5FWCA

Human spectrin sh3 domain d48g, e7a, k60a
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
b'KALVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNGRQGFVPAAYVKALD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPECTRIN ALPHA CHAIN, NON-ERYTHROCYTIC 1
publication title Human Spectrin SH3 Domain D48G, E7A, K60A
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5fwcA00
3PE0A 4F17A 2DL8A 5EC7A 1PNJA 2HSPA 2KT8A 2D8JA 2C0TA 2JS0A 2LJ0A 2O88A 2K2MA 1JXOA 2VVKA 1WYXA 1K9AA 2HEQA 4LN2A 2L3PA 2CSQA 2KBTA 2QDLA 2K7AA 2W10A 2MOXA 4WCIA 1SEMA 3A98A 1PRLC 2KEAA 4ORZA 2AK5A 2GGRA 2MIOA 2PZ1A 2GNCA 3UA7A 4IIMA 1I0CA 1T0JA 2H8HA 2BZXA 1AWXA 1ABQA 1RLPC 1UJYA 1ZUYA 1QWEA 1X69A 4AFQC 2PTKA 1SHGA 1MV3A 2DX1A 2ENMA 2KE9A 1UDLA 4AG1C 2LP5A 2X3XD 1ARKA 3QWXX 1UHCA 2KR3A 1G2BA 4JJDA 1E6HA 1U3OA 1KJWA 1H3HA 3VS3A 2LZ6B 4GBQA 2LCSA 3SEMA 2DA9A 2RQWA 3M0PA 3EG3A 2YSQA 1IO6A 2EPDA 2FO0A 4Z8AA 1WXBA 1RI9A 1UFFA 1N5ZA 4HVWA 3REAB 4AFZC 3M0QA 1AVZC 4ESRA 1UUEA 1K0XA 1H92A 2BZ8A 1X43A 3VS0A 1BK2A 2KGTA 4F14A 2EW3A 1YWOA 1JO8A 1GFCA 2RPNA 4FSSA 1CSKA 2RF0A 2DF6A 1K76A 1SPKA 1JEGA 2RN8A 1MV0B 5I22A 1UTIA 3U23A 4J9FA 1SRLA 3H0IA 4M4ZA 1OEBA 2HBWA 2YDLA 1PKSA 3NPFA 4RTYA 1S1NA 2J06A 1SSHA 4LE9A 4CC3A 2DE0X 2EYYA 2K6DA 5IHIA 2KRMA 3QWYA 4J9IA 2KYMA 4Z89A 2YT6A 4E6RA 3NMZC 4HCKA 2CDTA 3VRYA 1YP5A 3I5SA 1ZBJA 3EG1A 4CC4B 1K4US 2OAWA 2KRNA 2A08A 4J9HA 2LJ3A 2DILA 2LNHB 5IXBA 2LQWA 3EHRA 2DBKA 3RNJA 1AZGB 2J6FA 1UE9A 4RTVA 1MUZA 4ZNXA 2L3QA 1WI7A 2XMFA 4D8KA 3VS7A 1SHFA 3RBBB 1I07A 1T3LA 2RQRA 1X27A 1UG1A 4AFSC 2G6FX 2W0ZA 3REBB 1WXTA 5GJVB 4DEYA 4RTWA 2DRMA 1JXMA 1W6XA 1UGVA 1X6GA 1YWPA 2JM8A 2DL4A 2GTJA 3VS5A 1GRIA 1M3CA 3C0CA 2F2VA 2IIMA 4J9CA 2AZSA 4RTUA 2K79A 1TUDA 2OI3A 1ABOA 2GQIA 2KYBA 2FPEA 2RQTA 3THKA 1U06A 4JJBA 4IIOA 2K3BA 2M51A 2L3SA 4GLMA 1OPKA 1NEBA 1WXUA 2SEMA 5FW9A 2RMOA 1B3QA 1ZUKA 2CUBA 3LH5A 4JZ3A 2JT4A 1OV3A 2KT1A 4J9BA 1VYTA 2D8HA 5I11A 1EFNA 1NLOC 1RUWA 1KFZA 2EYZA 4LNPA 5IHNA 2J05A 2KXDA 1NYFA 2O9VA 3M0UA 2NUZA 4OMLA 2KROA 1H8KA 2VWFA 1GCQC 3M0TA 4J9DA 1QKWA 4CC7A 1LCKA 1GL5A 2FEIA 2NWMA 3H0HA 1GCPA 1E6GA 3UATA 1GFDA 2ECZA 1YNZA 1QWFA 2ABLA 2KNBB 2EKHA 3TVTA 1NLPC 1BU1A 1T3SA 1YCSB 3ZL7C 3PVLA 4RUGA 2JM9A 2L2PA 2C0OA 2F2WA 2J6KA 1GBRA 3GBQA 1M27C 1WLPB 3VS6A 3VS4A 1AD5A 4X1VA 1YN8A 2VKNA 4OMPA 2JXBA 1AZEA 3JV3A 4LUDA 1NEGA 1I1JA 2DLPA 3SHWA 1ZLMA 5L23A 1NG2A 2CUDA 2A28A 2J7IA 2EGCA 1TG0A 2ED0A 2DJQA 2DL3A 2A36A 2JMAA 3EG2A 1U5SA 3UF4A 1HJDA 1UHFA 1WX6A 2LQNA 2O2OA 2X3WD 1Y0MA 2YUNA 1M3AA 2AZVA 4HVUA 3EG0A 1QCFA 1AEYA 3CQTA 2AKKA 2EBPA 3TSWA 1ZSGA 1NYGA 1Y57A 2SRCA 2FRYA 2AKLA 3O5ZA 4RTTA 1QKXA 2LJ1A 4J9GA 1VA7A 2YUQA 3NGPA 1PKTA 2DM1A 4K11A 4RTXA 3KFVA 4OMQA 2FPDA 2DVJA 3EHQA 2HDAA 2ED1A 4DEXA 2ROLA 2EYWA 2RQUA 2DBMA 4Y92A 4OMMA 2D1XA 2O31A 4KRTA 1K1ZA 1X2QA 1AWOA 2KXCA 1VYUA 3PVQA 2JMCA 1PRMC 1HSQA 2CH4A 4JPBW 2RQVA 1K0SA 2GTOA 1NM7A 2I0NA 3IQLA 2K9GA 2DRKA 2L0AA 1SRMA 2YUPA 3VS1A 4OMNA 1WDXA 1JQQA 1V1CA 2FPFA 1PHTA 4Z88A 5FWCA 1CKBA 1KSWA 1CKAA 1JU5C 1M8MA 2DL7A 2FRWA 1PWTA 1ZX6A 4HVVA 2V1RA 4F16A 2EVRA 3ULRB 3NHNA 2ESWA 1BB9A 1WFWA 1AOJA 1Z9QA 4OMOA 1A0NB 2EQIA 2DNUA 2FG0A 5GJWB 3H0FA 3R6NA 2BTTA 1FMKA 4JJCA 4R0KA 1T0HA 1VYVA 1WA7A 3H41A 1G83A 2CREA 1FYNA 3TSZA 2ROTA 2DYBA 3EGUA 2KRSA 5FWBA 2E5KA 1W70A 3UA6A 1X2KA 2DL5A 4LUEA 2OJ2A 2C0IA 5IHKA 3I9QA 2YUOA 2JTEA 2CSIA 1RLQC 2EGEA 1B07A 4J9EA 2M0YA 4CC2A 1XOVA 4A63B 2CH4W 1GBQA 5IH2A 4HXJA 1UECA 2P4RA 2HCKA 2O9SA 1X6BA 1TUCA 2A37A 2GBQA 1ZUUA 2EYXA 1W1FA 2B86A 2PNIA 3I5RA 4AG2C 2JS2A 1WIEA 1M30A 2BZYA 2JW4A 1QLYA 2DMOA 4AFUC 2F2XA 4JZ4A 5IXFA 1UJ0A 1GCQA 1OPLA 5ECAA 1KIKA 2D0NA 2CT3A 3M0RA 4QT7A 2MCNA 2EGAA 2RNAA 2LMJA 4D8DA 1BBZA 2CT4A 1AWWA 3VRZA 1J3TA 4EIKA 4RTZA 1HD3A 1OOTA 3VS2A 3FJ5A 1M3BA 1AWJA 2J6OA 3M0SA 2LX7A 1Z9ZA 1E7OA 5HCKA 2V1QA 3I35A
chains in the Genus database with same CATH superfamily
1JRIA 2I2LA 2DL8A 2WACA 4IUPA 3CCEA 1QCOA 2HSPA 2LNVA 2DXBA 2KT8A 4B6MA 2O4XA 2D8JA 2HKQB 2V8IA 5LJ3h 1VQ9T 4N4GA 4F7UG 2RHZA 1MGQA 4PLLA 1K9AA 2HEQA 2E6NA 5CQXA 3CCQQ 3KUFA 2KBTA 2ZPFB 2P84A 2W10A 2DETA 3A98A 1PRLC 2IG0A 2OTJT 2PVDB 2GGRA 3GLXA 2MIOA 4IIMA 3RIRA 4QQGA 3EGXB 3FB9A 2FVUA 1X69A 5KYWB 2XK0A 2AT1B 2JUFA 4LXCA 1UDLA 3M4GA 5FRMA 2X3XD 1YJNA 3INZA 3L2RA 3QWXX 3RESA 1KJWA 3X28B 1UGSB 4QVDA 3SEMA 3QG1A 5GAMj 4JRQA 3M0PA 3EG3A 4IKFA 4FU6A 2FO0A 4PNOA 3E19A 4Z8AA 4PL6A 5FU6B 1UFFA 2KSSA 1N5ZA 2MAMA 1K73U 4ESRA 1UUEA 1K0XA 3HP9A 1X43A 2VXFA 5A2QE 1VQ4Q 2KGTA 2ZPGB 2RPNA 1BIBA 3E2UA 2QA4Q 2DF6A 1JEGA 3U23A 4QKUA 1VQ7Q 4J9FA 3C4SA 1KD1U 4C8QG 1OEBA 4M75G 2HBWA 3NPFA 4RTYA 2HAXA 5KYNA 4HT8A 5IHIA 2KRMA 1Y96A 2KYMA 1PM3A 1NJIC 1RAFB 2JJ9A 4HCCA 4C0DB 5CKEA 3SB2A 3VRYA 3I5SA 3EG1A 1K4US 4IUVA 4HCBA 4XU0A 1ACMB 3MPUB 4PJLA 2LCCA 2YWWA 3HL8A 1IHWA 1D1BA 2J6FA 3OYCA 2A7YA 3PNWC 1YI2T 4DQ2A 3VS7A 4BY6C 1V76A 1UGPB 1YHQA 2X4XA 4FT2A 3M9QA 4AFSC 2COWA 4MZMA 1WXTA 3QDFA 1YWPA 2JM8A 3CMEQ 2L5QA 4E47A 2X51A 1VQ6T 2COZA 4M7DG 3HRUA 1VQOT 4HA8A 2GQIA 1YIJT 4MZPA 2JOYA 3CMAQ 4ATOA 2K3BA 3HKSA 3G6EA 1M2VB 1OPKA 1NEBA 4C8QC 3BDLA 4M75C 2SEMA 3OW2A 1EIFA 3CD6Q 1YITA 4X34A 4M75D 5CR2A 5LJ3g 4V2SA 2D8HA 2DEUA 1NLOC 4B9WA 3I56Q 4KGXB 1SG5A 3HFNA 3CCEQ 4FSXA 3G4SA 2CP0A 2NUZA 4II1A 1VQKQ 2MK5A 2VGMA 4LD6A 4J9DA 3HSBA 1LCKA 1IB8A 1E6GA 1GFDA 2ECZA 2HQXA 4HCZA 1YNZA 4M78F 2QQ9A 4XTWA 2DO3A 3ZL7C 4RUGA 4MMKA 4ELZC 2DXTA 4NOYA 1UB4A 3VUZA 5J3BA 4DBFA 1LNXA 1AD5A 1BI0A 1S72T 3MHXA 5HY6A 4M7DC 3CCST 3JV3A 2DLPA 1RAEB 1ZLMA 4FCYA 5L23A 2DXCA 4M7DD 1KC8U 2DJQA 4KUDK 4QW2A 3CC2A 5I2SA 2ZPHB 3EG2A 4J8OA 1U5SA 2X3WD 1Y0MA 5FROA 1M3AA 4JDSA 4HVUA 3CXCA 2YHTA 2EBPA 2XI9A 5DY9A 1ZHIA 1I8FA 3CCJA 5LJ3f 4KH1B 3WXMB 1PD1A 2DFUA 4RTTA 3OW2P 2LJ1A 2E64A 3F70A 4XAXB 3A5ZB 1VA7A 3NGPA 2DM1A 2QTVA 3GPLA 2FZGB 1OULA 3EHQA 5GANe 2ED1A 1K73R 2H3EB 2MPXC 2NUPB 4DEXA 1VQLA 1X01A 2RQUA 4M7AB 2X4WA 4Y92A 2O31A 3OYAA 3S6WA 4M77A 2EWNA 2HNIA 3EG9A 1N6AA 2F5KA 3OSSC 3QZ5B 1KD1R 1R0BG 1K0SA 4JLIA 2RK2A 1NM7A 2M0OA 1ZA1B 2RM4A 2BE7D 3CPFA 4JLGA 1O75A 3V8KA 5KE2A 2DJZA 2DK3A 1QVGS 2YUPA 