5FWCA

Human spectrin sh3 domain d48g, e7a, k60a
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
KALVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNGRQGFVPAAYVKALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human Spectrin SH3 Domain D48G, E7A, K60A
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords SPECTRIN ALPHA CHAIN, NON-ERYTHROCYTIC 1
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5fwcA00
1NEGA 3QWYA 1I07A 1JU5C 3EG3A 2DL8A 3VS0A 1UUEA 2CREA 4LN2A 4X1VA 2DX1A 1SHGA 4E6RA 4ESRA 3M0TA 2KYMA 2KE9A 1AWOA 2CT4A 4RTZA 2RNAA 4AG2C 2MIOA 1WFWA 4AFQC 3KFVA 4J9CA 1GFDA 2CSIA 2PNIA 2DILA 3M0SA 2JMCA 1ABOA 4JJCA 3I35A 2BZYA 1ZSGA 3IQLA 3U23A 2F2VA 2MOXA 2O88A 1UTIA 2AZVA 2B86A 1SRMA 3EG2A 4J9FA 2C0OA 3UA7A 2M0YA 1E6GA 2LX7A 1LCKA 4ZNXA 2W0ZA 3NHNA 1GCQC 4D8DA 1WXBA 2RN8A 5ECAA 4ORZA 2I0NA 3QWXX 1KJWA 1MUZA 1PNJA 1T0JA 1CKBA 2LJ1A 4J9HA 1H3HA 2KR3A 2HDAA 1RUWA 2EGEA 3LH5A 2KXDA 3UF4A 1M3BA 2DBMA 2YDLA 4A63B 2EQIA 2J6KA 1JEGA 1FYNA 2J6FA 2A28A 3M0UA 2DYBA 1IO6A 2SRCA 2LQWA 1PWTA 2K6DA 2K7AA 3I5SA 2D8JA 1EFNA 2GGRA 2NUZA 5GJVB 1NEBA 2KXCA 4CC4B 3M0PA 2CT3A 2LCSA 1SPKA 4R0KA 2JS0A 1PRMC 3SHWA 1M3AA 3A98A 2ECZA 2EPDA 3R6NA 3VRZA 2ESWA 2VVKA 4DEYA 3SEMA 2F2WA 5FW9A 1H8KA 1OPLA 2BTTA 2DNUA 2LMJA 4CC3A 1RLQC 5HCKA 4RTWA 3EG1A 4AFZC 2LJ3A 1Z9ZA 3GBQA 3FJ5A 2EYZA 4M4ZA 1WI7A 1QKWA 3M0QA 3REAB 3PVQA 4HVWA 1K0SA 2J7IA 2RQWA 2FRWA 3C0CA 1Y0MA 1E7OA 2JT4A 4OMLA 3THKA 5I11A 1ZUYA 2IIMA 5IXFA 4EIKA 4JJDA 1WYXA 1WX6A 5GJWB 2CUBA 2A08A 3REBB 1MV0B 4Z88A 5IHNA 1ZUKA 2FPDA 4HCKA 2KNBB 2YUNA 2K3BA 2CDTA 2KBTA 3EHRA 1QKXA 1BK2A 4GLMA 2VWFA 2JXBA 2AK5A 1Y57A 2EYWA 4HXJA 2YUOA 1ZUUA 1NLPC 2JMAA 1W1FA 1UG1A 4JZ3A 1YP5A 1SEMA 3VS2A 2LNHB 4AFSC 3VS7A 2V1QA 2RF0A 3UATA 2YSQA 1AWXA 1E6HA 1CKAA 2L3PA 2RQTA 2A37A 1NYGA 3NGPA 5IXBA 1X6BA 5FWCA 2X3WD 2XMFA 2HSPA 1GCQA 1GFCA 1SRLA 2RQRA 1YWOA 2FG0A 2ROLA 2DVJA 2ENMA 3EG0A 1I1JA 1NLOC 4CC7A 4D8KA 1BB9A 2O2OA 3I5RA 1VYUA 1X6GA 2PZ1A 2J6OA 1AEYA 1UECA 1UE9A 4FSSA 1HSQA 4IIOA 1NM7A 4WCIA 2JS2A 3NMZC 4GBQA 1M8MA 4HVUA 1K0XA 2RQUA 3VS1A 4J9IA 4J9BA 1J3TA 2OAWA 5IHIA 3TVTA 2AZSA 1XOVA 1ZLMA 4F16A 4QT7A 1G2BA 1YWPA 3VS6A 2D0NA 2YUPA 3RBBB 2DRKA 1FMKA 2GTJA 3H41A 2JTEA 4JPBW 2J06A 2DLPA 2KROA 1YN8A 2RMOA 2YT6A 2CUDA 4OMPA 1AWJA 1GL5A 1T0HA 1OOTA 1GRIA 4Z89A 1ZX6A 2ROTA 5FWBA 1M30A 2F2XA 1X2KA 2AKLA 1U06A 2CH4W 1OV3A 2L3SA 1WA7A 2DL3A 3CQTA 1BBZA 2L2PA 4JZ4A 3VS3A 2JM8A 2DL4A 1SHFA 4JJBA 1UDLA 1AZEA 2GTOA 2DF6A 1B3QA 1WIEA 2FPFA 1OEBA 2P4RA 1GCPA 2J05A 1ZBJA 2LJ0A 4RTUA 2O9VA 1K1ZA 2BZXA 1AVZC 2ABLA 2SEMA 2PTKA 1NG2A 1UFFA 2KT8A 2H8HA 1I0CA 2O9SA 2W10A 2HBWA 4K11A 4LNPA 2LP5A 1WXTA 3H0IA 2ED1A 2KEAA 2YUQA 2L0AA 2GNCA 1GBQA 1X2QA 3O5ZA 1UJ0A 2K9GA 2O31A 1Z9QA 2MCNA 4F17A 2G6FX 2KRSA 5IH2A 2C0IA 2DRMA 2FEIA 3TSZA 2GBQA 2QDLA 1UHCA 5IHKA 2KGTA 2DMOA 1WDXA 2VKNA 2K2MA 4OMQA 2NWMA 1TUDA 2KRNA 2LQNA 1YNZA 3JV3A 1AZGB 2EW3A 3VS4A 1RI9A 2EGCA 2JM9A 1KSWA 3H0FA 1RLPC 1ABQA 1S1NA 2M51A 2DJQA 3RNJA 1U5SA 2BZ8A 4Y92A 1M27C 1VA7A 1N5ZA 1H92A 2DA9A 4RTTA 2DL7A 1AOJA 2D8HA 3PVLA 1UHFA 2DE0X 3EGUA 2K79A 2GQIA 4DEXA 2OI3A 5EC7A 5I22A 2ED0A 2L3QA 3H0HA 4Z8AA 1W70A 1PHTA 3I9QA 5L23A 1QLYA 4OMMA 2OJ2A 1PKSA 4OMNA 1NYFA 4OMOA 2HEQA 1VYTA 2A36A 1K76A 1SSHA 1JXOA 2RPNA 1WLPB 1T3SA 3UA6A 1YCSB 4AFUC 2EVRA 1UGVA 2DL5A 3TSWA 3NPFA 4LE9A 2KYBA 3EHQA 3ZL7C 4CC2A 1QCFA 1QWEA 4AG1C 2DBKA 2V1RA 2EYXA 1UJYA 1KIKA 1X43A 1A0NB 1GBRA 1PKTA 1B07A 1CSKA 2FO0A 1K9AA 4J9GA 2D1XA 1AD5A 4LUDA 2JW4A 1G83A 2EYYA 1KFZA 1U3OA 2CSQA 2C0TA 2FRYA 4RUGA 2KRMA 4RTVA 1QWFA 1VYVA 1JQQA 1X27A 1ARKA 4KRTA 1PRLC 2X3XD 4HVVA 1BU1A 2EGAA 1JO8A 1JXMA 3ULRB 4J9EA 1X69A 1TG0A 1V1CA 2EBPA 2CH4A 3M0RA 4J9DA 1AWWA 2FPEA 3VS5A 3PE0A 4RTYA 2DM1A 1M3CA 2HCKA 2AKKA 4F14A 1OPKA 1K4US 1HD3A 3VRYA 1W6XA 1T3LA 2RQVA 1TUCA 4IIMA 4LUEA 1HJDA 1WXUA 4RTXA 2E5KA 2KT1A 2LZ6B 2EKHA 1MV3A
chains in the Genus database with same CATH superfamily
1SF9A 2KY9A 3QWYA 4LDWA 1H3ZA 4E7JA 4EMGA 1U1TA 4E6RA 4PJNA 1OI1A 1MNEA 2KE9A 1VQ7A 1QW1A 4PL6A 3OS2A 4QQ6A 2MIOA 4C8QB 4M77F 2YRVA 2DXUA 4ZN3A 3CBOA 1VQNT 2CSIA 2R58A 3RESA 4M78B 3QKJA 3MCAB 4M78D 2HQXA 3ER0A 4M7DE 3JB9H 3EG2A 3UA7A 3JB9J 4ZNXA 1NPPA 3M9QA 4M7DA 5ECAA 2RN8A 3JCMc 3QWXX 4D6WA 2F69A 4PK4A 2KR3A 2HDAA 4ZGJB 2QA4Q 4E7IA 3LH5A 2ZAEA 2OAUA 1VQ4Q 2H3JA 2DBMA 2YDLA 5GAN4 2EQIA 2BIVA 3M0UA 3EGDA 4J6XA 1N8RR 1PWTA 3SWNA 1M1KU 2K7AA 3I5SA 2FYKA 2GGRA 3C12A 1NEBA 2ZPIB 1YJWT 3M0PA 4LDXA 1SPKA 4PFOA 3SHWA 1PRMC 1M3AA 1UEBA 3A98A 1M2OA 4FYWB 2DTOA 3EH2A 1K8AR 4OMFB 3H6ZA 2F2WA 3QBYA 3CCRQ 1X6OA 2COZA 2K5IA 2BTTA 2LMJA 3HSBA 4DBRA 4CC3A 5HCKA 4M7AE 5GAMe 2KQWA 1LOJA 4M77C 5GAN7 5GANg 3GBQA 2RHXA 3QYHB 3FJ5A 1QCNA 2VB6A 3REAB 2X51A 4M77G 3J80E 1DJ7B 2LT1A 2QASA 1K0SA 3CCMQ 3I55A 2E41A 2K3XA 4PJLA 1VQ9Q 2RQWA 2FRWA 1G3SA 5GAOl 1E7OA 4EIKA 4II1A 4E7HA 1AHJB 1MV0B 1WQWA 1K9MU 2IPOB 4NOYA 4OVAA 2XU8A 1VQ9T 2YUNA 5IAYA 1YJNT 1VQLA 2OTLQ 3FEOA 4PJOB 5CR2A 2M1HA 2D0QB 9ATCB 3CMEA 1UG1A 4WF2A 1V76A 1D0ZA 2P84A 3VS2A 4XTZA 3CCQA 4AFSC 3VS7A 1QVPA 4ZTFA 2RF0A 3UATA 2YSQA 1AWXA 1CKAA 3A1PA 1NYGA 5FWCA 3HRTA 1EIFA 2Y4YA 3JCMd 1GFCA 3INZA 3DLLA 1YWOA 3QHSA 2DVJA 4GY5A 3QZ9B 3M53A 2O2OA 5J3BA 5AYFA 4NL3A 3EGDB 1JRIA 1U8RA 4FSSA 3JCMP 3J7AF 3I56Q 4M75B 4JLGA 1K0XA 3E2UA 2Y4XA 5GMKl 3V7RA 1WJQA 4E7KA 1KC8C 2MYSA 4J9BA 2E12A 2ZZDA 3JCMV 4LD9K 2OAWA 1J3TA 2EQUA 4C5IA 3RERA 2KK4A 4PFPA 4GLKA 4QT7A 1YBYA 5LJ5f 2YUPA 1WQ7A 2EAYA 4JRKA 3CCVQ 4JPBW 2QEXA 4NS5A 3A8HB 2HQHA 2XKOC 3SB2A 1KG1A 4KH0B 1GL5A 1OOTA 4XU0A 4EMKC 1GRIA 1WHLA 4XTVA 1QP2A 1Q82C 3OS1A 2CH4W 1BBZA 5A0GA 1SHFA 4JJBA 1UDLA 1BKBA 4C92C 3H8ZA 1B3QA 1VQ9A 2CP5A 1N27A 2J05A 2RI2A 5I2MA 4RTUA 1V29B 2PTKA 2DVEA 2HBWA 2HQEA 3KUFA 1M90C 1U1SA 2DD5A 2MI6A 1VQ7T 1WJRA 1WPYA 1S72T 1GBQA 1FMWA 3O5ZA 1O9SA 1Z9QA 4F17A 2DRMA 3CC7T 1VQMT 2EJGA 2KAFA 4ATOA 2E10A 3FLGA 2QDLA 2KGTA 1WDXA 5GMKi 2RK1A 2PVOB 2VKNA 3CCRA 1VQOA 2NUTA 2VGNA 1M5Q1 1ZBXA 5AT1B 2NWMA 3GOXA 2NYSA 2KRNA 1Y96B 4XU3A 2I2LA 3GNGA 2EGCA 2JM9A 1YITQ 5J26A 3E19A 1XJWB 2DJQA 1K8AU 3CCMA 4HT8A 2KMTA 2HD0A 