5FWCA

Human spectrin sh3 domain d48g, e7a, k60a
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
KALVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNGRQGFVPAAYVKALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human Spectrin SH3 Domain D48G, E7A, K60A
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords SPECTRIN ALPHA CHAIN, NON-ERYTHROCYTIC 1
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5fwcA00
4LUEA 3TVTA 2DE0X 2E5KA 4JJCA 2FPDA 3M0QA 2A28A 3REAB 1GBRA 3CQTA 1W70A 2JS0A 1ZUYA 1X69A 5FWCA 1SSHA 1UFFA 1UHFA 2IIMA 2ESWA 1BB9A 4X1VA 1BU1A 4OMQA 1QWFA 1MV0B 2LJ3A 2PNIA 1PKTA 2O31A 3H0FA 1WXTA 3M0PA 2MIOA 4HCKA 1KJWA 2G6FX 3THKA 2JT4A 2KXDA 1RLPC 2SEMA 2AKLA 4J9FA 4CC2A 1WXUA 2YDLA 1AWJA 3SHWA 1AOJA 2DL5A 3VS7A 1T3LA 3O5ZA 1I1JA 4Z8AA 1B3QA 2D1XA 1G83A 2OJ2A 1ZX6A 2GTOA 2CH4A 3EG1A 2MOXA 2W0ZA 2ED0A 2V1QA 3EHRA 4F14A 2F2WA 4RTXA 2LNHB 2HDAA 2C0OA 3TSZA 3A98A 2M51A 1NLOC 1WA7A 3EG0A 2C0IA 3GBQA 1TUDA 3H0HA 1QWEA 4J9CA 4OMOA 4EIKA 1YNZA 2OAWA 2LQWA 1AWWA 1GFDA 1X27A 2J6KA 5L23A 2YT6A 2JS2A 5FWBA 2L2PA 5IXBA 3TSWA 2CUBA 2JMAA 3UA7A 1W6XA 5GJVB 4F17A 1A0NB 5EC7A 4LE9A 1NEGA 1SRLA 1SHGA 1TG0A 1OPLA 2KRMA 1SEMA 2LJ1A 3VS2A 4DEYA 4IIOA 1WX6A 1H8KA 3ULRB 2K2MA 1UG1A 2M0YA 4J9HA 1K9AA 2L3QA 2D0NA 4GBQA 2DX1A 2DL3A 2YUNA 3VS0A 1UGVA 1K4US 2ECZA 1VYTA 2H8HA 2V1RA 1WI7A 2C0TA 2GQIA 1H92A 2ED1A 1ABOA 1AZGB 4RUGA 2BZYA 2KT1A 1KSWA 2KROA 2KR3A 4M4ZA 2DM1A 3UF4A 2KE9A 2RN8A 1E7OA 1T0HA 1GRIA 3I5RA 4J9BA 5IHNA 1PRMC 1I0CA 1OEBA 1PNJA 1U06A 4GLMA 2CT3A 2O88A 1LCKA 2PZ1A 2RPNA 4DEXA 1N5ZA 2CREA 2QDLA 2KRSA 1Y0MA 4OMPA 1ZSGA 1B07A 1U3OA 1UE9A 1JEGA 3M0SA 1GCQA 2FRWA 2EYWA 1UHCA 2A08A 5I11A 1NEBA 2CDTA 1EFNA 1UTIA 2RQRA 3RNJA 1E6HA 2J05A 2LZ6B 2AK5A 4RTZA 4OMLA 3REBB 3IQLA 3EG2A 2L3SA 1AZEA 1M30A 1HD3A 1JQQA 1H3HA 1UUEA 4ESRA 4J9IA 1X6BA 4RTVA 2KYMA 2JM9A 4J9EA 2RNAA 1J3TA 2ABLA 2KNBB 1YN8A 2DF6A 3PVLA 1CSKA 1ZUKA 2EYZA 1RUWA 2O9VA 2O9SA 4OMNA 2LCSA 2MCNA 3VS1A 1M3AA 5FW9A 1OOTA 1CKBA 2LMJA 2K79A 4JZ3A 2LX7A 1ZBJA 1K0SA 2L0AA 1X43A 2K7AA 2VWFA 2FPFA 4WCIA 4HXJA 2EW3A 4AFQC 1M8MA 2O2OA 4D8KA 1SPKA 2HBWA 1SHFA 2KGTA 2X3WD 1QKWA 1NG2A 2GTJA 1K76A 2CT4A 1AD5A 2EGCA 2X3XD 4RTYA 2L3PA 2EPDA 4ZNXA 2DNUA 1MV3A 1X2QA 3NPFA 2GBQA 1QLYA 5IHIA 5GJWB 4QT7A 1S1NA 2KBTA 2I0NA 1JXMA 2GNCA 4E6RA 2FPEA 1GCQC 1VYUA 2NUZA 1NLPC 4CC7A 4HVUA 1Z9ZA 2AZVA 1VA7A 2B86A 2PTKA 1KIKA 1YWOA 1WLPB 3EGUA 4Y92A 4KRTA 2KXCA 2GGRA 1M3CA 1QCFA 2CSQA 1BBZA 2DRMA 1KFZA 2JW4A 3VS4A 1K1ZA 1Z9QA 5I22A 1E6GA 2J6FA 3M0RA 4OMMA 1XOVA 4CC4B 4RTTA 1AVZC 2FEIA 2DA9A 5ECAA 1IO6A 2ENMA 2KRNA 4K11A 2RMOA 2J7IA 2VVKA 2DILA 1WXBA 1WDXA 1ABQA 2DL8A 3UA6A 2D8JA 4LN2A 2OI3A 1GCPA 3R6NA 2LP5A 1I07A 2AKKA 2JTEA 5IH2A 1T3SA 3H41A 1BK2A 1HJDA 2DJQA 2NWMA 2RQUA 1JXOA 1Y57A 2BZXA 3SEMA 1JO8A 1YCSB 1V1CA 4ORZA 1AEYA 1NYGA 3M0TA 2W10A 4HVWA 1PWTA 1NM7A 4JJDA 2RQWA 2EKHA 3NGPA 2ROLA 1X2KA 1MUZA 4Z89A 1AWXA 1VYVA 2BTTA 3UATA 3H0IA 2JMCA 3RBBB 4F16A 3C0CA 1AWOA 2CH4W 1GBQA 2FRYA 3M0UA 1OV3A 4AFSC 1ZUUA 3I35A 3U23A 1YWPA 3NMZC 1PRLC 3PVQA 3QWYA 1M27C 1GL5A 2JM8A 1NYFA 2BZ8A 1GFCA 2EGEA 2DRKA 4J9GA 1PHTA 1G2BA 3VS5A 3NHNA 1HSQA 1RLQC 2FG0A 3ZL7C 2JXBA 4J9DA 2KT8A 2J6OA 1JU5C 2CUDA 2J06A 2K3BA 1SRMA 3VS6A 1ZLMA 2RQTA 2DBKA 2EYXA 2AZSA 4LUDA 3VRYA 2RF0A 2HSPA 1RI9A 2FO0A 2ROTA 1TUCA 3LH5A 1UJYA 1QKXA 4D8DA 4Z88A 3EHQA 1W1FA 1FYNA 3EG3A 4A63B 4LNPA 4R0KA 4CC3A 2YUPA 2XMFA 1UDLA 1CKAA 5IHKA 2D8HA 4FSSA 4HVVA 4AG1C 2A36A 2A37A 2K6DA 4JPBW 2EGAA 2CSIA 1X6GA 2DMOA 4RTUA 4JJBA 1UJ0A 1UECA 2DBMA 4AG2C 2YUQA 1OPKA 1WIEA 2K9GA 2P4RA 1M3BA 2EVRA 1YP5A 2SRCA 5HCKA 3PE0A 4RTWA 2DYBA 5IXFA 2EQIA 2KEAA 2YSQA 2HEQA 3JV3A 3I9QA 2LJ0A 1T0JA 2F2VA 3VRZA 4AFZC 4AFUC 3KFVA 1FMKA 1U5SA 1WFWA 3FJ5A 2F2XA 3QWXX 4IIMA 2DVJA 2KYBA 2LQNA 2DLPA 1PKSA 2YUOA 2VKNA 2EYYA 1ARKA 2DL7A 2HCKA 2RQVA 3I5SA 3VS3A 1WYXA 2EBPA 1K0XA 4JZ4A 2DL4A
chains in the Genus database with same CATH superfamily
1QVGP 3FIFA 3KBGA 1V29B 2A28A 3CCLQ 1KQ2A 2R58A 4FYWB 4ATOA 3CQTA 2JS0A 2LQKA 1ZUYA 5FWCA 2OX7A 1IGQA 1WPYA 4BI8B 2ESWA 2CZ6B 4OMQA 1MV0B 3CCVT 3CC7A 5I2SA 1WXTA 3E2UA 3M0PA 4HCKA 5GANf 4HCBA 4J83A 3THKA 2KXDA 4PJOA 5LJ3d 5GAOm 2DTHA 2L5QA 1WXUA 3CMAT 3VS7A 2KK4A 1T3LA 4EMKB 5GAOq 1M1FA 1B3QA 2D1XA 1ZX6A 5AT1B 1I5OB 2E41A 2CH4A 2K5FA 3OYHA 3DKMA 2LT4A 3LWIA 3EHRA 2X4WA 1G3YA 2HDAA 3TSZA 2M51A 5CKEA 2QQ9A 5KYWA 1PCXA 3GBQA 1NJIC 3RERA 1RAHB 4Q5WA 3T9NA 1VQPT 4TVRA 5CR2A 2DZCA 1AWWA 2VB6A 2RD1A 1YIJT 1X27A 2L8DA 2EJ9A 4ELZC 2DIGA 2OTJQ 2VV5A 3HP9A 2FZCB 1TG0A 3OW2A 1OPLA 5IT9E 2XICA 3VS2A 3M55A 1PSFA 3EGXB 4C0FA 4PJJA 1UG1A 2CP7A 2HMAA 2OTJT 2QI2A 4AMCA 2D0QB 4C92E 4JS4A 4OB1B 2KMTA 1YIJQ 3A8MB 2YUNA 4HCZA 1N9SA 2YXYA 4M75E 3OQ5A 2E5QA 3PMIA 1M90R 2PUKB 4KH0B 1VYTA 2H8HA 2AT1B 2C0TA 2GQIA 4M77A 1H92A 1RABB 4ZN3A 4FW2A 5LJ3f 2KT1A 3M9QA 5IAYA 2X35A 3JRZA 3X28B 4N4IA 4M4ZA 2QQSA 1Q82U 1G5VA 4N0AA 1VOMA 1GRIA 2E1HA 1G3TA 2Y4XA 3I5RA 4J9BA 1S72A 4GLMA 1WHJA 2B8AA 3CCUA 4FT4A 3M53A 4J6WA 4F7UB 4LDXA 5CAIA 3LH0A 1Q82R 2QYZA 4OMPA 2RHIA 9ATCB 3MEUA 1UE9A 3M0SA 3QYGB 2DXCA 1UHCA 1NEBA 2CDTA 4C5HA 1ZQ1A 4M7AA 4C0DB 2LZ6B 1VQ6A 1HYOA 2RHXA 3REBB 3IQLA 2L3SA 1HD3A 2VGNA 4PFOA 2QGFB 5CKFA 2GQVA 2K3XA 4BI4A 4XTVA 4LDWA 4RTVA 2JM9A 3JCMe 2RNAA 1J3TA 2G3RA 3FDRA 4PJOE 2KNBB 1YN8A 2OAUA 2DF6A 4J6YA 2R5MA 3QBYA 1RUWA 2O9SA 4OMNA 1W2BA 3MEVA 3QJ6A 1K9MC 1X01A 1VIEA 1OOTA 1LJOA 4LDUA 5A0GA 2ZGWA 5HY6A 1VQ5T 1K0SA 2FYKA 4M75B 2VWFA 2EW3A 4AT1B 2VGMA 4OB0B 4V2SA 1M8MA 2BE9B 4IURA 4MMKA 4D8KA 1SHFA 2KGTA 2CT4A 4FSXA 2EGCA 2EPDA 4ZNXA 5LJ5e 4M7AF 1WHHA 2DNUA 2HL3A 1MV3A 3CCST 3NPFA 1K73C 2GBQA 2MF2A 1XNIA 3SDZA 5GJWB 1N8RC 4QVCA 2I0NA 2E12A 1PM3A 2JN0A 1NLPC 3SWNC 5CKDA 2F69A 1Z9ZA 3QXEB 4KRTA 2X4JA 1BBZA 4DOWA 2DETA 4KGVB 3MEAA 1IREB 2J6FA 1SG5A 1WHMA 2DEQA 3M54A 4OMMA 5CIUA 3CCMT 3C94A 2COWA 2YHTA 4L5GA 4M77E 1MNEA 2HBPA 4M78B 1YHQQ 1DJ7B 5J39A 1WDXA 3G71A 1ABQA 4ZGEB 2D8JA 1Q86U 4C92A 1GCPA 2LP5A 5IN1A 1VQKA 2AKKA 3G7ZA 1VQNQ 3RIRA 2NWMA 1JXOA 2OTLA 1M90U 1JO8A 1YCSB 3CCSA 4N4HA 3OYAA 2CP0A 3M0TA 1TXQA 1I5LA 4BY6C 1NM7A 