4C5IA 1WDXA 1JQQA 3EFRA 1PHTA 4Z88A 2E5QA 4EMKC 4FW2A 2DL7A 3ZEHA 4IURA 1G3WA 1G5VA 2DTOA 3M59A 2V1RA 3L2VA 2JVVA 3ULRB 1BI2A 1N8RC 3QHSA 1G3YA 2FG0A 5GJWB 4E7HA 1OX9A 5GAN2 2M02A 2BTTA 3A8HB 2HL3A 4Z02A 3H41A 1FYNA 1KHIA 3TSZA 3QYHB 3OMGA 1JB0E 4C92B 4P5NA 2WSEE 1F1BB 4PJOG 1Q7YU 3GF5A 3JB9G 3G6EQ 2OJ2A 2C06A 4J7FA 3MEAA 2DYIA 1PSFA 4C5EA 3OYKA 5L8RE 2QEXA 4BD3A 1YJWA 2BE9B 3I55A 1SKUB 4A63B 1H3ZA 2JTMA 4XQ3A 5IH2A 2R5AA 3OBWA 5GANj 3OYBA 3I5RA 3PFSA 3OMCA 1QLYA 2DMOA 3FIFA 2K3YA 1JJ2S 2GF7A 2RHYA 2RJEA 5J26A 2DD4A 4D8DA 2LMJA 2PU9B 1BBZA 1IZ6A 3CCUA 1OOTA 3CC7A 3VS2A 3CCRQ 4N4HA 3M0SA 1Z9ZA 2CYZB 3VKIA 5KYYB 2VV5A 1PNJA 3GOXA 3FRNA 5GMKe 3GIBA 5C0MA 4OP0A 5LJ5d 4M77G 4M7AE 2KY9A 2COYA 2O88A 4XTZA 2K2MA 2Z0WA 1JXOA 3BDUA 4C0GA 2VVKA 4XTYA 3JCMh 4HT9A 4LN2A 3RKXA 3CCLA 4PJOD 5AYFA 2CSQA 1JBMA 3HFOA 2GFUA 1VQPT 1Q82U 4EDUA 1G8XA 2PZ1A 2GNCA 3UA7A 1I0CA 2MYSA 4ZN1A 4JS4A 1I5LA 2HSEB 4XU1A 4M78B 2RB6A 3JCMb 1AWXA 4AFQC 4A4EA 2PTKA 1SHGA 1YJ9Q 4JUVA 2VYTA 1BCOA 2E10A 1PG5B 1VQLQ 2EAYA 2OTJA 2KR3A 3OYEA 1U3OA 1Q86C 1TTHB 5GAN8 2DA9A 1IO6A 2EPDA 3URGA 4RCCA 2RHUA 2QK0A 1RI9A 2MMPA 3CBOA 1AVZC 1WQWA 5GAOm 1H92A 2BZ8A 3OYFA 4C92E 3VS0A 4GLKA 8ATCB 3QKJA 3UT1A 4F14A 2EW3A 1YWOA 1GFCA 4DOWA 4C8QA 4M75A 1K76A 4JJNK 1UTIA 4M77C 4M4ZA 5CVIA 2DTIA 2YDLA 2QQAA 2K3XA 4LE9A 3PIPA 1PSEA 4C0FA 2EYYA 3P8DA 5C6SA 1FX7A 2K6DA 3ASKA 2RJFA 3CC7T 2V26A 3QWYA 4F04B 3EFSA 3RKWA 4FT4A 1MMAA 1P92A 2YT6A 4E6RA 5CK9A 4RKUE 3NMZC 1NBEB 4HCKA 1LPLA 1VQNQ 2CDTA 2PUOB 4R56A 5KYXB 4LD9K 5GMKj 1ZA2B 1Q95G 3X26B 3QBYA 4CC4B 1WJQA 2KRNA 2A08A 2OAWA 4J9HA 2VB6A 4ZTFA 2E41A 3LWHA 3EHRA 2DBKA 3VUBA 4IUUA 1MUZA 1AT1B 3SWNC 4MZTA 4JRIA 1PD0A 1M4ZA 2XMFA 5FLXE 4D8KA 3CCLT 4LDXA 1N9RA 1SHFA 1I07A 1C6VX 2EQJA 3FEOA 4RG8A 2RQRA 3M4YA 1UG1A 2KI7A 3DB4A 2W0ZA 1TUGB 1Q7YR 2QEXQ 2DRMA 2DZ9A 3JCMV 1W6XA 1UGVA 4M7DA 2E1HA 2DL4A 2GTJA 3I55Q 2ZZDA 4PFPA 3OB9A 2GQVA 2JZ2A 3JAME 3LH0A 3PIOA 2F2VA 2IIMA 2QAZA 1YI2A 3BE3A 2AZSA 5D6XA 1VQ4T 3MKDA 2BKDN 2XICA 5GAMh 3OS5A 3QO3A 4ZGDB 2QA4T 2K57A 2IPOB 2FPEA 4DA4A 2XU8A 4E7IA 3S3OA 1U06A 2M51A 3JCMQ 4M7AF 1VQ6A 1K8AR 1WXUA 1D1AA 2PVGB 5FW9A 1QVFS 2O4XB 4XTUA 2R5MA 2VGNA 1W4SA 2DVEA 4JZ3A 1VQOA 2HQHA 1OV3A 4M78E 2KT1A 4J9BA 2HMAA 2R57A 4RMOA 1YIJA 5I11A 1O9SA 3JCMg 5AT1B 5GANd 3E9FA 3M55A 4F7UE 4X9DA 2KROA 2YRDA 3M0TA 2FEIA 2ZPBB 4PJNA 5M9OA 1IRXA 3RDVA 2VC8A 2ABLA 2KNBB 3V7SA 4DOVA 3GP8A 3CPWS 2DZCA 1BU1A 1T3SA 1FXXA 3PVLA 1IGQA 3C95A 5FU7C 3J81E 2JM9A 2JTFA 2F2WA 2J6KA 2CP3A 1GBRA 3GBQA 3CCVT 3VS4A 4EMKA 1YN8A 5GMKl 1K73C 3CCMQ 2VKNA 4N0AC 4OMPA 1VQ9Q 2CKKA 1AZEA 4GY5A 3EH1A 1Q82R 4C92F 1NEGA 4A54A 2KAFA 1IXDA 5LJ5e 2LTOA 2QQSA 2L3RA 3META 3SHWA 3D7SB 3FLGA 3X20B 3L2QA 1MHNA 4J83A 2J7IA 2P4TA 2EGCA 3JRZA 1KD1C 3CMAT 3JB9I 1WGSA 3V7RA 1S72A 3UF4A 4EMHA 3CC4Q 2YUNA 3G7ZA 4BE0A 4M78D 2AZVA 2RJCA 1D3BA 3CCSA 1YBYA 2EJFA 3CD6T 2AKKA 2Y4XA 1QVGA 3A8LB 3HPWA 3HTRA 1ZSGA 4Q5WA 1Y57A 2SRCA 3I56T 2OX7A 3O5ZA 1ZSZB 3OYYA 4KH0B 3JCMf 2CP7A 4BDZA 2LT1A 1Y96B 3L1AA 4K11A 1VQKT 1PKTA 1QMCA 2CS7A 5KH6A 3NTKA 2FPDA 2DVJA 2HDAA 4BE1A 9ATCB 1B7TA 2E6ZA 2QGFB 2D1XA 2MWPA 1X2QA 1M9SA 4KUIA 1M2VA 1VQ5Q 2JMCA 1PRMC 4XTVA 4JPBW 2RQVA 2GTOA 3TU4K 1VQ8Q 4WTOB 3H8ZA 1WQ7A 4E7SA 2DRKA 3RR6A 4FYXB 1SRMA 3VS1A 4OMNA 3PMIA 1M8VA 2F1LA 3SFMA 3LYIA 1V1CA 3H9NA 4A53A 1CKBA 3M54A 1JU5C 1M8MA 2QASA 4BI3A 2P0KA 3JCMc 3NHNA 2QTXA 2XDBA 5GAMg 1DJ7B 2E3HA 1AOJA 5FRNA 2K2VA 3TQ7P 4BACA 3C12A 3RKYA 3OYDA 3UPUA 5LJ5j 1T0HA 1WA7A 2EIFA 2FL7A 1G83A 3V8JA 1NZ9A 4QVCA 1RL2A 4PJOA 3KBGA 1C1AA 1WZOA 3CBPA 4F7UF 1QVGP 1KHCA 1WJSA 2KRSA 4OVAA 3OY9A 1XNIA 3L2UA 2E5KA 3UA6A 4LUEA 2LT4A 5IHKA 3AT1B 2JNGA 2JTEA 2CSIA 1N27A 2M1HA 5GAOq 2CP2A 3L42A 2WSFE 2CP5A 2EGEA 1YJNQ 1YIJQ 5DM7R 1Y71A 1QP3A 2D6FA 1IHVA 1QQJA 1GBQA 1D09B 4HXJA 4NS5A 1VIEA 2A37A 5D6YA 1ZUUA 2EYXA 3JB9J 1WIEA 2QDYB 2BZYA 2F2XA 1KC8C 2F69A 1RAIB 2R58A 2XG8D 3P8HA 1OX8A 5ECAA 1KIKA 4OB2B 1I81A 1M1KU 1Y07A 3JCMX 4QT7A 5CIUA 2MCNA 2RNAA 3LGLA 5GAMf 3HHTB 5KCHA 4DBHA 1QW1A 1AWWA 2P0QA 5FU6C 3VRZA 4D6WA 4EIKA 3FJ5A 4MMLA 4RG2A 1UGQB 2G3RA 2V1QA 3I35A 4R0KA 7AT1B 4F17A 3MP8A 5EC7A 4C8QF 1BYMA 4FYYB 3QJYA 1I4K1 2C0TA 5LJ3d 2JS0A 1IGUA 3X25B 3MEUA 1JJ2P 1VQMA 2YLBA 2WSCE 3OS0A 1ZQ1A 2QDLA 4LDVA 4WCIA 1SEMA 2KEAA 2FYKA 4C0DC 2MWOA 3MP6A 2XIDA 4E7KA 1T0JA 2CP6A 2BZXA 1MNEA 1YHQQ 3RMSA 1ABQA 1UJYA 3M56A 4AT1B 1QWEA 1OQKA 3MEWA 3EG9B 3SWNA 3JSCA 2ENMA 2KE9A 3LW5E 4AG1C 2RI5A 4VUBA 2LP5A 3DLMA 3EFOA 4J6XA 3UWNA 3TREA 1VQPA 1K9MR 4IUTA 2XDPA 2LQKA 1G2BA 4JJDA 1HK9A 3VS3A 2LZ6B 4ELYC 5GANh 3QSUA 4GBQA 2LCSA 1ZBXA 1VUBA 2VUBA 2X35A 4HVWA 3LWIA 2E65A 4AFZC 3M0QA 2MI6A 1RI0A 4OGEA 1YITQ 1CSKA 2RF0A 1SPKA 5I22A 1MV0B 1Q7YC 4BUGA 4E7LA 2DIGA 1SRLA 3H0IA 4KBMB 2DKGA 3G4SQ 3QXEB 2J06A 3NTHA 3PMTA 4CC3A 4KULA 1K8AU 2A0FB 2CGHA 4FYWB 4Z89A 1RAHB 3GNFB 5KE3A 2RD1A 2H3JA 1KQSS 2QQRA 4J6YA 2LJ3A 2LQWA 4M7AG 2V8KA 1UE9A 4ZNXA 2L3QA 2DIQA 1VQMT 2OTLT 1QVFA 1OI1A 6AT1B 3QDRB 1T3LA 1M2OA 3RUXA 4N0AA 4DEYA 4RTWA 1X6GA 2NYSA 3T9NA 4PJOC 2ZPEB 3CC2Q 3VS5A 3FJPA 2K5IA 3HRSA 2LVMA 5I21A 2LCLA 1WHLA 2K79A 2OI3A 4PFZA 3M57A 3QZ9B 3CPWA 1ABOA 3CCJQ 5FU7B 3FC3A 3THKA 3MEVA 2KQWA 3LX7A 3CXCS 1B34A 3QYGB 3N5BB 4FIBA 2RMOA 4F7UB 3FDRA 3MP1A 4E2FB 1RACB 1VQ4A 1Q82C 3LH5A 3VU3C 1LVKA 3G71T 2JT4A 4PFOA 2QA4A 2JN0A 1TSFA 2RO0A 1VYTA 1M1KR 4JRKA 1RUWA 4M77E 4C92G 5IHNA 2AIRB 2J05A 2LRQA 4OMLA 5KYUA 2VWFA 2RK1A 2NWMA 3OYIA 1N9SA 2PUKB 3H0HA 4XU3A 3TEEA 4CRIA 2CZ6B 2E3IA 3NTIA 4M7AC 2EJGA 2EKHA 3TVTA 1UEBA 1NLPC 5GMKh 2RJDA 4BY6B 4XU2A 4M7AD 2LC4A 4Y91A 3C94A 1QVFP 1M27C 4OB3B 4X1VA 2DD5A 4UC4A 2XDDA 3CCQT 4LUDA 5KYXA 1D1CA 2FHDA 5LJ3e 1WJRA 5GMKm 3S3MA 1RAAB 4FW1A 2CUDA 2ZGWA 3RMQA 3PTAA 4PK4A 3CCVA 4LDWA 1U1SA 1N8RR 1I5OB 2NUTB 2A36A 3RERA 4WF2A 1UHFA 1WX6A 2LQNA 3CPWP 4C8QB 4M75B 4FM4B 3EG0A 1OYXA 1IREB 3CQTA 3TSWA 3E9GA 3VV0A 4XK8E 5GAN3 3SDZA 2FRYA 3V8LA 2AKLA 2FZCB 3CMAA 1TOVA 3JB9F 2YUQA 4J7IA 4RTXA 3KFVA 1TXQA 4OMQA 2E4HA 1QVPA 1SF9A 1YJWQ 3EH2A 4C92D 5IAYA 1MMGA 3CD6A 5EG2A 5GMKi 3Q1JA 4J6WA 3OS1A 2EYWA 2K5FA 4DBQA 4KRTA 3I56A 3EGXA 