2DA9A 4RTTA 3JAME 5HK3A 4M75D 1Y96A 3EGUA 1PM3A 3JCMh 2GQIA 4HCZA 4DEXA 2NUPA 4DQ2A 1IZ6A 1RAAB 2LCCA 4JDSA 5GANd 3UT1A 2PU9B 3OS0A 1RI0A 2OTLA 1G5VA 2WSCE 1QLYA 1YJNA 1YHQT 4TVRA 4OMNA 2XI9A 5D6WA 2A36A 1K76A 1JXOA 1P92A 2M16A 2HSEB 3CD6T 2QA4A 1K9MC 1YCSB 4FT4A 2EVRA 3HTRA 3TSWA 3NPFA 1ZSZC 3EHQA 1KQSS 2X9HA 1QWEA 2JNGA 4OF1A 1UJYA 3G4SQ 1KIKA 1A0NB 4A4FA 1K9AA 2XDDA 4XU2A 5A0DA 4LXCA 3CMAA 1N6AA 1PD0A 4DBQA 4C8QF 4RTVA 1QWFA 1WNLA 1QVGS 4A4EA 2CYZB 4KUIA 4M78A 2QQAA 3I56A 2OTJA 2CP7A 2D6FA 4C5GA 4FL6A 4HVVA 3OYFA 5IN1A 1BU1A 2P0QA 1XTDA 1YJWA 4FSXA 1Q95G 4M78C 1TG0A 1V1CA 2VXFA 3RIRA 3CCSA 1G8XA 2CH4A 3M0RA 4J9DA 4C92D 1D1BA 1UB4A 1VQOT 4KGVB 5KYXB 3JB9F 4OB0B 3HL8A 3CC7A 2C06A 1VQ8A 2AKKA 2KVQG 2XIDA 2KDSA 2KSSA 2RQVA 1HYOA 2EQKA 1KQ1A 3RMSA 4C5EA 3MP8A 8AT1B 2KT1A 2ATCB 2RA2A 1NEGA 1I4K1 2CP2A 2FZCB 3I55T 1M9SA 4JJNK 4ESRA 2NUPB 3M0TA 1LJOA 2Y90A 1AWOA 3M54A 4RTZA 2RNAA 3CMEQ 4AG2C 1I8FA 4AFQC 3M59A 2V8JA 1QQJA 4XTWA 2PNIA 3G71T 2OTLT 4MMKA 2X4YA 1VQ6T 3FIFA 1SG5A 1Q86U 3G6EQ 4JJCA 1KD1U 3IQLA 3QIIA 3PTAA 3U23A 4QQDA 1KHCA 2MOXA 2V8KA 4BACA 3P8HA 1UTIA 2B86A 3C94A 3OW2A 4C8QG 4C92F 2HKNA 2M0YA 4L6V5 4PJOG 2LX7A 1LCKA 1OZ2A 1WXBA 3ME9A 2I0NA 2G3RA 4M75C 1T0JA 5CCAA 1VQMA 2LJ1A 1WHJA 1H3HA 1RUWA 4DOVA 1M3BA 5KYYB 3CCJT 2E5QA 3AHUA 2J6KA 3V7CA 1JEGA 2JUFA 2MWPA 2A28A 4PLIA 2K6DA 1YITT 5GJVB 2DXTA 4C8QE 3CCVA 3OQ5A 3CCEQ 4J6YA 1Y07A 2QI2A 5GAOr 4FYYB 2CP0A 1X01A 2ESWA 5IT9E 2VVKA 3SWNB 3L2VA 1GXIE 3TCJA 2R5MA 2OTJT 4P5NA 4QVZA 1RLQC 4RG2A 1Q7YU 3S3OA 3EG1A 3EFOB 1Z9ZA 1C1AA 1RL2A 1WI7A 1RAEB 3VYHB 1RAFB 3PFSA 4HVWA 3JB9I 2EQMA 1TS9A 2F5KA 1XQHA 1RADB 1IXDA 2J7IA 4C92E 5GAMg 2JZ2A 1D0YA 1KQSP 1Y0MA 4OMLA 3THKA 3FRNA 1ZUYA 3QDRB 5DLQE 3JCMJ 1WYXA 1LVKA 1WX6A 2CUBA 2A08A 1W2BS 3M57A 3CCLA 3PMTA 1UGQB 4DBFA 2KNBB 5EG2A 4B9XA 1QKXA 3DLMA 1YI2Q 1I5LA 3A8OB 1IRXA 2DTIA 2L89A 4FW1A 1Q82R 4GLMA 3JCMf 2QEXQ 2DEQA 1M2VA 2EYWA 4HXJA 2MAMA 1ZUUA 1WGSA 1NLPC 2QK0A 2B8AA 1SEMA 3QO3A 2PUOB 1JBMA 4QQGA 2RHUA 4BY6C 4M78G 4F7UG 2L3PA 1VQ4A 2RQTA 2FZGB 1MMAA 3L2ZA 1BI2A 5IXBA 5CIUA 3HHTB 4E47A 3X26B 2XMFA 1GCQA 1YJWQ 1SRLA 4JS5A 2E3HA 3E1SA 2WACA 2ROLA 3EG0A 1G3YA 4BI8B 3L2QA 1ZHIA 5CAIA 3I5RA 2A3LA 1UECA 5GAN2 3WVEB 2K5LA 5I2SA 1NM7A 2JS2A 8ATCB 4JRPA 2RHZA 4GBQA 1YIJA 2XK0A 2RQUA 4OGCA 3EAEA 4EMHA 3VS1A 4J9IA 3GLXA 2DZ9A 5IHIA 2JTMA 2XD0A 4M75A 1XOVA 2K3YA 2E3IA 3VS6A 3RBBB 2DRKA 1FMKA 2DJZA 4KBMB 2J06A 2P0KA 4IKFA 1BCOA 1OZ3A 1M4ZA 3FDRA 2DERA 1K73U 2RHYA 1T0HA 3L42A 3M5AA 3LYIA 1ZX6A 2ROTA 5FWBA 3OYBA 2X4WA 4LDYA 3OMCA 1R0BG 3G4SA 2AKLA 2DK3A 3DB4A 1OV3A 2L3SA 3BE3A 2DL3A 1VQ5Q 3JB9G 1VQPA 2LRQA 2L2PA 4M77D 3LWIA 2EIFA 2DF6A 5KYWB 1B7TA 4A53A 2FPFA 2P4RA 1GCPA 1YJ9Q 5FU7C 4ZGDB 2LJ0A 2QAZA 2RO0A 2BZXA 3AT1B 3MP1A 4M75G 1AVZC 2SEMA 4R55A 3SFMA 1SKUB 1I0CA 5GAOq 2W10A 2LP5A 5KCHA 2DIQA 3EG9B 2KEAA 2GNCA 4L5GA 3CD6Q 2K9GA 3OYNA 3OYYA 1NBEB 2MCNA 4BI4A 1VQ7Q 5FRNA 2ZPBB 2PUKB 3TSZA 1PC0A 4M7DG 4F04B 5J39A 1UHCA 4FM4B 2MWOA 3OYCA 2HL5C 2K2MA 4J6WA 2DO3A 1EX4A 4MDWA 4DBHA 3V8LA 5LJ3g 3JV3A 2E6NA 3LGFA 1YFNA 4PKCC 1W2BA 5CK9A 3SD4A 1ABQA 1D3BB 3RDVA 1PSFA 3LX7A 2YWWA 2H3EB 4PJJA 3S3NA 5C0MA 5GMKh 3RKYA 2OTJQ 3TEEA 3OYDA 2D8HA 2E64A 4XK8E 2EQJA 1M90U 1Q7YC 4DOWA 1OU9A 3CCUQ 5EC7A 5I22A 3FJPA 3CXCA 4ANJA 4KH1B 1K9MR 2BE7D 4Z8AA 1W70A 2X4JA 2QQ9A 1PHTA 2COWA 3I9QA 5L23A 2RJEA 2JJ9A 2EWNA 3MPUB 4J83A 3WVDB 2EKOA 1OQKA 1PKSA 4M7AG 1NYFA 2BE9B 3CCUT 2HEQA 3OYKA 1SSHA 4EMKB 5A2QE 1WLPB 1VQKQ 1VQ8Q 3Q1JA 3UA6A 4AT1B 4QW2A 2JOYA 2HBPA 5LJ5h 2QXFA 2DL5A 4NL2A 2GFUA 4CC2A 1QCFA 3CMET 2V1RA 2K57A 3LW5E 3VJPA 1IHWA 3UDCA 1X43A 3QYGB 4RCBA 1B07A 4UC4A 1CSKA 1IGUA 2LX9A 2LCLA 4JUVA 5LJ3j 5GAN3 3MP6A 4RG8A 4LUDA 4M7AC 1IB8A 4IUUA 2C0TA 4RUGA 4A4GA 2LC4A 1WHHA 1VYVA 1JQQA 4FIBA 1X27A 4F7UA 3EGXB 1Q81C 1ZSZA 2X3XD 2E4HA 5D6XA 1MGQA 2LQ8A 4WTOB 1JO8A 1JXMA 2RJFA 2DKGA 3ULRB 2R57A 3JCMQ 3OYLA 2HNIA 4ELYC 2EBPA 4RTYA 3CCJA 2HZYA 4ZN1A 3HRSA 1QVFS 4M78F 1K4US 1OPKA 3BY7A 1B34A 1IREB 2O4XB 2LZ6B 1IGQA 5CKBA 3MKDA 4V2SA 3OYJA 1JU5C 3OS5A 1YI2A 3VS0A 1UUEA 3ZFJA 3GIBA 2CREA 1EZZB 4X1VA 2DX1A 1VQ5A 1SHGA 1VQNA 3QZ5B 2DIGA 2LNVA 4BE2A 2OX7A 2CT4A 3MEAA 1UGRB 4BD3A 1OX8A 2V26A 4J9CA 2VUBA 2ZPFB 1GFDA 1RAHB 3EFRA 4X9DA 2DILA 3M0SA 4M78E 2O4XA 2QQRA 2ZPEB 1ABOA 1MMNA 3V8KA 3I35A 2BZYA 1ZSGA 4N4GA 5FU6B 3CCUA 4KGXB 3E9GA 5CKFA 2O88A 1K73C 3GP8A 4J9FA 2C0OA 2DETA 3P8BB 1E6GA 3X28B 2W0ZA 3X24B 3UPUA 1GCQC 4D8DA 5FRMA 3ZBDA 4E7LA 4ORZA 1W2BP 3M4GA 4A4HA 1KJWA 1MUZA 1PNJA 3DKMA 1CKBA 1VQ4T 4J9HA 2YRCA 1S72Q 3SDZA 2KXDA 2Z0WA 1KC8R 3A8MB 3OBYA 1HK9A 4A63B 4BE0A 1SSFA 3QPHA 2LQWA 5LJ5j 1BI1A 3CCRT 1PSEA 3QXEB 3OYIA 2D8JA 2NUZA 7AT1B 3RKXA 2CT3A 2RH2A 4R0KA 3HRUA 2JS0A 4XTUA 4Y91A 1KK7A 3VRZA 1BI3A 1M1KC 1W4SA 1OPLA 2CP6A 3QDFA 4RTWA 2MF2A 4MZPA 4RCCA 4AFZC 4BY6B 2LJ3A 4RMOA 2EYZA 4M7AD 3L2WA 3M0QA 4MZTA 3PVQA 1TSFA 3V7SA 5GAN8 3I55Q 4IUVA 1QVFA 3VUBA 3CC2T 3C0CA 4Q5WA 1I81A 1D1CA 1FWZA 2QYZA 2IIMA 5IXFA 3CPWS 5GANf 5GJWB 2CZ0B 4A54A 3MO8A 3REBB 2L8DA 4Z88A 1ACMB 1M2VB 4F7UF 3G7ZA 2K3BA 4VUBA 2RJCA 2XDPA 3G71Q 3LWHA 3CD6A 4QVDA 2JXBA 2QG9B 5KYUA 1Y57A 3A8GB 2YHTA 2YUOA 3JB9D 1W1FA 4JZ3A 1YP5A 1TU0B 3JCMW 2V1QA 3PNWC 5LL6S 3G1JA 1E6HA 3HP9A 2A37A 1X6BA 2F1LA 3CMAT 3JRZA 2HSPA 2M0OA 5HKCA 3EFOA 5FROA 2RQRA 1JJ2A 3OW2P 2FG0A 1K8AC 2ENMA 2XDBA 1NLOC 4C8QD 4CC7A 4X34A 4D8KA 4HA8A 3A8LB 4HT9A 1X6GA 4FW2A 1VUBA 3CC4T 3CCEA 2GCXA 3CCJQ 1AEYA 2BKDN 3CC2A 1MNDA 1VOMA 1UE9A 1YJ9A 4FYXB 3PIPA 2X4XA 1Y7XA 5L8RE 3X25B 3GF5A 3QJ6A 2A7YA 3NMZC 4KUDK 4C5HA 1LPLA 1VQKT 2DXBA 4C0DB 4LD6A 2RHIA 2O01E 3TVTA 2YXYA 4ELZC 1ZLMA 4XTXA 4F16A 1HXDA 2LT4A 2D0NA 2EJFA 2GTJA 3H41A 2JTEA 3CMAQ 1YN8A 4A4KA 2RMOA 1YIJT 2CUDA 1TH7A 4OMPA 3M4YA 1BI0A 4M77A 1D09B 1N9SA 1NE8A 2GQVA 3RUXA 4Z89A 1MHNA 3VUZA 5LJ5g 1BYMA 1TTHB 5GAOp 1X2KA 4M75F 1H641 1U06A 2VC8A 2YLBA 2RK2A 1WA7A 4CI0C 4JZ4A 1M8VA 2LDMA 4OB2B 3VS3A 3VYGA 2JM8A 4PJOD 2DL4A 4ZGEB 1AZEA 2RI5A 4KT0E 4M77B 1WIEA 5CKEA 5KYUB 1ZBJA 3CBMA 2O9VA 4JLIA 1S72A 5LJ5d 3T9NA 2VXEA 2ABLA 1OULA 3G4ST 5KYNA 1NG2A 4FYVB 3RMQA 2AIRB 4K11A 3CEYA 1WXTA 