5FY4A

Crystal structure of the catalytic domain of human jarid1b in complex with succinate
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
462
structure length
454
Chain Sequence
b'SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with Succinate
rcsb
total genus 147
structure length 454
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fy4A01
2OS2A 3KV9A 3PURA 4GJYA 5FPLA 5FXXA 4AI9A 4URAA 5F37A 5LW9A 2OT7A 3PUSA 2WWJA 2WWUA 4QXCA 3LD8A 5IVJA 3PU3A 5FXZA 3DXTA 3ZLIA 5FZHA 4DIQA 2XUEA 2GP5A 4Y3OA 3N9PA 4D6SA 5ANQA 2XXZA 4UF0B 5FY7A 5K4LA 4CCLA 5IVVA 5A3PA 3AL5A 4CCNA 2Q8CA 4V2VA 5FP4A 5FY0A 4BISA 4QX7A 3KVBA 3NJYA 2YBKA 2YPDA 5LWBA 3OPTA 3PU8A 3LDBA 5FYYA 5IVYA 5A7PA 5FPUA 4IGPA 3PDQA 3AVSA 5KR7A 4CCJA 2OQ6A 5FZEA 4HOOA 5F2WA 1VRBA 3KVAA 5FYBA 5FBJA 5FYTA 5FZLA 4GD4A 4QWNA 4GJZA 5FV3A 5F32A 4QXHA 4IGOA 5FP8A 5FZ8A 5A1FA 5FY9A 4EZHA 4BU2A 2XMLA 4CCOA 2YU2A 4LITA 3U4SA 4Y33A 4EYUA 5F3EA 5IVBA 4TN7A 2P5BA 5FYZA 3RVHA 4ASKA 3N9LA 3DXUA 5FZDA 5FZBA 5ISLA 5FYHA 4LIVA 5FP3A 5FZOB 2OX0A 3PUAA 5FPBA 4Y4RA 5F5AA 5LY2A 4XDOA 5FZGA 3ZPOA 5FY5A 5FZ3A 3UYJA 4DO0A 5A7NA 5A7WA 4BXFA 3AVRA 5FZIA 5FJKA 4XDPA 3KV6A 5FUPA 4E4HA 2VD7A 2YBSA 2W2IA 4CSWA 5FYUA 5A3TA 5IVCA 5IWFA 5A3WA 5FZ4A 3N9NA 5FYMA 3N9OA 5FY4A 5FZAA 5FUNA 5FYSA 3KV5A 3K3NA 3KV4A 4CCMA 5CEHA 2GP3A 5FP7A 5FYCA 5FPVA 5FY1A 4IGQA 5A1LA 5FZ1A 3K2OA 4CUGA 2PXJA 5A80A 4LXLA 4GAZA 5E6HA 5FZ0A 5FZ6A 5LY1A 4V2WA 5FZ9A 5FZKA 2Q8EA 3N9QA 4D6QA 5F5IA 4D6RA 5A7OA 5A7SA 4NUBA 4CCKA 5FWJA 5FZCA 4AAPA 4UF0A 5IVFA 5A7QA 5FZFA 4HONA 5F39A 5F3GA 2Q8DA 4C8DA 5IVEA 5IW0A 2OQ7A 2XDVA 5F3IA 5FPAA 3PUQA 4QXBA 3N9MA 5FYIA 5FXVA 5FP9A 5FWEA 5F3CA 4QU1A 3U78A 5F2SA 5A7WB 3AL6A 5FYVA 5FY8A 5FZ7A 4LIUA 2YBPA 4EZ4A 3OPWA 5FZMA 5F5CA 3K3OA 2YU1A 5FXWA 5FJHA 5FZOA 4QX8A 5A3NA 3PTRB
chains in the Genus database with same CATH superfamily
5GZEA 1QJEA 3RPQA 2VW1A 2JD9A 3AYAA 1O3SA 2R30A 2RDRA 1JTZX 1AVBA 1ZX5A 4K21A 4FSJA 2BGCA 1I1EA 1C1FA 3QOPA 3O1UA 1RUJ1 2PA7A 3POBA 2XUEA 2JG8C 4GXLA 2WA3A 1C8NA 5K4LA 3LGRA 1GANA 2R072 4ZXKA 3UJOA 2ZMLA 3PVEA 5C9AC 5IK8A 1WA6X 2EF6A 4IEUA 2IVJA 4ZY9A 1RXGA 2FBEA 2KA3A 4QT6A 3IPVA 4S2DA 1GZ9A 3LDBA 2VCMA 2W92A 2DTWA 4Q0PA 2W91A 1YJKA 2OQ6A 4LO8A 3AKQA 3T0BA 1UY4A 1W8ZA 4A6OA 4CP1A 5J7MA 2LM3A 4LQRA 5JXIA 5DZFA 5IHRA 4QHZA 3WF3A 1AR63 3FN9A 2VZSA 1POV1 3S6PA 3FUOA 3VKNA 3HJRA 4Y5TA 3U1XA 1O7FA 3LFIA 5T50A 3POWA 3TRSB 1FOD1 4PDWB 4BU2A 5GZGA 3USUB 4WV8A 5IVBA 5JOZA 1YCIA 2P5BA 1RUG1 3LEKA 3CIHA 3DXUA 3Q8FA 1IPSA 1AR93 2ZGKA 5FP3A 1EP0A 4JTOA 4NN0A 5FZOB 2OZJA 4W6WA 1H6YA 3WDXA 4QQPA 3VUOA 3SCFA 1UIKA 2VPVA 1FOD2 4BXFA 4BLIA 4K8RB 4AHXA 5A3MA 1IGOA 1OLRA 3NAPB 4JRAA 5D21A 1JZ7A 