3TCJA 1AWOA 1AHJB 2DXUA 2QQBA 2XD0A 4N4IA 5KYWA 1VYUA 1VQKA 3L2WA 4M78G 3EGDB 3UDCA 1VQ7T 1U8RA 3CCMT 2K9GA 5GANf 5HK0A 4PKCC 2QGGA 1LJOA 1BIAA 4BDYA 1NPPA 3DKMA 3CCUQ 4M7DB 5FWCA 1KSWA 3CC7Q 1CKAA 1TWBA 2FRWA 1PWTA 4HVVA 1GXIE 2EVRA 1WHGA 2ESWA 3WVDB 5GAN6 1OZ3A 4C0ZA 4OMOA 3CC4T 1A0NB 4QVZA 5A0GA 5GAN7 2EFIA 2DNUA 3H0FA 1OU9A 1BI3A 5GAN5 1FMKA 4JJCA 1VYVA 5LJ3j 3CCLQ 2HL5C 4M77F 2BUDA 3R6OA 1MMNA 3DLLA 4JS5A 3OYMA 2ROTA 2DAQA 4LDUA 1VIFA 3EGUA 5D6WA 3MCAB 5GAOl 5J39A 1H641 3CMET 1W70A 4A4GA 1FWZA 1X2KA 2DL5A 2CZ1B 2C0IA 3OYHA 4BI8B 1Q81R 2DPPB 4E7ZA 3I9QA 3VYHB 3OYJA 4NL3A 2E12A 3LGFA 2BIVA 4YTLA 3QJ6A 4TVRA 1VQ5T 4DBRA 2PVOB 4KGVB 2OTJQ 1NJIU 4J9EA 2M0YA 1W2BS 4CC2A 4M78C 5IN1A 1VQ8T 4FL6A 1LOJA 2P4RA 2O9SA 3AHUA 1X6BA 1TUCA 1EZZB 1ZSZA 2GBQA 1W1FA 2B86A 1R0CB 4EMKB 2JS2A 1M30A 3G1JA 2EYQA 4JZ4A 1K9MU 5CKFA 1GCQA 1OPLA 1Q86R 1MNDA 1YFNA 1M90R 4IUQA 1RABB 4C8QE 4M75E 3CCET 2Y4YA 1WHJA 4OF1A 4Y28E 1D0YA 3M58A 1J3TA 1HD3A 1M3BA 1AWJA 2LX7A 1K9MC 1KG1A 5GAOp 1M1FA 3PE0A 1D3BB 3CEYA 2XHCA 3M5AA 2ZAEA 3JB9H 2AHJB 1EX4A 3CCVQ 2LJ0A 4KT0E 5LJ5h 1XQHA 2EQMA 1PC0A 4NL2A 3OA6A 3JCMd 3HRTA 1WYXA 5GAOn 2L3PA 3A1PA 4J5YA 2K7AA 2P0PA 2MOXA 3CBMA 1YJNT 4ORZA 2AK5A 2H8HA 1G3TA 4MDXA 1RLPC 5GAN4 1ZUYA 2HD0A 4M7DE 1MV3A 2DX1A 3KXTA 3OSVA 3LLRA 4EPCA 1V29B 2HQEA 4C8QD 1ARKA 2DERA 1UHCA 1YI2Q 1TH7A 2CZ7B 1E6HA 1RADB 1M5Q1 2Y90A 4ZGEB 1H3HA 2HZYA 1JJ2A 4ZGJB 2K5LA 2RQWA 2YSQA 8AT1B 1WXBA 1KQSA 1VQ6Q 3REAB 5D7UA 3ZBDA 1R77A 4RCBA 3BY7A 3QPHA 1BK2A 2IVWA 2QI2A 1JO8A 2EQUA 1VQOQ 4FSSA 1WHHA 1U1TA 3OBYA 2RN8A 3OQ5A 5CQYA 4PJOB 2GCXA 3CCRA 2QYZA 1PKSA 1S1NA 2CZ0B 1SSHA 2ZPIB 2DE0X 5LL6S 1OU8A 5HKCA 4J9IA 2PQWA 3BW1A 2YRVA 1YCYA 1YP5A 1YHQT 2YRCA 1KQ2A 1ZBJA 2NUPA 4ZN3A 2M16A 4M7AA 5CKBA 2DILA 2LNHB 2RHIA 4C5HA 3PT9A 5IXBA 4L5GA 3RNJA 3EAEA 1AZGB 1C0MA 2D0QB 2X9HA 4RTVA 1XJWB 1WI7A 2X4JA 2F5TX 2M9UA 1HYOA 2L8DA 3RBBB 2DTHA 1M1KC 4MDWA 1X27A 4M75F 3J7AF 2LDMA 2G6FX 3REBB 5GJVB 5HK3A 1YJ9A 1JXMA 2VASA 3L2ZA 5CCAA 3E1SA 3G6ET 1GRIA 1M3CA 1S72Q 3C0CA 2OTLA 4J9CA 3CCSQ 5GAMd 1BKBA 1TUDA 1KQSP 3MO8A 1YITT 1NJIR 2HKNA 5CO7A 2O01E 2KYBA 2RQTA 2FZKB 3OS2A 4JJBA 4IIOA 2L3SA 4GLMA 3G4ST 3BFMA 4JRPA 2OAUA 4M77B 2K4YA 1N8RU 1X6OA 1R8OB 1WHMA 1B3QA 1ZUKA 2EJ9A 2YXYA 5A0DA 2CUBA 4C92A 5A0LA 2RH2A 5CAIA 5LJ5g 3A8OB 2FB7A 4O5VA 2VXEA 1ZSZC 1EFNA 1KFZA 2EYZA 4LNPA 2KXDA 1NYFA 1FMVA 2GFAA 2O9VA 3M0UA 3PGGA 4M7DF 1RAGB 1H8KA 1GCQC 2E70A 4CC7A 1QKWA 1GL5A 2A3LA 3A8GB 1GCPA 3UATA 1G3SA 2KMTA 3CCRT 1QWFA 3G71A 3M53A 1OZ2A 2HBPA 3SWNB 1VQNA 3ZFJA 1YCSB 4QQ6A 1QCNA 5CKHA 3CXCP 3EFOB 2L2PA 2C0OA 4OB0B 3O8VA 3OW2S 2ZCFB 3ME9A 4ME7A 4AMCA 2D9TA 1WLPB 3VS6A 4C5GA 3CC2T 1VOMA 2YLCA 2RHXA 5I2MA 2JXBA 2LQ8A 4X9CA 3X24B 1PCXA 1I1JA 1TU0B 3S3NA 4A4HA 1NG2A 3CCJT 3JCMe 4ANJA 2A28A 4PJOE 1WNLA 1NE8A 1TG0A 2ED0A 2DL3A 4E7JA 1QP2A 2JMAA 1HJDA 5GAOr 1K8AC 1YJ9T 2O2OA 5KYYA 3CCQA 1QCFA 1AEYA 1D0XA 3ER0A 2DEQA 1VQLT 2X4YA 5LJ5f 1KK7A 4XTXA 1NYGA 2QG9B 3H6ZA 1WHKA 1X75C 4R55A 3OYNA 1QKXA 2LX9A 4J9GA 3QUIA 3V7CA 1BCMA 4L59A 4OMFB 2ROLA 2DBMA 4OMMA 1Q81U 1K1ZA 4M78A 2KXCA 2RI3A 2L89A 4A4FA 3PVQA 2ATCB 3NFCA 3WVEB 1HSQA 2CH4A 4F7UA 5DLQE 2I0NA 3IQLA 2L0AA 4BE2A 1Q81C 1BI1A 3JCMJ 2V8JA 2FPFA 4ZTJA 3JB9D 5KCOA 1TS9A 1MMDA 1KC8R 1ZX6A 2RI2A 1VQNT 4F16A 3MJXA 1VQ7A 4PLIA 1BB9A 1Q86U 1M90U 3CCMA 4CI0C 1WFWA 3DB3A 1W2BA 1VQ9A 1Z9QA 2EQIA 3SD4A 2NLUA 4B9XA 4OB1B 3R6NA 1B34B 3P8BB 1VQMQ 2OTLQ 2KVQG 4EMGA 2CREA 4KGZB 3OYLA 1M90C 3VJPA 2DYBA 2QEXT 3JCMW 3CC4A 1YJWT 5FWBA 1M1GA 2RA2A 3I55T 4PJMA 2B8AA 4A4KA 3A8MB 5GANg 2KK4A 3JCMP 3OYGA 3J80E 2YUOA 1SSFA 5KYUB 2NUTA 1RLQC 1VQPQ 1B07A 1NPRA 5CKDA 1D0ZA 1XOVA 3CMEA 4OGCA 5GAMe 2CH4W 1HXDA 2KDSA 1UECA 5DLOA 2HCKA 2EKOA 1FMWA 4O6JA 3CCUT 1UGRB 2PNIA 4AG2C 4PJJA 4LDYA 4M77D 2JW4A 3GNGA 1VQ5A 4FYVB 4AFUC 3G71Q 4L6V5 1Y7XA 5IXFA 1UJ0A 4PJOF 2QXFA 2D0NA 2XKOC 2CT3A 4C92C 3M0RA 4QQDA 1VQ8A 2EGAA 2MF2A 1WPYA 2CT4A 3VYGA 3QIIA 4RTZA 4BI4A 1XTDA 4HKEA 2J6OA 5IT9E 3EGDA 2EQKA 1E7OA 1KQ1A 4BB7A 5HCKA 1W2BP 4RTUA
chains in the Genus database with same CATH topology
3PE0A 4F17A 2DL8A 5EC7A 1PNJA 2HSPA 2KT8A 2D8JA 2C0TA 2JS0A 2LJ0A 2O88A 2K2MA 1JXOA 2VVKA 1WYXA 1K9AA 2HEQA 4LN2A 2L3PA 2CSQA 2KBTA 2QDLA 2K7AA 2W10A 2MOXA 4WCIA 1SEMA 3A98A 1PRLC 2KEAA 4ORZA 2AK5A 2GGRA 2MIOA 2PZ1A 2GNCA 3UA7A 4IIMA 1I0CA 1T0JA 2H8HA 2BZXA 1AWXA 1ABQA 1RLPC 1UJYA 1ZUYA 1QWEA 1X69A 4AFQC 2PTKA 1SHGA 1MV3A 2DX1A 2ENMA 2KE9A 1UDLA 4AG1C 2LP5A 2X3XD 1ARKA 3QWXX 1UHCA 2KR3A 1G2BA 4JJDA 1E6HA 1U3OA 1KJWA 1H3HA 3VS3A 2LZ6B 4GBQA 2LCSA 3SEMA 2DA9A 2RQWA 3M0PA 3EG3A 2YSQA 1IO6A 2EPDA 2FO0A 4Z8AA 1WXBA 1RI9A 1UFFA 1N5ZA 4HVWA 3REAB 4AFZC 3M0QA 1AVZC 4ESRA 1UUEA 1K0XA 1H92A 2BZ8A 1X43A 3VS0A 1BK2A 2KGTA 4F14A 2EW3A 1YWOA 1JO8A 1GFCA 2RPNA 4FSSA 1CSKA 2RF0A 2DF6A 1K76A 1SPKA 1JEGA 2RN8A 1MV0B 5I22A 1UTIA 3U23A 4J9FA 1SRLA 3H0IA 4M4ZA 1OEBA 2HBWA 2YDLA 1PKSA 3NPFA 4RTYA 1S1NA 2J06A 1SSHA 4LE9A 4CC3A 2DE0X 2EYYA 2K6DA 5IHIA 2KRMA 3QWYA 4J9IA 2KYMA 4Z89A 2YT6A 4E6RA 3NMZC 4HCKA 2CDTA 3VRYA 1YP5A 3I5SA 1ZBJA 3EG1A 4CC4B 1K4US 2OAWA 2KRNA 2A08A 4J9HA 2LJ3A 2DILA 2LNHB 5IXBA 2LQWA 3EHRA 2DBKA 3RNJA 1AZGB 2J6FA 1UE9A 4RTVA 1MUZA 4ZNXA 2L3QA 1WI7A 2XMFA 4D8KA 3VS7A 1SHFA 3RBBB 1I07A 1T3LA 2RQRA 1X27A 1UG1A 4AFSC 2G6FX 2W0ZA 3REBB 1WXTA 5GJVB 4DEYA 4RTWA 2DRMA 1JXMA 1W6XA 1UGVA 1X6GA 1YWPA 2JM8A 2DL4A 2GTJA 3VS5A 1GRIA 1M3CA 3C0CA 2F2VA 2IIMA 4J9CA 2AZSA 4RTUA 2K79A 1TUDA 2OI3A 1ABOA 2GQIA 2KYBA 2FPEA 2RQTA 3THKA 1U06A 4JJBA 4IIOA 2K3BA 2M51A 2L3SA 4GLMA 1OPKA 1NEBA 1WXUA 2SEMA 5FW9A 2RMOA 1B3QA 1ZUKA 2CUBA 3LH5A 4JZ3A 2JT4A 1OV3A 2KT1A 4J9BA 1VYTA 2D8HA 5I11A 1EFNA 1NLOC 1RUWA 1KFZA 2EYZA 4LNPA 5IHNA 2J05A 2KXDA 1NYFA 2O9VA 3M0UA 2NUZA 4OMLA 2KROA 1H8KA 2VWFA 1GCQC 3M0TA 4J9DA 1QKWA 4CC7A 1LCKA 1GL5A 2FEIA 2NWMA 3H0HA 1GCPA 1E6GA 3UATA 1GFDA 2ECZA 1YNZA 1QWFA 2ABLA 2KNBB 2EKHA 3TVTA 1NLPC 1BU1A 1T3SA 1YCSB 3ZL7C 3PVLA 4RUGA 2JM9A 2L2PA 2C0OA 2F2WA 2J6KA 1GBRA 3GBQA 1M27C 1WLPB 3VS6A 3VS4A 1AD5A 4X1VA 1YN8A 2VKNA 4OMPA 2JXBA 1AZEA 3JV3A 4LUDA 1NEGA 1I1JA 2DLPA 3SHWA 1ZLMA 5L23A 