2PVGB 4J8OA 3H0IA 2XHCA 3OMGA 4ME7A 4RKUE 4M77E 4M7DC 1UJ0A 1KQ2A 3OYHA 1YI2T 2G6FX 2KRSA 4IURA 1UGPB 2FEIA 1M1GA 2GBQA 3UWNA 1KC8U 2JVVA 1OYXA 5IHKA 4KULA 3RKWA 1NJIR 3QJYA 4HCBA 1TUDA 2LQNA 3G6EA 5GMKe 4CRIA 1JJ2P 1C6VX 3CCET 2EW3A 3VS4A 1M1FA 1RI9A 5DY9A 5LJ3d 1VQ6Q 4B9WA 1VQNQ 1YITA 1S1NA 2M51A 3CPWA 1JJ2S 3PGGA 5GANj 1G3WA 1U5SA 2BZ8A 2DD4A 1VA7A 1N5ZA 1NJIU 2XG8D 2NUTB 2YRDA 2DL7A 3PVLA 2WSEE 3WXMB 5GANh 2DE0X 2AHJB 1QCOA 4C0FA 1YHQA 2OI3A 2RD1A 3CBPA 2ED0A 4C8QC 3QUIA 3OSSC 3H0HA 1VQLT 2K2VA 3EG9A 1I5OB 4EPCA 1PCXA 3J81E 5KH6A 3CCQT 2MMPA 3OYMA 3VU3C 4MMLA 1T3SA 1VQ5T 1UGVA 4LE9A 2KYBA 3ZL7C 1RAGB 2DBKA 2EYXA 3E9FA 5DLOA 3BDUA 2K5FA 1GBRA 4PJOF 2FHDA 4J9GA 3CPFA 4Y28E 2HMAA 3TQ7P 4BDYA 2JW4A 4BDZA 3OB9A 1R0CB 1U3OA 2FRYA 2KRMA 1TOVA 1ZA2B 3OYAA 3LLRA 2LTOA 1VIEA 1ARKA 4KRTA 3VKIA 2ZPHB 4HKEA 2LVMA 3M56A 4N4HA 2EGAA 2AT1B 4C92A 3TU4K 2DAQA 3NTIA 3V8JA 3I56T 2QTXA 4MZMA 3H9NA 1AWWA 3MEVA 3VS5A 2DZCA 4OB1B 2DEUA 1UGSB 3CC4Q 1M3CA 1B34B 3L1AA 5KE3A 1HD3A 3N5BB 3JCMe 1PG5B 2E70A 3C95A 1BCMA 1TUCA 4IIMA 4EMKA 1Y71A 1HJDA 1WXUA 2D9TA 2EKHA 1MV3A 1NJIC 3G6ET 2CZ6B 1I07A 4M7DD 4AMCA 3PMIA 3CPWP 2WSFE 3EG3A 5LJ5e 2DL8A 1OX9A 1RACB 3OYEA 4LN2A 5A0LA 2KYMA 1TUGB 2CS7A 2RI3A 2A0FB 5KCOA 3CXCS 3O8VA 3OSVA 1WFWA 3EFSA 3KFVA 6AT1B 4MDXA 1TWBA 1AT1B 1OU8A 3CXCP 4OGEA 2JMCA 2NLUA 1Q82U 3OA6A 1YHQQ 2F2VA 3TREA 2MPXC 2AZVA 1SRMA 5KE2A 3NHNA 4IUTA 3CC2Q 2ZPGB 1VQMQ 3OW2S 3FC3A 2VASA 4C0DC 5GAMd 2GF7A 1FMVA 2EGEA 3GNFB 1BIBA 2LQKA 1QVGA 4M7DB 4IUPA 1F1BB 4N0AA 4LDVA 3UF4A 2RM4A 2QTVA 1QMCA 4E7ZA 1FYNA 2J6FA 1Q7YR 4PJOA 2DYBA 1IO6A 2SRCA 2JTFA 3HFNA 1VQPQ 1EFNA 1LNXA 1YJ9T 2KXCA 4CC4B 2BUDA 2LCSA 4O5VA 2ECZA 2EPDA 3R6NA 4IUQA 4DEYA 1WHMA 3SEMA 3LH0A 1IHVA 5GAN5 1N9RA 5FW9A 2V8IA 1H8KA 2DNUA 2QDYB 2FL7A 5D7UA 3VV0A 2ZGWA 1X75C 4M4ZA 3C4SA 4E2FB 3JCMX 4HCCA 1QKWA 3NTKA 4F7UE 3NFCA 2M02A 1VQ8T 1PD1A 4FU6A 3CCLT 4XTYA 3MEUA 4Z02A 3PIOA 2JT4A 3KXTA 5I11A 1D1AA 3S6WA 3JCMg 4JJDA 4XQ3A 4C0GA 3L2UA 2E6ZA 5IHNA 2L5QA 1ZUKA 2QGFB 3X20B 3CCLQ 2FPDA 4HCKA 5GAMf 2JN0A 2CDTA 2KBTA 1N8RC 3EHRA 1Q86R 1BK2A 2QA4T 2CZ7B 3SWNC 5CKHA 2VWFA 3F70A 5HK0A 2AK5A 1KD1R 3HPWA 3MJXA 2JMAA 4C92G 4L59A 1FX7A 2LNHB 2P4TA 5M9OA 4JRQA 4N4IA 1FXXA 1WHGA 5FLXE 2DYIA 3NGPA 3ZEHA 2X3WD 4OP0A 1O75A 5GMKj 2YLCA 5KYYA 1KHIA 1BIAA 1I1JA 2EJ9A 2RJDA 5GAMh 5FU7B 1TXQA 1BB9A 4M7DF 1VYUA 2PZ1A 2J6OA 1NPRA 4BI3A 4PJOC 4B6MA 1HSQA 1NZ9A 4IIOA 1G3TA 4WCIA 1M8MA 4HVUA 4N0AC 1YIJQ 4J5YA 2VGMA 5GMKm 3META 3CCVT 3BDLA 2X35A 3A5ZB 2AZSA 4BB7A 2CP3A 1YCYA 3S3MA 1G2BA 1YWPA 1VQLQ 4ZTJA 2DLPA 2CKKA 3PT9A 2KROA 4DA4A 3CCMT 2YT6A 1R8OB 1AWJA 4BE1A 2KI7A 5CQYA 1M30A 5HY6A 4C0ZA 4PJMA 4XAXB 2F2XA 2K4YA 2CGHA 4XU1A 2HKQB 5GAN6 3G71A 2FVUA 4FT2A 3CCST 3CQTA 4M7AF 1VQ6A 1YJNQ 5C6SA 4PNOA 4J7FA 2GTOA 2F5TX 3D7SB 4PFZA 5CVIA 1OEBA 2DPPB 1VQPT 5CQXA 1D0XA 3JCMb 1K1ZA 5D6YA 1UFFA 2KT8A 2H8HA 2O9SA 2VYTA 4LNPA 2QQSA 2ED1A 1MMDA 2YUQA 2L0AA 4BUGA 1WZOA 1X2QA 3URGA 2O31A 2MK5A 3GPLA 5LJ3f 5GAOm 5I21A 2VV5A 2C0IA 5IH2A 1N8RU 3EGXA 5LJ3e 1M1KR 4X9CA 3L2RA 1WHKA 2EYQA 2EFIA 3CCQQ 2GFAA 2DMOA 4O6JA 2HL3A 5FU6C 5CO7A 2QGGA 4OMQA 4M75E 1VIFA 4JRIA 3ASKA 1YNZA 1M90R 1AZGB 2RB6A 3OYGA 1KSWA 2IG0A 3H0FA 1JB0E 5GANe 3CCSQ 1RLPC 2ZCFB 4PLLA 3MEWA 2L3RA 4QKUA 2E1HA 1QVGP 3RNJA 4E7SA 3CC7Q 3OBWA 4Y92A 1M27C 1H92A 2QEXT 1AOJA 5GAMj 4R56A 1UHFA 2P0PA 3HFOA 1WJSA 2K79A 3KBGA 1K73R 1Q81R 4LDUA 2QQBA 2L3QA 3RR6A 2HAXA 5GAOn 1D3BA 3QSUA 3HKSA 1XNIA 2XICA 4FCYA 4OMMA 2OJ2A 5KYXA 3OY9A 3EH1A 3CC4A 4PJOE 3NTHA 4OMOA 4YTLA 3JSCA 1VYTA 2RPNA 3QG1A 1VQOQ 3DB3A 5DM7R 4AFUC 1VQKA 1Q81U 2COYA 5LJ3h 5KYWA 1MMGA 3M58A 4AG1C 3BW1A 2DTHA 2M9UA 3P8DA 2PQWA 1PKTA 2FO0A 2FZKB 2D1XA 1AD5A 2E65A 1G83A 3MHXA 1C0MA 2EYYA 1KFZA 2CSQA 1KD1C 3R6OA 1RABB 4M7AB 1Q86C 3LGLA 2DXCA 1PRLC 1ZA1B 1RAIB 1R77A 2CZ1B 2DFUA 4EDUA 3BFMA 4J9EA 1X69A 1QVFP 2FB7A 2FPEA 4C92B 3PE0A 4QVCA 2DM1A 4KGZB 4JS4A 1ZQ1A 3FB9A 4J7IA 4M7AA 2HCKA 2R5AA 4F14A 1KQSA 3VRYA 4F7UB 4C8QA 1ZSZB 1W6XA 1T3LA 2PVDB 4LUEA 4RTXA 2IVWA 1QP3A 2E5KA 4OB3B 5CKDA 3M55A
chains in the Genus database with same CATH topology
1NEGA 3QWYA 1I07A 1JU5C 3EG3A 2DL8A 3VS0A 1UUEA 2CREA 4LN2A 4X1VA 2DX1A 1SHGA 4E6RA 4ESRA 3M0TA 2KYMA 2KE9A 1AWOA 2CT4A 4RTZA 2RNAA 4AG2C 2MIOA 1WFWA 4AFQC 3KFVA 4J9CA 1GFDA 2CSIA 2PNIA 2DILA 3M0SA 2JMCA 1ABOA 4JJCA 3I35A 2BZYA 1ZSGA 3IQLA 3U23A 2F2VA 2MOXA 2O88A 1UTIA 2AZVA 2B86A 1SRMA 3EG2A 4J9FA 2C0OA 3UA7A 2M0YA 1E6GA 2LX7A 1LCKA 4ZNXA 2W0ZA 3NHNA 1GCQC 4D8DA 1WXBA 2RN8A 5ECAA 4ORZA 2I0NA 3QWXX 1KJWA 1MUZA 1PNJA 1T0JA 1CKBA 2LJ1A 4J9HA 1H3HA 2KR3A 2HDAA 1RUWA 2EGEA 3LH5A 2KXDA 3UF4A 1M3BA 2DBMA 2YDLA 4A63B 2EQIA 2J6KA 1JEGA 1FYNA 2J6FA 2A28A 3M0UA 2DYBA 1IO6A 2SRCA 2LQWA 1PWTA 2K6DA 2K7AA 3I5SA 2D8JA 1EFNA 2GGRA 2NUZA 5GJVB 1NEBA 2KXCA 4CC4B 3M0PA 2CT3A 2LCSA 1SPKA 4R0KA 2JS0A 1PRMC 3SHWA 1M3AA 3A98A 2ECZA 2EPDA 3R6NA 3VRZA 2ESWA 2VVKA 4DEYA 3SEMA 2F2WA 5FW9A 1H8KA 1OPLA 2BTTA 2DNUA 2LMJA 4CC3A 1RLQC 5HCKA 4RTWA 3EG1A 4AFZC 2LJ3A 1Z9ZA 3GBQA 3FJ5A 2EYZA 4M4ZA 1WI7A 1QKWA 3M0QA 3REAB 3PVQA 4HVWA 1K0SA 2J7IA 2RQWA 2FRWA 3C0CA 1Y0MA 1E7OA 2JT4A 4OMLA 3THKA 5I11A 1ZUYA 2IIMA 5IXFA 4EIKA 4JJDA 1WYXA 1WX6A 5GJWB 2CUBA 2A08A 3REBB 1MV0B 4Z88A 5IHNA 1ZUKA 2FPDA 4HCKA 2KNBB 2YUNA 2K3BA 2CDTA 2KBTA 3EHRA 1QKXA 1BK2A 4GLMA 2VWFA 2JXBA 2AK5A 1Y57A 2EYWA 4HXJA 2YUOA 1ZUUA 1NLPC 2JMAA 1W1FA 1UG1A 4JZ3A 1YP5A 1SEMA 3VS2A 2LNHB 4AFSC 3VS7A 2V1QA 2RF0A 3UATA 2YSQA 1AWXA 1E6HA 1CKAA 2L3PA 2RQTA 2A37A 1NYGA 3NGPA 5IXBA 1X6BA 5FWCA 2X3WD 2XMFA 2HSPA 1GCQA 1GFCA 1SRLA 2RQRA 1YWOA 2FG0A 2ROLA 2DVJA 2ENMA 3EG0A 1I1JA 1NLOC 4CC7A 4D8KA 1BB9A 2O2OA 3I5RA 1VYUA 1X6GA 2PZ1A 2J6OA 1AEYA 1UECA 1UE9A 4FSSA 1HSQA 4IIOA 1NM7A 4WCIA 2JS2A 3NMZC 4GBQA 1M8MA 4HVUA 1K0XA 2RQUA 3VS1A 4J9IA 4J9BA 1J3TA 2OAWA 5IHIA 3TVTA 2AZSA 1XOVA 1ZLMA 4F16A 4QT7A 1G2BA 1YWPA 3VS6A 2D0NA 2YUPA 3RBBB 2DRKA 1FMKA 2GTJA 3H41A 2JTEA 4JPBW 2J06A 2DLPA 2KROA 1YN8A 2RMOA 2YT6A 2CUDA 4OMPA 1AWJA 1GL5A 1T0HA 1OOTA 1GRIA 4Z89A 1ZX6A 2ROTA 5FWBA 1M30A 2F2XA 1X2KA 2AKLA 1U06A 2CH4W 1OV3A 2L3SA 1WA7A 2DL3A 