1Y43B 3HQRA 1KFUL 4RQPC 1EV13 2R1BA 2ZX0A 2A71A 3OUJA 1AL22 3LIGA 4NOTA 3QBQA 4COUA 1UZ0A 3WNXA 4QPIA 1CESA 2HYXA 2VBDA 3RZGA 2PHFA 1DGWA 1YI9A 2B4KA 4JGZC 1R083 3QLQA 3KF5A 4AVBA 1S55A 5DAVA 2CGNA 4MGYE 1DDLA 2D6PA 4PQQA 1SLTA 5FP7A 1W0NA 2VU9A 3IPVB 3NJXA 3WW4A 5FOJB 3OBTA 3WF4A 5JXJA 4ZZ8A 1F4AA 2LUWA 2IFRA 2X53S 5F5IA 4HETA 2V4VA 3AMHA 4CCKA 3FHAA 4ITCA 4JTNA 5HCHA 1F4HA 1L7RA 2K9ZA 4BK5A 4QHOA 4ONUA 4M3CB 4XXPA 1PMHX 3U11A 2WFF1 3O1MA 2RR11 3B7MA 1PGSA 3RYRA 1VBC1 4QDQA 5K9YA 4P9WA 4NRQA 2ARCA 1YQ2A 1FV3A 4YW5A 4QXBA 2HWC3 1UYPA 1DGRN 2BTVC 1WW6A 3VDBA 5A7WB 2QNKA 5FQ0A 1HJFA 4LIUA 1YQ6A 4FOYA 4IEWA 4Y4YA 1YQ5A 2WUHA 2RS13 1JYNA 1G6NA 3GBFA 1HXS3 5A3NA 2W1WA 1RXFA 4A6SA 3UESA 3VD3A 5IK5A 2DU0A 4M4RA 2W1QA 3M3EA 3S5QA 4URAA 1KFXL 2A3WA 5F37A 1R1ZA 1W6MB 5E8AA 2YG0A 2EAAA 3J7MA 4NHXA 5CFDB 3BB6A 1SZBA 1GWKA 3GNEA 5HCBA 1N1YA 2VNOA 3RQ0A 3LB9A 4CTEA 2ZZQA 5ANQA 4Y24A 3SH5A 2PHWA 3HT1A 3WT3A 4RGKA 2HEYF 1XE0A 2VQUA 4OZOA 3WV6A 4C0HA 2Y6KA 4UT5A 4UI9L 4MHUA 1H8VA 3SEPA 1PVC2 3WHUA 1PZ7A 1S2BA 3FFQA 5FYYA 2G9ZA 2C26A 3LDKA 1OF4A 4FPKA 5A33B 2Z79A 3H8RA 2WABA 4UWDA 4ZHNA 3ZFFB 3ZR6A 2DURA 1O8SA 1PO23 1ZZBA 2WLQA 4ZONA 3KCXA 1GR3A 4Y22A 3OY8A 1A3KA 1I3HA 2JG9A 1WMXA 5FPZA 1RUC2 1LESA 1YFWA 2I2SA 1KDMA 1BBT1 1U12A 3D0SA 4M4PA 2P1BA 4IGOA 3B9CA 5A1FA 2G4IA 3NV3A 4XZUG 2XMLA 1H2NA 3N4MA 1QH6A 3ORJA 4V1PA 5D8AC 4ZS2A 5FR3A 1RB8G 4UFMA 4NRMA 3AZYA 1Q8QA 1VIWB 4AG4A 1CD3G 4CXWA 4DB5A 2YGMA 1NE6A 3PJQA 1POV0 3ROUA 5KC5A 3MIDA 3PUHA 1XXNA 3HQXA 2P3IA 2XWJB 2Z4FA 4XFFA 1EV11 5FZIA 2W5FA 1LOCA 3OGRA 3V0BB 3CMGA 5JZGC 4AEDC 2BFUS 3QACA 4LPLA 2PMWB 1Y9MA 3H1MA 1JUIA 2ARAA 1MR5A 2IXIA 1WMFA 4Q4W3 3IZOA 1WCQA 5FYMA 1OD5A 1W8TA 2WNOA 3ACHA 2UURA 1O8PA 1H1MA 4UFHA 3TYJA 4Z1VA 5T5JA 2C24A 2DBNA 5CEHA 3B00A 4AVSA 2WYFA 1REFA 2ZKNA 2FDJA 1ULPA 5DMYA 3AMMA 2R042 5LBFA 4INDA 5CKQA 4XFHA 2GSYA 4IE6A 2D97A 3ZDVA 5HCAA 1DQ6A 3SCHA 3H42B 3WG1A 1LB2A 4XCAA 1AZDA 4D6RA 4E8CA 5J37A 1RUC3 1FMD3 2WO1A 5FWJA 1CIYA 4N43C 3CBNA 4DFSA 3ZSMA 3HBZA 2VZQA 5E16A 4DXSA 4TTGA 1SLAA 5D8AB 3NKGA 4JDMA 4C1WA 5B4NA 4XTMA 2JDKA 2A6XA 2FDIA 2XVKA 2QFEA 3JBG2 3OBZA 5H9RA 2Y6JA 3SH4A 4YGDA 4YLZA 1GZWA 3ZR5A 1W8UA 4DQAA 4DS0A 3U78A 1AX2A 4Y20B 1APNA 3O1OA 4RHV3 4HANA 5FY8A 4YFZA 3KSCA 1OQDA 1YUDA 2QUOA 3LF7A 4DXTA 5A6YA 4Y26A 2JG9B 2PAEA 1ND3A 2LTNA 4ES9A 4OHZA 3E5UA 5FXXA 3WP6A 1W9SA 4U36A 2AZ5A 4AI1A 3R6SA 4JGZB 4QXCA 2X8KA 3O0XA 5I93A 4AI8A 4R4XA 1O3TA 1I5ZA 1ZA4A 1W0OA 1FNZA 1Y3TA 1ZA7A 3UT0A 4BM8A 1IS3A 4DUWA 3U14A 5JIUA 4QKNA 4YW1A 1MS9A 5JIAA 2PHRA 1DGWX 1PZ9A 3VZJA 3CJXA 3VDCA 1UU6A 4KWKA 4OHVA 2A3XA 3GHMA 4MGZE 3ACIA 3ZN4A 1V6LA 2RMU2 4HSJA 3PL0A 3AVSA 1ODNA 3HNMA 5L36A 3RS6A 3LA2A 