1VQNA 1MMDA 3HKSA 3CC2Q 2RQWA 2DXTA 1FWZA 3MKDA 3JB9J 4C0GA 1PC0A 3NGPA 2I2LA 3OS2A 3E19A 3M59A 4BDYA 3CPWA 3RBBB 4F16A 3C0CA 2CH4W 3UPUA 1BYMA 3CMEQ 2M16A 4EMGA 3G6EQ 1TH7A 2A3LA 3R6OA 3NTKA 3U23A 1YWPA 2JM8A 2BZ8A 1GFCA 4J9GA 2QXFA 3NHNA 1W2BS 1C0MA 4KGZB 3KXTA 3OYLA 4XQ3A 3ZL7C 4KUDK 2JXBA 3QYHB 2CKKA 2HL5C 2KT8A 1JU5C 2PU9B 3QKJA 5GAN5 3P8DA 2K3BA 1SRMA 3HSBA 3D7SB 4BUGA 2DXUA 3CC7T 3CCVA 2DBKA 3ASKA 2AZSA 4M7DA 1D0ZA 2M1HA 1UGRB 2FO0A 1TUCA 3TQ7P 1VQ9Q 2M02A 1W1FA 2XDBA 2DTIA 1FYNA 1ZHIA 3C12A 1B34A 4A63B 2RHYA 4LNPA 1KQ1A 4DBHA 2E3IA 2JUFA 3VKIA 5GAN7 2E70A 4NOYA 1LPLA 1BCOA 4XTXA 5IHKA 3GIBA 4E7JA 4C5EA 2QDYB 2K6DA 1RI0A 1D1CA 1UJ0A 2DBMA 1YJNA 4EMKC 1OPKA 1WIEA 1M1KR 2EIFA 4C5GA 2PVGB 1M3BA 2EVRA 2SRCA 4RTWA 4F7UE 5IXFA 1G8XA 2EQIA 2DKGA 2KEAA 3CCLT 3OS1A 1SSFA 3WVEB 3JV3A 2PUOB 2QEXQ 2MWOA 1NJIR 1T0JA 5KE3A 1VQ6Q 3NTHA 3A1PA 3I55Q 1U5SA 2F2XA 3QWXX 3L2QA 3JCMh 2RK2A 4IIMA 4R56A 5KYUA 4IUTA 2E3HA 4OGCA 3H8ZA 4RG2A 5CO7A 1KQSS 3H6ZA 5FU6B 3BFMA 1QP3A 4IUQA 4ZN1A 4JRIA 1OZ2A 1WYXA 5C0MA 3CC4T 4Z02A 2P4TA 2DE0X 3OS5A 1K73U 2FPDA 4MMLA 5CQXA 3REAB 2HAXA 3EAEA 2RHZA 1W70A 1QVPA 3S3OA 1YJWT 2KVQG 1UFFA 1BB9A 4M7AB 3L2UA 2MYSA 1RADB 4M77C 2LJ3A 4E7HA 5FRMA 2RI2A 2O31A 3M56A 4JDSA 4FW1A 2QGGA 1KJWA 2QEXA 2V8IA 3DLMA 3VV0A 3BDLA 3HHTB 1YJWQ 2DXBA 2SEMA 4J9FA 2DAQA 2YDLA 1AWJA 2YLCA 1JJ2P 3RESA 3OYJA 3QIIA 3O5ZA 2DIQA 1G83A 2JNGA 2OJ2A 2GTOA 4PJOG 5LJ5f 3EG1A 4WF2A 5LJ3h 3LW5E 4JJNK 4EMKA 4M75A 4F14A 1Q7YU 2LNHB 3QO3A 1OX8A 1WJQA 2FHDA 1K8AU 1NLOC 5CK9A 1IZ6A 4JRPA 1KHIA 2C0IA 3M4GA 4QVZA 1Y96B 3H0HA 4J9CA 4MZTA 4OMOA 1D0XA 2OAWA 2LQWA 5L23A 3CCEA 5FWBA 2L2PA 5IXBA 3TSWA 3TREA 3M58A 2E64A 3UDCA 4F17A 5GAOr 4LE9A 1SHGA 4EPCA 1EZZB 4C8QA 2QTXA 2KRMA 3SWNB 4DEYA 1H8KA 4XU2A 3I56T 5KYUB 1K9AA 2BIVA 2WSFE 1JJ2S 5AYFA 5M9OA 3V7RA 5FU7C 2DL3A 2GCXA 3S3MA 1WNLA 2XKOC 5GAMd 2H3JA 2KSSA 3H9NA 2LT1A 1VQ9T 4YTLA 1M2VB 3NTIA 5GMKh 1WI7A 2K2VA 3PIPA 3V8JA 2X51A 3I56A 3TEEA 3MO8A 1YJNT 3VYGA 4MZMA 5J3BA 4BE2A 4M75G 1WZOA 1Q86C 5KYYB 2LVMA 1RACB 3JCMJ 5GAOn 5HK3A 1VQMT 3QDFA 3CCJT 1VQ9A 1U06A 1OEBA 4M7DF 2E4HA 4XU3A 1TOVA 4DBRA 1YIJA 1LCKA 4A54A 1WHKA 2BUDA 2DFUA 2Y90A 2ZPEB 1Y0MA 1ZSGA 2DTOA 2JOYA 4A4HA 1C1AA 3EG9A 4OF1A 3G6ET 4ZTFA 3CCUQ 1F1BB 4LDVA 2FRWA 1Q81U 1D0YA 2COZA 5DLOA 3MPUB 1UTIA 2J05A 1XJWB 1S72Q 4PJNA 1AZEA 1M30A 3QHSA 3G71Q 2A7YA 1N27A 4DBQA 5GANh 1UUEA 4ESRA 7AT1B 1X6BA 2KYMA 2FVUA 3GNFB 2ABLA 4PKCC 2DERA 3PVLA 1CSKA 2QA4A 2EYZA 2LCSA 2MCNA 2RM4A 1M3AA 5FW9A 3JCMQ 3JCMc 2XHCA 3OYKA 2LMJA 5CKBA 2K79A 2LX7A 4B9WA 1H3ZA 4HXJA 1BI3A 4AFQC 5KH6A 3GPLA 1VQLQ 2KAFA 3GLXA 2X3WD 4E2FB 1K76A 3JCMP 4M78C 3CCMQ 4X34A 1QLYA 1RAIB 1FMVA 5HKCA 1QVFS 2LDMA 4PK4A 1PD1A 2NUPB 3QDRB 2EQJA 3JCMd 2IVWA 4HVUA 2AZVA 1Q81R 4UC4A 3VUBA 1YWOA 4J6XA 3HFOA 2L89A 4O6JA 2RHUA 2ZPFB 1M3CA 1QCFA 2YRCA 1BIAA 1TS9A 2CSQA 3OYIA 4JRKA 2DRMA 1BCMA 2JW4A 1E6GA 3M0RA 4OGEA 4CC4B 4XK8E 1KQSA 1D09B 3OBYA 2DK3A 3OYDA 2M9UA 2DILA 1WXBA 2D9TA 3UA6A 4IUPA 4N0AC 1UB4A 3CCLA 4QW2A 2K4YA 3GF5A 3PGGA 3DLLA 3CPWP 1Y57A 2BZXA 5C6SA 1KC8C 4FT2A 1NYGA 1MMGA 1QVFA 5DLQE 3JCMg 2W10A 1UGPB 3EH1A 4JJDA 2OTLQ 3CPFA 2EKHA 1BI2A 3CCET 3GOXA 3OS0A 5LL6S 3CD6Q 3G4SQ 1VQPA 1FXXA 1X2KA 1MUZA 3FLGA 1YI2A 3EFOA 1VYVA 2BTTA 2C06A 2JMCA 1AWOA 2MK5A 3SD4A 3M0UA 2EFIA 1ZSZA 2JTFA 4E7IA 4M7AD 3CBPA 3MP8A 1PSEA 3JCMW 1SF9A 3NMZC 3QPHA 1PRLC 3PVQA 3LWHA 2DPPB 4LXCA 1VQOA 4NL3A 4FYVB 2K5LA 1X75C 4XU0A 5KYXA 2EGEA 4M7AC 3JCMf 3VS5A 3EFSA 5LJ5h 2NUPA 3OYEA 2RJCA 2EAYA 5GAN6 2XI9A 3CCRQ 2FG0A 2MWPA 1VQ8T 3G6EA 1RL2A 3J81E 3VS6A 3S3NA 1NBEB 2EYXA 1NZ9A 2HSPA 4R55A 3LH5A 2A0FB 2X9HA 3HRSA 3ZBDA 3RKWA 2HNIA 5GANj 4PFPA 1U1SA 2MMPA 1G3SA 4GLKA 4M7DB 3WXMB 2QA4T 1N6AA 5LJ5g 4CC3A 2XMFA 1S72T 1CKAA 1QQJA 1W2BP 2A36A 2A37A 4JPBW 2CSIA 1X6GA 2IG0A 1WQ7A 2DMOA 3HRTA 3LX7A 1D3BA 2P4RA 4A53A 5HCKA 2FZKB 2IPOB 3CCQT 2DYBA 2YSQA 2HEQA 2EJGA 1WJRA 2K57A 3MP6A 4ELYC 2E6ZA 2WSEE 3OYNA 2LJ0A 3SB2A 1KHCA 2F2VA 4C0DC 3OW2S 4AFUC 3PIOA 3OB9A 3FJ5A 1MGQA 2KYBA 5FU7B 3UWNA 1HXDA 1YJNQ 1OI1A 4A4FA 2QK0A 2HCKA 2RQVA 1MHNA 2DJZA 1K0XA 4C92D 5KCOA 4JZ4A 2VC8A 2DL4A 2DVEA 4M7AE 1Q86R 3TVTA 2QQRA 1W4SA 4DA4A 1BI1A 3CMAQ 4KUIA 1X69A 1JBMA 1SSHA 1UHFA 2IIMA 5GANe 4ZGJB 1VQ7T 2F5KA 4F7UF 2H3EB 1QWFA 2R57A 3AHUA 1PKTA 4B9XA 2COYA 1UEBA 2MIOA 3WVDB 1AT1B 3M5AA 2JTMA 1KQSP 4E7LA 3LGLA 2AKLA 3P8HA 1YITA 4CC2A 5GMKj 3BY7A 2YRVA 5FRNA 4MDWA 4PJOF 1Q81C 1V76A 2EJFA 4IUUA 1YITT 1Y71A 5CVIA 2CP5A 3AT1B 1NE8A 3A8LB 4F04B 2ED0A 3QUIA 5KYYA 2V1QA 4LDYA 2LX9A 1FMWA 2C0OA 3A98A 3HRUA 2HQEA 4M75F 3EG0A 4FIBA 3N5BB 3MJXA 4M78E 4EIKA 1YNZA 1M5Q1 5L8RE 4A4KA 3RUXA 2YT6A 2JS2A 2F5TX 2ZPGB 3CC4A 4RG8A 3PTAA 2CUBA 2LCCA 4M75C 3UA7A 1W6XA 3EFRA 4DOVA 3EG9B 3A5ZB 4QQ6A 1SEMA 2LJ1A 5KYWB 4PJLA 1WX6A 2X4XA 4II1A 3OA6A 2RJDA 2DYIA 3FRNA 1BI0A 4J9HA 2L3QA 2D0NA 1N8RR 3O8VA 3OSSC 5D6YA 2P84A 3QZ9B 1QW1A 1K4US 4FL6A 5GAN8 3CCQA 3V7SA 2ECZA 4KULA 2V8KA 1ABOA 2CP6A 2NLUA 1NJIU 2GFAA 2BZYA 3EGXA 1KSWA 2KROA 2V8JA 2KR3A 3HTRA 3EGDB 4J8OA 2DM1A 5GAMf 1JJ2A 3UF4A 2KE9A 1VQ6T 1M2OA 1KD1U 2QEXT 1M1KC 1IXDA 1I0CA 5GANg 1QVGA 2XD0A 2CT3A 5A0DA 4M77B 5LJ5j 4PJOB 5GAN2 4OVAA 2RPNA 1N5ZA 2CS7A 2CREA 2QDLA 2VASA 1IHWA 2KRSA 1B07A 2CZ7B 4J5YA 3P8BB 1U3OA 5D7UA 3X26B 1GCQA 1VQKQ 4X9DA 2A08A 5I11A 5KYNA 1EFNA 3VJPA 2EQMA 2RQRA 1E6HA 1BIBA 4RTZA 1ZA2B 3SFMA 4OMLA 3EG2A 1Q82C 4J9IA 4J9EA 5GMKi 4IKFA 3CC7Q 5GMKl 1YI2Q 3VS1A 1O9SA 3L1AA 1CKBA 2XIDA 1G3WA 4JZ3A 1B7TA 2VXFA 3FC3A 2L0AA 2RA2A 1X43A 4WCIA 2FPFA 4QKUA 4RCCA 4O5VA 4KGXB 1JB0E 2XDPA 2O2OA 3CMAA 4B6MA 2GF7A 1SPKA 2HBWA 1FX7A 4D6WA 1VQOQ 1NG2A 4N4GA 3OMCA 4M7DC 2YWWA 2X3XD 2XDDA 4PJMA 4M75D 4MZPA 4HKEA 4QT7A 1P92A 3BE3A 2KBTA 1JXMA 4E6RA 1X6OA 1GCQC 5GAN3 3ZFJA 2RI3A 2NUZA 4CC7A 4KT0E 2QA4Q 1VA7A 1C6VX 1TWBA 1KIKA 1OZ3A 4BI3A 1Y7XA 1WLPB 3EGUA 4M78A 4Y92A 2KXCA 3C95A 2R5AA 5D6XA 5LJ5d 4C92C 4PFZA 3OYYA 4JUVA 3VS4A 1K1ZA 1Z9QA 1KC8R 3RDVA 2AHJB 2ZPBB 1AVZC 5D6WA 4XTUA 1R0BG 5ECAA 1VQNT 2ENMA 2KRNA 3QG1A 4IUVA 4C92F 4K11A 2J7IA 3CCRT 2AIRB 4JRQA 2MPXC 2VVKA 1U8RA 5GAMe 3JB9H 4LN2A 2OI3A 4CRIA 4ME7A 