1NG2A 2CUDA 2A28A 2J7IA 2EGCA 1TG0A 2ED0A 2DJQA 2DL3A 2A36A 2JMAA 3EG2A 1U5SA 3UF4A 1HJDA 1UHFA 1WX6A 2LQNA 2O2OA 2X3WD 1Y0MA 2YUNA 1M3AA 2AZVA 4HVUA 3EG0A 1QCFA 1AEYA 3CQTA 2AKKA 2EBPA 3TSWA 1ZSGA 1NYGA 1Y57A 2SRCA 2FRYA 2AKLA 3O5ZA 4RTTA 1QKXA 2LJ1A 4J9GA 1VA7A 2YUQA 3NGPA 1PKTA 2DM1A 4K11A 4RTXA 3KFVA 4OMQA 2FPDA 2DVJA 3EHQA 2HDAA 2ED1A 4DEXA 2ROLA 2EYWA 2RQUA 2DBMA 4Y92A 4OMMA 2D1XA 2O31A 4KRTA 1K1ZA 1X2QA 1AWOA 2KXCA 1VYUA 3PVQA 2JMCA 1PRMC 1HSQA 2CH4A 4JPBW 2RQVA 1K0SA 2GTOA 1NM7A 2I0NA 3IQLA 2K9GA 2DRKA 2L0AA 1SRMA 2YUPA 3VS1A 4OMNA 1WDXA 1JQQA 1V1CA 2FPFA 1PHTA 4Z88A 5FWCA 1CKBA 1KSWA 1CKAA 1JU5C 1M8MA 2DL7A 2FRWA 1PWTA 1ZX6A 4HVVA 2V1RA 4F16A 2EVRA 3ULRB 3NHNA 2ESWA 1BB9A 1WFWA 1AOJA 1Z9QA 4OMOA 1A0NB 2EQIA 2DNUA 2FG0A 5GJWB 3H0FA 3R6NA 2BTTA 1FMKA 4JJCA 4R0KA 1T0HA 1VYVA 1WA7A 3H41A 1G83A 2CREA 1FYNA 3TSZA 2ROTA 2DYBA 3EGUA 2KRSA 5FWBA 2E5KA 1W70A 3UA6A 1X2KA 2DL5A 4LUEA 2OJ2A 2C0IA 5IHKA 3I9QA 2YUOA 2JTEA 2CSIA 1RLQC 2EGEA 1B07A 4J9EA 2M0YA 4CC2A 1XOVA 4A63B 2CH4W 1GBQA 5IH2A 4HXJA 1UECA 2P4RA 2HCKA 2O9SA 1X6BA 1TUCA 2A37A 2GBQA 1ZUUA 2EYXA 1W1FA 2B86A 2PNIA 3I5RA 4AG2C 2JS2A 1WIEA 1M30A 2BZYA 2JW4A 1QLYA 2DMOA 4AFUC 2F2XA 4JZ4A 5IXFA 1UJ0A 1GCQA 1OPLA 5ECAA 1KIKA 2D0NA 2CT3A 3M0RA 4QT7A 2MCNA 2EGAA 2RNAA 2LMJA 4D8DA 1BBZA 2CT4A 1AWWA 3VRZA 1J3TA 4EIKA 4RTZA 1HD3A 1OOTA 3VS2A 3FJ5A 1M3BA 1AWJA 2J6OA 3M0SA 2LX7A 1Z9ZA 1E7OA 5HCKA 2V1QA 3I35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PE0 A;  4F17 A;  2DL8 A;  5EC7 A;  1PNJ A;  2HSP A;  2KT8 A;  2D8J A;  2C0T A;  2JS0 A;  2LJ0 A;  2O88 A;  2K2M A;  1JXO A;  2VVK A;  1WYX A;  1K9A A;  2HEQ A;  4LN2 A;  2L3P A;  2CSQ A;  2KBT A;  2QDL A;  2K7A A;  2W10 A;  2MOX A;  4WCI A;  1SEM A;  3A98 A;  1PRL C;  2KEA A;  4ORZ A;  2AK5 A;  2GGR A;  2MIO A;  2PZ1 A;  2GNC A;  3UA7 A;  4IIM A;  1I0C A;  1T0J A;  2H8H A;  2BZX A;  1AWX A;  1ABQ A;  1RLP C;  1UJY A;  1ZUY A;  1QWE A;  1X69 A;  4AFQ C;  2PTK A;  1SHG A;  1MV3 A;  2DX1 A;  2ENM A;  2KE9 A;  1UDL A;  4AG1 C;  2LP5 A;  2X3X D;  1ARK A;  3QWX X;  1UHC A;  2KR3 A;  1G2B A;  4JJD A;  1E6H A;  1U3O A;  1KJW A;  1H3H A;  3VS3 A;  2LZ6 B;  4GBQ A;  2LCS A;  3SEM A;  2DA9 A;  2RQW A;  3M0P A;  3EG3 A;  2YSQ A;  1IO6 A;  2EPD A;  2FO0 A;  4Z8A A;  1WXB A;  1RI9 A;  1UFF A;  1N5Z A;  4HVW A;  3REA B;  4AFZ C;  3M0Q A;  1AVZ C;  4ESR A;  1UUE A;  1K0X A;  1H92 A;  2BZ8 A;  1X43 A;  3VS0 A;  1BK2 A;  2KGT A;  4F14 A;  2EW3 A;  1YWO A;  1JO8 A;  1GFC A;  2RPN A;  4FSS A;  1CSK A;  2RF0 A;  2DF6 A;  1K76 A;  1SPK A;  1JEG A;  2RN8 A;  1MV0 B;  5I22 A;  1UTI A;  3U23 A;  4J9F A;  1SRL A;  3H0I A;  4M4Z A;  1OEB A;  2HBW A;  2YDL A;  1PKS A;  3NPF A;  4RTY A;  1S1N A;  2J06 A;  1SSH A;  4LE9 A;  4CC3 A;  2DE0 X;  2EYY A;  2K6D A;  5IHI A;  2KRM A;  3QWY A;  4J9I A;  2KYM A;  4Z89 A;  2YT6 A;  4E6R A;  3NMZ C;  4HCK A;  2CDT A;  3VRY A;  1YP5 A;  3I5S A;  1ZBJ A;  3EG1 A;  4CC4 B;  1K4U S;  2OAW A;  2KRN A;  2A08 A;  4J9H A;  2LJ3 A;  2DIL A;  2LNH B;  5IXB A;  2LQW A;  3EHR A;  2DBK A;  3RNJ A;  1AZG B;  2J6F A;  1UE9 A;  4RTV A;  1MUZ A;  4ZNX A;  2L3Q A;  1WI7 A;  2XMF A;  4D8K A;  3VS7 A;  1SHF A;  3RBB B;  1I07 A;  1T3L A;  2RQR A;  1X27 A;  1UG1 A;  4AFS C;  2G6F X;  2W0Z A;  3REB B;  1WXT A;  5GJV B;  4DEY A;  4RTW A;  2DRM A;  1JXM A;  1W6X A;  1UGV A;  1X6G A;  1YWP A;  2JM8 A;  2DL4 A;  2GTJ A;  3VS5 A;  1GRI A;  1M3C A;  3C0C A;  2F2V A;  2IIM A;  4J9C A;  2AZS A;  4RTU A;  2K79 A;  1TUD A;  2OI3 A;  1ABO A;  2GQI A;  2KYB A;  2FPE A;  2RQT A;  3THK A;  1U06 A;  4JJB A;  4IIO A;  2K3B A;  2M51 A;  2L3S A;  4GLM A;  1OPK A;  1NEB A;  1WXU A;  2SEM A;  5FW9 A;  2RMO A;  1B3Q A;  1ZUK A;  2CUB A;  3LH5 A;  4JZ3 A;  2JT4 A;  1OV3 A;  2KT1 A;  4J9B A;  1VYT A;  2D8H A;  5I11 A;  1EFN A;  1NLO C;  1RUW A;  1KFZ A;  2EYZ A;  4LNP A;  5IHN A;  2J05 A;  2KXD A;  1NYF A;  2O9V A;  3M0U A;  2NUZ A;  4OML A;  2KRO A;  1H8K A;  2VWF A;  1GCQ C;  3M0T A;  4J9D A;  1QKW A;  4CC7 A;  1LCK A;  1GL5 A;  2FEI A;  2NWM A;  3H0H A;  1GCP A;  1E6G A;  3UAT A;  1GFD A;  2ECZ A;  1YNZ A;  1QWF A;  2ABL A;  2KNB B;  2EKH A;  3TVT A;  1NLP C;  1BU1 A;  1T3S A;  1YCS B;  3ZL7 C;  3PVL A;  4RUG A;  2JM9 A;  2L2P A;  2C0O A;  2F2W A;  2J6K A;  1GBR A;  3GBQ A;  1M27 C;  1WLP B;  3VS6 A;  3VS4 A;  1AD5 A;  4X1V A;  1YN8 A;  2VKN A;  4OMP A;  2JXB A;  1AZE A;  3JV3 A;  4LUD A;  1NEG A;  1I1J A;  2DLP A;  3SHW A;  1ZLM A;  5L23 A;  1NG2 A;  2CUD A;  2A28 A;  2J7I A;  2EGC A;  1TG0 A;  2ED0 A;  2DJQ A;  2DL3 A;  2A36 A;  2JMA A;  3EG2 A;  1U5S A;  3UF4 A;  1HJD A;  1UHF A;  1WX6 A;  2LQN A;  2O2O A;  2X3W D;  1Y0M A;  2YUN A;  1M3A A;  2AZV A;  4HVU A;  3EG0 A;  1QCF A;  1AEY A;  3CQT A;  2AKK A;  2EBP A;  3TSW A;  1ZSG A;  1NYG A;  1Y57 A;  2SRC A;  2FRY A;  2AKL A;  3O5Z A;  4RTT A;  1QKX A;  2LJ1 A;  4J9G A;  1VA7 A;  2YUQ A;  3NGP A;  1PKT A;  2DM1 A;  4K11 A;  4RTX A;  3KFV A;  4OMQ A;  2FPD A;  2DVJ A;  3EHQ A;  2HDA A;  2ED1 A;  4DEX A;  2ROL A;  2EYW A;  2RQU A;  2DBM A;  4Y92 A;  4OMM A;  2D1X A;  2O31 A;  4KRT A;  1K1Z A;  1X2Q A;  1AWO A;  2KXC A;  1VYU A;  3PVQ A;  2JMC A;  1PRM C;  1HSQ A;  2CH4 A;  4JPB W;  2RQV A;  1K0S A;  2GTO A;  1NM7 A;  2I0N A;  3IQL A;  2K9G A;  2DRK A;  2L0A A;  1SRM A;  2YUP A;  3VS1 A;  4OMN A;  1WDX A;  1JQQ A;  1V1C A;  2FPF A;  1PHT A;  4Z88 A;  5FWC A;  1CKB A;  1KSW A;  1CKA A;  1JU5 C;  1M8M A;  2DL7 A;  2FRW A;  1PWT A;  1ZX6 A;  4HVV A;  2V1R A;  4F16 A;  2EVR A;  3ULR B;  3NHN A;  2ESW A;  1BB9 A;  1WFW A;  1AOJ A;  1Z9Q A;  4OMO A;  1A0N B;  2EQI A;  2DNU A;  2FG0 A;  5GJW B;  3H0F A;  3R6N A;  2BTT A;  1FMK A;  4JJC A;  4R0K A;  1T0H A;  1VYV A;  1WA7 A;  3H41 A;  1G83 A;  2CRE A;  1FYN A;  3TSZ A;  2ROT A;  2DYB A;  3EGU A;  2KRS A;  5FWB A;  2E5K A;  1W70 A;  3UA6 A;  1X2K A;  2DL5 A;  4LUE A;  2OJ2 A;  2C0I A;  5IHK A;  3I9Q A;  2YUO A;  2JTE A;  2CSI A;  1RLQ C;  2EGE A;  1B07 A;  4J9E A;  2M0Y A;  4CC2 A;  1XOV A;  4A63 B;  2CH4 W;  1GBQ A;  5IH2 A;  4HXJ A;  1UEC A;  2P4R A;  2HCK A;  2O9S A;  1X6B A;  1TUC A;  2A37 A;  2GBQ A;  1ZUU A;  2EYX A;  1W1F A;  2B86 A;  2PNI A;  3I5R A;  4AG2 C;  2JS2 A;  1WIE A;  1M30 A;  2BZY A;  2JW4 A;  1QLY A;  2DMO A;  4AFU C;  2F2X A;  4JZ4 A;  5IXF A;  1UJ0 A;  1GCQ A;  1OPL A;  5ECA A;  1KIK A;  2D0N A;  2CT3 A;  3M0R A;  4QT7 A;  2MCN A;  2EGA A;  2RNA A;  2LMJ A;  4D8D A;  1BBZ A;  2CT4 A;  1AWW A;  3VRZ A;  1J3T A;  4EIK A;  4RTZ A;  1HD3 A;  1OOT A;  3VS2 A;  3FJ5 A;  1M3B A;  1AWJ A;  2J6O A;  3M0S A;  2LX7 A;  1Z9Z A;  1E7O A;  5HCK A;  2V1Q A;  3I35 A; 