3CQTA 1BBZA 2L2PA 4JZ4A 3VS3A 2JM8A 2DL4A 1SHFA 4JJBA 1UDLA 1AZEA 2GTOA 2DF6A 1B3QA 1WIEA 2FPFA 1OEBA 2P4RA 1GCPA 2J05A 1ZBJA 2LJ0A 4RTUA 2O9VA 1K1ZA 2BZXA 1AVZC 2ABLA 2SEMA 2PTKA 1NG2A 1UFFA 2KT8A 2H8HA 1I0CA 2O9SA 2W10A 2HBWA 4K11A 4LNPA 2LP5A 1WXTA 3H0IA 2ED1A 2KEAA 2YUQA 2L0AA 2GNCA 1GBQA 1X2QA 3O5ZA 1UJ0A 2K9GA 2O31A 1Z9QA 2MCNA 4F17A 2G6FX 2KRSA 5IH2A 2C0IA 2DRMA 2FEIA 3TSZA 2GBQA 2QDLA 1UHCA 5IHKA 2KGTA 2DMOA 1WDXA 2VKNA 2K2MA 4OMQA 2NWMA 1TUDA 2KRNA 2LQNA 1YNZA 3JV3A 1AZGB 2EW3A 3VS4A 1RI9A 2EGCA 2JM9A 1KSWA 3H0FA 1RLPC 1ABQA 1S1NA 2M51A 2DJQA 3RNJA 1U5SA 2BZ8A 4Y92A 1M27C 1VA7A 1N5ZA 1H92A 2DA9A 4RTTA 2DL7A 1AOJA 2D8HA 3PVLA 1UHFA 2DE0X 3EGUA 2K79A 2GQIA 4DEXA 2OI3A 5EC7A 5I22A 2ED0A 2L3QA 3H0HA 4Z8AA 1W70A 1PHTA 3I9QA 5L23A 1QLYA 4OMMA 2OJ2A 1PKSA 4OMNA 1NYFA 4OMOA 2HEQA 1VYTA 2A36A 1K76A 1SSHA 1JXOA 2RPNA 1WLPB 1T3SA 3UA6A 1YCSB 4AFUC 2EVRA 1UGVA 2DL5A 3TSWA 3NPFA 4LE9A 2KYBA 3EHQA 3ZL7C 4CC2A 1QCFA 1QWEA 4AG1C 2DBKA 2V1RA 2EYXA 1UJYA 1KIKA 1X43A 1A0NB 1GBRA 1PKTA 1B07A 1CSKA 2FO0A 1K9AA 4J9GA 2D1XA 1AD5A 4LUDA 2JW4A 1G83A 2EYYA 1KFZA 1U3OA 2CSQA 2C0TA 2FRYA 4RUGA 2KRMA 4RTVA 1QWFA 1VYVA 1JQQA 1X27A 1ARKA 4KRTA 1PRLC 2X3XD 4HVVA 1BU1A 2EGAA 1JO8A 1JXMA 3ULRB 4J9EA 1X69A 1TG0A 1V1CA 2EBPA 2CH4A 3M0RA 4J9DA 1AWWA 2FPEA 3VS5A 3PE0A 4RTYA 2DM1A 1M3CA 2HCKA 2AKKA 4F14A 1OPKA 1K4US 1HD3A 3VRYA 1W6XA 1T3LA 2RQVA 1TUCA 4IIMA 4LUEA 1HJDA 1WXUA 4RTXA 2E5KA 2KT1A 2LZ6B 2EKHA 1MV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEG A;  3QWY A;  1I07 A;  1JU5 C;  3EG3 A;  2DL8 A;  3VS0 A;  1UUE A;  2CRE A;  4LN2 A;  4X1V A;  2DX1 A;  1SHG A;  4E6R A;  4ESR A;  3M0T A;  2KYM A;  2KE9 A;  1AWO A;  2CT4 A;  4RTZ A;  2RNA A;  4AG2 C;  2MIO A;  1WFW A;  4AFQ C;  3KFV A;  4J9C A;  1GFD A;  2CSI A;  2PNI A;  2DIL A;  3M0S A;  2JMC A;  1ABO A;  4JJC A;  3I35 A;  2BZY A;  1ZSG A;  3IQL A;  3U23 A;  2F2V A;  2MOX A;  2O88 A;  1UTI A;  2AZV A;  2B86 A;  1SRM A;  3EG2 A;  4J9F A;  2C0O A;  3UA7 A;  2M0Y A;  1E6G A;  2LX7 A;  1LCK A;  4ZNX A;  2W0Z A;  3NHN A;  1GCQ C;  4D8D A;  1WXB A;  2RN8 A;  5ECA A;  4ORZ A;  2I0N A;  3QWX X;  1KJW A;  1MUZ A;  1PNJ A;  1T0J A;  1CKB A;  2LJ1 A;  4J9H A;  1H3H A;  2KR3 A;  2HDA A;  1RUW A;  2EGE A;  3LH5 A;  2KXD A;  3UF4 A;  1M3B A;  2DBM A;  2YDL A;  4A63 B;  2EQI A;  2J6K A;  1JEG A;  1FYN A;  2J6F A;  2A28 A;  3M0U A;  2DYB A;  1IO6 A;  2SRC A;  2LQW A;  1PWT A;  2K6D A;  2K7A A;  3I5S A;  2D8J A;  1EFN A;  2GGR A;  2NUZ A;  5GJV B;  1NEB A;  2KXC A;  4CC4 B;  3M0P A;  2CT3 A;  2LCS A;  1SPK A;  4R0K A;  2JS0 A;  1PRM C;  3SHW A;  1M3A A;  3A98 A;  2ECZ A;  2EPD A;  3R6N A;  3VRZ A;  2ESW A;  2VVK A;  4DEY A;  3SEM A;  2F2W A;  5FW9 A;  1H8K A;  1OPL A;  2BTT A;  2DNU A;  2LMJ A;  4CC3 A;  1RLQ C;  5HCK A;  4RTW A;  3EG1 A;  4AFZ C;  2LJ3 A;  1Z9Z A;  3GBQ A;  3FJ5 A;  2EYZ A;  4M4Z A;  1WI7 A;  1QKW A;  3M0Q A;  3REA B;  3PVQ A;  4HVW A;  1K0S A;  2J7I A;  2RQW A;  2FRW A;  3C0C A;  1Y0M A;  1E7O A;  2JT4 A;  4OML A;  3THK A;  5I11 A;  1ZUY A;  2IIM A;  5IXF A;  4EIK A;  4JJD A;  1WYX A;  1WX6 A;  5GJW B;  2CUB A;  2A08 A;  3REB B;  1MV0 B;  4Z88 A;  5IHN A;  1ZUK A;  2FPD A;  4HCK A;  2KNB B;  2YUN A;  2K3B A;  2CDT A;  2KBT A;  3EHR A;  1QKX A;  1BK2 A;  4GLM A;  2VWF A;  2JXB A;  2AK5 A;  1Y57 A;  2EYW A;  4HXJ A;  2YUO A;  1ZUU A;  1NLP C;  2JMA A;  1W1F A;  1UG1 A;  4JZ3 A;  1YP5 A;  1SEM A;  3VS2 A;  2LNH B;  4AFS C;  3VS7 A;  2V1Q A;  2RF0 A;  3UAT A;  2YSQ A;  1AWX A;  1E6H A;  1CKA A;  2L3P A;  2RQT A;  2A37 A;  1NYG A;  3NGP A;  5IXB A;  1X6B A;  5FWC A;  2X3W D;  2XMF A;  2HSP A;  1GCQ A;  1GFC A;  1SRL A;  2RQR A;  1YWO A;  2FG0 A;  2ROL A;  2DVJ A;  2ENM A;  3EG0 A;  1I1J A;  1NLO C;  4CC7 A;  4D8K A;  1BB9 A;  2O2O A;  3I5R A;  1VYU A;  1X6G A;  2PZ1 A;  2J6O A;  1AEY A;  1UEC A;  1UE9 A;  4FSS A;  1HSQ A;  4IIO A;  1NM7 A;  4WCI A;  2JS2 A;  3NMZ C;  4GBQ A;  1M8M A;  4HVU A;  1K0X A;  2RQU A;  3VS1 A;  4J9I A;  4J9B A;  1J3T A;  2OAW A;  5IHI A;  3TVT A;  2AZS A;  1XOV A;  1ZLM A;  4F16 A;  4QT7 A;  1G2B A;  1YWP A;  3VS6 A;  2D0N A;  2YUP A;  3RBB B;  2DRK A;  1FMK A;  2GTJ A;  3H41 A;  2JTE A;  4JPB W;  2J06 A;  2DLP A;  2KRO A;  1YN8 A;  2RMO A;  2YT6 A;  2CUD A;  4OMP A;  1AWJ A;  1GL5 A;  1T0H A;  1OOT A;  1GRI A;  4Z89 A;  1ZX6 A;  2ROT A;  5FWB A;  1M30 A;  2F2X A;  1X2K A;  2AKL A;  1U06 A;  2CH4 W;  1OV3 A;  2L3S A;  1WA7 A;  2DL3 A;  3CQT A;  1BBZ A;  2L2P A;  4JZ4 A;  3VS3 A;  2JM8 A;  2DL4 A;  1SHF A;  4JJB A;  1UDL A;  1AZE A;  2GTO A;  2DF6 A;  1B3Q A;  1WIE A;  2FPF A;  1OEB A;  2P4R A;  1GCP A;  2J05 A;  1ZBJ A;  2LJ0 A;  4RTU A;  2O9V A;  1K1Z A;  2BZX A;  1AVZ C;  2ABL A;  2SEM A;  2PTK A;  1NG2 A;  1UFF A;  2KT8 A;  2H8H A;  1I0C A;  2O9S A;  2W10 A;  2HBW A;  4K11 A;  4LNP A;  2LP5 A;  1WXT A;  3H0I A;  2ED1 A;  2KEA A;  2YUQ A;  2L0A A;  2GNC A;  1GBQ A;  1X2Q A;  3O5Z A;  1UJ0 A;  2K9G A;  2O31 A;  1Z9Q A;  2MCN A;  4F17 A;  2G6F X;  2KRS A;  5IH2 A;  2C0I A;  2DRM A;  2FEI A;  3TSZ A;  2GBQ A;  2QDL A;  1UHC A;  5IHK A;  2KGT A;  2DMO A;  1WDX A;  2VKN A;  2K2M A;  4OMQ A;  2NWM A;  1TUD A;  2KRN A;  2LQN A;  1YNZ A;  3JV3 A;  1AZG B;  2EW3 A;  3VS4 A;  1RI9 A;  2EGC A;  2JM9 A;  1KSW A;  3H0F A;  1RLP C;  1ABQ A;  1S1N A;  2M51 A;  2DJQ A;  3RNJ A;  1U5S A;  2BZ8 A;  4Y92 A;  1M27 C;  1VA7 A;  1N5Z A;  1H92 A;  2DA9 A;  4RTT A;  2DL7 A;  1AOJ A;  2D8H A;  3PVL A;  1UHF A;  2DE0 X;  3EGU A;  2K79 A;  2GQI A;  4DEX A;  2OI3 A;  5EC7 A;  5I22 A;  2ED0 A;  2L3Q A;  3H0H A;  4Z8A A;  1W70 A;  1PHT A;  3I9Q A;  5L23 A;  1QLY A;  4OMM A;  2OJ2 A;  1PKS A;  4OMN A;  1NYF A;  4OMO A;  2HEQ A;  1VYT A;  2A36 A;  1K76 A;  1SSH A;  1JXO A;  2RPN A;  1WLP B;  1T3S A;  3UA6 A;  1YCS B;  4AFU C;  2EVR A;  1UGV A;  2DL5 A;  3TSW A;  3NPF A;  4LE9 A;  2KYB A;  3EHQ A;  3ZL7 C;  4CC2 A;  1QCF A;  1QWE A;  4AG1 C;  2DBK A;  2V1R A;  2EYX A;  1UJY A;  1KIK A;  1X43 A;  1A0N B;  1GBR A;  1PKT A;  1B07 A;  1CSK A;  2FO0 A;  1K9A A;  4J9G A;  2D1X A;  1AD5 A;  4LUD A;  2JW4 A;  1G83 A;  2EYY A;  1KFZ A;  1U3O A;  2CSQ A;  2C0T A;  2FRY A;  4RUG A;  2KRM A;  4RTV A;  1QWF A;  1VYV A;  1JQQ A;  1X27 A;  1ARK A;  4KRT A;  1PRL C;  2X3X D;  4HVV A;  1BU1 A;  2EGA A;  1JO8 A;  1JXM A;  3ULR B;  4J9E A;  1X69 A;  1TG0 A;  1V1C A;  2EBP A;  2CH4 A;  3M0R A;  4J9D A;  1AWW A;  2FPE A;  3VS5 A;  3PE0 A;  4RTY A;  2DM1 A;  1M3C A;  2HCK A;  2AKK A;  4F14 A;  1OPK A;  1K4U S;  1HD3 A;  3VRY A;  1W6X A;  1T3L A;  2RQV A;  1TUC A;  4IIM A;  4LUE A;  1HJD A;  1WXU A;  4RTX A;  2E5K A;  2KT1 A;  2LZ6 B;  2EKH A;  1MV3 A; 