5JR2A 4A7KA 4B4QA 4AFDA 2QBXA 4D8MA 1RUF3 4HVQA 5J48A 3VL9A 1FMD1 3AMPA 1U5IA 2LS6A 4OMCA 1RMU2 4FPGA 4PBOA 1O4YA 5FMCA 1AR62 2NQYA 4BB3A 1D4M1 1W6QA 5FQ0B 4EWEA 4XABA 1SFYA 3VHNA 2VMDA 4LORA 1JUHA 1XSRA 4AQ6A 2RG4A 2YDEA 5BV6A 2ADEA 2W9XA 3AMNA 1WGPA 3IAPA 5CNAA 3T4VA 3VBSB 4EYUA 5JXHA 3ZXLA 4KNCA 3MV01 4O65A 4CPBA 1ND3B 1QJY2 5FZGA 1W8FA 3OGGA 4CUAA 1V6IA 1J83A 1XNDA 4AGRA 2XOMA 3DYOA 1CJPA 3AVRA 3DKQA 5FIXA 3SH3A 1C8M3 4CYDA 2VOXA 2WZEA 2D43A 2ZGMA 3IT8A 2VBPA 4CCDA 1GOHA 3DCQA 5IWFA 2QQPA 5FY4A 4Q4Y2 5HCFA 1RHI1 5KHIA 4J1WA 2J1TA 1ULGA 5A3LA 1XNBA 3VZMA 2ORXA 3TEWA 4LO6B 2YHJA 5BNNC 1PNGA 1MEC3 1VMFA 1ZNPA 3ZXGA 4AL9A 1NXD1 4F3JA 1ZBE3 1DG6A 5FZ1A 1QOOA 3CNAA 3U07A 2WO7A 1FV2A 1N3QA 4CU8A 3KWVA 2B5HA 3B9IA 4LHNA 3TNPB 1VBE2 2QKDA 2ADDA 5FZ6A 1RUF2 5FZ9A 5FZKA 1J58A 1Y4WA 2WNVB 5A7SA 1RINA 3E97A 1BKZA 4UF0A 4DEQA 2OXBA 3T09A 3OBRA 1TMF1 4JGYA 3FE5A 1W9TA 4BIFA 3ZFEC 4JKLA 1DBNA 2BGPA 3ILNA 3N35A 4META 4PDWC 4QD2A 5F3GA 3R4UA 5EIYB 3E1F1 3VBHA 3OYWA 2BUKA 4KBBA 1XSQA 4XIOA 2ZPXA 4Y1UA 1BEV3 2XQRA 3APBA 3CKHA 3FC0A 3OD0A 2QQJA 4YW7A 4AOCA 5C7GA 3I49A 2MEV2 1LGNA 1Q3EA 2J1VA 5T54A 2YBPA 4HKOA 1RUNA 3M70A 3WG3A 5K0UB 1LU1A 1DFQA 4MXWB 1CAXA 4H2AA 4AGGA 2BYVE 1YFYA 5CYYA 1VMJA 3SXWA 3TWIA 3PTRB 3AMQA 3GALA 4BE3A 2AEYA 2XB6C 3KCCA 4PLMA 1UX7A 2ZX2A 3JU9A 1H1AA 2R041 2R062 1V6OA 2IXCA 3E6DA 4Q29A 1NQJA 2VM9A 2WAAA 4Q1PA 4Y3OA 3MLLA 3I2OA 1H2MA 2KM2A 2W46A 1OQEA 1S0CA 2JG8B 4K3UA 4XF1A 1FPN2 2WRAA 1Y7BA 4YM1A 5B4XA 3RI8A 3S7IA 1GQGA 3ZN6A 1W8OA 5FP4A 5JSOA 5JDBA 2ZAHA 5T5PA 3GYDA 3VDDA 2DF7A 1NAEA 1AYN2 1PMJX 2JJ6A 4XIKA 3PMSA 4JVAA 1JOPA 3N7JA 2WQ4A 1QGLA 1V9U3 1EPZA 1KGYA 4IGPA 4QX3A 4Q0SA 3RZMA 2VZ3A 4Z8BA 3DPRA 4AI3A 3LKJA 1ASJ2 3MYXA 2ZHLA 1QNWA 4GWIA 4LA3A 4NPRA 3W5MA 3M3IA 4ZPIA 4GA9A 1IS4A 5L7OC 1EY2A 4E4SA 3I2DA 1ULFA 2X09A 2FZ2A 5F32A 1HRV1 3EO6A 2XPJA 2J22A 2VMHA 3DEMA 1MS3A 1ENSA 1UXXX 1M06G 5CG9A 1YEWA 3WW1A 1O3RA 1SACA 2ZAAA 1QJU3 1C5HA 3GCXA 3UGFA 3WNKA 4QGMA 5BNOB 4B4PA 1YQ8A 1KJRA 1OOPA 3ZO0B 4COVA 4Q4W1 4DO0A 2VW2A 4GULA 4KG8A 2GC0A 3B5LB 2R063 4GALA 3LPFA 4J25A 1HIXA 1NOVA 2QZ2A 2P3YA 1R1A3 4BDVB 4KWJA 3UGHA 4WM7C 1AL0G 1R64A 1ST8A 1CPMA 2BVVA 1HW5A 1IHMA 1MEC1 5CA6A 3MW3A 3KF3A 1PIV1 5CFCC 1F8VA 4QKFA 4TLFA 1DP0A 1NY71 1E5SA 4QB1A 1HB1A 2WQ8A 1UD1A 4XW3A 1S0IA 2VUAA 1I6XA 2VY0A 4V2WA 1D0GA 4JCKA 2FHRA 3WP3A 3CJIC 4XURA 4Q27A 1O5UA 3O5SA 4N8MA 5FZCA 3WCSA 3AZXA 1DLLA 3LQCA 4WM8B 4MHRA 4ARXA 1ENXA 4GIQA 1J1TA 3DYPA 4PI2A 4R9DA 5FZFA 1D0HA 5DAWA 4L9BA 3USUA 4CEWA 1X50A 3NJZA 1XNAA 1D7PM 3G7DA 3WINE 3RFRA 2E63A 4XC9A 5C3OA 3ECQA 1COV1 1C4RA 2V4AA 4BQ1A 5JXGA 3AL6A 1RUG2 3JQXA 3VD5A 2EICA 2QQKA 2JDYA 3NAPA 1K5JA 3ZSEA 2IXLA 