3OW2P 1K8AC 4C8QC 5IH2A 1HK9A 5HK0A 2WSCE 2WACA 1BK2A 1HJDA 2DZ9A 2EQUA 2DJQA 2RQUA 3LLRA 3L42A 4PLIA 2F1LA 3SEMA 3CPWS 1V1CA 4OMFB 4C8QB 1M9SA 2EQKA 1Q95G 1AEYA 5J26A 4C92G 4M78F 3BW1A 1IB8A 4C92B 3G4ST 3CD6T 1TTHB 5LJ3g 2QG9B 1OYXA 4Z89A 2OTLT 3UATA 5GMKe 3RKYA 4FM4B 4XTWA 2O4XB 1UGQB 4DBFA 3NFCA 1U1TA 2ZAEA 4XU1A 3JB9D 3Q1JA 2O01E 4AFSC 1R0CB 3I35A 1IHVA 3QWYA 4L6V5 1M27C 4M78G 4XTZA 1GL5A 1ZSZB 1NYFA 1RAGB 2DRKA 3JCMV 1PHTA 5I2MA 2CP2A 4KBMB 1RLQC 1KK7A 5KYXB 1VQ5Q 2FZGB 1VQ4Q 1ACMB 2J6OA 3RKXA 2CGHA 1K8AR 2HD0A 2J06A 1ZLMA 1M1GA 2QTVA 2ZPIB 2RJFA 1LVKA 4C8QE 3M57A 2RF0A 1RAEB 1TU0B 2RI5A 2ROTA 3C4SA 4FU6A 4D8DA 2DD4A 3MEWA 3JCMb 3J80E 3META 1YITQ 5CCAA 2YUPA 3UT1A 1UDLA 5CKHA 3CXCP 1IGUA 4FSSA 4HVVA 3CXCS 4BDZA 3MCAB 1I4K1 4LD6A 4RTUA 2YUQA 4C0ZA 2E6NA 1VQ5A 1VQ7Q 3JB9F 4M78D 1WHGA 2KQWA 4M77G 1YJ9T 4OP0A 1OQKA 4EMHA 2EYQA 2FB7A 2PQWA 3CEYA 3I9QA 1D3BB 3ER0A 2LQ8A 4E7SA 1SKUB 5KCHA 3CXCA 3HL8A 3VUZA 1FMKA 4J7IA 1O75A 1WFWA 1KD1C 5FLXE 3CCMA 1VUBA 1Y07A 1I8FA 1PKSA 2XU8A 2EYYA 4ZTJA 3GP8A 3V7CA 3VS3A 1WQWA 3PNWC 4VUBA 4C8QG 1IRXA 4EDUA 4LUEA 1MMNA 2E5KA 1YHQA 4JJCA 1OX9A 2LC4A 3M0QA 2CYZB 4QQDA 1GBRA 3CCQQ 4X1VA 1BU1A 3CCUT 1KG1A 2KDSA 3L2WA 2PNIA 3S6WA 3H0FA 2CP3A 3TU4K 2G6FX 2E10A 2JT4A 2HKQB 2CZ1B 2OTJA 3LYIA 1RLPC 4ANJA 1ZBXA 3SHWA 1AOJA 2DL5A 1YCYA 1VQLA 3G4SA 1VQPQ 6AT1B 4Z8AA 1I1JA 2JVVA 3CCJQ 3L2RA 4FCYA 4X9CA 4A4EA 3MHXA 1B34B 2MOXA 1YBYA 2W0ZA 2F2WA 4RTXA 3JB9G 1H641 2HQXA 2XK0A 3SWNA 2BE7D 1WA7A 1QVFP 1XQHA 1WJSA 3FJPA 3LGFA 1TUDA 1VQ8Q 3MP1A 1QWEA 2VXEA 2HZYA 4XAXB 3M4YA 1GFDA 2PVDB 3QJYA 5LJ3j 1NPRA 2J6KA 1YJ9Q 2JMAA 1QCOA 1N8RU 5GAOp 5GJVB 3VYHB 5A0LA 1A0NB 5EC7A 2ATCB 2DO3A 1NEGA 1PG5B 1SRLA 3I56Q 2RO0A 4M7DE 2X4YA 3TCJA 3CCVQ 4IIOA 3ULRB 2K2MA 2M0YA 3A8OB 2EWNA 5GAOl 5GAMg 4GBQA 2DX1A 3A8GB 4RCBA 1UGVA 3VS0A 3CCEQ 2V26A 4OB3B 4BY6B 2NUTB 2V1RA 1RAFB 2ED1A 5FU6C 3GNGA 2P0PA 1VQ8A 1AZGB 4WTOB 1TSFA 2HSEB 4RUGA 4BACA 4MDXA 2O4XA 1MMAA 4RMOA 2K3YA 3JSCA 2RN8A 4E7ZA 1VQ4T 1E7OA 1T0HA 2Y4YA 3G1JA 5IHNA 1PRMC 1PNJA 2VYTA 3HFNA 4BB7A 3EGDA 3E9GA 2PVOB 2DEUA 2M0OA 2O88A 2PZ1A 4L59A 4JLIA 4DEXA 1VQ7A 2LNVA 4M7DD 1YJWA 2MAMA 3A8HB 3PFSA 4HA8A 1WHLA 4PJOC 8ATCB 1JEGA 1PD0A 1NPPA 2EYWA 4C8QD 4M77D 1VQ4A 3RNJA 1BKBA 3BDUA 2L3RA 2AK5A 2VUBA 3DB3A 1M90C 1JQQA 1ZSZC 1H3HA 3KUFA 3URGA 1Y96A 4PL6A 4JLGA 2RK1A 3QZ5B 4C5IA 1YFNA 5I21A 2MI6A 1ZUKA 1K73R 2O9VA 4FYYB 3CBMA 4HT9A 1GXIE 2ZZDA 2JJ9A 5GAMh 5GANd 3I55T 2JZ2A 3L2VA 1ZBJA 4QQGA 2K7AA 5FROA 2LTOA 1VQLT 3QSUA 4HCCA 2DD5A 4QVDA 1QKWA 3F70A 1M4ZA 2GTJA 1EIFA 3L2ZA 4HT8A 1AD5A 1QP2A 4RTYA 2L3PA 1OU9A 3OY9A 2NYSA 4Y91A 1K9MR 4F7UG 1X2QA 1M2VA 5GAN4 5IHIA 2BKDN 1S1NA 2GNCA 2FPEA 1XTDA 3OYBA 1VYUA 1RAAB 2QQBA 4E7KA 1KC8U 2B86A 2PTKA 3X24B 2P0QA 3ZEHA 3G71T 4CI0C 2HQHA 3OYCA 1EX4A 4PJOD 4LD9K 1M8VA 2GGRA 4RKUE 2QASA 2CZ0B 1QMCA 3OYGA 1KFZA 5I22A 3OSVA 4BE1A 1ZA1B 2YLBA 5GMKm 1XOVA 1JRIA 3PMTA 4RTTA 2FEIA 2DA9A 1IO6A 1VQOT 2XG8D 3OBWA 2RMOA 4PLLA 4XTYA 2DL8A 4FYXB 3R6NA 1R8OB 1I07A 2JTEA 3HPWA 1KD1R 3ME9A 1VQMQ 2LCLA 4PNOA 1T3SA 3H41A 3EFOB 4E47A 3CC2A 1QVGS 1YI2T 4ZGDB 2D6FA 1AHJB 3RMSA 3OYMA 4ORZA 4F7UA 1LNXA 3CBOA 3CMET 3CCJA 3X20B 3JB9I 4Y28E 2LRQA 4HVWA 1PWTA 4NL2A 2YRDA 2EKOA 4JS5A 3CMEA 5DY9A 8AT1B 2ROLA 1K9MU 3CC2T 1AWXA 4M7DG 2E65A 3H0IA 1GBQA 2FRYA 2RH2A 3FB9A 1VQKT 2FL7A 1OV3A 4NS5A 4DQ2A 1OULA 3INZA 4P5NA 1ZUUA 1YJ9A 1VQMA 1R77A 3OYFA 1VIFA 4GY5A 4BD3A 5A2QE 1G2BA 3JAME 1LOJA 5KE2A 1Q7YR 1HSQA 3E9FA 4M77F 1WGSA 1YHQT 2HKNA 3EH2A 1QCNA 4J9DA 5LJ3e 3VU3C 5EG2A 2CUDA 4J7FA 1M1KU 3PT9A 2RJEA 4M7AG 2RQTA 3X25B 2K5IA 4LUDA 4C8QF 1D1BA 3DB4A 3VRYA 3J7AF 3V8KA 1RI9A 2ZCFB 2QQAA 1UJYA 1QKXA 2QAZA 4Z88A 3EHQA 4BE0A 3EG3A 5CQYA 1Q7YC 2P0KA 3CCRA 4R0KA 1MNDA 2RB6A 2D8HA 4AG1C 3CCSQ 2EGAA 1N9RA 2KY9A 4JJBA 1UECA 4AG2C 2K9GA 4A4GA 3FEOA 3JCMX 2ZPHB 3E1SA 1YP5A 2NUTA 3I55A 3PE0A 1I81A 1OU8A 3V8LA 3CC4Q 5DM7R 3RR6A 3VRZA 4AFZC 3KFVA 3RMQA 2KI7A 1TUGB 3OMGA 2DVJA 2LQNA 2DLPA 2YUOA 2VKNA 1ARKA 3CD6A 2DL7A 3I5SA 1UGSB 2EBPA 2Z0WA 5GAMj 1D1AA 4KH1B 4OB2B 2GFUA
chains in the Genus database with same CATH topology
4LUEA 3TVTA 2DE0X 2E5KA 4JJCA 2FPDA 3M0QA 2A28A 3REAB 1GBRA 3CQTA 1W70A 2JS0A 1ZUYA 1X69A 5FWCA 1SSHA 1UFFA 1UHFA 2IIMA 2ESWA 1BB9A 4X1VA 1BU1A 4OMQA 1QWFA 1MV0B 2LJ3A 2PNIA 1PKTA 2O31A 3H0FA 1WXTA 3M0PA 2MIOA 4HCKA 1KJWA 2G6FX 3THKA 2JT4A 2KXDA 1RLPC 2SEMA 2AKLA 4J9FA 4CC2A 1WXUA 2YDLA 1AWJA 3SHWA 1AOJA 2DL5A 3VS7A 1T3LA 3O5ZA 1I1JA 4Z8AA 1B3QA 2D1XA 1G83A 2OJ2A 1ZX6A 2GTOA 2CH4A 3EG1A 2MOXA 2W0ZA 2ED0A 2V1QA 3EHRA 4F14A 2F2WA 4RTXA 2LNHB 2HDAA 2C0OA 3TSZA 3A98A 2M51A 1NLOC 1WA7A 3EG0A 2C0IA 3GBQA 1TUDA 3H0HA 1QWEA 4J9CA 4OMOA 4EIKA 1YNZA 2OAWA 2LQWA 1AWWA 1GFDA 1X27A 2J6KA 5L23A 2YT6A 2JS2A 5FWBA 2L2PA 5IXBA 3TSWA 2CUBA 2JMAA 3UA7A 1W6XA 5GJVB 4F17A 1A0NB 5EC7A 4LE9A 1NEGA 1SRLA 1SHGA 1TG0A 1OPLA 2KRMA 1SEMA 2LJ1A 3VS2A 4DEYA 4IIOA 1WX6A 1H8KA 3ULRB 2K2MA 1UG1A 2M0YA 4J9HA 1K9AA 2L3QA 2D0NA 4GBQA 2DX1A 2DL3A 2YUNA 3VS0A 1UGVA 1K4US 2ECZA 1VYTA 2H8HA 2V1RA 1WI7A 2C0TA 2GQIA 1H92A 2ED1A 1ABOA 1AZGB 4RUGA 2BZYA 2KT1A 1KSWA 2KROA 2KR3A 4M4ZA 2DM1A 3UF4A 2KE9A 2RN8A 1E7OA 1T0HA 1GRIA 3I5RA 4J9BA 5IHNA 1PRMC 1I0CA 1OEBA 1PNJA 1U06A 4GLMA 2CT3A 2O88A 1LCKA 2PZ1A 2RPNA 4DEXA 1N5ZA 2CREA 2QDLA 2KRSA 1Y0MA 4OMPA 1ZSGA 1B07A 1U3OA 1UE9A 1JEGA 3M0SA 1GCQA 2FRWA 2EYWA 1UHCA 2A08A 5I11A 1NEBA 2CDTA 1EFNA 1UTIA 2RQRA 3RNJA 1E6HA 2J05A 2LZ6B 2AK5A 4RTZA 4OMLA 3REBB 3IQLA 3EG2A 2L3SA 1AZEA 1M30A 1HD3A 1JQQA 1H3HA 1UUEA 4ESRA 4J9IA 1X6BA 4RTVA 2KYMA 2JM9A 4J9EA 2RNAA 1J3TA 2ABLA 2KNBB 1YN8A 2DF6A 3PVLA 1CSKA 1ZUKA 2EYZA 1RUWA 2O9VA 2O9SA 4OMNA 2LCSA 2MCNA 3VS1A 1M3AA 5FW9A 1OOTA 1CKBA 2LMJA 2K79A 4JZ3A 2LX7A 1ZBJA 1K0SA 2L0AA 1X43A 2K7AA 2VWFA 2FPFA 4WCIA 4HXJA 2EW3A 4AFQC 1M8MA 2O2OA 4D8KA 1SPKA 2HBWA 1SHFA 2KGTA 2X3WD 1QKWA 1NG2A 2GTJA 1K76A 2CT4A 1AD5A 2EGCA 2X3XD 4RTYA 2L3PA 2EPDA 4ZNXA 2DNUA 1MV3A 1X2QA 3NPFA 2GBQA 1QLYA 5IHIA 5GJWB 4QT7A 1S1NA 2KBTA 2I0NA 1JXMA 2GNCA 4E6RA 2FPEA 1GCQC 1VYUA 2NUZA 1NLPC 4CC7A 4HVUA 1Z9ZA 2AZVA 1VA7A 2B86A 2PTKA 1KIKA 1YWOA 1WLPB 