#chains in the Genus database with same CATH topology
 1JRI A;  2I2L A;  2DL8 A;  2WAC A;  4IUP A;  3CCE A;  1QCO A;  2HSP A;  2LNV A;  2DXB A;  2KT8 A;  4B6M A;  2O4X A;  2D8J A;  2HKQ B;  2V8I A;  5LJ3 h;  1VQ9 T;  4N4G A;  4F7U G;  2RHZ A;  1MGQ A;  4PLL A;  1K9A A;  2HEQ A;  2E6N A;  5CQX A;  3CCQ Q;  3KUF A;  2KBT A;  2ZPF B;  2P84 A;  2W10 A;  2DET A;  3A98 A;  1PRL C;  2IG0 A;  2OTJ T;  2PVD B;  2GGR A;  3GLX A;  2MIO A;  4IIM A;  3RIR A;  4QQG A;  3EGX B;  3FB9 A;  2FVU A;  1X69 A;  5KYW B;  2XK0 A;  2AT1 B;  2JUF A;  4LXC A;  1UDL A;  3M4G A;  5FRM A;  2X3X D;  1YJN A;  3INZ A;  3L2R A;  3QWX X;  3RES A;  1KJW A;  3X28 B;  1UGS B;  4QVD A;  3SEM A;  3QG1 A;  5GAM j;  4JRQ A;  3M0P A;  3EG3 A;  4IKF A;  4FU6 A;  2FO0 A;  4PNO A;  3E19 A;  4Z8A A;  4PL6 A;  5FU6 B;  1UFF A;  2KSS A;  1N5Z A;  2MAM A;  1K73 U;  4ESR A;  1UUE A;  1K0X A;  3HP9 A;  1X43 A;  2VXF A;  5A2Q E;  1VQ4 Q;  2KGT A;  2ZPG B;  2RPN A;  1BIB A;  3E2U A;  2QA4 Q;  2DF6 A;  1JEG A;  3U23 A;  4QKU A;  1VQ7 Q;  4J9F A;  3C4S A;  1KD1 U;  4C8Q G;  1OEB A;  4M75 G;  2HBW A;  3NPF A;  4RTY A;  2HAX A;  5KYN A;  4HT8 A;  5IHI A;  2KRM A;  1Y96 A;  2KYM A;  1PM3 A;  1NJI C;  1RAF B;  2JJ9 A;  4HCC A;  4C0D B;  5CKE A;  3SB2 A;  3VRY A;  3I5S A;  3EG1 A;  1K4U S;  4IUV A;  4HCB A;  4XU0 A;  1ACM B;  3MPU B;  4PJL A;  2LCC A;  2YWW A;  3HL8 A;  1IHW A;  1D1B A;  2J6F A;  3OYC A;  2A7Y A;  3PNW C;  1YI2 T;  4DQ2 A;  3VS7 A;  4BY6 C;  1V76 A;  1UGP B;  1YHQ A;  2X4X A;  4FT2 A;  3M9Q A;  4AFS C;  2COW A;  4MZM A;  1WXT A;  3QDF A;  1YWP A;  2JM8 A;  3CME Q;  2L5Q A;  4E47 A;  2X51 A;  1VQ6 T;  2COZ A;  4M7D G;  3HRU A;  1VQO T;  4HA8 A;  2GQI A;  1YIJ T;  4MZP A;  2JOY A;  3CMA Q;  4ATO A;  2K3B A;  3HKS A;  3G6E A;  1M2V B;  1OPK A;  1NEB A;  4C8Q C;  3BDL A;  4M75 C;  2SEM A;  3OW2 A;  1EIF A;  3CD6 Q;  1YIT A;  4X34 A;  4M75 D;  5CR2 A;  5LJ3 g;  4V2S A;  2D8H A;  2DEU A;  1NLO C;  4B9W A;  3I56 Q;  4KGX B;  1SG5 A;  3HFN A;  3CCE Q;  4FSX A;  3G4S A;  2CP0 A;  2NUZ A;  4II1 A;  1VQK Q;  2MK5 A;  2VGM A;  4LD6 A;  4J9D A;  3HSB A;  1LCK A;  1IB8 A;  1E6G A;  1GFD A;  2ECZ A;  2HQX A;  4HCZ A;  1YNZ A;  4M78 F;  2QQ9 A;  4XTW A;  2DO3 A;  3ZL7 C;  4RUG A;  4MMK A;  4ELZ C;  2DXT A;  4NOY A;  1UB4 A;  3VUZ A;  5J3B A;  4DBF A;  1LNX A;  1AD5 A;  1BI0 A;  1S72 T;  3MHX A;  5HY6 A;  4M7D C;  3CCS T;  3JV3 A;  2DLP A;  1RAE B;  1ZLM A;  4FCY A;  5L23 A;  2DXC A;  4M7D D;  1KC8 U;  2DJQ A;  4KUD K;  4QW2 A;  3CC2 A;  5I2S A;  2ZPH B;  3EG2 A;  4J8O A;  1U5S A;  2X3W D;  1Y0M A;  5FRO A;  1M3A A;  4JDS A;  4HVU A;  3CXC A;  2YHT A;  2EBP A;  2XI9 A;  5DY9 A;  1ZHI A;  1I8F A;  3CCJ A;  5LJ3 f;  4KH1 B;  3WXM B;  1PD1 A;  2DFU A;  4RTT A;  3OW2 P;  2LJ1 A;  2E64 A;  3F70 A;  4XAX B;  3A5Z B;  1VA7 A;  3NGP A;  2DM1 A;  2QTV A;  3GPL A;  2FZG B;  1OUL A;  3EHQ A;  5GAN e;  2ED1 A;  1K73 R;  2H3E B;  2MPX C;  2NUP B;  4DEX A;  1VQL A;  1X01 A;  2RQU A;  4M7A B;  2X4W A;  4Y92 A;  2O31 A;  3OYA A;  3S6W A;  4M77 A;  2EWN A;  2HNI A;  3EG9 A;  1N6A A;  2F5K A;  3OSS C;  3QZ5 B;  1KD1 R;  1R0B G;  1K0S A;  4JLI A;  2RK2 A;  1NM7 A;  2M0O A;  1ZA1 B;  2RM4 A;  2BE7 D;  3CPF A;  4JLG A;  1O75 A;  3V8K A;  5KE2 A;  2DJZ A;  2DK3 A;  1QVG S;  2YUP A;  4C5I A;  1WDX A;  1JQQ A;  3EFR A;  1PHT A;  4Z88 A;  2E5Q A;  4EMK C;  4FW2 A;  2DL7 A;  3ZEH A;  4IUR A;  1G3W A;  1G5V A;  2DTO A;  3M59 A;  2V1R A;  3L2V A;  2JVV A;  3ULR B;  1BI2 A;  1N8R C;  3QHS A;  1G3Y A;  2FG0 A;  5GJW B;  4E7H A;  1OX9 A;  5GAN 2;  2M02 A;  2BTT A;  3A8H B;  2HL3 A;  4Z02 A;  3H41 A;  1FYN A;  1KHI A;  3TSZ A;  3QYH B;  3OMG A;  1JB0 E;  4C92 B;  4P5N A;  2WSE E;  1F1B B;  4PJO G;  1Q7Y U;  3GF5 A;  3JB9 G;  3G6E Q;  2OJ2 A;  2C06 A;  4J7F A;  3MEA A;  2DYI A;  1PSF A;  4C5E A;  3OYK A;  5L8R E;  2QEX A;  4BD3 A;  1YJW A;  2BE9 B;  3I55 A;  1SKU B;  4A63 B;  1H3Z A;  2JTM A;  4XQ3 A;  5IH2 A;  2R5A A;  3OBW A;  5GAN j;  3OYB A;  3I5R A;  3PFS A;  3OMC A;  1QLY A;  2DMO A;  3FIF A;  2K3Y A;  1JJ2 S;  2GF7 A;  2RHY A;  2RJE A;  5J26 A;  2DD4 A;  4D8D A;  2LMJ A;  2PU9 B;  1BBZ A;  1IZ6 A;  3CCU A;  1OOT A;  3CC7 A;  3VS2 A;  3CCR Q;  4N4H A;  3M0S A;  1Z9Z A;  2CYZ B;  3VKI A;  5KYY B;  2VV5 A;  1PNJ A;  3GOX A;  3FRN A;  5GMK e;  3GIB A;  5C0M A;  4OP0 A;  5LJ5 d;  4M77 G;  4M7A E;  2KY9 A;  2COY A;  2O88 A;  4XTZ A;  2K2M A;  2Z0W A;  1JXO A;  3BDU A;  4C0G A;  2VVK A;  4XTY A;  3JCM h;  4HT9 A;  4LN2 A;  3RKX A;  3CCL A;  4PJO D;  5AYF A;  2CSQ A;  1JBM A;  3HFO A;  2GFU A;  1VQP T;  1Q82 U;  4EDU A;  1G8X A;  2PZ1 A;  2GNC A;  3UA7 A;  1I0C A;  2MYS A;  4ZN1 A;  4JS4 A;  1I5L A;  2HSE B;  4XU1 A;  4M78 B;  2RB6 A;  3JCM b;  1AWX A;  4AFQ C;  4A4E A;  2PTK A;  1SHG A;  1YJ9 Q;  4JUV A;  2VYT A;  1BCO A;  2E10 A;  1PG5 B;  1VQL Q;  2EAY A;  2OTJ A;  2KR3 A;  3OYE A;  1U3O A;  1Q86 C;  1TTH B;  5GAN 8;  2DA9 A;  1IO6 A;  2EPD A;  3URG A;  4RCC A;  2RHU A;  2QK0 A;  1RI9 A;  2MMP A;  3CBO A;  1AVZ C;  1WQW A;  5GAO m;  1H92 A;  2BZ8 A;  3OYF A;  4C92 E;  3VS0 A;  4GLK A;  8ATC B;  3QKJ A;  3UT1 A;  4F14 A;  2EW3 A;  1YWO A;  1GFC A;  4DOW A;  4C8Q A;  4M75 A;  1K76 A;  4JJN K;  1UTI A;  4M77 C;  4M4Z A;  5CVI A;  2DTI A;  2YDL A;  2QQA A;  2K3X A;  4LE9 A;  3PIP A;  1PSE A;  4C0F A;  2EYY A;  3P8D A;  5C6S A;  1FX7 A;  2K6D A;  3ASK A;  2RJF A;  3CC7 T;  2V26 A;  3QWY A;  4F04 B;  3EFS A;  3RKW A;  4FT4 A;  1MMA A;  1P92 A;  2YT6 