2YU1A 4BLJA 1CX1A 1YIFA 1F2NA 3O7OA 2VOTA 1FI2A 5CKMA 3TBDA 1U5XA 3I8TA 1DU3D 4FXGB 4CDXB 3RZHA 4FP2A 3OEAA 2VE1A 4BYYA 1UMIA 2GDFA 2VZRA 4AVAA 1CX4A 1TNFA 2E6VA 5TSWA 4DIQA 4B7EA 2R1DA 4AZZA 5T55A 1W6QB 5GZFA 3HNYM 4OQ8A 5A3PA 4R52A 4NIDA 2VMFA 1RUE3 2YYOA 2HWB3 3TN93 2YXSA 4OI0A 2ZMNA 4A4AA 3TNQA 1UN1A 5FREA 4LTAA 4QX0A 5CFCB 1OSGA 1M4WA 3OPTA 2WSVA 1MS0A 3UK9A 5IVYA 2VH9A 5C5UA 2RR13 3ASIA 2VXRA 4D0QA 2ES3A 2ZEZA 4G9SB 4P14A 3VBOB 4C91A 4EJRA 2E31A 2XR4A 1W03A 1CZSA 1GBGA 2JE7A 4PIXA 2EVXA 4QWNA 2Y0IA 4KWUA 4AGVA 4K7JA 3A7QA 3HOBA 1XRUA 5FOBB 2DWRA 2DVDA 4CCOA 1U5ZA 2XJPA 2E51A 5A6ZA 2EIGA 1ZZ9A 1K42A 1GP5A 3NWKA 4UXAA 2VOVA 3UKNA 1G86A 2R6QA 5FZDA 1S0EA 1WD3A 3OGVA 5E1RA 2OPKA 1CAXB 5DZEA 4JHZA 4XFAA 5EYYA 1JS9A 4E27A 5BNOA 1ZZ6A 1BLZA 3GDBA 4RL7A 3VKMA 4FTSA 1HV0A 2BNNA 5LASA 1RC6A 2BVBA 1W6MA 2JECA 3WXPA 2PELA 4R9AA 5DPNA 5FUPA 3ILFA 4Y1YA 1PK6B 2XHNA 3RSJA 1REEA 5FYUA 4QPGB 3BGAA 1IS6A 5LCWL 1GP6A 1UOGA 2D6MA 2QQIA 2VCAA 3I3BA 1SEFA 4BQ5A 4WVZA 1MACA 2RDNA 3VLBB 4Q4X3 1MVQA 3ACGA 5FYSA 2MPFA 1UAIA 1ZRIA 2CGOA 3KV4A 1ND2A 4QKDA 3HAGA 4XUQA 1UY2A 4QGNA 5DABA 1VBA1 1W39A 1OOPB 3C8XA 4S2GA 1J3QA 2WT2A 3AXDA 1AL23 3CZUA 1ZZ7A 2GN7A 2XJVA 4UOJA 3N36A 4O61A 4BK4A 2HYKA 2WJSA 1XJAA 3UV9A 3KCYA 3L2HA 4RD7A 4XAAA 3CU7A 3FUQA 2PFWA 1OVPA 1A6CA 1OPOA 2B9UA 4I01A 4ASMB 3S5AA 1AXZA 1WKYA 1P8JA 3AFGA 4OUSA 1D2SA 1GMMA 1H30A 4GZ9A 4LKSA 3I2IA 4CDWB 4P9YA 2XDVA 2VAUA 5FPAA 2RDQA 4GMP3 1HB4A 2GH8A 3P6BA 1UCXA 2GAUA 1IQAA 3CF6E 3OCPA 1BEV2 3NNJA 4HKWA 2BWCA 3CLPA 5ACA3 1NKGA 4NJ4A 1J59A 3VBSC 2UYAA 3ILRA 5AC92 1OVSA 1DZRA 1W6OA 4AQ2A 1BK0A 4YVSB 4A44A 2IXHA 3KZ4C 1JBCA 4GQ7A 5ERLA 5C33A 3OEBA 3LDRA 3K51A 3V0AA 1AX1A 1DYKA 1VRH1 2BOIA 2ZA9A 3AKTA 1QHDA 1B35C 1KJLA 2P37A 4FFFA 1KITA 2OT7A 2WWUA 3VD7A 4XETA 4CPBD 3EBRA 3MUZ1 1MQTC 1EUTA 4IV3B 2D6LX 2CSGA 2JXAA 5JOYA 1JZ3A 1G9BA 5IYYA 3JUUA 3OB8A 1SCSA 4PF5A 5EWSA 4AWDA 1MS1A 4QAWA 4COZA 5K7PA 1JYTA 3L9JT 1WLDA 5FY7A 4KL1A 4YZ1A 1W2AX 1OF3A 1FPN3 1V70A 2X5IA 4LOSA 3ZXJA 4EN6B 2R071 2YB7A 4GKYA 5HI0A 4DMIA 1V6MA 5LWBA 1RUD3 2WNUC 5C8WA 3VN4A 1STMA 4ZZ5A 1JOJA 4I2OA 1JZ4A 1QDOA 2XKOA 5IAXA 4LEJA 4RGGA 3V56A 2WNUB 1Z0HA 3WDUA 1RJ7A 3NJVA 2V5YA 4MGIE 4XAEA 3OBAA 1JH5A 1TEIA 2HEVF 4H55A 3ZYBA 4ES8A 2DV9A 3P1IA 4LHSA 4WM8A 4DY3A 4JGYB 4EZHA 5AC93 1QIQA 4JGZA 4QM8A 5JI7A 4HFSA 4Q2FA 1E57A 4HN0A 1L3JA 2FCUA 4COYA 3BYWA 4B1MA 4LIVA 1YJLA 1Q56A 3K46A 5LY2A 1T6GC 1HQWA 3A23A 2Q30A 2HKXA 4DXRA 3BPSA 5CBLA 3CJIA 4GWJA 5A7NA 2VZOA 1VBB2 3FBMA 3FLPA 5SV8A 1UL9A 1YRZA 3MLJA 2YPJA 4E4HA 4YVSC 2NPIA 2VTFA 3NRUA 4CEYB 4LR4A 1ENRA 5A3TA 1EAH1 1OT5A 2QQMA 3GHNA 2ATFA 1AR71 1MZ6A 3T2TA 2KR2A 4RN5A 3GBWA 4CRQA 1VBB1 2BEOA 5IAVA 