3EGUA 4Y92A 4KRTA 2KXCA 2GGRA 1M3CA 1QCFA 2CSQA 1BBZA 2DRMA 1KFZA 2JW4A 3VS4A 1K1ZA 1Z9QA 5I22A 1E6GA 2J6FA 3M0RA 4OMMA 1XOVA 4CC4B 4RTTA 1AVZC 2FEIA 2DA9A 5ECAA 1IO6A 2ENMA 2KRNA 4K11A 2RMOA 2J7IA 2VVKA 2DILA 1WXBA 1WDXA 1ABQA 2DL8A 3UA6A 2D8JA 4LN2A 2OI3A 1GCPA 3R6NA 2LP5A 1I07A 2AKKA 2JTEA 5IH2A 1T3SA 3H41A 1BK2A 1HJDA 2DJQA 2NWMA 2RQUA 1JXOA 1Y57A 2BZXA 3SEMA 1JO8A 1YCSB 1V1CA 4ORZA 1AEYA 1NYGA 3M0TA 2W10A 4HVWA 1PWTA 1NM7A 4JJDA 2RQWA 2EKHA 3NGPA 2ROLA 1X2KA 1MUZA 4Z89A 1AWXA 1VYVA 2BTTA 3UATA 3H0IA 2JMCA 3RBBB 4F16A 3C0CA 1AWOA 2CH4W 1GBQA 2FRYA 3M0UA 1OV3A 4AFSC 1ZUUA 3I35A 3U23A 1YWPA 3NMZC 1PRLC 3PVQA 3QWYA 1M27C 1GL5A 2JM8A 1NYFA 2BZ8A 1GFCA 2EGEA 2DRKA 4J9GA 1PHTA 1G2BA 3VS5A 3NHNA 1HSQA 1RLQC 2FG0A 3ZL7C 2JXBA 4J9DA 2KT8A 2J6OA 1JU5C 2CUDA 2J06A 2K3BA 1SRMA 3VS6A 1ZLMA 2RQTA 2DBKA 2EYXA 2AZSA 4LUDA 3VRYA 2RF0A 2HSPA 1RI9A 2FO0A 2ROTA 1TUCA 3LH5A 1UJYA 1QKXA 4D8DA 4Z88A 3EHQA 1W1FA 1FYNA 3EG3A 4A63B 4LNPA 4R0KA 4CC3A 2YUPA 2XMFA 1UDLA 1CKAA 5IHKA 2D8HA 4FSSA 4HVVA 4AG1C 2A36A 2A37A 2K6DA 4JPBW 2EGAA 2CSIA 1X6GA 2DMOA 4RTUA 4JJBA 1UJ0A 1UECA 2DBMA 4AG2C 2YUQA 1OPKA 1WIEA 2K9GA 2P4RA 1M3BA 2EVRA 1YP5A 2SRCA 5HCKA 3PE0A 4RTWA 2DYBA 5IXFA 2EQIA 2KEAA 2YSQA 2HEQA 3JV3A 3I9QA 2LJ0A 1T0JA 2F2VA 3VRZA 4AFZC 4AFUC 3KFVA 1FMKA 1U5SA 1WFWA 3FJ5A 2F2XA 3QWXX 4IIMA 2DVJA 2KYBA 2LQNA 2DLPA 1PKSA 2YUOA 2VKNA 2EYYA 1ARKA 2DL7A 2HCKA 2RQVA 3I5SA 3VS3A 1WYXA 2EBPA 1K0XA 4JZ4A 2DL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LUE A;  3TVT A;  2DE0 X;  2E5K A;  4JJC A;  2FPD A;  3M0Q A;  2A28 A;  3REA B;  1GBR A;  3CQT A;  1W70 A;  2JS0 A;  1ZUY A;  1X69 A;  5FWC A;  1SSH A;  1UFF A;  1UHF A;  2IIM A;  2ESW A;  1BB9 A;  4X1V A;  1BU1 A;  4OMQ A;  1QWF A;  1MV0 B;  2LJ3 A;  2PNI A;  1PKT A;  2O31 A;  3H0F A;  1WXT A;  3M0P A;  2MIO A;  4HCK A;  1KJW A;  2G6F X;  3THK A;  2JT4 A;  2KXD A;  1RLP C;  2SEM A;  2AKL A;  4J9F A;  4CC2 A;  1WXU A;  2YDL A;  1AWJ A;  3SHW A;  1AOJ A;  2DL5 A;  3VS7 A;  1T3L A;  3O5Z A;  1I1J A;  4Z8A A;  1B3Q A;  2D1X A;  1G83 A;  2OJ2 A;  1ZX6 A;  2GTO A;  2CH4 A;  3EG1 A;  2MOX A;  2W0Z A;  2ED0 A;  2V1Q A;  3EHR A;  4F14 A;  2F2W A;  4RTX A;  2LNH B;  2HDA A;  2C0O A;  3TSZ A;  3A98 A;  2M51 A;  1NLO C;  1WA7 A;  3EG0 A;  2C0I A;  3GBQ A;  1TUD A;  3H0H A;  1QWE A;  4J9C A;  4OMO A;  4EIK A;  1YNZ A;  2OAW A;  2LQW A;  1AWW A;  1GFD A;  1X27 A;  2J6K A;  5L23 A;  2YT6 A;  2JS2 A;  5FWB A;  2L2P A;  5IXB A;  3TSW A;  2CUB A;  2JMA A;  3UA7 A;  1W6X A;  5GJV B;  4F17 A;  1A0N B;  5EC7 A;  4LE9 A;  1NEG A;  1SRL A;  1SHG A;  1TG0 A;  1OPL A;  2KRM A;  1SEM A;  2LJ1 A;  3VS2 A;  4DEY A;  4IIO A;  1WX6 A;  1H8K A;  3ULR B;  2K2M A;  1UG1 A;  2M0Y A;  4J9H A;  1K9A A;  2L3Q A;  2D0N A;  4GBQ A;  2DX1 A;  2DL3 A;  2YUN A;  3VS0 A;  1UGV A;  1K4U S;  2ECZ A;  1VYT A;  2H8H A;  2V1R A;  1WI7 A;  2C0T A;  2GQI A;  1H92 A;  2ED1 A;  1ABO A;  1AZG B;  4RUG A;  2BZY A;  2KT1 A;  1KSW A;  2KRO A;  2KR3 A;  4M4Z A;  2DM1 A;  3UF4 A;  2KE9 A;  2RN8 A;  1E7O A;  1T0H A;  1GRI A;  3I5R A;  4J9B A;  5IHN A;  1PRM C;  1I0C A;  1OEB A;  1PNJ A;  1U06 A;  4GLM A;  2CT3 A;  2O88 A;  1LCK A;  2PZ1 A;  2RPN A;  4DEX A;  1N5Z A;  2CRE A;  2QDL A;  2KRS A;  1Y0M A;  4OMP A;  1ZSG A;  1B07 A;  1U3O A;  1UE9 A;  1JEG A;  3M0S A;  1GCQ A;  2FRW A;  2EYW A;  1UHC A;  2A08 A;  5I11 A;  1NEB A;  2CDT A;  1EFN A;  1UTI A;  2RQR A;  3RNJ A;  1E6H A;  2J05 A;  2LZ6 B;  2AK5 A;  4RTZ A;  4OML A;  3REB B;  3IQL A;  3EG2 A;  2L3S A;  1AZE A;  1M30 A;  1HD3 A;  1JQQ A;  1H3H A;  1UUE A;  4ESR A;  4J9I A;  1X6B A;  4RTV A;  2KYM A;  2JM9 A;  4J9E A;  2RNA A;  1J3T A;  2ABL A;  2KNB B;  1YN8 A;  2DF6 A;  3PVL A;  1CSK A;  1ZUK A;  2EYZ A;  1RUW A;  2O9V A;  2O9S A;  4OMN A;  2LCS A;  2MCN A;  3VS1 A;  1M3A A;  5FW9 A;  1OOT A;  1CKB A;  2LMJ A;  2K79 A;  4JZ3 A;  2LX7 A;  1ZBJ A;  1K0S A;  2L0A A;  1X43 A;  2K7A A;  2VWF A;  2FPF A;  4WCI A;  4HXJ A;  2EW3 A;  4AFQ C;  1M8M A;  2O2O A;  4D8K A;  1SPK A;  2HBW A;  1SHF A;  2KGT A;  2X3W D;  1QKW A;  1NG2 A;  2GTJ A;  1K76 A;  2CT4 A;  1AD5 A;  2EGC A;  2X3X D;  4RTY A;  2L3P A;  2EPD A;  4ZNX A;  2DNU A;  1MV3 A;  1X2Q A;  3NPF A;  2GBQ A;  1QLY A;  5IHI A;  5GJW B;  4QT7 A;  1S1N A;  2KBT A;  2I0N A;  1JXM A;  2GNC A;  4E6R A;  2FPE A;  1GCQ C;  1VYU A;  2NUZ A;  1NLP C;  4CC7 A;  4HVU A;  1Z9Z A;  2AZV A;  1VA7 A;  2B86 A;  2PTK A;  1KIK A;  1YWO A;  1WLP B;  3EGU A;  4Y92 A;  4KRT A;  2KXC A;  2GGR A;  1M3C A;  1QCF A;  2CSQ A;  1BBZ A;  2DRM A;  1KFZ A;  2JW4 A;  3VS4 A;  1K1Z A;  1Z9Q A;  5I22 A;  1E6G A;  2J6F A;  3M0R A;  4OMM A;  1XOV A;  4CC4 B;  4RTT A;  1AVZ C;  2FEI A;  2DA9 A;  5ECA A;  1IO6 A;  2ENM A;  2KRN A;  4K11 A;  2RMO A;  2J7I A;  2VVK A;  2DIL A;  1WXB A;  1WDX A;  1ABQ A;  2DL8 A;  3UA6 A;  2D8J A;  4LN2 A;  2OI3 A;  1GCP A;  3R6N A;  2LP5 A;  1I07 A;  2AKK A;  2JTE A;  5IH2 A;  1T3S A;  3H41 A;  1BK2 A;  1HJD A;  2DJQ A;  2NWM A;  2RQU A;  1JXO A;  1Y57 A;  2BZX A;  3SEM A;  1JO8 A;  1YCS B;  1V1C A;  4ORZ A;  1AEY A;  1NYG A;  3M0T A;  2W10 A;  4HVW A;  1PWT A;  1NM7 A;  4JJD A;  2RQW A;  2EKH A;  3NGP A;  2ROL A;  1X2K A;  1MUZ A;  4Z89 A;  1AWX A;  1VYV A;  2BTT A;  3UAT A;  3H0I A;  2JMC A;  3RBB B;  4F16 A;  3C0C A;  1AWO A;  2CH4 W;  1GBQ A;  2FRY A;  3M0U A;  1OV3 A;  4AFS C;  1ZUU A;  3I35 A;  3U23 A;  1YWP A;  3NMZ C;  1PRL C;  3PVQ A;  3QWY A;  1M27 C;  1GL5 A;  2JM8 A;  1NYF A;  2BZ8 A;  1GFC A;  2EGE A;  2DRK A;  4J9G A;  1PHT A;  1G2B A;  3VS5 A;  3NHN A;  1HSQ A;  1RLQ C;  2FG0 A;  3ZL7 C;  2JXB A;  4J9D A;  2KT8 A;  2J6O A;  1JU5 C;  2CUD A;  2J06 A;  2K3B A;  1SRM A;  3VS6 A;  1ZLM A;  2RQT A;  2DBK A;  2EYX A;  2AZS A;  4LUD A;  3VRY A;  2RF0 A;  2HSP A;  1RI9 A;  2FO0 A;  2ROT A;  1TUC A;  3LH5 A;  1UJY A;  1QKX A;  4D8D A;  4Z88 A;  3EHQ A;  1W1F A;  1FYN A;  3EG3 A;  4A63 B;  4LNP A;  4R0K A;  4CC3 A;  2YUP A;  2XMF A;  1UDL A;  1CKA A;  5IHK A;  2D8H A;  4FSS A;  4HVV A;  4AG1 C;  2A36 A;  2A37 A;  2K6D A;  4JPB W;  2EGA A;  2CSI A;  1X6G A;  2DMO A;  4RTU A;  4JJB A;  1UJ0 A;  1UEC A;  2DBM A;  4AG2 C;  2YUQ A;  1OPK A;  1WIE A;  2K9G A;  2P4R A;  1M3B A;  2EVR A;  1YP5 A;  2SRC A;  5HCK A;  3PE0 A;  4RTW A;  2DYB A;  5IXF A;  2EQI A;  2KEA A;  2YSQ A;  2HEQ A;  3JV3 A;  3I9Q A;  2LJ0 A;  1T0J A;  2F2V A;  3VRZ A;  4AFZ C;  4AFU C;  3KFV A;  1FMK A;  1U5S A;  1WFW A;  3FJ5 A;  2F2X A;  3QWX X;  4IIM A;  2DVJ A;  2KYB A;  2LQN A;  2DLP A;  1PKS A;  2YUO A;  2VKN A;  2EYY A;  1ARK A;  2DL7 A;  2HCK A;  2RQV A;  3I5S A;  3VS3 A;  1WYX A;  2EBP A;  1K0X A;  4JZ4 A;  2DL4 A; 