#chains in the Genus database with same CATH topology
 1SF9 A;  2KY9 A;  3QWY A;  4LDW A;  1H3Z A;  4E7J A;  4EMG A;  1U1T A;  4E6R A;  4PJN A;  1OI1 A;  1MNE A;  2KE9 A;  1VQ7 A;  1QW1 A;  4PL6 A;  3OS2 A;  4QQ6 A;  2MIO A;  4C8Q B;  4M77 F;  2YRV A;  2DXU A;  4ZN3 A;  3CBO A;  1VQN T;  2CSI A;  2R58 A;  3RES A;  4M78 B;  3QKJ A;  3MCA B;  4M78 D;  2HQX A;  3ER0 A;  4M7D E;  3JB9 H;  3EG2 A;  3UA7 A;  3JB9 J;  4ZNX A;  1NPP A;  3M9Q A;  4M7D A;  5ECA A;  2RN8 A;  3JCM c;  3QWX X;  4D6W A;  2F69 A;  4PK4 A;  2KR3 A;  2HDA A;  4ZGJ B;  2QA4 Q;  4E7I A;  3LH5 A;  2ZAE A;  2OAU A;  1VQ4 Q;  2H3J A;  2DBM A;  2YDL A;  5GAN 4;  2EQI A;  2BIV A;  3M0U A;  3EGD A;  4J6X A;  1N8R R;  1PWT A;  3SWN A;  1M1K U;  2K7A A;  3I5S A;  2FYK A;  2GGR A;  3C12 A;  1NEB A;  2ZPI B;  1YJW T;  3M0P A;  4LDX A;  1SPK A;  4PFO A;  3SHW A;  1PRM C;  1M3A A;  1UEB A;  3A98 A;  1M2O A;  4FYW B;  2DTO A;  3EH2 A;  1K8A R;  4OMF B;  3H6Z A;  2F2W A;  3QBY A;  3CCR Q;  1X6O A;  2COZ A;  2K5I A;  2BTT A;  2LMJ A;  3HSB A;  4DBR A;  4CC3 A;  5HCK A;  4M7A E;  5GAM e;  2KQW A;  1LOJ A;  4M77 C;  5GAN 7;  5GAN g;  3GBQ A;  2RHX A;  3QYH B;  3FJ5 A;  1QCN A;  2VB6 A;  3REA B;  2X51 A;  4M77 G;  3J80 E;  1DJ7 B;  2LT1 A;  2QAS A;  1K0S A;  3CCM Q;  3I55 A;  2E41 A;  2K3X A;  4PJL A;  1VQ9 Q;  2RQW A;  2FRW A;  1G3S A;  5GAO l;  1E7O A;  4EIK A;  4II1 A;  4E7H A;  1AHJ B;  1MV0 B;  1WQW A;  1K9M U;  2IPO B;  4NOY A;  4OVA A;  2XU8 A;  1VQ9 T;  2YUN A;  5IAY A;  1YJN T;  1VQL A;  2OTL Q;  3FEO A;  4PJO B;  5CR2 A;  2M1H A;  2D0Q B;  9ATC B;  3CME A;  1UG1 A;  4WF2 A;  1V76 A;  1D0Z A;  2P84 A;  3VS2 A;  4XTZ A;  3CCQ A;  4AFS C;  3VS7 A;  1QVP A;  4ZTF A;  2RF0 A;  3UAT A;  2YSQ A;  1AWX A;  1CKA A;  3A1P A;  1NYG A;  5FWC A;  3HRT A;  1EIF A;  2Y4Y A;  3JCM d;  1GFC A;  3INZ A;  3DLL A;  1YWO A;  3QHS A;  2DVJ A;  4GY5 A;  3QZ9 B;  3M53 A;  2O2O A;  5J3B A;  5AYF A;  4NL3 A;  3EGD B;  1JRI A;  1U8R A;  4FSS A;  3JCM P;  3J7A F;  3I56 Q;  4M75 B;  4JLG A;  1K0X A;  3E2U A;  2Y4X A;  5GMK l;  3V7R A;  1WJQ A;  4E7K A;  1KC8 C;  2MYS A;  4J9B A;  2E12 A;  2ZZD A;  3JCM V;  4LD9 K;  2OAW A;  1J3T A;  2EQU A;  4C5I A;  3RER A;  2KK4 A;  4PFP A;  4GLK A;  4QT7 A;  1YBY A;  5LJ5 f;  2YUP A;  1WQ7 A;  2EAY A;  4JRK A;  3CCV Q;  4JPB W;  2QEX A;  4NS5 A;  3A8H B;  2HQH A;  2XKO C;  3SB2 A;  1KG1 A;  4KH0 B;  1GL5 A;  1OOT A;  4XU0 A;  4EMK C;  1GRI A;  1WHL A;  4XTV A;  1QP2 A;  1Q82 C;  3OS1 A;  2CH4 W;  1BBZ A;  5A0G A;  1SHF A;  4JJB A;  1UDL A;  1BKB A;  4C92 C;  3H8Z A;  1B3Q A;  1VQ9 A;  2CP5 A;  1N27 A;  2J05 A;  2RI2 A;  5I2M A;  4RTU A;  1V29 B;  2PTK A;  2DVE A;  2HBW A;  2HQE A;  3KUF A;  1M90 C;  1U1S A;  2DD5 A;  2MI6 A;  1VQ7 T;  1WJR A;  1WPY A;  1S72 T;  1GBQ A;  1FMW A;  3O5Z A;  1O9S A;  1Z9Q A;  4F17 A;  2DRM A;  3CC7 T;  1VQM T;  2EJG A;  2KAF A;  4ATO A;  2E10 A;  3FLG A;  2QDL A;  2KGT A;  1WDX A;  5GMK i;  2RK1 A;  2PVO B;  2VKN A;  3CCR A;  1VQO A;  2NUT A;  2VGN A;  1M5Q 1;  1ZBX A;  5AT1 B;  2NWM A;  3GOX A;  2NYS A;  2KRN A;  1Y96 B;  4XU3 A;  2I2L A;  3GNG A;  2EGC A;  2JM9 A;  1YIT Q;  5J26 A;  3E19 A;  1XJW B;  2DJQ A;  1K8A U;  3CCM A;  4HT8 A;  2KMT A;  2HD0 A;  2DA9 A;  4RTT A;  3JAM E;  5HK3 A;  4M75 D;  1Y96 A;  3EGU A;  1PM3 A;  3JCM h;  2GQI A;  4HCZ A;  4DEX A;  2NUP A;  4DQ2 A;  1IZ6 A;  1RAA B;  2LCC A;  4JDS A;  5GAN d;  3UT1 A;  2PU9 B;  3OS0 A;  1RI0 A;  2OTL A;  1G5V A;  2WSC E;  1QLY A;  1YJN A;  1YHQ T;  4TVR A;  4OMN A;  2XI9 A;  5D6W A;  2A36 A;  1K76 A;  1JXO A;  1P92 A;  2M16 A;  2HSE B;  3CD6 T;  2QA4 A;  1K9M C;  1YCS B;  4FT4 A;  2EVR A;  3HTR A;  3TSW A;  3NPF A;  1ZSZ C;  3EHQ A;  1KQS S;  2X9H A;  1QWE A;  2JNG A;  4OF1 A;  1UJY A;  3G4S Q;  1KIK A;  1A0N B;  4A4F A;  1K9A A;  2XDD A;  4XU2 A;  5A0D A;  4LXC A;  3CMA A;  1N6A A;  1PD0 A;  4DBQ A;  4C8Q F;  4RTV A;  1QWF A;  1WNL A;  1QVG S;  4A4E A;  2CYZ B;  4KUI A;  4M78 A;  2QQA A;  3I56 A;  2OTJ A;  2CP7 A;  2D6F A;  4C5G A;  4FL6 A;  4HVV A;  3OYF A;  5IN1 A;  1BU1 A;  2P0Q A;  1XTD A;  1YJW A;  4FSX A;  1Q95 G;  4M78 C;  1TG0 A;  1V1C A;  2VXF A;  3RIR A;  3CCS A;  1G8X A;  2CH4 A;  3M0R A;  4J9D A;  4C92 D;  1D1B A;  1UB4 A;  1VQO T;  4KGV B;  5KYX B;  3JB9 F;  4OB0 B;  3HL8 A;  3CC7 A;  2C06 A;  1VQ8 A;  2AKK A;  2KVQ G;  2XID A;  2KDS A;  2KSS A;  2RQV A;  1HYO A;  2EQK A;  1KQ1 A;  3RMS A;  4C5E A;  3MP8 A;  8AT1 B;  2KT1 A;  2ATC B;  2RA2 A;  1NEG A;  1I4K 1;  2CP2 A;  2FZC B;  3I55 T;  1M9S A;  4JJN K;  4ESR A;  2NUP B;  3M0T A;  1LJO A;  2Y90 A;  1AWO A;  3M54 A;  4RTZ A;  2RNA A;  3CME Q;  4AG2 C;  1I8F A;  4AFQ C;  3M59 A;  2V8J A;  1QQJ A;  4XTW A;  2PNI A;  3G71 T;  2OTL T;  4MMK A;  2X4Y A;  1VQ6 T;  3FIF A;  1SG5 A;  1Q86 U;  3G6E Q;  4JJC A;  1KD1 U;  3IQL A;  3QII A;  3PTA A;  3U23 A;  4QQD A;  1KHC A;  2MOX A;  2V8K A;  4BAC A;  3P8H A;  1UTI A;  2B86 A;  3C94 A;  3OW2 A;  4C8Q G;  4C92 F;  2HKN A;  2M0Y A;  4L6V 5;  4PJO G;  2LX7 A;  1LCK A;  1OZ2 A;  1WXB A;  3ME9 A;  2I0N A;  2G3R A;  4M75 C;  1T0J A;  5CCA A;  1VQM A;  2LJ1 A;  1WHJ A;  1H3H A;  1RUW A;  4DOV A;  1M3B A;  5KYY B;  3CCJ T;  2E5Q A;  3AHU A;  2J6K A;  3V7C A;  1JEG A;  2JUF A;  2MWP A;  2A28 A;  4PLI A;  2K6D A;  1YIT T;  5GJV B;  2DXT A;  4C8Q E;  3CCV A;  3OQ5 A;  3CCE Q;  4J6Y A;  1Y07 A;  2QI2 A;  5GAO r;  4FYY B;  2CP0 A;  1X01 A;  2ESW A;  5IT9 E;  2VVK A;  3SWN B;  3L2V A;  1GXI E;  