5GZCA 4FOVA 3A0NA 1OPMA 1VBA3 3J8F2 5DAPA 5FYCA 5BNNB 4XCBA 1WCKA 3VBRA 4FAHA 1SFNA 1WD4A 2WR9A 2ZGSA 1BBT3 2GZWA 4JDOA 4Z07A 1C1LA 5SV5A 4C0BA 4CP9B 4ZKTB 3LPGA 5GLTA 4B7KA 4SLIA 5DUXA 3RGBA 1OA2A 3MI8A 2Q8EA 2AYHA 5I0TA 1DYPA 4MV2A 4YSFA 1OOPC 3WLUA 3OUHA 4YG0A 4X6QB 1W3XA 4K9SA 5IVFA 3NNFA 5M0TA 4KBZA 5H9PA 2J1EA 1JYIA 4YGCA 3MUY1 1UX6A 1OHFA 4QQLA 3T30A 3FX3A 3AP4A 1W6PA 5DAXA 4A41A 4PLOA 5AFEA 2VQTA 2RJKA 3N9MA 1CIWA 5L19A 4MUVA 5FWEA 3UKTA 3I2HA 2VZPA 4HVOA 4K1YA 3BVCA 2YY1A 2X29A 2Y64A 4JDNA 3BTXA 3WG4A 1VP6A 2ZTNA 4LOTA 1NZIA 5LB6A 2VZTA 1QQP1 5I8SA 4BWOA 3ZFGA 4HBNA 3BTZA 1BVP1 1GWMA 1HRI1 4Q4V3 5EHDA 5J98B 2XL9A 3PUSA 3VBOA 2A5ZA 2A7AA 1W2OA 2H0BA 3DXTA 4KI5M 4XMAA 3D5OA 3RWNA 5GJ6A 3WSOA 5F7UA 4ZU4A 2E7QA 4QM9A 4RS5C 5H9SA 2DVBA 5DDJ3 5C70A 2PLV1 4YWAA 1ALYA 4FPJA 1ZREA 3VBRB 1LULA 3SITA 4CCLA 1JZ6A 1BBT2 1L7LA 5KXCA 3KT7A 1JOBA 1QOSA 1NCRB 2AENA 3GJAA 1CQ9A 2CV6A 2ERFA 3BOWA 2HWB2 3TN92 3I54A 1JYXA 4IEQA 2ZEXA 4LBQB 4QB2A 4U2AA 4M00A 4PI0A 2QJVA 1QJFA 2HWE3 4BCUA 4P9GA 2Q1FA 1H6XA 1CAUA 4O7XA 2WNEA 5CIRA 3RRDA 4IEOA 3E5XA 3V65A 5FZEA 4QPIC 1ZBA3 4A3ZA 2Q4SA 4LUMA 4RYDA 3C7OA 4OCTA 2E33A 1IOAA 5C8CC 5JI9A 4B4RA 5C4WB 1RUC1 3SEEA 1L7QA 1OUXA 1GYKA 1WW4A 2BOJA 3BU7A 1KEXA 3EXUA 4FQZA 4HKLA 4OI1A 3VHRA 1UU5A 4DY5A 5A6QA 4WVMA 1DQ0A 4Y1VA 3MIHA 2NN8A 3MFCA 3VDDC 2Y8KA 1W06A 2D3SA 4Q4V2 2OX0A 2VVEA 1R093 1D4VB 2WS92 2LALA 2J42A 2DCKA 1NLSA 3THTA 2A3YA 3DPRC 4B29A 1LJ7A 1CR7A 1US3A 2PHTA 1Z7S2 2BZDA 2Q1ZB 2R49A 4FPHA 5T5LA 3TB0A 4O9EA 1XOYA 1IZ3A 1HXS1 2V73A 3DN7A 3T2PA 3BODA 3JD71 2WS91 5FZ4A 1C8M1 2R061 4Q8LA 1ENQA 3T1MA 5F6KA 2JWPA 5T3NA 4COWA 5F9TA 4CDQC 3ENRA 3B3QE 4BMEA 3KV5A 5JR7B 3KGZA 3RI9A 5FCCA 3WF2A 1SHWB 4NR1A 2WAOA 5CAZA 4CCMA 2ILMA 2VG9A 4FQ4A 4IE0A 4XHBA 5C9AB 5A3OA 3K4ZA 4XF9A 1W8NA 2O8QA 1C8M2 1BVVA 4IGQA 1RUH2 4OHWA 5IK7A 3OJBA 2GNTA 3ZX7A 4OHYA 3KGLA 1G9DA 3BOPA 3ZPYA 1NCQA 5FZ0A 1Y9GA 1F5JA 3CJIB 1GWLA 1B35A 2B39A 3N9QA 5LA9A 3BKZA 4NROA 4CEWC 3THDA 3AZWA 4OI4A 1AF9A 1NCRA 4A3XA 4YFWA 5FAXA 3WF0A 2YC2A 1ZBE2 4C8DA 2N7GA 1PHMA 4G4FA 4AF9A 3OG2A 1WA4A 1SLBA 1W9YA 2FD8A 2JE8A 3TAYA 3RMXA 3DKWA 1BZWA 1RUOA 4DUVA 1F9KA 5FYVA 1H4GA 5ACA2 5FO7B 3ITQA 5K0UC 4EZ4A 1EAH2 1RVF2 1Z7S3 2QE3A 3C2UA 3CHXA 1R1A1 4IESA 2YZ4A 4XMIA 2YC4A 2VUDA 1NXMA 2V72A 3LZZA 1DHKB 3AJZA 3LOIA 3POEA 1QJX2 2WL1A 1JYWA 4FTEA 4GJYA 1BJQA 1GZCA 3GXUA 3O12A 3ZMNA 5FO9B 3ZXFA 3IB3A 5LW9A 4PDWA 2DVGA 3LA7A 4IE4A 2WYSA 1H2KA 3D6EA 3VD4A 2GH2A 1UWWA 1TG7A 4KU8A 3VD9A 1PO13 3O1TA 1KQRA 2TNFA 4A7ZA 1W6PB 4AEKA 1DLCA 1PX3A 5BNNA 5LBEA 1IKPA 1D2QA 5G04L 1RUH3 2PAKA 1JHJA 5GKAC 5C71A 1D4M2 3C7GA 1LHVA 1LAJA 3M2MA 3O1SA 2NYYA 1LRHA 1GU3A 3KS7A 3IDAA 5GZDA 