#chains in the Genus database with same CATH topology
 1QVG P;  3FIF A;  3KBG A;  1V29 B;  2A28 A;  3CCL Q;  1KQ2 A;  2R58 A;  4FYW B;  4ATO A;  3CQT A;  2JS0 A;  2LQK A;  1ZUY A;  5FWC A;  2OX7 A;  1IGQ A;  1WPY A;  4BI8 B;  2ESW A;  2CZ6 B;  4OMQ A;  1MV0 B;  3CCV T;  3CC7 A;  5I2S A;  1WXT A;  3E2U A;  3M0P A;  4HCK A;  5GAN f;  4HCB A;  4J83 A;  3THK A;  2KXD A;  4PJO A;  5LJ3 d;  5GAO m;  2DTH A;  2L5Q A;  1WXU A;  3CMA T;  3VS7 A;  2KK4 A;  1T3L A;  4EMK B;  5GAO q;  1M1F A;  1B3Q A;  2D1X A;  1ZX6 A;  5AT1 B;  1I5O B;  2E41 A;  2CH4 A;  2K5F A;  3OYH A;  3DKM A;  2LT4 A;  3LWI A;  3EHR A;  2X4W A;  1G3Y A;  2HDA A;  3TSZ A;  2M51 A;  5CKE A;  2QQ9 A;  5KYW A;  1PCX A;  3GBQ A;  1NJI C;  3RER A;  1RAH B;  4Q5W A;  3T9N A;  1VQP T;  4TVR A;  5CR2 A;  2DZC A;  1AWW A;  2VB6 A;  2RD1 A;  1YIJ T;  1X27 A;  2L8D A;  2EJ9 A;  4ELZ C;  2DIG A;  2OTJ Q;  2VV5 A;  3HP9 A;  2FZC B;  1TG0 A;  3OW2 A;  1OPL A;  5IT9 E;  2XIC A;  3VS2 A;  3M55 A;  1PSF A;  3EGX B;  4C0F A;  4PJJ A;  1UG1 A;  2CP7 A;  2HMA A;  2OTJ T;  2QI2 A;  4AMC A;  2D0Q B;  4C92 E;  4JS4 A;  4OB1 B;  2KMT A;  1YIJ Q;  3A8M B;  2YUN A;  4HCZ A;  1N9S A;  2YXY A;  4M75 E;  3OQ5 A;  2E5Q A;  3PMI A;  1M90 R;  2PUK B;  4KH0 B;  1VYT A;  2H8H A;  2AT1 B;  2C0T A;  2GQI A;  4M77 A;  1H92 A;  1RAB B;  4ZN3 A;  4FW2 A;  5LJ3 f;  2KT1 A;  3M9Q A;  5IAY A;  2X35 A;  3JRZ A;  3X28 B;  4N4I A;  4M4Z A;  2QQS A;  1Q82 U;  1G5V A;  4N0A A;  1VOM A;  1GRI A;  2E1H A;  1G3T A;  2Y4X A;  3I5R A;  4J9B A;  1S72 A;  4GLM A;  1WHJ A;  2B8A A;  3CCU A;  4FT4 A;  3M53 A;  4J6W A;  4F7U B;  4LDX A;  5CAI A;  3LH0 A;  1Q82 R;  2QYZ A;  4OMP A;  2RHI A;  9ATC B;  3MEU A;  1UE9 A;  3M0S A;  3QYG B;  2DXC A;  1UHC A;  1NEB A;  2CDT A;  4C5H A;  1ZQ1 A;  4M7A A;  4C0D B;  2LZ6 B;  1VQ6 A;  1HYO A;  2RHX A;  3REB B;  3IQL A;  2L3S A;  1HD3 A;  2VGN A;  4PFO A;  2QGF B;  5CKF A;  2GQV A;  2K3X A;  4BI4 A;  4XTV A;  4LDW A;  4RTV A;  2JM9 A;  3JCM e;  2RNA A;  1J3T A;  2G3R A;  3FDR A;  4PJO E;  2KNB B;  1YN8 A;  2OAU A;  2DF6 A;  4J6Y A;  2R5M A;  3QBY A;  1RUW A;  2O9S A;  4OMN A;  1W2B A;  3MEV A;  3QJ6 A;  1K9M C;  1X01 A;  1VIE A;  1OOT A;  1LJO A;  4LDU A;  5A0G A;  2ZGW A;  5HY6 A;  1VQ5 T;  1K0S A;  2FYK A;  4M75 B;  2VWF A;  2EW3 A;  4AT1 B;  2VGM A;  4OB0 B;  4V2S A;  1M8M A;  2BE9 B;  4IUR A;  4MMK A;  4D8K A;  1SHF A;  2KGT A;  2CT4 A;  4FSX A;  2EGC A;  2EPD A;  4ZNX A;  5LJ5 e;  4M7A F;  1WHH A;  2DNU A;  2HL3 A;  1MV3 A;  3CCS T;  3NPF A;  1K73 C;  2GBQ A;  2MF2 A;  1XNI A;  3SDZ A;  5GJW B;  1N8R C;  4QVC A;  2I0N A;  2E12 A;  1PM3 A;  2JN0 A;  1NLP C;  3SWN C;  5CKD A;  2F69 A;  1Z9Z A;  3QXE B;  4KRT A;  2X4J A;  1BBZ A;  4DOW A;  2DET A;  4KGV B;  3MEA A;  1IRE B;  2J6F A;  1SG5 A;  1WHM A;  2DEQ A;  3M54 A;  4OMM A;  5CIU A;  3CCM T;  3C94 A;  2COW A;  2YHT A;  4L5G A;  4M77 E;  1MNE A;  2HBP A;  4M78 B;  1YHQ Q;  1DJ7 B;  5J39 A;  1WDX A;  3G71 A;  1ABQ A;  4ZGE B;  2D8J A;  1Q86 U;  4C92 A;  1GCP A;  2LP5 A;  5IN1 A;  1VQK A;  2AKK A;  3G7Z A;  1VQN Q;  3RIR A;  2NWM A;  1JXO A;  2OTL A;  1M90 U;  1JO8 A;  1YCS B;  3CCS A;  4N4H A;  3OYA A;  2CP0 A;  3M0T A;  1TXQ A;  1I5L A;  4BY6 C;  1NM7 A;  1VQN A;  1MMD A;  3HKS A;  3CC2 Q;  2RQW A;  2DXT A;  1FWZ A;  3MKD A;  3JB9 J;  4C0G A;  1PC0 A;  3NGP A;  2I2L A;  3OS2 A;  3E19 A;  3M59 A;  4BDY A;  3CPW A;  3RBB B;  4F16 A;  3C0C A;  2CH4 W;  3UPU A;  1BYM A;  3CME Q;  2M16 A;  4EMG A;  3G6E Q;  1TH7 A;  2A3L A;  3R6O A;  3NTK A;  3U23 A;  1YWP A;  2JM8 A;  2BZ8 A;  1GFC A;  4J9G A;  2QXF A;  3NHN A;  1W2B S;  1C0M A;  4KGZ B;  3KXT A;  3OYL A;  4XQ3 A;  3ZL7 C;  4KUD K;  2JXB A;  3QYH B;  2CKK A;  2HL5 C;  2KT8 A;  1JU5 C;  2PU9 B;  3QKJ A;  5GAN 5;  3P8D A;  2K3B A;  1SRM A;  3HSB A;  3D7S B;  4BUG A;  2DXU A;  3CC7 T;  3CCV A;  2DBK A;  3ASK A;  2AZS A;  4M7D A;  1D0Z A;  2M1H A;  1UGR B;  2FO0 A;  1TUC A;  3TQ7 P;  1VQ9 Q;  2M02 A;  1W1F A;  2XDB A;  2DTI A;  1FYN A;  1ZHI A;  3C12 A;  1B34 A;  4A63 B;  2RHY A;  4LNP A;  1KQ1 A;  4DBH A;  2E3I A;  2JUF A;  3VKI A;  5GAN 7;  2E70 A;  4NOY A;  1LPL A;  1BCO A;  4XTX A;  5IHK A;  3GIB A;  4E7J A;  4C5E A;  2QDY B;  2K6D A;  1RI0 A;  1D1C A;  1UJ0 A;  2DBM A;  1YJN A;  4EMK C;  1OPK A;  1WIE A;  1M1K R;  2EIF A;  4C5G A;  2PVG B;  1M3B A;  2EVR A;  2SRC A;  4RTW A;  4F7U E;  5IXF A;  1G8X A;  2EQI A;  2DKG A;  2KEA A;  3CCL T;  3OS1 A;  1SSF A;  3WVE B;  3JV3 A;  2PUO B;  2QEX Q;  2MWO A;  1NJI R;  1T0J A;  5KE3 A;  1VQ6 Q;  3NTH A;  3A1P A;  3I55 Q;  1U5S A;  2F2X A;  3QWX X;  3L2Q A;  3JCM h;  2RK2 A;  4IIM A;  4R56 A;  5KYU A;  4IUT A;  2E3H A;  4OGC A;  3H8Z A;  4RG2 A;  5CO7 A;  1KQS S;  3H6Z A;  5FU6 B;  3BFM A;  1QP3 A;  4IUQ A;  4ZN1 A;  4JRI A;  1OZ2 A;  1WYX A;  5C0M A;  3CC4 T;  4Z02 A;  2P4T A;  2DE0 X;  3OS5 A;  1K73 U;  2FPD A;  4MML A;  5CQX A;  3REA B;  2HAX A;  3EAE A;  2RHZ A;  1W70 A;  1QVP A;  3S3O A;  1YJW T;  2KVQ G;  1UFF A;  1BB9 A;  4M7A B;  3L2U A;  2MYS A;  1RAD B;  4M77 C;  2LJ3 A;  4E7H A;  5FRM A;  2RI2 A;  2O31 A;  3M56 A;  4JDS A;  4FW1 A;  2QGG A;  1KJW A;  2QEX A;  2V8I A;  3DLM A;  3VV0 A;  3BDL A;  3HHT B;  1YJW Q;  2DXB A;  2SEM A;  4J9F A;  2DAQ A;  2YDL A;  1AWJ A;  2YLC A;  1JJ2 P;  3RES A;  3OYJ A;  3QII A;  3O5Z A;  2DIQ A;  1G83 A;  2JNG A;  2OJ2 A;  2GTO A;  4PJO G;  5LJ5 f;  3EG1 A;  4WF2 A;  5LJ3 h;  3LW5 E;  4JJN K;  4EMK A;  4M75 A;  4F14 