A;  4E6R A;  5CK9 A;  4RKU E;  3NMZ C;  1NBE B;  4HCK A;  1LPL A;  1VQN Q;  2CDT A;  2PUO B;  4R56 A;  5KYX B;  4LD9 K;  5GMK j;  1ZA2 B;  1Q95 G;  3X26 B;  3QBY A;  4CC4 B;  1WJQ A;  2KRN A;  2A08 A;  2OAW A;  4J9H A;  2VB6 A;  4ZTF A;  2E41 A;  3LWH A;  3EHR A;  2DBK A;  3VUB A;  4IUU A;  1MUZ A;  1AT1 B;  3SWN C;  4MZT A;  4JRI A;  1PD0 A;  1M4Z A;  2XMF A;  5FLX E;  4D8K A;  3CCL T;  4LDX A;  1N9R A;  1SHF A;  1I07 A;  1C6V X;  2EQJ A;  3FEO A;  4RG8 A;  2RQR A;  3M4Y A;  1UG1 A;  2KI7 A;  3DB4 A;  2W0Z A;  1TUG B;  1Q7Y R;  2QEX Q;  2DRM A;  2DZ9 A;  3JCM V;  1W6X A;  1UGV A;  4M7D A;  2E1H A;  2DL4 A;  2GTJ A;  3I55 Q;  2ZZD A;  4PFP A;  3OB9 A;  2GQV A;  2JZ2 A;  3JAM E;  3LH0 A;  3PIO A;  2F2V A;  2IIM A;  2QAZ A;  1YI2 A;  3BE3 A;  2AZS A;  5D6X A;  1VQ4 T;  3MKD A;  2BKD N;  2XIC A;  5GAM h;  3OS5 A;  3QO3 A;  4ZGD B;  2QA4 T;  2K57 A;  2IPO B;  2FPE A;  4DA4 A;  2XU8 A;  4E7I A;  3S3O A;  1U06 A;  2M51 A;  3JCM Q;  4M7A F;  1VQ6 A;  1K8A R;  1WXU A;  1D1A A;  2PVG B;  5FW9 A;  1QVF S;  2O4X B;  4XTU A;  2R5M A;  2VGN A;  1W4S A;  2DVE A;  4JZ3 A;  1VQO A;  2HQH A;  1OV3 A;  4M78 E;  2KT1 A;  4J9B A;  2HMA A;  2R57 A;  4RMO A;  1YIJ A;  5I11 A;  1O9S A;  3JCM g;  5AT1 B;  5GAN d;  3E9F A;  3M55 A;  4F7U E;  4X9D A;  2KRO A;  2YRD A;  3M0T A;  2FEI A;  2ZPB B;  4PJN A;  5M9O A;  1IRX A;  3RDV A;  2VC8 A;  2ABL A;  2KNB B;  3V7S A;  4DOV A;  3GP8 A;  3CPW S;  2DZC A;  1BU1 A;  1T3S A;  1FXX A;  3PVL A;  1IGQ A;  3C95 A;  5FU7 C;  3J81 E;  2JM9 A;  2JTF A;  2F2W A;  2J6K A;  2CP3 A;  1GBR A;  3GBQ A;  3CCV T;  3VS4 A;  4EMK A;  1YN8 A;  5GMK l;  1K73 C;  3CCM Q;  2VKN A;  4N0A C;  4OMP A;  1VQ9 Q;  2CKK A;  1AZE A;  4GY5 A;  3EH1 A;  1Q82 R;  4C92 F;  1NEG A;  4A54 A;  2KAF A;  1IXD A;  5LJ5 e;  2LTO A;  2QQS A;  2L3R A;  3MET A;  3SHW A;  3D7S B;  3FLG A;  3X20 B;  3L2Q A;  1MHN A;  4J83 A;  2J7I A;  2P4T A;  2EGC A;  3JRZ A;  1KD1 C;  3CMA T;  3JB9 I;  1WGS A;  3V7R A;  1S72 A;  3UF4 A;  4EMH A;  3CC4 Q;  2YUN A;  3G7Z A;  4BE0 A;  4M78 D;  2AZV A;  2RJC A;  1D3B A;  3CCS A;  1YBY A;  2EJF A;  3CD6 T;  2AKK A;  2Y4X A;  1QVG A;  3A8L B;  3HPW A;  3HTR A;  1ZSG A;  4Q5W A;  1Y57 A;  2SRC A;  3I56 T;  2OX7 A;  3O5Z A;  1ZSZ B;  3OYY A;  4KH0 B;  3JCM f;  2CP7 A;  4BDZ A;  2LT1 A;  1Y96 B;  3L1A A;  4K11 A;  1VQK T;  1PKT A;  1QMC A;  2CS7 A;  5KH6 A;  3NTK A;  2FPD A;  2DVJ A;  2HDA A;  4BE1 A;  9ATC B;  1B7T A;  2E6Z A;  2QGF B;  2D1X A;  2MWP A;  1X2Q A;  1M9S A;  4KUI A;  1M2V A;  1VQ5 Q;  2JMC A;  1PRM C;  4XTV A;  4JPB W;  2RQV A;  2GTO A;  3TU4 K;  1VQ8 Q;  4WTO B;  3H8Z A;  1WQ7 A;  4E7S A;  2DRK A;  3RR6 A;  4FYX B;  1SRM A;  3VS1 A;  4OMN A;  3PMI A;  1M8V A;  2F1L A;  3SFM A;  3LYI A;  1V1C A;  3H9N A;  4A53 A;  1CKB A;  3M54 A;  1JU5 C;  1M8M A;  2QAS A;  4BI3 A;  2P0K A;  3JCM c;  3NHN A;  2QTX A;  2XDB A;  5GAM g;  1DJ7 B;  2E3H A;  1AOJ A;  5FRN A;  2K2V A;  3TQ7 P;  4BAC A;  3C12 A;  3RKY A;  3OYD A;  3UPU A;  5LJ5 j;  1T0H A;  1WA7 A;  2EIF A;  2FL7 A;  1G83 A;  3V8J A;  1NZ9 A;  4QVC A;  1RL2 A;  4PJO A;  3KBG A;  1C1A A;  1WZO A;  3CBP A;  4F7U F;  1QVG P;  1KHC A;  1WJS A;  2KRS A;  4OVA A;  3OY9 A;  1XNI A;  3L2U A;  2E5K A;  3UA6 A;  4LUE A;  2LT4 A;  5IHK A;  3AT1 B;  2JNG A;  2JTE A;  2CSI A;  1N27 A;  2M1H A;  5GAO q;  2CP2 A;  3L42 A;  2WSF E;  2CP5 A;  2EGE A;  1YJN Q;  1YIJ Q;  5DM7 R;  1Y71 A;  1QP3 A;  2D6F A;  1IHV A;  1QQJ A;  1GBQ A;  1D09 B;  4HXJ A;  4NS5 A;  1VIE A;  2A37 A;  5D6Y A;  1ZUU A;  2EYX A;  3JB9 J;  1WIE A;  2QDY B;  2BZY A;  2F2X A;  1KC8 C;  2F69 A;  1RAI B;  2R58 A;  2XG8 D;  3P8H A;  1OX8 A;  5ECA A;  1KIK A;  4OB2 B;  1I81 A;  1M1K U;  1Y07 A;  3JCM X;  4QT7 A;  5CIU A;  2MCN A;  2RNA A;  3LGL A;  5GAM f;  3HHT B;  5KCH A;  4DBH A;  1QW1 A;  1AWW A;  2P0Q A;  5FU6 C;  3VRZ A;  4D6W A;  4EIK A;  3FJ5 A;  4MML A;  4RG2 A;  1UGQ B;  2G3R A;  2V1Q A;  3I35 A;  4R0K A;  7AT1 B;  4F17 A;  3MP8 A;  5EC7 A;  4C8Q F;  1BYM A;  4FYY B;  3QJY A;  1I4K 1;  2C0T A;  5LJ3 d;  2JS0 A;  1IGU A;  3X25 B;  3MEU A;  1JJ2 P;  1VQM A;  2YLB A;  2WSC E;  3OS0 A;  1ZQ1 A;  2QDL A;  4LDV A;  4WCI A;  1SEM A;  2KEA A;  2FYK A;  4C0D C;  2MWO A;  3MP6 A;  2XID A;  4E7K A;  1T0J A;  2CP6 A;  2BZX A;  1MNE A;  1YHQ Q;  3RMS A;  1ABQ A;  1UJY A;  3M56 A;  4AT1 B;  1QWE A;  1OQK A;  3MEW A;  3EG9 B;  3SWN A;  3JSC A;  2ENM A;  2KE9 A;  3LW5 E;  4AG1 C;  2RI5 A;  4VUB A;  2LP5 A;  3DLM A;  3EFO A;  4J6X A;  3UWN A;  3TRE A;  1VQP A;  1K9M R;  4IUT A;  2XDP A;  2LQK A;  1G2B A;  4JJD A;  1HK9 A;  3VS3 A;  2LZ6 B;  4ELY C;  5GAN h;  3QSU A;  4GBQ A;  2LCS A;  1ZBX A;  1VUB A;  2VUB A;  2X35 A;  4HVW A;  3LWI A;  2E65 A;  4AFZ C;  3M0Q A;  2MI6 A;  1RI0 A;  4OGE A;  1YIT Q;  1CSK A;  2RF0 A;  1SPK A;  5I22 A;  1MV0 B;  1Q7Y C;  4BUG A;  4E7L A;  2DIG A;  1SRL A;  3H0I A;  4KBM B;  2DKG A;  3G4S Q;  3QXE B;  2J06 A;  3NTH A;  3PMT A;  4CC3 A;  4KUL A;  1K8A U;  2A0F B;  2CGH A;  4FYW B;  4Z89 A;  1RAH B;  3GNF B;  5KE3 A;  2RD1 A;  2H3J A;  1KQS S;  2QQR A;  4J6Y A;  2LJ3 A;  2LQW A;  4M7A G;  2V8K A;  1UE9 A;  4ZNX A;  2L3Q A;  2DIQ A;  1VQM T;  2OTL T;  1QVF A;  1OI1 A;  6AT1 B;  3QDR B;  1T3L A;  1M2O A;  3RUX A;  4N0A A;  4DEY A;  4RTW A;  1X6G A;  2NYS A;  3T9N A;  4PJO C;  2ZPE B;  3CC2 Q;  3VS5 A;  3FJP A;  2K5I A;  3HRS A;  2LVM A;  5I21 A;  2LCL A;  1WHL A;  2K79 A;  2OI3 A;  4PFZ A;  3M57 A;  3QZ9 B;  3CPW A;  1ABO A;  3CCJ Q;  5FU7 B;  3FC3 A;  3THK A;  3MEV A;  2KQW A;  3LX7 A;  3CXC S;  1B34 A;  3QYG B;  3N5B B;  4FIB A;  2RMO A;  4F7U B;  3FDR A;  3MP1 A;  4E2F B;  1RAC B;  1VQ4 A;  1Q82 C;  3LH5 A;  3VU3 C;  1LVK A;  3G71 T;  2JT4 A;  4PFO A;  2QA4 A;  2JN0 A;  1TSF A;  2RO0 A;  1VYT A;  1M1K R;  4JRK A;  1RUW A;  4M77 E;  4C92 G;  5IHN A;  2AIR B;  2J05 A;  2LRQ A;  4OML A;  5KYU A;  2VWF A;  2RK1 A;  2NWM A;  3OYI A;  1N9S A;  2PUK B;  3H0H A;  4XU3 A;  3TEE A;  4CRI A;  2CZ6 B;  2E3I A;  3NTI A;  4M7A C;  2EJG A;  2EKH A;  3TVT A;  1UEB A;  1NLP C;  