4AQSA 2IFWA 5JVVA 3OPZA 3U37A 2P6HA 3ELNA 2IZWA 3VZOA 1PMIA 3RZZA 1OKOA 2F4PA 3IDEA 4CEWB 1MS4A 4Q0UA 5JSRA 3E6BA 4AYUA 2FQPA 5FYTA 2C6SA 3UNPA 4QDRA 1GOGA 2TEPA 2WO2A 4EN9B 4DXZA 2BNMA 1JU4A 3HN3A 4K6BA 1DZQA 2RS53 4L0PA 1AYN3 1UYXA 4PT6A 1RVF3 1EUUA 1ND2B 2B9VA 3I2JA 2D44A 4J1XA 4WM7A 4PJYA 4X8NA 3U75A 5DUUA 1R081 1QJX3 1ASJ3 4XF3A 5EYXA 3HBKA 4CDXC 2VMGA 3IWZA 2PAMA 2X5IC 5FZ3A 2EXHA 2Q5TA 1XBFA 4RR3A 4XBQA 4YARA 2XG3A 1PVC1 1WMDA 1JZ8A 4NRPA 4UW6A 4XDPA 2BERA 1VBE1 3I4IA 2HWC2 2UY8A 1S2KA 2VD7A 2YBSA 4FT8A 4FPCA 3WCRA 4XUOA 1GKBA 1ZM1A 2R0FA 4CSWA 3V0AB 3HT2A 2YROA 3N9NA 3WF1A 1CZVA 2A75A 4K1ZA 2MHFA 5ABJA 2DU1A 2CWMA 4E2GA 2RS12 1IKQA 4PIYA 4EWAA 2AH2A 1HN1A 2B42B 2Q8OA 5IFPA 1GQHA 4XF4A 4J6GA 5J36A 5FY1A 2C0ZA 4Q4X1 4CUGA 3UL2A 1W8WA 1HRV3 2B45X 2ZGTA 1CGPA 2LROA 5FTTC 2BPA2 1PX4A 4IL7A 1OLME 4WZCA 3SMHA 1VBD1 2BBVA 4ZU7A 4YZ5A 2IXJA 3D0JA 5EJ3A 2YFUA 4W6YA 4AVCA 3MIEA 4B1LA 3LEGA 1V9U1 2RS52 1F5FA 3IIAA 4HONA 4URTA 5F39A 1VE0A 5I8YA 4KGGA 1H1IA 1NA1C 1S4CA 2OPWA 1NLRA 2OIIA 4XBLA 3MEPA 1LEMA 5IW0A 2OQ7A 3S0MA 1QQP3 2VC9A 3NW4A 3SKVA 3VBUC 4BH9A 4P08A 4H3WA 1HN0A 3C3VA 1Z7S1 2VR4A 1V6NA 4L8QA 1O6UA 4QPGA 3T0AA 4JZRA 1S0FA 2RS51 2ZGUA 3JD72 2WQZC 5L9VA 3RNSA 4PCRA 1C57A 1VLNA 4XUNA 1LOBA 5F1RA 2K0GA 2ZX3A 4IEZA 2P4EA 5FPLA 2VZUA 1SBFA 4BHPA 4I0BA 2VTXA 3DPRB 4AFAA 1URXA 4AFMA 4Q8KA 2ZGPA 2BQPA 3DL3A 5EXOA 2E9QA 4NE9A 5GLZA 2KXLA 5JMCA 2RS32 3W59A 4ISRA 4RFT0 1VRH3 2CNAA 1MZEA 2F4LA 2VQAA 4FFGA 3K75B 3WUCA 2QDRA 1RUG3 2KD7A 3ZYFA 1MZ5A 2ZABA 1HRV2 2DUOA 3GZAA 3AC0A 2Q8CA 3JBG1 2UWBA 5GLUA 3SC7X 2K46A 2K2SA 3X29B 2ZACA 1GICA 4L11A 2YGLA 1W2TA 2SLIA 1VAVA 4P9XA 4QPIB 5FLHA 5JLVA 1OBNA 1OH3A 2FMYA 2Y6GA 3EYPA 5FKBA 3H8XA 2VJXA 1ZBA2 2JDHA 1BQPA 3KVAA 5KHJA 4KG0A 1GP4A 3KD4A 2OVUA 3I3QA 2FDKA 1SPPA 2CHHA 3Q8BA 4CDWA 2P3KA 4OHXA 2R7EB 1C28A 2HJIA 2J7MA 4N53B 2RHPA 2OYZA 5BNPB 2CY6A 3CL1A 1FMD2 1Y9QA 2HH9A 3QD6A 2RR12 1AR91 1BMV1 5ISLA 2WC2A 2ZS6B 1T6BX 2PQQA 2CU5A 4UFLA 1CAVB 4OMDA 5GLWA 4NIGA 4FFIA 3SNMA 1LHWA 2WS93 5FY5A 1AR81 1HLCA 1OFNA 2IWGB 3MHZA 4N7IA 5FK8A 3VZLA 5BYNA 5I91A 2RS33 2VOKA 3ETPA 3FWEA 2WA4A 3TOJA 3PMEA 2WNVA 1UPIA 3AFKA 1MS8A 4IE7A 5C3RA 1UU4A 4P00B 4AXOA 3T4HB 1N3OA 1SDWA 4HL0A 1GFF2 1FNYA 3N9OA 3EQEA 1VPHA 4LLFA 3G6JB 4Q5OA 3I97A 1LOGA 2JD4A 1GNYA 4QPYA 4ZU5A 5HXVA 2AEZA 3ZOIA 3U4XA 4YZ4A 2VW0A 1PIV2 1K3IA 2JDAA 2HWD2 4YG3A 4LLOA 2HBUA 4IEXA 3N7MA 1NY72 4JKKA 5A1LA 1H4HA 3GM8A 1OXCA 1RUI3 1YC61 4LBMA 2A70A 1AYM3 1SLIA 4GB33 5E6HA 3GGLA 1DZTA 3JZVA 3KQRA 5A7OA 2HWD1 1QH7A 2XJUA 1TME3 3V0BA 5LBBA 2JIJA 1F15A 3F2ZA 3H3ZA 4N53A 5FMBA 2ZBJA 2PQSA 2HWF2 4AFCA 3HMYA 2WBKA 5T5OA 4JX0A 5ABJB 5BXXA 3MGUA 2RMU3 1ODMA 3ALQA 3KT1A 