3TCJ A;  2R5M A;  2OTJ T;  4P5N A;  4QVZ A;  1RLQ C;  4RG2 A;  1Q7Y U;  3S3O A;  3EG1 A;  3EFO B;  1Z9Z A;  1C1A A;  1RL2 A;  1WI7 A;  1RAE B;  3VYH B;  1RAF B;  3PFS A;  4HVW A;  3JB9 I;  2EQM A;  1TS9 A;  2F5K A;  1XQH A;  1RAD B;  1IXD A;  2J7I A;  4C92 E;  5GAM g;  2JZ2 A;  1D0Y A;  1KQS P;  1Y0M A;  4OML A;  3THK A;  3FRN A;  1ZUY A;  3QDR B;  5DLQ E;  3JCM J;  1WYX A;  1LVK A;  1WX6 A;  2CUB A;  2A08 A;  1W2B S;  3M57 A;  3CCL A;  3PMT A;  1UGQ B;  4DBF A;  2KNB B;  5EG2 A;  4B9X A;  1QKX A;  3DLM A;  1YI2 Q;  1I5L A;  3A8O B;  1IRX A;  2DTI A;  2L89 A;  4FW1 A;  1Q82 R;  4GLM A;  3JCM f;  2QEX Q;  2DEQ A;  1M2V A;  2EYW A;  4HXJ A;  2MAM A;  1ZUU A;  1WGS A;  1NLP C;  2QK0 A;  2B8A A;  1SEM A;  3QO3 A;  2PUO B;  1JBM A;  4QQG A;  2RHU A;  4BY6 C;  4M78 G;  4F7U G;  2L3P A;  1VQ4 A;  2RQT A;  2FZG B;  1MMA A;  3L2Z A;  1BI2 A;  5IXB A;  5CIU A;  3HHT B;  4E47 A;  3X26 B;  2XMF A;  1GCQ A;  1YJW Q;  1SRL A;  4JS5 A;  2E3H A;  3E1S A;  2WAC A;  2ROL A;  3EG0 A;  1G3Y A;  4BI8 B;  3L2Q A;  1ZHI A;  5CAI A;  3I5R A;  2A3L A;  1UEC A;  5GAN 2;  3WVE B;  2K5L A;  5I2S A;  1NM7 A;  2JS2 A;  8ATC B;  4JRP A;  2RHZ A;  4GBQ A;  1YIJ A;  2XK0 A;  2RQU A;  4OGC A;  3EAE A;  4EMH A;  3VS1 A;  4J9I A;  3GLX A;  2DZ9 A;  5IHI A;  2JTM A;  2XD0 A;  4M75 A;  1XOV A;  2K3Y A;  2E3I A;  3VS6 A;  3RBB B;  2DRK A;  1FMK A;  2DJZ A;  4KBM B;  2J06 A;  2P0K A;  4IKF A;  1BCO A;  1OZ3 A;  1M4Z A;  3FDR A;  2DER A;  1K73 U;  2RHY A;  1T0H A;  3L42 A;  3M5A A;  3LYI A;  1ZX6 A;  2ROT A;  5FWB A;  3OYB A;  2X4W A;  4LDY A;  3OMC A;  1R0B G;  3G4S A;  2AKL A;  2DK3 A;  3DB4 A;  1OV3 A;  2L3S A;  3BE3 A;  2DL3 A;  1VQ5 Q;  3JB9 G;  1VQP A;  2LRQ A;  2L2P A;  4M77 D;  3LWI A;  2EIF A;  2DF6 A;  5KYW B;  1B7T A;  4A53 A;  2FPF A;  2P4R A;  1GCP A;  1YJ9 Q;  5FU7 C;  4ZGD B;  2LJ0 A;  2QAZ A;  2RO0 A;  2BZX A;  3AT1 B;  3MP1 A;  4M75 G;  1AVZ C;  2SEM A;  4R55 A;  3SFM A;  1SKU B;  1I0C A;  5GAO q;  2W10 A;  2LP5 A;  5KCH A;  2DIQ A;  3EG9 B;  2KEA A;  2GNC A;  4L5G A;  3CD6 Q;  2K9G A;  3OYN A;  3OYY A;  1NBE B;  2MCN A;  4BI4 A;  1VQ7 Q;  5FRN A;  2ZPB B;  2PUK B;  3TSZ A;  1PC0 A;  4M7D G;  4F04 B;  5J39 A;  1UHC A;  4FM4 B;  2MWO A;  3OYC A;  2HL5 C;  2K2M A;  4J6W A;  2DO3 A;  1EX4 A;  4MDW A;  4DBH A;  3V8L A;  5LJ3 g;  3JV3 A;  2E6N A;  3LGF A;  1YFN A;  4PKC C;  1W2B A;  5CK9 A;  3SD4 A;  1ABQ A;  1D3B B;  3RDV A;  1PSF A;  3LX7 A;  2YWW A;  2H3E B;  4PJJ A;  3S3N A;  5C0M A;  5GMK h;  3RKY A;  2OTJ Q;  3TEE A;  3OYD A;  2D8H A;  2E64 A;  4XK8 E;  2EQJ A;  1M90 U;  1Q7Y C;  4DOW A;  1OU9 A;  3CCU Q;  5EC7 A;  5I22 A;  3FJP A;  3CXC A;  4ANJ A;  4KH1 B;  1K9M R;  2BE7 D;  4Z8A A;  1W70 A;  2X4J A;  2QQ9 A;  1PHT A;  2COW A;  3I9Q A;  5L23 A;  2RJE A;  2JJ9 A;  2EWN A;  3MPU B;  4J83 A;  3WVD B;  2EKO A;  1OQK A;  1PKS A;  4M7A G;  1NYF A;  2BE9 B;  3CCU T;  2HEQ A;  3OYK A;  1SSH A;  4EMK B;  5A2Q E;  1WLP B;  1VQK Q;  1VQ8 Q;  3Q1J A;  3UA6 A;  4AT1 B;  4QW2 A;  2JOY A;  2HBP A;  5LJ5 h;  2QXF A;  2DL5 A;  4NL2 A;  2GFU A;  4CC2 A;  1QCF A;  3CME T;  2V1R A;  2K57 A;  3LW5 E;  3VJP A;  1IHW A;  3UDC A;  1X43 A;  3QYG B;  4RCB A;  1B07 A;  4UC4 A;  1CSK A;  1IGU A;  2LX9 A;  2LCL A;  4JUV A;  5LJ3 j;  5GAN 3;  3MP6 A;  4RG8 A;  4LUD A;  4M7A C;  1IB8 A;  4IUU A;  2C0T A;  4RUG A;  4A4G A;  2LC4 A;  1WHH A;  1VYV A;  1JQQ A;  4FIB A;  1X27 A;  4F7U A;  3EGX B;  1Q81 C;  1ZSZ A;  2X3X D;  2E4H A;  5D6X A;  1MGQ A;  2LQ8 A;  4WTO B;  1JO8 A;  1JXM A;  2RJF A;  2DKG A;  3ULR B;  2R57 A;  3JCM Q;  3OYL A;  2HNI A;  4ELY C;  2EBP A;  4RTY A;  3CCJ A;  2HZY A;  4ZN1 A;  3HRS A;  1QVF S;  4M78 F;  1K4U S;  1OPK A;  3BY7 A;  1B34 A;  1IRE B;  2O4X B;  2LZ6 B;  1IGQ A;  5CKB A;  3MKD A;  4V2S A;  3OYJ A;  1JU5 C;  3OS5 A;  1YI2 A;  3VS0 A;  1UUE A;  3ZFJ A;  3GIB A;  2CRE A;  1EZZ B;  4X1V A;  2DX1 A;  1VQ5 A;  1SHG A;  1VQN A;  3QZ5 B;  2DIG A;  2LNV A;  4BE2 A;  2OX7 A;  2CT4 A;  3MEA A;  1UGR B;  4BD3 A;  1OX8 A;  2V26 A;  4J9C A;  2VUB A;  2ZPF B;  1GFD A;  1RAH B;  3EFR A;  4X9D A;  2DIL A;  3M0S A;  4M78 E;  2O4X A;  2QQR A;  2ZPE B;  1ABO A;  1MMN A;  3V8K A;  3I35 A;  2BZY A;  1ZSG A;  4N4G A;  5FU6 B;  3CCU A;  4KGX B;  3E9G A;  5CKF A;  2O88 A;  1K73 C;  3GP8 A;  4J9F A;  2C0O A;  2DET A;  3P8B B;  1E6G A;  3X28 B;  2W0Z A;  3X24 B;  3UPU A;  1GCQ C;  4D8D A;  5FRM A;  3ZBD A;  4E7L A;  4ORZ A;  1W2B P;  3M4G A;  4A4H A;  1KJW A;  1MUZ A;  1PNJ A;  3DKM A;  1CKB A;  1VQ4 T;  4J9H A;  2YRC A;  1S72 Q;  3SDZ A;  2KXD A;  2Z0W A;  1KC8 R;  3A8M B;  3OBY A;  1HK9 A;  4A63 B;  4BE0 A;  1SSF A;  3QPH A;  2LQW A;  5LJ5 j;  1BI1 A;  3CCR T;  1PSE A;  3QXE B;  3OYI A;  2D8J A;  2NUZ A;  7AT1 B;  3RKX A;  2CT3 A;  2RH2 A;  4R0K A;  3HRU A;  2JS0 A;  4XTU A;  4Y91 A;  1KK7 A;  3VRZ A;  1BI3 A;  1M1K C;  1W4S A;  1OPL A;  2CP6 A;  3QDF A;  4RTW A;  2MF2 A;  4MZP A;  4RCC A;  4AFZ C;  4BY6 B;  2LJ3 A;  4RMO A;  2EYZ A;  4M7A D;  3L2W A;  3M0Q A;  4MZT A;  3PVQ A;  1TSF A;  3V7S A;  5GAN 8;  3I55 Q;  4IUV A;  1QVF A;  3VUB A;  3CC2 T;  3C0C A;  4Q5W A;  1I81 A;  1D1C A;  1FWZ A;  2QYZ A;  2IIM A;  5IXF A;  3CPW S;  5GAN f;  5GJW B;  2CZ0 B;  4A54 A;  3MO8 A;  3REB B;  2L8D A;  4Z88 A;  1ACM B;  1M2V B;  4F7U F;  3G7Z A;  2K3B A;  4VUB A;  2RJC A;  2XDP A;  3G71 Q;  3LWH A;  3CD6 A;  4QVD A;  2JXB A;  2QG9 B;  5KYU A;  1Y57 A;  3A8G B;  2YHT A;  2YUO A;  3JB9 D;  1W1F A;  4JZ3 A;  1YP5 A;  1TU0 B;  3JCM W;  2V1Q A;  3PNW C;  5LL6 S;  3G1J A;  1E6H A;  3HP9 A;  2A37 A;  1X6B A;  2F1L A;  3CMA T;  3JRZ A;  2HSP A;  2M0O A;  5HKC A;  3EFO A;  5FRO A;  2RQR A;  1JJ2 A;  3OW2 P;  2FG0 A;  1K8A C;  2ENM A;  2XDB A;  1NLO C;  4C8Q D;  4CC7 A;  4X34 A;  4D8K A;  4HA8 A;  3A8L B;  4HT9 A;  1X6G A;  4FW2 A;  1VUB A;  3CC4 T;  3CCE A;  2GCX A;  3CCJ Q;  1AEY A;  2BKD N;  3CC2 A;  1MND A;  1VOM A;  1UE9 A;  1YJ9 A;  4FYX B;  3PIP A;  2X4X A;  1Y7X A;  5L8R E;  3X25 B;  3GF5 A;  3QJ6 A;  2A7Y A;  3NMZ C;  4KUD K;  4C5H A;  1LPL A;  1VQK