5GMK h;  2RJD A;  4BY6 B;  4XU2 A;  4M7A D;  2LC4 A;  4Y91 A;  3C94 A;  1QVF P;  1M27 C;  4OB3 B;  4X1V A;  2DD5 A;  4UC4 A;  2XDD A;  3CCQ T;  4LUD A;  5KYX A;  1D1C A;  2FHD A;  5LJ3 e;  1WJR A;  5GMK m;  3S3M A;  1RAA B;  4FW1 A;  2CUD A;  2ZGW A;  3RMQ A;  3PTA A;  4PK4 A;  3CCV A;  4LDW A;  1U1S A;  1N8R R;  1I5O B;  2NUT B;  2A36 A;  3RER A;  4WF2 A;  1UHF A;  1WX6 A;  2LQN A;  3CPW P;  4C8Q B;  4M75 B;  4FM4 B;  3EG0 A;  1OYX A;  1IRE B;  3CQT A;  3TSW A;  3E9G A;  3VV0 A;  4XK8 E;  5GAN 3;  3SDZ A;  2FRY A;  3V8L A;  2AKL A;  2FZC B;  3CMA A;  1TOV A;  3JB9 F;  2YUQ A;  4J7I A;  4RTX A;  3KFV A;  1TXQ A;  4OMQ A;  2E4H A;  1QVP A;  1SF9 A;  1YJW Q;  3EH2 A;  4C92 D;  5IAY A;  1MMG A;  3CD6 A;  5EG2 A;  5GMK i;  3Q1J A;  4J6W A;  3OS1 A;  2EYW A;  2K5F A;  4DBQ A;  4KRT A;  3I56 A;  3EGX A;  3TCJ A;  1AWO A;  1AHJ B;  2DXU A;  2QQB A;  2XD0 A;  4N4I A;  5KYW A;  1VYU A;  1VQK A;  3L2W A;  4M78 G;  3EGD B;  3UDC A;  1VQ7 T;  1U8R A;  3CCM T;  2K9G A;  5GAN f;  5HK0 A;  4PKC C;  2QGG A;  1LJO A;  1BIA A;  4BDY A;  1NPP A;  3DKM A;  3CCU Q;  4M7D B;  5FWC A;  1KSW A;  3CC7 Q;  1CKA A;  1TWB A;  2FRW A;  1PWT A;  4HVV A;  1GXI E;  2EVR A;  1WHG A;  2ESW A;  3WVD B;  5GAN 6;  1OZ3 A;  4C0Z A;  4OMO A;  3CC4 T;  1A0N B;  4QVZ A;  5A0G A;  5GAN 7;  2EFI A;  2DNU A;  3H0F A;  1OU9 A;  1BI3 A;  5GAN 5;  1FMK A;  4JJC A;  1VYV A;  5LJ3 j;  3CCL Q;  2HL5 C;  4M77 F;  2BUD A;  3R6O A;  1MMN A;  3DLL A;  4JS5 A;  3OYM A;  2ROT A;  2DAQ A;  4LDU A;  1VIF A;  3EGU A;  5D6W A;  3MCA B;  5GAO l;  5J39 A;  1H64 1;  3CME T;  1W70 A;  4A4G A;  1FWZ A;  1X2K A;  2DL5 A;  2CZ1 B;  2C0I A;  3OYH A;  4BI8 B;  1Q81 R;  2DPP B;  4E7Z A;  3I9Q A;  3VYH B;  3OYJ A;  4NL3 A;  2E12 A;  3LGF A;  2BIV A;  4YTL A;  3QJ6 A;  4TVR A;  1VQ5 T;  4DBR A;  2PVO B;  4KGV B;  2OTJ Q;  1NJI U;  4J9E A;  2M0Y A;  1W2B S;  4CC2 A;  4M78 C;  5IN1 A;  1VQ8 T;  4FL6 A;  1LOJ A;  2P4R A;  2O9S A;  3AHU A;  1X6B A;  1TUC A;  1EZZ B;  1ZSZ A;  2GBQ A;  1W1F A;  2B86 A;  1R0C B;  4EMK B;  2JS2 A;  1M30 A;  3G1J A;  2EYQ A;  4JZ4 A;  1K9M U;  5CKF A;  1GCQ A;  1OPL A;  1Q86 R;  1MND A;  1YFN A;  1M90 R;  4IUQ A;  1RAB B;  4C8Q E;  4M75 E;  3CCE T;  2Y4Y A;  1WHJ A;  4OF1 A;  4Y28 E;  1D0Y A;  3M58 A;  1J3T A;  1HD3 A;  1M3B A;  1AWJ A;  2LX7 A;  1K9M C;  1KG1 A;  5GAO p;  1M1F A;  3PE0 A;  1D3B B;  3CEY A;  2XHC A;  3M5A A;  2ZAE A;  3JB9 H;  2AHJ B;  1EX4 A;  3CCV Q;  2LJ0 A;  4KT0 E;  5LJ5 h;  1XQH A;  2EQM A;  1PC0 A;  4NL2 A;  3OA6 A;  3JCM d;  3HRT A;  1WYX A;  5GAO n;  2L3P A;  3A1P A;  4J5Y A;  2K7A A;  2P0P A;  2MOX A;  3CBM A;  1YJN T;  4ORZ A;  2AK5 A;  2H8H A;  1G3T A;  4MDX A;  1RLP C;  5GAN 4;  1ZUY A;  2HD0 A;  4M7D E;  1MV3 A;  2DX1 A;  3KXT A;  3OSV A;  3LLR A;  4EPC A;  1V29 B;  2HQE A;  4C8Q D;  1ARK A;  2DER A;  1UHC A;  1YI2 Q;  1TH7 A;  2CZ7 B;  1E6H A;  1RAD B;  1M5Q 1;  2Y90 A;  4ZGE B;  1H3H A;  2HZY A;  1JJ2 A;  4ZGJ B;  2K5L A;  2RQW A;  2YSQ A;  8AT1 B;  1WXB A;  1KQS A;  1VQ6 Q;  3REA B;  5D7U A;  3ZBD A;  1R77 A;  4RCB A;  3BY7 A;  3QPH A;  1BK2 A;  2IVW A;  2QI2 A;  1JO8 A;  2EQU A;  1VQO Q;  4FSS A;  1WHH A;  1U1T A;  3OBY A;  2RN8 A;  3OQ5 A;  5CQY A;  4PJO B;  2GCX A;  3CCR A;  2QYZ A;  1PKS A;  1S1N A;  2CZ0 B;  1SSH A;  2ZPI B;  2DE0 X;  5LL6 S;  1OU8 A;  5HKC A;  4J9I A;  2PQW A;  3BW1 A;  2YRV A;  1YCY A;  1YP5 A;  1YHQ T;  2YRC A;  1KQ2 A;  1ZBJ A;  2NUP A;  4ZN3 A;  2M16 A;  4M7A A;  5CKB A;  2DIL A;  2LNH B;  2RHI A;  4C5H A;  3PT9 A;  5IXB A;  4L5G A;  3RNJ A;  3EAE A;  1AZG B;  1C0M A;  2D0Q B;  2X9H A;  4RTV A;  1XJW B;  1WI7 A;  2X4J A;  2F5T X;  2M9U A;  1HYO A;  2L8D A;  3RBB B;  2DTH A;  1M1K C;  4MDW A;  1X27 A;  4M75 F;  3J7A F;  2LDM A;  2G6F X;  3REB B;  5GJV B;  5HK3 A;  1YJ9 A;  1JXM A;  2VAS A;  3L2Z A;  5CCA A;  3E1S A;  3G6E T;  1GRI A;  1M3C A;  1S72 Q;  3C0C A;  2OTL A;  4J9C A;  3CCS Q;  5GAM d;  1BKB A;  1TUD A;  1KQS P;  3MO8 A;  1YIT T;  1NJI R;  2HKN A;  5CO7 A;  2O01 E;  2KYB A;  2RQT A;  2FZK B;  3OS2 A;  4JJB A;  4IIO A;  2L3S A;  4GLM A;  3G4S T;  3BFM A;  4JRP A;  2OAU A;  4M77 B;  2K4Y A;  1N8R U;  1X6O A;  1R8O B;  1WHM A;  1B3Q A;  1ZUK A;  2EJ9 A;  2YXY A;  5A0D A;  2CUB A;  4C92 A;  5A0L A;  2RH2 A;  5CAI A;  5LJ5 g;  3A8O B;  2FB7 A;  4O5V A;  2VXE A;  1ZSZ C;  1EFN A;  1KFZ A;  2EYZ A;  4LNP A;  2KXD A;  1NYF A;  1FMV A;  2GFA A;  2O9V A;  3M0U A;  3PGG A;  4M7D F;  1RAG B;  1H8K A;  1GCQ C;  2E70 A;  4CC7 A;  1QKW A;  1GL5 A;  2A3L A;  3A8G B;  1GCP A;  3UAT A;  1G3S A;  2KMT A;  3CCR T;  1QWF A;  3G71 A;  3M53 A;  1OZ2 A;  2HBP A;  3SWN B;  1VQN A;  3ZFJ A;  1YCS B;  4QQ6 A;  1QCN A;  5CKH A;  3CXC P;  3EFO B;  2L2P A;  2C0O A;  4OB0 B;  3O8V A;  3OW2 S;  2ZCF B;  3ME9 A;  4ME7 A;  4AMC A;  2D9T A;  1WLP B;  3VS6 A;  4C5G A;  3CC2 T;  1VOM A;  2YLC A;  2RHX A;  5I2M A;  2JXB A;  2LQ8 A;  4X9C A;  3X24 B;  1PCX A;  1I1J A;  1TU0 B;  3S3N A;  4A4H A;  1NG2 A;  3CCJ T;  3JCM e;  4ANJ A;  2A28 A;  4PJO E;  1WNL A;  1NE8 A;  1TG0 A;  2ED0 A;  2DL3 A;  4E7J A;  1QP2 A;  2JMA A;  1HJD A;  5GAO r;  1K8A C;  1YJ9 T;  2O2O A;  5KYY A;  3CCQ A;  1QCF A;  1AEY A;  1D0X A;  3ER0 A;  2DEQ A;  1VQL T;  2X4Y A;  5LJ5 f;  1KK7 A;  4XTX A;  1NYG A;  2QG9 B;  3H6Z A;  1WHK A;  1X75 C;  4R55 A;  3OYN A;  1QKX A;  2LX9 A;  4J9G A;  3QUI A;  3V7C A;  1BCM A;  4L59 A;  4OMF B;  2ROL A;  2DBM A;  4OMM A;  1Q81 U;  1K1Z A;  4M78 A;  2KXC A;  2RI3 A;  2L89 A;  4A4F A;  3PVQ A;  2ATC B;  3NFC A;  3WVE B;  1HSQ A;  2CH4 A;  4F7U A;  5DLQ E;  2I0N A;  3IQL A;  2L0A A;  4BE2 A;  1Q81 C;  1BI1 A;  3JCM J;  2V8J A;  2FPF A;  4ZTJ A;  3JB9 D;  5KCO A;  1TS9 A;  1MMD A;  1KC8 R;  1ZX6 A;  2RI2 A;  1VQN T;  4F16 A;  3MJX A;  1VQ7 A;  4PLI A;  1BB9 A;  1Q86 U;  1M90 U;  3CCM A;  4CI0 C;  1WFW A;  3DB3 A;  1W2B A;  1VQ9 A;  1Z9Q A;  2EQI A;  3SD4 A;  2NLU A;  4B9X A;  4OB1 B;  3R6N A;  1B34 B;  3P8B B;  1VQM Q;  2OTL Q;  2KVQ G;  4EMG A;  2CRE A;  4KGZ B;  3OYL A;  1M90 C;  3VJP A;  2DYB A;  2QEX T;  3JCM W;  3CC4 A;  1YJW T;  5FWB A;  1M1G A;  2RA2 A;  3I55 T;  4PJM A;  2B8A A;  4A4K A;  3A8M B;  5GAN g;  2KK4 A;  3JCM P;  3OYG A;  3J80 E;  2YUO A;  1SSF A;  5KYU B;  2NUT A;  1RLQ C;  1VQP Q;  1B07 A;  1NPR A;  5CKD A;  1D0Z A;  1XOV A;  3CME A;  4OGC A;  5GAM e;  2CH4 W;  1HXD A;  2KDS A;  1UEC A;  5DLO A;  2HCK A;  2EKO A;  1FMW A;  4O6J A;  3CCU T;  1UGR B;  2PNI A;  4AG2 C;  4PJJ A;  4LDY A;  4M77 D;  2JW4 A;  3GNG A;  1VQ5 A;  4FYV B;  4AFU C;  3G71 Q;  4L6V 5;  1Y7X A;  5IXF A;  1UJ0 A;  4PJO F;  2QXF A;  2D0N A;  2XKO C;  2CT3 A;  4C92 C;  3M0R A;  4QQD A;  1VQ8 A;  2EGA A;  2MF2 A;  1WPY A;  2CT4 A;  3VYG A;  3QII A;  4RTZ A;  4BI4 A;  1XTD A;  4HKE A;  2J6O A;  5IT9 E;  3EGD A;  2EQK A;  1E7O A;  1KQ1 A;  4BB7 A;  5HCK A;  1W2B P;  4RTU A; 