5CU1A 2UWAA 4XUPA 4B3NA 4YM3A 3H7YA 2W1SA 4IV1C 5I8TA 2I74A 1LHOA 4PIZA 4NAMA 4RR3B 4Y1ZA 5BNOC 4Z2AA 1QY4A 2W47A 3OPWA 2PHXA 1T2XA 1YI7A 5F5CA 1RMU3 1EAH3 3K3OA 4BJ0A 3SISA 3MDPA 1EYBA 3IKWA 1PO11 5F2WA 3WNLA 5DAQA 1H0BA 4RS5B 1BCXA 4L99A 3S57A 2BV4A 2XJRA 2JKXA 5KBFA 4E2SA 1Q43A 4MGTA 1HRI3 5I0DA 3PVOA 1AR72 1QJY3 2XGXA 1PO12 2D5FA 2J1UA 2Y38A 5D2AA 4AVTA 4D6SA 3NSTA 2W3JA 2OA2A 2RV9A 5KHGA 1QKQA 1V0AA 1WLCA 5IVVA 4GMP0 2BFUL 4YPJA 2BP6A 1AX0A 1WBFA 2VCCA 3ACLA 3IM0A 1D4M3 3D3AA 2PLV3 5LK5A 3J7HA 1E5IA 4FXKB 4EROA 2DFBA 1XPWA 4Q4Y3 1YFUA 1MZFA 4LUKA 4LO5B 1JYVA 2UY9A 1XB9A 3LCPA 3SKJE 3I59B 2HWF3 3HN1A 4IETA 4NPLA 2ZZJA 2RM22 4AW7A 1VBC2 2GALA 2QTWB 1KDKA 4JRLA 5L7OA 2E7AA 2QZ3A 5LZ6A 4QXKA 5F5QA 4AFBA 2Y26A 3VBHB 4QXHA 4ATEA 3THCA 3WVJA 1SLLA 4CVUA 1N3PA 4GWNA 4EE2A 2RM21 3RZKA 2FMDA 4YW2A 2YU2A 2B46X 4UW3A 3O1VA 4QQOA 4E2QA 2O14A 1UKRA 5F3EA 4DEVA 2VVDA 3MIGA 2QQUA 2J1RA 3BALA 4W4ZA 3Q8AA 5IJRA 3AXEA 3HQUA 2BW8A 3JCIA 5FYHA 5CZKA 3NL1A 3FBYA 4PHZA 3B94A 4LJHA 3M3CA 1HB2A 1UQXA 2NZ9A 3ZXKA 1ND3C 3RDIA 3O1PA 2DDUA 4Z2WA 2JKBA 1UOBA 1IG0A 3RYKA 1POV3 4XILA 2QVSB 3KV6A 3WD5A 3ZIWA 3OSDA 3WR0A 2MEV3 2WZR1 2OKXA 2XLGA 2P34A 3FLTA 4HG6B 3T1LA 2DTYA 4XQ4A 4CDUC 4MOAA 5FRAA 3POJA 3K48A 5FZAA 2FDGA 3ST7A 1PM7A 1X36A 1ONAA 2PLV2 4Q0VA 1NT0A 5KHKA 4SBVA 5CKNA 1GUIA 1RGSA 3HNBM 3IDCB 1H9WA 3W20A 2VCBA 2EXJA 4BQ2A 4LO7A 4IDZA 1O91A 1PGW1 3OGSA 4LNVA 1VBB3 4JHTA 2HWB1 1LTEA 2F17A 2MNGA 4JQRA 3TN91 5AVAA 2O8OA 1DQ2A 4YVSA 1IQDC 4D7SA 1DCSA 5AC91 1YIPA 2W95A 1N1SA 1RIRA 2XVLA 5LATA 2IC1A 4BIOA 4BXSV 2WZ8A 5L7OB 4NIHA 1SPPB 4QQ2A 4CP0A 4I0AA 1ZRDA 1RUJ2 1WZXA 1YFXA 4AE2A 1UKGA 1S0BA 3H1WA 4E9KA 3RYPA 3EMRA 3I3MA 5LBCA 4NO4A 1QXJA 3KT4A 5FBZA 1AR82 4IE5A 1XNKA 5IVEA 1BK1A 1CAVA 3UGGA 1JU3A 2G9GA 1E5HA 3FMGA 3MFAA 4OVEA 4WVVA 5FKCA 5ABJC 5F3CA 1EV12 1QJU1 3JXSA 3RZLA 2ZHNA 5AVPA 4I09A 4YM0A 4XDQA 4E8DA 3JD73 1UMHA 1S0DA 1H8TC 5FJHA 1S2EA 4RFRB 1DYOA 2BU9A 4JV4A 4UFIA 1OQ1A 3MF9A 1HKDA 4OQ9A 3PURA 4HXCA 4KWLA 1FATA 2WFF3 1QJU2 2WWJA 2X05A 5EV7A 1CAWB 1BHGA 2D7FA 2XQXA 4P9LA 2X10A 5LK7B 4FPEA 4LHLA 1B35B 2ET7A 4Q1RA 3VV1A 5EZWA 1HQLA 4YRDA 2XXZA 2GNDA 3DGTA 2GC2A 4ZXEA 4TLGA 1LNSA 4OFGA 1G9FA 2WKKA 3AL5A 1NA1A 2BBAA 2PN5A 3K77A 3N7LA 4XJAA 4QX2A 2B7YA 1QXPA 4B8EA 2D6KA 2XJQA 5H9QA 1RUH1 1UXZA 1COV2 5EJZB 4YW6A 2XBO1 3ZYGA 3MW2A 1RUJ3 3AP7A 3PDQA 2ZGNA 1C3HA 4Z82A 3PVBB 3WDVA 4LBQD 2ORZA 4HOOA 1LCLA 5BUVA 5JOXA 3JB8A 1JODA 1DF0A 1LKNA 2ZHMA 3NNGA 5LRRA 3UJQA 2VNRA 3K4DA 3AKRA 4GD4A 4XHXA 2EXIA 4CU9A 1CPNA 1QWRA 4JKMA 4D7TA 1HQNA 1OH4A 4UBHA 5FP8A 4RA0A 2RJLA 3VBHC 3LFMA 4CXYA 3WUDA 2VGDA 2VOWA 3U4SA 4N9IA 2VVFA 3KHBA 3SHRA 3V64A 3PJYA 2Q0AA 1FXZA 2ZMKA 