6H A;  1MUZ A;  3I5S A;  1M8M A;  4LUD A;  4CC3 A;  1NYG A;  2DBK A;  2AKK A;  2BZ8 A;  1H92 A;  2KEA A;  3VS2 A;  1X43 A;  1AVZ C;  2F2X A;  2O31 A;  2K9G A;  2JMC A;  1ABO A;  1GCP A;  2KGT A;  1ZX6 A;  1QLY A;  1IO6 A;  2JS0 A;  2HSP A;  3EHQ A;  1AWO A;  3I9Q A;  2PTK A;  2DE0 X;  2KBT A;  2EBP A;  2LP5 A;  2LZ6 B;  1KSW A;  3EGU A;  1X6B A;  1FYN A;  5ECA A;  1WFW A;  1G2B A;  4D8D A;  5HCK A;  1UJ0 A;  4CC7 A;  4DEX A;  1UTI A;  3ULR B;  1UG1 A;  2PNI A;  5I11 A;  2YT6 A;  3UAT A;  1NLP C;  2ESW A;  4LNP A;  3H0I A;  2EKH A;  1YP5 A;  2KRO A;  1X27 A;  1OPK A;  3TVT A;  4ZNX A;  3VRY A;  1FMK A;  1AZE A;  4LUE A;  2J05 A;  3NHN A;  2X3X D;  1SHF A;  1QKX A;  2OI3 A;  1JO8 A;  1I0C A;  1NYF A;  1JXM A;  2KXD A;  4J9B A;  4LE9 A;  4J9C A;  1JXO A;  2DYB A;  2DIL A;  1TUC A;  2RQT A;  2DJQ A;  1PRL C;  2OAW A;  3THK A;  1UGV A;  2KRN A;  2SRC A;  2ABL A;  3UA6 A;  1J3T A;  2DVJ A;  4Z89 A;  1K4U S;  2ECZ A;  1UDL A;  1T0H A;  4J9G A;  2NWM A;  4R0K A;  2KT8 A;  2O88 A;  3R6N A;  3REA B;  2RQW A;  4E6R A;  3I35 A;  1WA7 A;  2KRM A;  3FJ5 A;  1CKA A;  3EG0 A;  4F16 A;  3EG1 A;  2O9S A;  2EPD A;  4Y92 A;  1UE9 A;  4X1V A;  2F2W A;  2LQW A;  3PVL A;  5IHN A;  2E5K A;  1PKS A;  5IXB A;  2PZ1 A;  2C0T A;  4J9D A;  2HCK A;  1GBQ A;  2ED0 A;  4AG1 C;  2OJ2 A;  2EYX A;  2RQU A;  2JW4 A;  5FWB A;  4RTZ A;  4J9I A;  4Z8A A;  2CUD A;  5GJV B;  1GCQ C;  1M3B A;  2L3S A;  2GTJ A;  1NLO C;  2RMO A;  1YWP A;  2JMA A;  2DMO A;  3NMZ C;  3RNJ A;  3M0R A;  3O5Z A;  2JT4 A;  3VRZ A;  1JU5 C;  2JS2 A;  2ED1 A;  3TSW A;  3RBB B;  4J9F A;  2YUO A;  2DBM A;  2IIM A;  4AFQ C;  4RTU A;  1WXT A;  2A08 A;  4WCI A;  1ABQ A;  2ROL A;  3CQT A;  2H8H A;  1CKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...