#chains in the Genus database with same CATH homology
 3PE0 A;  4F17 A;  2DL8 A;  5EC7 A;  1PNJ A;  2HSP A;  2KT8 A;  2D8J A;  2C0T A;  2JS0 A;  2LJ0 A;  2O88 A;  2K2M A;  1JXO A;  2VVK A;  1WYX A;  1K9A A;  2HEQ A;  4LN2 A;  2L3P A;  2CSQ A;  2KBT A;  2QDL A;  2K7A A;  2W10 A;  2MOX A;  4WCI A;  1SEM A;  3A98 A;  1PRL C;  2KEA A;  4ORZ A;  2AK5 A;  2GGR A;  2MIO A;  2PZ1 A;  2GNC A;  3UA7 A;  4IIM A;  1I0C A;  1T0J A;  2H8H A;  2BZX A;  1AWX A;  1ABQ A;  1RLP C;  1UJY A;  1ZUY A;  1QWE A;  1X69 A;  4AFQ C;  2PTK A;  1SHG A;  1MV3 A;  2DX1 A;  2ENM A;  2KE9 A;  1UDL A;  4AG1 C;  2LP5 A;  2X3X D;  1ARK A;  3QWX X;  1UHC A;  2KR3 A;  1G2B A;  4JJD A;  1E6H A;  1U3O A;  1KJW A;  1H3H A;  3VS3 A;  2LZ6 B;  4GBQ A;  2LCS A;  3SEM A;  2DA9 A;  2RQW A;  3M0P A;  3EG3 A;  2YSQ A;  1IO6 A;  2EPD A;  2FO0 A;  4Z8A A;  1WXB A;  1RI9 A;  1UFF A;  1N5Z A;  4HVW A;  3REA B;  4AFZ C;  3M0Q A;  1AVZ C;  4ESR A;  1UUE A;  1K0X A;  1H92 A;  2BZ8 A;  1X43 A;  3VS0 A;  1BK2 A;  2KGT A;  4F14 A;  2EW3 A;  1YWO A;  1JO8 A;  1GFC A;  2RPN A;  4FSS A;  1CSK A;  2RF0 A;  2DF6 A;  1K76 A;  1SPK A;  1JEG A;  2RN8 A;  1MV0 B;  5I22 A;  1UTI A;  3U23 A;  4J9F A;  1SRL A;  3H0I A;  4M4Z A;  1OEB A;  2HBW A;  2YDL A;  1PKS A;  3NPF A;  4RTY A;  1S1N A;  2J06 A;  1SSH A;  4LE9 A;  4CC3 A;  2DE0 X;  2EYY A;  2K6D A;  5IHI A;  2KRM A;  3QWY A;  4J9I A;  2KYM A;  4Z89 A;  2YT6 A;  4E6R A;  3NMZ C;  4HCK A;  2CDT A;  3VRY A;  1YP5 A;  3I5S A;  1ZBJ A;  3EG1 A;  4CC4 B;  1K4U S;  2OAW A;  2KRN A;  2A08 A;  4J9H A;  2LJ3 A;  2DIL A;  2LNH B;  5IXB A;  2LQW A;  3EHR A;  2DBK A;  3RNJ A;  1AZG B;  2J6F A;  1UE9 A;  4RTV A;  1MUZ A;  4ZNX A;  2L3Q A;  1WI7 A;  2XMF A;  4D8K A;  3VS7 A;  1SHF A;  3RBB B;  1I07 A;  1T3L A;  2RQR A;  1X27 A;  1UG1 A;  4AFS C;  2G6F X;  2W0Z A;  3REB B;  1WXT A;  5GJV B;  4DEY A;  4RTW A;  2DRM A;  1JXM A;  1W6X A;  1UGV A;  1X6G A;  1YWP A;  2JM8 A;  2DL4 A;  2GTJ A;  3VS5 A;  1GRI A;  1M3C A;  3C0C A;  2F2V A;  2IIM A;  4J9C A;  2AZS A;  4RTU A;  2K79 A;  1TUD A;  2OI3 A;  1ABO A;  2GQI A;  2KYB A;  2FPE A;  2RQT A;  3THK A;  1U06 A;  4JJB A;  4IIO A;  2K3B A;  2M51 A;  2L3S A;  4GLM A;  1OPK A;  1NEB A;  1WXU A;  2SEM A;  5FW9 A;  2RMO A;  1B3Q A;  1ZUK A;  2CUB A;  3LH5 A;  4JZ3 A;  2JT4 A;  1OV3 A;  2KT1 A;  4J9B A;  1VYT A;  2D8H A;  5I11 A;  1EFN A;  1NLO C;  1RUW A;  1KFZ A;  2EYZ A;  4LNP A;  5IHN A;  2J05 A;  2KXD A;  1NYF A;  2O9V A;  3M0U A;  2NUZ A;  4OML A;  2KRO A;  1H8K A;  2VWF A;  1GCQ C;  3M0T A;  4J9D A;  1QKW A;  4CC7 A;  1LCK A;  1GL5 A;  2FEI A;  2NWM A;  3H0H A;  1GCP A;  1E6G A;  3UAT A;  1GFD A;  2ECZ A;  1YNZ A;  1QWF A;  2ABL A;  2KNB B;  2EKH A;  3TVT A;  1NLP C;  1BU1 A;  1T3S A;  1YCS B;  3ZL7 C;  3PVL A;  4RUG A;  2JM9 A;  2L2P A;  2C0O A;  2F2W A;  2J6K A;  1GBR A;  3GBQ A;  1M27 C;  1WLP B;  3VS6 A;  3VS4 A;  1AD5 A;  4X1V A;  1YN8 A;  2VKN A;  4OMP A;  2JXB A;  1AZE A;  3JV3 A;  4LUD A;  1NEG A;  1I1J A;  2DLP A;  3SHW A;  1ZLM A;  5L23 A;  1NG2 A;  2CUD A;  2A28 A;  2J7I A;  2EGC A;  1TG0 A;  2ED0 A;  2DJQ A;  2DL3 A;  2A36 A;  2JMA A;  3EG2 A;  1U5S A;  3UF4 A;  1HJD A;  1UHF A;  1WX6 A;  2LQN A;  2O2O A;  2X3W D;  1Y0M A;  2YUN A;  1M3A A;  2AZV A;  4HVU A;  3EG0 A;  1QCF A;  1AEY A;  3CQT A;  2AKK A;  2EBP A;  3TSW A;  1ZSG A;  1NYG A;  1Y57 A;  2SRC A;  2FRY A;  2AKL A;  3O5Z A;  4RTT A;  1QKX A;  2LJ1 A;  4J9G A;  1VA7 A;  2YUQ A;  3NGP A;  1PKT A;  2DM1 A;  4K11 A;  4RTX A;  3KFV A;  4OMQ A;  2FPD A;  2DVJ A;  3EHQ A;  2HDA A;  2ED1 A;  4DEX A;  2ROL A;  2EYW A;  2RQU A;  2DBM A;  4Y92 A;  4OMM A;  2D1X A;  2O31 A;  4KRT A;  1K1Z A;  1X2Q A;  1AWO A;  2KXC A;  1VYU A;  3PVQ A;  2JMC A;  1PRM C;  1HSQ A;  2CH4 A;  4JPB W;  2RQV A;  1K0S A;  2GTO A;  1NM7 A;  2I0N A;  3IQL A;  2K9G A;  2DRK A;  2L0A A;  1SRM A;  2YUP A;  3VS1 A;  4OMN A;  1WDX A;  1JQQ A;  1V1C A;  2FPF A;  1PHT A;  4Z88 A;  5FWC A;  1CKB A;  1KSW A;  1CKA A;  1JU5 C;  1M8M A;  2DL7 A;  2FRW A;  1PWT A;  1ZX6 A;  4HVV A;  2V1R A;  4F16 A;  2EVR A;  3ULR B;  3NHN A;  2ESW A;  1BB9 A;  1WFW A;  1AOJ A;  1Z9Q A;  4OMO A;  1A0N B;  2EQI A;  2DNU A;  2FG0 A;  5GJW B;  3H0F A;  3R6N A;  2BTT A;  1FMK A;  4JJC A;  4R0K A;  1T0H A;  1VYV A;  1WA7 A;  3H41 A;  1G83 A;  2CRE A;  1FYN A;  3TSZ A;  2ROT A;  2DYB A;  3EGU A;  2KRS A;  5FWB A;  2E5K A;  1W70 A;  3UA6 A;  1X2K A;  2DL5 A;  4LUE A;  2OJ2 A;  2C0I A;  5IHK A;  3I9Q A;  2YUO A;  2JTE A;  2CSI A;  1RLQ C;  2EGE A;  1B07 A;  4J9E A;  2M0Y A;  4CC2 A;  1XOV A;  4A63 B;  2CH4 W;  1GBQ A;  5IH2 A;  4HXJ A;  1UEC A;  2P4R A;  2HCK A;  2O9S A;  1X6B A;  1TUC A;  2A37 A;  2GBQ A;  1ZUU A;  2EYX A;  1W1F A;  2B86 A;  2PNI A;  3I5R A;  4AG2 C;  2JS2 A;  1WIE A;  1M30 A;  2BZY A;  2JW4 A;  1QLY A;  2DMO A;  4AFU C;  2F2X A;  4JZ4 A;  5IXF A;  1UJ0 A;  1GCQ A;  1OPL A;  5ECA A;  1KIK A;  2D0N A;  2CT3 A;  3M0R A;  4QT7 A;  2MCN A;  2EGA A;  2RNA A;  2LMJ A;  4D8D A;  1BBZ A;  2CT4 A;  1AWW A;  3VRZ A;  1J3T A;  4EIK A;  4RTZ A;  1HD3 A;  1OOT A;  3VS2 A;  3FJ5 A;  1M3B A;  1AWJ A;  2J6O A;  3M0S A;  2LX7 A;  1Z9Z A;  1E7O A;  5HCK A;  2V1Q A;  3I35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...