A;  1Q7Y U;  2LNH B;  3QO3 A;  1OX8 A;  1WJQ A;  2FHD A;  1K8A U;  1NLO C;  5CK9 A;  1IZ6 A;  4JRP A;  1KHI A;  2C0I A;  3M4G A;  4QVZ A;  1Y96 B;  3H0H A;  4J9C A;  4MZT A;  4OMO A;  1D0X A;  2OAW A;  2LQW A;  5L23 A;  3CCE A;  5FWB A;  2L2P A;  5IXB A;  3TSW A;  3TRE A;  3M58 A;  2E64 A;  3UDC A;  4F17 A;  5GAO r;  4LE9 A;  1SHG A;  4EPC A;  1EZZ B;  4C8Q A;  2QTX A;  2KRM A;  3SWN B;  4DEY A;  1H8K A;  4XU2 A;  3I56 T;  5KYU B;  1K9A A;  2BIV A;  2WSF E;  1JJ2 S;  5AYF A;  5M9O A;  3V7R A;  5FU7 C;  2DL3 A;  2GCX A;  3S3M A;  1WNL A;  2XKO C;  5GAM d;  2H3J A;  2KSS A;  3H9N A;  2LT1 A;  1VQ9 T;  4YTL A;  1M2V B;  3NTI A;  5GMK h;  1WI7 A;  2K2V A;  3PIP A;  3V8J A;  2X51 A;  3I56 A;  3TEE A;  3MO8 A;  1YJN T;  3VYG A;  4MZM A;  5J3B A;  4BE2 A;  4M75 G;  1WZO A;  1Q86 C;  5KYY B;  2LVM A;  1RAC B;  3JCM J;  5GAO n;  5HK3 A;  1VQM T;  3QDF A;  3CCJ T;  1VQ9 A;  1U06 A;  1OEB A;  4M7D F;  2E4H A;  4XU3 A;  1TOV A;  4DBR A;  1YIJ A;  1LCK A;  4A54 A;  1WHK A;  2BUD A;  2DFU A;  2Y90 A;  2ZPE B;  1Y0M A;  1ZSG A;  2DTO A;  2JOY A;  4A4H A;  1C1A A;  3EG9 A;  4OF1 A;  3G6E T;  4ZTF A;  3CCU Q;  1F1B B;  4LDV A;  2FRW A;  1Q81 U;  1D0Y A;  2COZ A;  5DLO A;  3MPU B;  1UTI A;  2J05 A;  1XJW B;  1S72 Q;  4PJN A;  1AZE A;  1M30 A;  3QHS A;  3G71 Q;  2A7Y A;  1N27 A;  4DBQ A;  5GAN h;  1UUE A;  4ESR A;  7AT1 B;  1X6B A;  2KYM A;  2FVU A;  3GNF B;  2ABL A;  4PKC C;  2DER A;  3PVL A;  1CSK A;  2QA4 A;  2EYZ A;  2LCS A;  2MCN A;  2RM4 A;  1M3A A;  5FW9 A;  3JCM Q;  3JCM c;  2XHC A;  3OYK A;  2LMJ A;  5CKB A;  2K79 A;  2LX7 A;  4B9W A;  1H3Z A;  4HXJ A;  1BI3 A;  4AFQ C;  5KH6 A;  3GPL A;  1VQL Q;  2KAF A;  3GLX A;  2X3W D;  4E2F B;  1K76 A;  3JCM P;  4M78 C;  3CCM Q;  4X34 A;  1QLY A;  1RAI B;  1FMV A;  5HKC A;  1QVF S;  2LDM A;  4PK4 A;  1PD1 A;  2NUP B;  3QDR B;  2EQJ A;  3JCM d;  2IVW A;  4HVU A;  2AZV A;  1Q81 R;  4UC4 A;  3VUB A;  1YWO A;  4J6X A;  3HFO A;  2L89 A;  4O6J A;  2RHU A;  2ZPF B;  1M3C A;  1QCF A;  2YRC A;  1BIA A;  1TS9 A;  2CSQ A;  3OYI A;  4JRK A;  2DRM A;  1BCM A;  2JW4 A;  1E6G A;  3M0R A;  4OGE A;  4CC4 B;  4XK8 E;  1KQS A;  1D09 B;  3OBY A;  2DK3 A;  3OYD A;  2M9U A;  2DIL A;  1WXB A;  2D9T A;  3UA6 A;  4IUP A;  4N0A C;  1UB4 A;  3CCL A;  4QW2 A;  2K4Y A;  3GF5 A;  3PGG A;  3DLL A;  3CPW P;  1Y57 A;  2BZX A;  5C6S A;  1KC8 C;  4FT2 A;  1NYG A;  1MMG A;  1QVF A;  5DLQ E;  3JCM g;  2W10 A;  1UGP B;  3EH1 A;  4JJD A;  2OTL Q;  3CPF A;  2EKH A;  1BI2 A;  3CCE T;  3GOX A;  3OS0 A;  5LL6 S;  3CD6 Q;  3G4S Q;  1VQP A;  1FXX A;  1X2K A;  1MUZ A;  3FLG A;  1YI2 A;  3EFO A;  1VYV A;  2BTT A;  2C06 A;  2JMC A;  1AWO A;  2MK5 A;  3SD4 A;  3M0U A;  2EFI A;  1ZSZ A;  2JTF A;  4E7I A;  4M7A D;  3CBP A;  3MP8 A;  1PSE A;  3JCM W;  1SF9 A;  3NMZ C;  3QPH A;  1PRL C;  3PVQ A;  3LWH A;  2DPP B;  4LXC A;  1VQO A;  4NL3 A;  4FYV B;  2K5L A;  1X75 C;  4XU0 A;  5KYX A;  2EGE A;  4M7A C;  3JCM f;  3VS5 A;  3EFS A;  5LJ5 h;  2NUP A;  3OYE A;  2RJC A;  2EAY A;  5GAN 6;  2XI9 A;  3CCR Q;  2FG0 A;  2MWP A;  1VQ8 T;  3G6E A;  1RL2 A;  3J81 E;  3VS6 A;  3S3N A;  1NBE B;  2EYX A;  1NZ9 A;  2HSP A;  4R55 A;  3LH5 A;  2A0F B;  2X9H A;  3HRS A;  3ZBD A;  3RKW A;  2HNI A;  5GAN j;  4PFP A;  1U1S A;  2MMP A;  1G3S A;  4GLK A;  4M7D B;  3WXM B;  2QA4 T;  1N6A A;  5LJ5 g;  4CC3 A;  2XMF A;  1S72 T;  1CKA A;  1QQJ A;  1W2B P;  2A36 A;  2A37 A;  4JPB W;  2CSI A;  1X6G A;  2IG0 A;  1WQ7 A;  2DMO A;  3HRT A;  3LX7 A;  1D3B A;  2P4R A;  4A53 A;  5HCK A;  2FZK B;  2IPO B;  3CCQ T;  2DYB A;  2YSQ A;  2HEQ A;  2EJG A;  1WJR A;  2K57 A;  3MP6 A;  4ELY C;  2E6Z A;  2WSE E;  3OYN A;  2LJ0 A;  3SB2 A;  1KHC A;  2F2V A;  4C0D C;  3OW2 S;  4AFU C;  3PIO A;  3OB9 A;  3FJ5 A;  1MGQ A;  2KYB A;  5FU7 B;  3UWN A;  1HXD A;  1YJN Q;  1OI1 A;  4A4F A;  2QK0 A;  2HCK A;  2RQV A;  1MHN A;  2DJZ A;  1K0X A;  4C92 D;  5KCO A;  4JZ4 A;  2VC8 A;  2DL4 A;  2DVE A;  4M7A E;  1Q86 R;  3TVT A;  2QQR A;  1W4S A;  4DA4 A;  1BI1 A;  3CMA Q;  4KUI A;  1X69 A;  1JBM A;  1SSH A;  1UHF A;  2IIM A;  5GAN e;  4ZGJ B;  1VQ7 T;  2F5K A;  4F7U F;  2H3E B;  1QWF A;  2R57 A;  3AHU A;  1PKT A;  4B9X A;  2COY A;  1UEB A;  2MIO A;  3WVD B;  1AT1 B;  3M5A A;  2JTM A;  1KQS P;  4E7L A;  3LGL A;  2AKL A;  3P8H A;  1YIT A;  4CC2 A;  5GMK j;  3BY7 A;  2YRV A;  5FRN A;  4MDW A;  4PJO F;  1Q81 C;  1V76 A;  2EJF A;  4IUU A;  1YIT T;  1Y71 A;  5CVI A;  2CP5 A;  3AT1 B;  1NE8 A;  3A8L B;  4F04 B;  2ED0 A;  3QUI A;  5KYY A;  2V1Q A;  4LDY A;  2LX9 A;  1FMW A;  2C0O A;  3A98 A;  3HRU A;  2HQE A;  4M75 F;  3EG0 A;  4FIB A;  3N5B B;  3MJX A;  4M78 E;  4EIK A;  1YNZ A;  1M5Q 1;  5L8R E;  4A4K A;  3RUX A;  2YT6 A;  2JS2 A;  2F5T X;  2ZPG B;  3CC4 A;  4RG8 A;  3PTA A;  2CUB A;  2LCC A;  4M75 C;  3UA7 A;  1W6X A;  3EFR A;  4DOV A;  3EG9 B;  3A5Z B;  4QQ6 A;  1SEM A;  2LJ1 A;  5KYW B;  4PJL A;  1WX6 A;  2X4X A;  4II1 A;  3OA6 A;  2RJD A;  2DYI A;  3FRN A;  1BI0 A;  4J9H A;  2L3Q A;  2D0N A;  1N8R R;  3O8V A;  3OSS C;  5D6Y A;  2P84 A;  3QZ9 B;  1QW1 A;  1K4U S;  4FL6 A;  5GAN 8;  3CCQ A;  3V7S A;  2ECZ A;  4KUL A;  2V8K A;  1ABO A;  2CP6 A;  2NLU A;  1NJI U;  2GFA A;  2BZY A;  3EGX A;  1KSW A;  2KRO A;  2V8J A;  2KR3 A;  3HTR A;  3EGD B;  4J8O A;  2DM1 A;  5GAM f;  1JJ2 A;  3UF4 A;  2KE9 A;  1VQ6 T;  1M2O A;  1KD1 U;  2QEX T;  1M1K C;  1IXD A;  1I0C A;  5GAN g;  1QVG A;  2XD0 A;  2CT3 A;  5A0D A;  4M77 B;  5LJ5 j;  4PJO B;  5GAN 2;  4OVA A;  2RPN A;  1N5Z A;  2CS7 A;  2CRE A;  2QDL A;  2VAS A;  1IHW A;  2KRS A;  1B07 A;  2CZ7 B;  4J5Y A;  3P8B B;  1U3O A;  5D7U A;  3X26 B;  1GCQ A;  1VQK Q;  4X9D A;  2A08 A;  5I11 A;  5KYN A;  1EFN A;  3VJP A;  2EQM A;  2RQR A;  1E6H A;  1BIB A;  4RTZ A;  1ZA2 B;  3SFM A;  4OML A;  3EG2 A;  1Q82 C;  4J9I A;  4J9E A;  5GMK i;  4IKF A;  3CC7 Q;  5GMK l;  1YI2 Q;  3VS1 A;  1O9S A;  3L1A A;  1CKB A;  2XID A;  1G3W A;  4JZ3 A;  1B7T A;  2VXF A;  3FC3 A;  2L0A A;  2RA2 A;  1X43 A;  4WCI A;  2FPF A;  4QKU A;  4RCC A;  4O5V A;  4KGX B;  1JB0 E;  2XDP A;  2O2O