T;  2DXB A;  4C0D B;  4LD6 A;  2RHI A;  2O01 E;  3TVT A;  2YXY A;  4ELZ C;  1ZLM A;  4XTX A;  4F16 A;  1HXD A;  2LT4 A;  2D0N A;  2EJF A;  2GTJ A;  3H41 A;  2JTE A;  3CMA Q;  1YN8 A;  4A4K A;  2RMO A;  1YIJ T;  2CUD A;  1TH7 A;  4OMP A;  3M4Y A;  1BI0 A;  4M77 A;  1D09 B;  1N9S A;  1NE8 A;  2GQV A;  3RUX A;  4Z89 A;  1MHN A;  3VUZ A;  5LJ5 g;  1BYM A;  1TTH B;  5GAO p;  1X2K A;  4M75 F;  1H64 1;  1U06 A;  2VC8 A;  2YLB A;  2RK2 A;  1WA7 A;  4CI0 C;  4JZ4 A;  1M8V A;  2LDM A;  4OB2 B;  3VS3 A;  3VYG A;  2JM8 A;  4PJO D;  2DL4 A;  4ZGE B;  1AZE A;  2RI5 A;  4KT0 E;  4M77 B;  1WIE A;  5CKE A;  5KYU B;  1ZBJ A;  3CBM A;  2O9V A;  4JLI A;  1S72 A;  5LJ5 d;  3T9N A;  2VXE A;  2ABL A;  1OUL A;  3G4S T;  5KYN A;  1NG2 A;  4FYV B;  3RMQ A;  2AIR B;  4K11 A;  3CEY A;  1WXT A;  2PVG B;  4J8O A;  3H0I A;  2XHC A;  3OMG A;  4ME7 A;  4RKU E;  4M77 E;  4M7D C;  1UJ0 A;  1KQ2 A;  3OYH A;  1YI2 T;  2G6F X;  2KRS A;  4IUR A;  1UGP B;  2FEI A;  1M1G A;  2GBQ A;  3UWN A;  1KC8 U;  2JVV A;  1OYX A;  5IHK A;  4KUL A;  3RKW A;  1NJI R;  3QJY A;  4HCB A;  1TUD A;  2LQN A;  3G6E A;  5GMK e;  4CRI A;  1JJ2 P;  1C6V X;  3CCE T;  2EW3 A;  3VS4 A;  1M1F A;  1RI9 A;  5DY9 A;  5LJ3 d;  1VQ6 Q;  4B9W A;  1VQN Q;  1YIT A;  1S1N A;  2M51 A;  3CPW A;  1JJ2 S;  3PGG A;  5GAN j;  1G3W A;  1U5S A;  2BZ8 A;  2DD4 A;  1VA7 A;  1N5Z A;  1NJI U;  2XG8 D;  2NUT B;  2YRD A;  2DL7 A;  3PVL A;  2WSE E;  3WXM B;  5GAN h;  2DE0 X;  2AHJ B;  1QCO A;  4C0F A;  1YHQ A;  2OI3 A;  2RD1 A;  3CBP A;  2ED0 A;  4C8Q C;  3QUI A;  3OSS C;  3H0H A;  1VQL T;  2K2V A;  3EG9 A;  1I5O B;  4EPC A;  1PCX A;  3J81 E;  5KH6 A;  3CCQ T;  2MMP A;  3OYM A;  3VU3 C;  4MML A;  1T3S A;  1VQ5 T;  1UGV A;  4LE9 A;  2KYB A;  3ZL7 C;  1RAG B;  2DBK A;  2EYX A;  3E9F A;  5DLO A;  3BDU A;  2K5F A;  1GBR A;  4PJO F;  2FHD A;  4J9G A;  3CPF A;  4Y28 E;  2HMA A;  3TQ7 P;  4BDY A;  2JW4 A;  4BDZ A;  3OB9 A;  1R0C B;  1U3O A;  2FRY A;  2KRM A;  1TOV A;  1ZA2 B;  3OYA A;  3LLR A;  2LTO A;  1VIE A;  1ARK A;  4KRT A;  3VKI A;  2ZPH B;  4HKE A;  2LVM A;  3M56 A;  4N4H A;  2EGA A;  2AT1 B;  4C92 A;  3TU4 K;  2DAQ A;  3NTI A;  3V8J A;  3I56 T;  2QTX A;  4MZM A;  3H9N A;  1AWW A;  3MEV A;  3VS5 A;  2DZC A;  4OB1 B;  2DEU A;  1UGS B;  3CC4 Q;  1M3C A;  1B34 B;  3L1A A;  5KE3 A;  1HD3 A;  3N5B B;  3JCM e;  1PG5 B;  2E70 A;  3C95 A;  1BCM A;  1TUC A;  4IIM A;  4EMK A;  1Y71 A;  1HJD A;  1WXU A;  2D9T A;  2EKH A;  1MV3 A;  1NJI C;  3G6E T;  2CZ6 B;  1I07 A;  4M7D D;  4AMC A;  3PMI A;  3CPW P;  2WSF E;  3EG3 A;  5LJ5 e;  2DL8 A;  1OX9 A;  1RAC B;  3OYE A;  4LN2 A;  5A0L A;  2KYM A;  1TUG B;  2CS7 A;  2RI3 A;  2A0F B;  5KCO A;  3CXC S;  3O8V A;  3OSV A;  1WFW A;  3EFS A;  3KFV A;  6AT1 B;  4MDX A;  1TWB A;  1AT1 B;  1OU8 A;  3CXC P;  4OGE A;  2JMC A;  2NLU A;  1Q82 U;  3OA6 A;  1YHQ Q;  2F2V A;  3TRE A;  2MPX C;  2AZV A;  1SRM A;  5KE2 A;  3NHN A;  4IUT A;  3CC2 Q;  2ZPG B;  1VQM Q;  3OW2 S;  3FC3 A;  2VAS A;  4C0D C;  5GAM d;  2GF7 A;  1FMV A;  2EGE A;  3GNF B;  1BIB A;  2LQK A;  1QVG A;  4M7D B;  4IUP A;  1F1B B;  4N0A A;  4LDV A;  3UF4 A;  2RM4 A;  2QTV A;  1QMC A;  4E7Z A;  1FYN A;  2J6F A;  1Q7Y R;  4PJO A;  2DYB A;  1IO6 A;  2SRC A;  2JTF A;  3HFN A;  1VQP Q;  1EFN A;  1LNX A;  1YJ9 T;  2KXC A;  4CC4 B;  2BUD A;  2LCS A;  4O5V A;  2ECZ A;  2EPD A;  3R6N A;  4IUQ A;  4DEY A;  1WHM A;  3SEM A;  3LH0 A;  1IHV A;  5GAN 5;  1N9R A;  5FW9 A;  2V8I A;  1H8K A;  2DNU A;  2QDY B;  2FL7 A;  5D7U A;  3VV0 A;  2ZGW A;  1X75 C;  4M4Z A;  3C4S A;  4E2F B;  3JCM X;  4HCC A;  1QKW A;  3NTK A;  4F7U E;  3NFC A;  2M02 A;  1VQ8 T;  1PD1 A;  4FU6 A;  3CCL T;  4XTY A;  3MEU A;  4Z02 A;  3PIO A;  2JT4 A;  3KXT A;  5I11 A;  1D1A A;  3S6W A;  3JCM g;  4JJD A;  4XQ3 A;  4C0G A;  3L2U A;  2E6Z A;  5IHN A;  2L5Q A;  1ZUK A;  2QGF B;  3X20 B;  3CCL Q;  2FPD A;  4HCK A;  5GAM f;  2JN0 A;  2CDT A;  2KBT A;  1N8R C;  3EHR A;  1Q86 R;  1BK2 A;  2QA4 T;  2CZ7 B;  3SWN C;  5CKH A;  2VWF A;  3F70 A;  5HK0 A;  2AK5 A;  1KD1 R;  3HPW A;  3MJX A;  2JMA A;  4C92 G;  4L59 A;  1FX7 A;  2LNH B;  2P4T A;  5M9O A;  4JRQ A;  4N4I A;  1FXX A;  1WHG A;  5FLX E;  2DYI A;  3NGP A;  3ZEH A;  2X3W D;  4OP0 A;  1O75 A;  5GMK j;  2YLC A;  5KYY A;  1KHI A;  1BIA A;  1I1J A;  2EJ9 A;  2RJD A;  5GAM h;  5FU7 B;  1TXQ A;  1BB9 A;  4M7D F;  1VYU A;  2PZ1 A;  2J6O A;  1NPR A;  4BI3 A;  4PJO C;  4B6M A;  1HSQ A;  1NZ9 A;  4IIO A;  1G3T A;  4WCI A;  1M8M A;  4HVU A;  4N0A C;  1YIJ Q;  4J5Y A;  2VGM A;  5GMK m;  3MET A;  3CCV T;  3BDL A;  2X35 A;  3A5Z B;  2AZS A;  4BB7 A;  2CP3 A;  1YCY A;  3S3M A;  1G2B A;  1YWP A;  1VQL Q;  4ZTJ A;  2DLP A;  2CKK A;  3PT9 A;  2KRO A;  4DA4 A;  3CCM T;  2YT6 A;  1R8O B;  1AWJ A;  4BE1 A;  2KI7 A;  5CQY A;  1M30 A;  5HY6 A;  4C0Z A;  4PJM A;  4XAX B;  2F2X A;  2K4Y A;  2CGH A;  4XU1 A;  2HKQ B;  5GAN 6;  3G71 A;  2FVU A;  4FT2 A;  3CCS T;  3CQT A;  4M7A F;  1VQ6 A;  1YJN Q;  5C6S A;  4PNO A;  4J7F A;  2GTO A;  2F5T X;  3D7S B;  4PFZ A;  5CVI A;  1OEB A;  2DPP B;  1VQP T;  5CQX A;  1D0X A;  3JCM b;  1K1Z A;  5D6Y A;  1UFF A;  2KT8 A;  2H8H A;  2O9S A;  2VYT A;  4LNP A;  2QQS A;  2ED1 A;  1MMD A;  2YUQ A;  2L0A A;  4BUG A;  1WZO A;  1X2Q A;  3URG A;  2O31 A;  2MK5 A;  3GPL A;  5LJ3 f;  5GAO m;  5I21 A;  2VV5 A;  2C0I A;  5IH2 A;  1N8R U;  3EGX A;  5LJ3 e;  1M1K R;  4X9C A;  3L2R A;  1WHK A;  2EYQ A;  2EFI A;  3CCQ Q;  2GFA A;  2DMO A;  4O6J A;  2HL3 A;  5FU6 C;  5CO7 A;  2QGG A;  4OMQ A;  4M75 E;  1VIF A;  4JRI A;  3ASK A;  1YNZ A;  1M90 R;  1AZG B;  2RB6 A;  3OYG A;  1KSW A;  2IG0 A;  3H0F A;  1JB0 E;  5GAN e;  3CCS Q;  1RLP C;  2ZCF B;  4PLL A;  3MEW A;  2L3R A;  4QKU A;  2E1H A;  1QVG P;  3RNJ A;  4E7S A;  3CC7 Q;  3OBW A;  4Y92 A;  1M27 C;  1H92 A;  2QEX T;  1AOJ A;  5GAM j;  4R56 A;  1UHF A;  2P0P A;  3HFO A;  1WJS A;  2K79 A;  3KBG A;  1K73 R;  1Q81 R;  4LDU A;  2QQB A;  2L3Q A;  3RR6 A;  2HAX A;  5GAO n;  1D3B A;  3QSU A;  3HKS A;  1XNI A;  2XIC A;  4FCY A;  4OMM A;  2OJ2 A;  5KYX A;  3OY9 A;  3EH1 A;  3CC4 A;  4PJO E;  3NTH A;  4OMO A;  4YTL A;  3JSC A;  1VYT A;  2RPN A;  3QG1 A;  1VQO Q;  3DB3 A;  5DM7 R;  4AFU C;  1VQK A;  1Q81 U;  2COY A;  5LJ3 h;  5KYW A;  1MMG A;  3M58 A;  4AG1 C;  3BW1 A;  2DTH A;  2M9U A;  3P8D A;  2PQW A;  1PKT A;  2FO0 A;  2FZK B;  2D1X A;  1AD5 A;  2E65 A;  1G83 A;  3MHX A;  1C0M A;  2EYY A;  1KFZ A;  2CSQ A;  1KD1 C;  3R6O A;  1RAB B;  4M7A B;  1Q86 C;  3LGL A;  2DXC A;  1PRL C;  1ZA1 B;  1RAI B;  1R77 A;  2CZ1 B;  2DFU A;  4EDU A;  3BFM A;  4J9E A;  1X69 A;  1QVF P;  2FB7 A;  2FPE A;  4C92 B;  3PE0 A;  4QVC A;  2DM1 A;  4KGZ B;  4JS4 A;  1ZQ1 A;  3FB9 A;  4J7I A;  4M7A A;  2HCK A;  2R5A A;  4F14 A;  1KQS A;  3VRY A;  4F7U B;  4C8Q A;  1ZSZ B;  1W6X A;  1T3L A;  2PVD B;  4LUE A;  4RTX A;  2IVW A;  1QP3 A;  2E5K A;  4OB3 B;  5CKD A;  3M55 A; 