A;  3CMA A;  4B6M A;  2GF7 A;  1SPK A;  2HBW A;  1FX7 A;  4D6W A;  1VQO Q;  1NG2 A;  4N4G A;  3OMC A;  4M7D C;  2YWW A;  2X3X D;  2XDD A;  4PJM A;  4M75 D;  4MZP A;  4HKE A;  4QT7 A;  1P92 A;  3BE3 A;  2KBT A;  1JXM A;  4E6R A;  1X6O A;  1GCQ C;  5GAN 3;  3ZFJ A;  2RI3 A;  2NUZ A;  4CC7 A;  4KT0 E;  2QA4 Q;  1VA7 A;  1C6V X;  1TWB A;  1KIK A;  1OZ3 A;  4BI3 A;  1Y7X A;  1WLP B;  3EGU A;  4M78 A;  4Y92 A;  2KXC A;  3C95 A;  2R5A A;  5D6X A;  5LJ5 d;  4C92 C;  4PFZ A;  3OYY A;  4JUV A;  3VS4 A;  1K1Z A;  1Z9Q A;  1KC8 R;  3RDV A;  2AHJ B;  2ZPB B;  1AVZ C;  5D6W A;  4XTU A;  1R0B G;  5ECA A;  1VQN T;  2ENM A;  2KRN A;  3QG1 A;  4IUV A;  4C92 F;  4K11 A;  2J7I A;  3CCR T;  2AIR B;  4JRQ A;  2MPX C;  2VVK A;  1U8R A;  5GAM e;  3JB9 H;  4LN2 A;  2OI3 A;  4CRI A;  4ME7 A;  3OW2 P;  1K8A C;  4C8Q C;  5IH2 A;  1HK9 A;  5HK0 A;  2WSC E;  2WAC A;  1BK2 A;  1HJD A;  2DZ9 A;  2EQU A;  2DJQ A;  2RQU A;  3LLR A;  3L42 A;  4PLI A;  2F1L A;  3SEM A;  3CPW S;  1V1C A;  4OMF B;  4C8Q B;  1M9S A;  2EQK A;  1Q95 G;  1AEY A;  5J26 A;  4C92 G;  4M78 F;  3BW1 A;  1IB8 A;  4C92 B;  3G4S T;  3CD6 T;  1TTH B;  5LJ3 g;  2QG9 B;  1OYX A;  4Z89 A;  2OTL T;  3UAT A;  5GMK e;  3RKY A;  4FM4 B;  4XTW A;  2O4X B;  1UGQ B;  4DBF A;  3NFC A;  1U1T A;  2ZAE A;  4XU1 A;  3JB9 D;  3Q1J A;  2O01 E;  4AFS C;  1R0C B;  3I35 A;  1IHV A;  3QWY A;  4L6V 5;  1M27 C;  4M78 G;  4XTZ A;  1GL5 A;  1ZSZ B;  1NYF A;  1RAG B;  2DRK A;  3JCM V;  1PHT A;  5I2M A;  2CP2 A;  4KBM B;  1RLQ C;  1KK7 A;  5KYX B;  1VQ5 Q;  2FZG B;  1VQ4 Q;  1ACM B;  2J6O A;  3RKX A;  2CGH A;  1K8A R;  2HD0 A;  2J06 A;  1ZLM A;  1M1G A;  2QTV A;  2ZPI B;  2RJF A;  1LVK A;  4C8Q E;  3M57 A;  2RF0 A;  1RAE B;  1TU0 B;  2RI5 A;  2ROT A;  3C4S A;  4FU6 A;  4D8D A;  2DD4 A;  3MEW A;  3JCM b;  3J80 E;  3MET A;  1YIT Q;  5CCA A;  2YUP A;  3UT1 A;  1UDL A;  5CKH A;  3CXC P;  1IGU A;  4FSS A;  4HVV A;  3CXC S;  4BDZ A;  3MCA B;  1I4K 1;  4LD6 A;  4RTU A;  2YUQ A;  4C0Z A;  2E6N A;  1VQ5 A;  1VQ7 Q;  3JB9 F;  4M78 D;  1WHG A;  2KQW A;  4M77 G;  1YJ9 T;  4OP0 A;  1OQK A;  4EMH A;  2EYQ A;  2FB7 A;  2PQW A;  3CEY A;  3I9Q A;  1D3B B;  3ER0 A;  2LQ8 A;  4E7S A;  1SKU B;  5KCH A;  3CXC A;  3HL8 A;  3VUZ A;  1FMK A;  4J7I A;  1O75 A;  1WFW A;  1KD1 C;  5FLX E;  3CCM A;  1VUB A;  1Y07 A;  1I8F A;  1PKS A;  2XU8 A;  2EYY A;  4ZTJ A;  3GP8 A;  3V7C A;  3VS3 A;  1WQW A;  3PNW C;  4VUB A;  4C8Q G;  1IRX A;  4EDU A;  4LUE A;  1MMN A;  2E5K A;  1YHQ A;  4JJC A;  1OX9 A;  2LC4 A;  3M0Q A;  2CYZ B;  4QQD A;  1GBR A;  3CCQ Q;  4X1V A;  1BU1 A;  3CCU T;  1KG1 A;  2KDS A;  3L2W A;  2PNI A;  3S6W A;  3H0F A;  2CP3 A;  3TU4 K;  2G6F X;  2E10 A;  2JT4 A;  2HKQ B;  2CZ1 B;  2OTJ A;  3LYI A;  1RLP C;  4ANJ A;  1ZBX A;  3SHW A;  1AOJ A;  2DL5 A;  1YCY A;  1VQL A;  3G4S A;  1VQP Q;  6AT1 B;  4Z8A A;  1I1J A;  2JVV A;  3CCJ Q;  3L2R A;  4FCY A;  4X9C A;  4A4E A;  3MHX A;  1B34 B;  2MOX A;  1YBY A;  2W0Z A;  2F2W A;  4RTX A;  3JB9 G;  1H64 1;  2HQX A;  2XK0 A;  3SWN A;  2BE7 D;  1WA7 A;  1QVF P;  1XQH A;  1WJS A;  3FJP A;  3LGF A;  1TUD A;  1VQ8 Q;  3MP1 A;  1QWE A;  2VXE A;  2HZY A;  4XAX B;  3M4Y A;  1GFD A;  2PVD B;  3QJY A;  5LJ3 j;  1NPR A;  2J6K A;  1YJ9 Q;  2JMA A;  1QCO A;  1N8R U;  5GAO p;  5GJV B;  3VYH B;  5A0L A;  1A0N B;  5EC7 A;  2ATC B;  2DO3 A;  1NEG A;  1PG5 B;  1SRL A;  3I56 Q;  2RO0 A;  4M7D E;  2X4Y A;  3TCJ A;  3CCV Q;  4IIO A;  3ULR B;  2K2M A;  2M0Y A;  3A8O B;  2EWN A;  5GAO l;  5GAM g;  4GBQ A;  2DX1 A;  3A8G B;  4RCB A;  1UGV A;  3VS0 A;  3CCE Q;  2V26 A;  4OB3 B;  4BY6 B;  2NUT B;  2V1R A;  1RAF B;  2ED1 A;  5FU6 C;  3GNG A;  2P0P A;  1VQ8 A;  1AZG B;  4WTO B;  1TSF A;  2HSE B;  4RUG A;  4BAC A;  4MDX A;  2O4X A;  1MMA A;  4RMO A;  2K3Y A;  3JSC A;  2RN8 A;  4E7Z A;  1VQ4 T;  1E7O A;  1T0H A;  2Y4Y A;  3G1J A;  5IHN A;  1PRM C;  1PNJ A;  2VYT A;  3HFN A;  4BB7 A;  3EGD A;  3E9G A;  2PVO B;  2DEU A;  2M0O A;  2O88 A;  2PZ1 A;  4L59 A;  4JLI A;  4DEX A;  1VQ7 A;  2LNV A;  4M7D D;  1YJW A;  2MAM A;  3A8H B;  3PFS A;  4HA8 A;  1WHL A;  4PJO C;  8ATC B;  1JEG A;  1PD0 A;  1NPP A;  2EYW A;  4C8Q D;  4M77 D;  1VQ4 A;  3RNJ A;  1BKB A;  3BDU A;  2L3R A;  2AK5 A;  2VUB A;  3DB3 A;  1M90 C;  1JQQ A;  1ZSZ C;  1H3H A;  3KUF A;  3URG A;  1Y96 A;  4PL6 A;  4JLG A;  2RK1 A;  3QZ5 B;  4C5I A;  1YFN A;  5I21 A;  2MI6 A;  1ZUK A;  1K73 R;  2O9V A;  4FYY B;  3CBM A;  4HT9 A;  1GXI E;  2ZZD A;  2JJ9 A;  5GAM h;  5GAN d;  3I55 T;  2JZ2 A;  3L2V A;  1ZBJ A;  4QQG A;  2K7A A;  5FRO A;  2LTO A;  1VQL T;  3QSU A;  4HCC A;  2DD5 A;  4QVD A;  1QKW A;  3F70 A;  1M4Z A;  2GTJ A;  1EIF A;  3L2Z A;  4HT8 A;  1AD5 A;  1QP2 A;  4RTY A;  2L3P A;  1OU9 A;  3OY9 A;  2NYS A;  4Y91 A;  1K9M R;  4F7U G;  1X2Q A;  1M2V A;  5GAN 4;  5IHI A;  2BKD N;  1S1N A;  2GNC A;  2FPE A;  1XTD A;  3OYB A;  1VYU A;  1RAA B;  2QQB A;  4E7K A;  1KC8 U;  2B86 A;  2PTK A;  3X24 B;  2P0Q A;  3ZEH A;  3G71 T;  4CI0 C;  2HQH A;  3OYC A;  1EX4 A;  4PJO D;  4LD9 K;  1M8V A;  2GGR A;  4RKU E;  2QAS A;  2CZ0 B;  1QMC A;  3OYG A;  1KFZ A;  5I22 A;  3OSV A;  4BE1 A;  1ZA1 B;  2YLB A;  5GMK m;  1XOV A;  1JRI A;  3PMT A;  4RTT A;  2FEI A;  2DA9 A;  1IO6 A;  1VQO T;  2XG8 D;  3OBW A;  2RMO A;  4PLL A;  4XTY A;  2DL8 A;  4FYX B;  3R6N A;  1R8O B;  1I07 A;  2JTE A;  3HPW A;  1KD1 R;  3ME9 A;  1VQM Q;  2LCL A;  4PNO A;  1T3S A;  3H41 A;  3EFO B;  4E47 A;  3CC2 A;  1QVG S;  1YI2 T;  4ZGD B;  2D6F A;  1AHJ B;  3RMS A;  3OYM A;  4ORZ A;  4F7U A;  1LNX A;  3CBO A;  3CME T;  3CCJ A;  3X20 B;  3JB9 I;  4Y28 E;  2LRQ A;  4HVW A;  1PWT A;  4NL2 A;  2YRD A;  2EKO A;  4JS5 A;  3CME A;  5DY9 A;  8AT1 B;  2ROL A;  1K9M U;  3CC2 T;  1AWX A;  4M7D G;  2E65 A;  3H0I A;  1GBQ A;  2FRY A;  2RH2 A;  3FB9 A;  1VQK T;  2FL7 A;  1OV3 A;  4NS5 A;  4DQ2 A;  1OUL A;  3INZ A;  4P5N A;  1ZUU A;  1YJ9 A;  1VQM A;  1R77 A;  3OYF A;  1VIF A;  4GY5 A;  4BD3 A;  5A2Q E;  1G2B A;  3JAM E;  1LOJ A;  5KE2 A;  1Q7Y R;  1HSQ A;  3E9F A;  4M77 F;  1WGS A;  1YHQ T;  2HKN A;  3EH2 A;  1QCN A;  4J9D A;  5LJ3 e;  3VU3 C;  5EG2 A;  2CUD A;  4J7F A;  1M1K U;  3PT9 A;  2RJE A;  4M7A G;  2RQT A;  3X25 B;  2K5I A;  4LUD A;  4C8Q F;  1D1B A;  3DB4 A;  3VRY A;  3J7A F;  3V8K A;  1RI9 A;  2ZCF B;  2QQA A;  1UJY A;  1QKX A;  2QAZ A;  4Z88 A;  3EHQ A;  4BE0 A;  3EG3 A;  5CQY A;  1Q7Y C;  2P0K A;  3CCR A;  4R0K A;  1MND A;  2RB6 A;  2D8H A;  4AG1 C;  3CCS Q;  2EGA A;  1N9R A;  2KY9 A;  4JJB A;  1UEC A;  4AG2 C;  2K9G A;  4A4G A;  3FEO A;  3JCM X;  2ZPH B;  3E1S A;  1YP5 A;  2NUT A;  3I55 A;  3PE0 A;  1I81 A;  1OU8 A;  3V8L A;  3CC4 Q;  5DM7 R;  3RR6 A;  3VRZ A;  4AFZ C;  3KFV A;  3RMQ A;  2KI7 A;  1TUG B;  3OMG A;  2DVJ A;  2LQN A;  2DLP A;  2YUO A;  2VKN A;  1ARK A;  3CD6 A;  2DL7 A;  3I5S A;  1UGS B;  2EBP A;  2Z0W A;  5GAM j;  1D1A A;  4KH1 B;  4OB2 B;  2GFU A; 