#chains in the Genus database with same CATH homology
 1NEG A;  3QWY A;  1I07 A;  1JU5 C;  3EG3 A;  2DL8 A;  3VS0 A;  1UUE A;  2CRE A;  4LN2 A;  4X1V A;  2DX1 A;  1SHG A;  4E6R A;  4ESR A;  3M0T A;  2KYM A;  2KE9 A;  1AWO A;  2CT4 A;  4RTZ A;  2RNA A;  4AG2 C;  2MIO A;  1WFW A;  4AFQ C;  3KFV A;  4J9C A;  1GFD A;  2CSI A;  2PNI A;  2DIL A;  3M0S A;  2JMC A;  1ABO A;  4JJC A;  3I35 A;  2BZY A;  1ZSG A;  3IQL A;  3U23 A;  2F2V A;  2MOX A;  2O88 A;  1UTI A;  2AZV A;  2B86 A;  1SRM A;  3EG2 A;  4J9F A;  2C0O A;  3UA7 A;  2M0Y A;  1E6G A;  2LX7 A;  1LCK A;  4ZNX A;  2W0Z A;  3NHN A;  1GCQ C;  4D8D A;  1WXB A;  2RN8 A;  5ECA A;  4ORZ A;  2I0N A;  3QWX X;  1KJW A;  1MUZ A;  1PNJ A;  1T0J A;  1CKB A;  2LJ1 A;  4J9H A;  1H3H A;  2KR3 A;  2HDA A;  1RUW A;  2EGE A;  3LH5 A;  2KXD A;  3UF4 A;  1M3B A;  2DBM A;  2YDL A;  4A63 B;  2EQI A;  2J6K A;  1JEG A;  1FYN A;  2J6F A;  2A28 A;  3M0U A;  2DYB A;  1IO6 A;  2SRC A;  2LQW A;  1PWT A;  2K6D A;  2K7A A;  3I5S A;  2D8J A;  1EFN A;  2GGR A;  2NUZ A;  5GJV B;  1NEB A;  2KXC A;  4CC4 B;  3M0P A;  2CT3 A;  2LCS A;  1SPK A;  4R0K A;  2JS0 A;  1PRM C;  3SHW A;  1M3A A;  3A98 A;  2ECZ A;  2EPD A;  3R6N A;  3VRZ A;  2ESW A;  2VVK A;  4DEY A;  3SEM A;  2F2W A;  5FW9 A;  1H8K A;  1OPL A;  2BTT A;  2DNU A;  2LMJ A;  4CC3 A;  1RLQ C;  5HCK A;  4RTW A;  3EG1 A;  4AFZ C;  2LJ3 A;  1Z9Z A;  3GBQ A;  3FJ5 A;  2EYZ A;  4M4Z A;  1WI7 A;  1QKW A;  3M0Q A;  3REA B;  3PVQ A;  4HVW A;  1K0S A;  2J7I A;  2RQW A;  2FRW A;  3C0C A;  1Y0M A;  1E7O A;  2JT4 A;  4OML A;  3THK A;  5I11 A;  1ZUY A;  2IIM A;  5IXF A;  4EIK A;  4JJD A;  1WYX A;  1WX6 A;  5GJW B;  2CUB A;  2A08 A;  3REB B;  1MV0 B;  4Z88 A;  5IHN A;  1ZUK A;  2FPD A;  4HCK A;  2KNB B;  2YUN A;  2K3B A;  2CDT A;  2KBT A;  3EHR A;  1QKX A;  1BK2 A;  4GLM A;  2VWF A;  2JXB A;  2AK5 A;  1Y57 A;  2EYW A;  4HXJ A;  2YUO A;  1ZUU A;  1NLP C;  2JMA A;  1W1F A;  1UG1 A;  4JZ3 A;  1YP5 A;  1SEM A;  3VS2 A;  2LNH B;  4AFS C;  3VS7 A;  2V1Q A;  2RF0 A;  3UAT A;  2YSQ A;  1AWX A;  1E6H A;  1CKA A;  2L3P A;  2RQT A;  2A37 A;  1NYG A;  3NGP A;  5IXB A;  1X6B A;  5FWC A;  2X3W D;  2XMF A;  2HSP A;  1GCQ A;  1GFC A;  1SRL A;  2RQR A;  1YWO A;  2FG0 A;  2ROL A;  2DVJ A;  2ENM A;  3EG0 A;  1I1J A;  1NLO C;  4CC7 A;  4D8K A;  1BB9 A;  2O2O A;  3I5R A;  1VYU A;  1X6G A;  2PZ1 A;  2J6O A;  1AEY A;  1UEC A;  1UE9 A;  4FSS A;  1HSQ A;  4IIO A;  1NM7 A;  4WCI A;  2JS2 A;  3NMZ C;  4GBQ A;  1M8M A;  4HVU A;  1K0X A;  2RQU A;  3VS1 A;  4J9I A;  4J9B A;  1J3T A;  2OAW A;  5IHI A;  3TVT A;  2AZS A;  1XOV A;  1ZLM A;  4F16 A;  4QT7 A;  1G2B A;  1YWP A;  3VS6 A;  2D0N A;  2YUP A;  3RBB B;  2DRK A;  1FMK A;  2GTJ A;  3H41 A;  2JTE A;  4JPB W;  2J06 A;  2DLP A;  2KRO A;  1YN8 A;  2RMO A;  2YT6 A;  2CUD A;  4OMP A;  1AWJ A;  1GL5 A;  1T0H A;  1OOT A;  1GRI A;  4Z89 A;  1ZX6 A;  2ROT A;  5FWB A;  1M30 A;  2F2X A;  1X2K A;  2AKL A;  1U06 A;  2CH4 W;  1OV3 A;  2L3S A;  1WA7 A;  2DL3 A;  3CQT A;  1BBZ A;  2L2P A;  4JZ4 A;  3VS3 A;  2JM8 A;  2DL4 A;  1SHF A;  4JJB A;  1UDL A;  1AZE A;  2GTO A;  2DF6 A;  1B3Q A;  1WIE A;  2FPF A;  1OEB A;  2P4R A;  1GCP A;  2J05 A;  1ZBJ A;  2LJ0 A;  4RTU A;  2O9V A;  1K1Z A;  2BZX A;  1AVZ C;  2ABL A;  2SEM A;  2PTK A;  1NG2 A;  1UFF A;  2KT8 A;  2H8H A;  1I0C A;  2O9S A;  2W10 A;  2HBW A;  4K11 A;  4LNP A;  2LP5 A;  1WXT A;  3H0I A;  2ED1 A;  2KEA A;  2YUQ A;  2L0A A;  2GNC A;  1GBQ A;  1X2Q A;  3O5Z A;  1UJ0 A;  2K9G A;  2O31 A;  1Z9Q A;  2MCN A;  4F17 A;  2G6F X;  2KRS A;  5IH2 A;  2C0I A;  2DRM A;  2FEI A;  3TSZ A;  2GBQ A;  2QDL A;  1UHC A;  5IHK A;  2KGT A;  2DMO A;  1WDX A;  2VKN A;  2K2M A;  4OMQ A;  2NWM A;  1TUD A;  2KRN A;  2LQN A;  1YNZ A;  3JV3 A;  1AZG B;  2EW3 A;  3VS4 A;  1RI9 A;  2EGC A;  2JM9 A;  1KSW A;  3H0F A;  1RLP C;  1ABQ A;  1S1N A;  2M51 A;  2DJQ A;  3RNJ A;  1U5S A;  2BZ8 A;  4Y92 A;  1M27 C;  1VA7 A;  1N5Z A;  1H92 A;  2DA9 A;  4RTT A;  2DL7 A;  1AOJ A;  2D8H A;  3PVL A;  1UHF A;  2DE0 X;  3EGU A;  2K79 A;  2GQI A;  4DEX A;  2OI3 A;  5EC7 A;  5I22 A;  2ED0 A;  2L3Q A;  3H0H A;  4Z8A A;  1W70 A;  1PHT A;  3I9Q A;  5L23 A;  1QLY A;  4OMM A;  2OJ2 A;  1PKS A;  4OMN A;  1NYF A;  4OMO A;  2HEQ A;  1VYT A;  2A36 A;  1K76 A;  1SSH A;  1JXO A;  2RPN A;  1WLP B;  1T3S A;  3UA6 A;  1YCS B;  4AFU C;  2EVR A;  1UGV A;  2DL5 A;  3TSW A;  3NPF A;  4LE9 A;  2KYB A;  3EHQ A;  3ZL7 C;  4CC2 A;  1QCF A;  1QWE A;  4AG1 C;  2DBK A;  2V1R A;  2EYX A;  1UJY A;  1KIK A;  1X43 A;  1A0N B;  1GBR A;  1PKT A;  1B07 A;  1CSK A;  2FO0 A;  1K9A A;  4J9G A;  2D1X A;  1AD5 A;  4LUD A;  2JW4 A;  1G83 A;  2EYY A;  1KFZ A;  1U3O A;  2CSQ A;  2C0T A;  2FRY A;  4RUG A;  2KRM A;  4RTV A;  1QWF A;  1VYV A;  1JQQ A;  1X27 A;  1ARK A;  4KRT A;  1PRL C;  2X3X D;  4HVV A;  1BU1 A;  2EGA A;  1JO8 A;  1JXM A;  3ULR B;  4J9E A;  1X69 A;  1TG0 A;  1V1C A;  2EBP A;  2CH4 A;  3M0R A;  4J9D A;  1AWW A;  2FPE A;  3VS5 A;  3PE0 A;  4RTY A;  2DM1 A;  1M3C A;  2HCK A;  2AKK A;  4F14 A;  1OPK A;  1K4U S;  1HD3 A;  3VRY A;  1W6X A;  1T3L A;  2RQV A;  1TUC A;  4IIM A;  4LUE A;  1HJD A;  1WXU A;  4RTX A;  2E5K A;  2KT1 A;  2LZ6 B;  2EKH A;  1MV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...