#chains in the Genus database with same CATH homology
 4LUE A;  3TVT A;  2DE0 X;  2E5K A;  4JJC A;  2FPD A;  3M0Q A;  2A28 A;  3REA B;  1GBR A;  3CQT A;  1W70 A;  2JS0 A;  1ZUY A;  1X69 A;  5FWC A;  1SSH A;  1UFF A;  1UHF A;  2IIM A;  2ESW A;  1BB9 A;  4X1V A;  1BU1 A;  4OMQ A;  1QWF A;  1MV0 B;  2LJ3 A;  2PNI A;  1PKT A;  2O31 A;  3H0F A;  1WXT A;  3M0P A;  2MIO A;  4HCK A;  1KJW A;  2G6F X;  3THK A;  2JT4 A;  2KXD A;  1RLP C;  2SEM A;  2AKL A;  4J9F A;  4CC2 A;  1WXU A;  2YDL A;  1AWJ A;  3SHW A;  1AOJ A;  2DL5 A;  3VS7 A;  1T3L A;  3O5Z A;  1I1J A;  4Z8A A;  1B3Q A;  2D1X A;  1G83 A;  2OJ2 A;  1ZX6 A;  2GTO A;  2CH4 A;  3EG1 A;  2MOX A;  2W0Z A;  2ED0 A;  2V1Q A;  3EHR A;  4F14 A;  2F2W A;  4RTX A;  2LNH B;  2HDA A;  2C0O A;  3TSZ A;  3A98 A;  2M51 A;  1NLO C;  1WA7 A;  3EG0 A;  2C0I A;  3GBQ A;  1TUD A;  3H0H A;  1QWE A;  4J9C A;  4OMO A;  4EIK A;  1YNZ A;  2OAW A;  2LQW A;  1AWW A;  1GFD A;  1X27 A;  2J6K A;  5L23 A;  2YT6 A;  2JS2 A;  5FWB A;  2L2P A;  5IXB A;  3TSW A;  2CUB A;  2JMA A;  3UA7 A;  1W6X A;  5GJV B;  4F17 A;  1A0N B;  5EC7 A;  4LE9 A;  1NEG A;  1SRL A;  1SHG A;  1TG0 A;  1OPL A;  2KRM A;  1SEM A;  2LJ1 A;  3VS2 A;  4DEY A;  4IIO A;  1WX6 A;  1H8K A;  3ULR B;  2K2M A;  1UG1 A;  2M0Y A;  4J9H A;  1K9A A;  2L3Q A;  2D0N A;  4GBQ A;  2DX1 A;  2DL3 A;  2YUN A;  3VS0 A;  1UGV A;  1K4U S;  2ECZ A;  1VYT A;  2H8H A;  2V1R A;  1WI7 A;  2C0T A;  2GQI A;  1H92 A;  2ED1 A;  1ABO A;  1AZG B;  4RUG A;  2BZY A;  2KT1 A;  1KSW A;  2KRO A;  2KR3 A;  4M4Z A;  2DM1 A;  3UF4 A;  2KE9 A;  2RN8 A;  1E7O A;  1T0H A;  1GRI A;  3I5R A;  4J9B A;  5IHN A;  1PRM C;  1I0C A;  1OEB A;  1PNJ A;  1U06 A;  4GLM A;  2CT3 A;  2O88 A;  1LCK A;  2PZ1 A;  2RPN A;  4DEX A;  1N5Z A;  2CRE A;  2QDL A;  2KRS A;  1Y0M A;  4OMP A;  1ZSG A;  1B07 A;  1U3O A;  1UE9 A;  1JEG A;  3M0S A;  1GCQ A;  2FRW A;  2EYW A;  1UHC A;  2A08 A;  5I11 A;  1NEB A;  2CDT A;  1EFN A;  1UTI A;  2RQR A;  3RNJ A;  1E6H A;  2J05 A;  2LZ6 B;  2AK5 A;  4RTZ A;  4OML A;  3REB B;  3IQL A;  3EG2 A;  2L3S A;  1AZE A;  1M30 A;  1HD3 A;  1JQQ A;  1H3H A;  1UUE A;  4ESR A;  4J9I A;  1X6B A;  4RTV A;  2KYM A;  2JM9 A;  4J9E A;  2RNA A;  1J3T A;  2ABL A;  2KNB B;  1YN8 A;  2DF6 A;  3PVL A;  1CSK A;  1ZUK A;  2EYZ A;  1RUW A;  2O9V A;  2O9S A;  4OMN A;  2LCS A;  2MCN A;  3VS1 A;  1M3A A;  5FW9 A;  1OOT A;  1CKB A;  2LMJ A;  2K79 A;  4JZ3 A;  2LX7 A;  1ZBJ A;  1K0S A;  2L0A A;  1X43 A;  2K7A A;  2VWF A;  2FPF A;  4WCI A;  4HXJ A;  2EW3 A;  4AFQ C;  1M8M A;  2O2O A;  4D8K A;  1SPK A;  2HBW A;  1SHF A;  2KGT A;  2X3W D;  1QKW A;  1NG2 A;  2GTJ A;  1K76 A;  2CT4 A;  1AD5 A;  2EGC A;  2X3X D;  4RTY A;  2L3P A;  2EPD A;  4ZNX A;  2DNU A;  1MV3 A;  1X2Q A;  3NPF A;  2GBQ A;  1QLY A;  5IHI A;  5GJW B;  4QT7 A;  1S1N A;  2KBT A;  2I0N A;  1JXM A;  2GNC A;  4E6R A;  2FPE A;  1GCQ C;  1VYU A;  2NUZ A;  1NLP C;  4CC7 A;  4HVU A;  1Z9Z A;  2AZV A;  1VA7 A;  2B86 A;  2PTK A;  1KIK A;  1YWO A;  1WLP B;  3EGU A;  4Y92 A;  4KRT A;  2KXC A;  2GGR A;  1M3C A;  1QCF A;  2CSQ A;  1BBZ A;  2DRM A;  1KFZ A;  2JW4 A;  3VS4 A;  1K1Z A;  1Z9Q A;  5I22 A;  1E6G A;  2J6F A;  3M0R A;  4OMM A;  1XOV A;  4CC4 B;  4RTT A;  1AVZ C;  2FEI A;  2DA9 A;  5ECA A;  1IO6 A;  2ENM A;  2KRN A;  4K11 A;  2RMO A;  2J7I A;  2VVK A;  2DIL A;  1WXB A;  1WDX A;  1ABQ A;  2DL8 A;  3UA6 A;  2D8J A;  4LN2 A;  2OI3 A;  1GCP A;  3R6N A;  2LP5 A;  1I07 A;  2AKK A;  2JTE A;  5IH2 A;  1T3S A;  3H41 A;  1BK2 A;  1HJD A;  2DJQ A;  2NWM A;  2RQU A;  1JXO A;  1Y57 A;  2BZX A;  3SEM A;  1JO8 A;  1YCS B;  1V1C A;  4ORZ A;  1AEY A;  1NYG A;  3M0T A;  2W10 A;  4HVW A;  1PWT A;  1NM7 A;  4JJD A;  2RQW A;  2EKH A;  3NGP A;  2ROL A;  1X2K A;  1MUZ A;  4Z89 A;  1AWX A;  1VYV A;  2BTT A;  3UAT A;  3H0I A;  2JMC A;  3RBB B;  4F16 A;  3C0C A;  1AWO A;  2CH4 W;  1GBQ A;  2FRY A;  3M0U A;  1OV3 A;  4AFS C;  1ZUU A;  3I35 A;  3U23 A;  1YWP A;  3NMZ C;  1PRL C;  3PVQ A;  3QWY A;  1M27 C;  1GL5 A;  2JM8 A;  1NYF A;  2BZ8 A;  1GFC A;  2EGE A;  2DRK A;  4J9G A;  1PHT A;  1G2B A;  3VS5 A;  3NHN A;  1HSQ A;  1RLQ C;  2FG0 A;  3ZL7 C;  2JXB A;  4J9D A;  2KT8 A;  2J6O A;  1JU5 C;  2CUD A;  2J06 A;  2K3B A;  1SRM A;  3VS6 A;  1ZLM A;  2RQT A;  2DBK A;  2EYX A;  2AZS A;  4LUD A;  3VRY A;  2RF0 A;  2HSP A;  1RI9 A;  2FO0 A;  2ROT A;  1TUC A;  3LH5 A;  1UJY A;  1QKX A;  4D8D A;  4Z88 A;  3EHQ A;  1W1F A;  1FYN A;  3EG3 A;  4A63 B;  4LNP A;  4R0K A;  4CC3 A;  2YUP A;  2XMF A;  1UDL A;  1CKA A;  5IHK A;  2D8H A;  4FSS A;  4HVV A;  4AG1 C;  2A36 A;  2A37 A;  2K6D A;  4JPB W;  2EGA A;  2CSI A;  1X6G A;  2DMO A;  4RTU A;  4JJB A;  1UJ0 A;  1UEC A;  2DBM A;  4AG2 C;  2YUQ A;  1OPK A;  1WIE A;  2K9G A;  2P4R A;  1M3B A;  2EVR A;  1YP5 A;  2SRC A;  5HCK A;  3PE0 A;  4RTW A;  2DYB A;  5IXF A;  2EQI A;  2KEA A;  2YSQ A;  2HEQ A;  3JV3 A;  3I9Q A;  2LJ0 A;  1T0J A;  2F2V A;  3VRZ A;  4AFZ C;  4AFU C;  3KFV A;  1FMK A;  1U5S A;  1WFW A;  3FJ5 A;  2F2X A;  3QWX X;  4IIM A;  2DVJ A;  2KYB A;  2LQN A;  2DLP A;  1PKS A;  2YUO A;  2VKN A;  2EYY A;  1ARK A;  2DL7 A;  2HCK A;  2RQV A;  3I5S A;  3VS3 A;  1WYX A;  2EBP A;  1K0X A;  4JZ4 A;  2DL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...