3I7DA 1OI6A 4GMP1 4IEYA 3VBFA 5EP9A 1OUSA 1RVF1 4BQ4A 3LIHA 1W6OB 4NVPA 3KM5A 3BI3A 5JOWA 3KLSA 4FP3A 1NYWA 1JXNA 2MEV1 2VXJA 2WZR3 4BQ3A 4MG2A 3BCWA 4DUXA 2UU8A 4NHYA 1IG3A 1LGBA 2P6CA 1W90A 2A1XA 3AB0A 3J7NA 5A32B 4AEDA 1YLLA 2GNBA 4CEYC 2NP0A 1PK6C 5A3WA 4FPOB 1ACCA 1PVC3 2XONA 5C4WA 1G9AA 2NMNA 4IV3A 4IEVA 1V6KA 2P3JA 3USSA 5FUNA 2VECA 4BA6A 4XXAA 1RUI1 3FL7A 2RVAA 2XLAA 1PO22 2E26A 1PIV3 1AJKA 3ZM8A 2D6OX 5FPVA 1CAUB 3INAA 3M3OA 4CDXA 4LK6A 3DECA 4PQ9A 2VNVA 4GH4A 5BNPA 1K5MB 4E4ZA 3RMYA 5HPOA 3IDBB 1I5PA 1FT9A 1RUI2 1U5YA 2JDNA 1AYM2 1YNAA 4GB32 5LY1A 2Y60A 1WW5A 2W08A 3ZVXA 1AR61 1PO21 4NUBA 4OUEA 3GZEA 1W04A 3N3HA 1W9WA 3OUIA 4CA9A 1UY0A 3ZN6B 1B09A 3VBOC 1NA1B 1R091 5CB7A 2BJSA 3R4DB 1S0JA 4FO9A 3QH6A 3WQBA 1G8WA 1ASJ1 4CUCA 2G1MA 3TEYA 1YWKA 4XOGA 3OOXA 5FYIA 1LECA 3WY6A 2PHDA 1OURA 2Y0OA 1MS5A 5FZ7A 2HEWF 2WZR2 4XPVA 2A6YA 4NPMA 5FZMA 1QJZA 3OF1A 1NX9A 5CG8A 2SBAA 4P5YA 1KS4A 5BY5A 2OS2A 3POFA 3N7KA 4AI9A 1LHNA 3WW3A 1JZ2A 3A0KA 2VNGA 4IUGA 2EIEA 2AACA 2R043 3LD8A 2DVFA 5FMOL 1ULEA 3POIA 4CEYA 1RUD1 3ZLIA 5F8PA 2QQNA 3H7JA 1CWPA 4IEPA 4AK3A 1BYHA 4MZUA 2RS11 1XYNA 1W9FA 4CDUB 2DUQA 5FMDA 3WNOA 2XH6A 4I30A 1GNHA 3AKPA 5FFOC 3FJSA 4QX7A 4DOUA 2Z42A 1BEV1 3POSA 4AAXA 3VKOA 4WVWA 1TMF2 5FPUA 4UW4A 3PIGA 2FDFA 4YM2A 5FPXA 1V00A 4CCJA 1LGCA 2V09A 1JI6A 4HVRA 1VRBA 4UAPA 4L92A 5DUVA 5FBJA 1XE7A 2NLRA 3TEZA 3VL8A 5C5TA 2IVIB 1MQTA 4EV0A 2PHLA 3WW2A 2C9KA 2UYBA 5BPXA 5FY9A 1ZZCA 3I2FA 4UW5A 4CDQA 1QXRA 5C6CA 1LEDA 4JAAA 2XJSA 4MYEA 4I0WB 4JQTA 4TN7A 2DCTA 2J1AA 3N9LA 5C9AA 3T08A 3OD4A 3NAPC 3BIWE 4CP2A 2P17A 4LE4A 1A8MA 3ZPOA 2A73B 3UYJA 3VHPA 1US2A 2DCYA 3NV1A 4M3CE 4QGLA 3MPBA 5JZGB 3ZFFA 2I45A 4DZGA 2ARBA 1AL21 2DYCA 4HK9A 4W8JA 1Z78A 3M7AA 2GMPA 4CDUA 5A3UA 1N1TA 1UF2C 4DRRA 1JZ5A 3H8UA 4RGAA 2E53A 3OTFA 1S1AA 4FPYA 4CCCA 1ZBE1 2O1QA 2XL7A 3J4UH 3PHMA 2GP3A 1XC6A 2DCZA 3O14A 3MW4A 2ZGQA 1E5RA 4AHZA 3VZNA 4PF1A 3MBWA 4AR2A 4CCEA 2OZ6A 1OC1A 5A33A 2D6NA 3GZUC 3VKFC 1XU1A 2LW8A 1I9RA 2DFCA 3AYCA 2JDPA 3NQHA 5DQ0A 1Q8VA 1BXHA 4RS5A 5CVRA 4AHYA 1QU0A 3MPPG 4XJWA 4NIAA 4XACA 5J3UA 1OFSA 3I3EA 4CZSA 4N43A 2FCVA 3NNLA 5DXDA 1U0AA 5IUQA 4FFHA 4Z92B 1SBEA 2Q8DA 4CU6A 2C9AA 2D3RA 2D3PA 3PIJA 1VB2A 2CL2A 4XZPA 3WNNA 3PUQA 4LKDA 1QEXA 2RJ2A 1YO8A 1W6NA 2AC1A 1F35A 2GMMA 4Q0QA 4W6XA 3DV8A 4WVMB 3OGJA 1TZOA 4M0NA 4XEZA 1UY1A 2CDPA 5ACA1 5DDJ1 2C5DA 1K5MA 3THPA 1ZRFA 3HR9A 3ACFA 2GNMA 1Q8PA 3WG2A 3IBMA 3KB5A 1HDKA 3KV9A 4NHKA 2AGSA 1MEC2 2WFF2 2DVAA 4A2UA 2Y6HA 2JB8A 4LO4B 3PU3A 5FXZA 4CDQB 1KD7A 1QQP2 4XTPA 3ZXAC 4TZDA 4CE8A 2HWE1 3H3LA 4K20A 4NIIA 3T0DA 4LE3A 3NV4A 2GP5A 1YXWA 2Y6FA 3N9PA 4UF0B 1AYM1 4GB31 5A6XA 1RUE1 3A21A 2WSUA 4AEMA 4V2VA 5FY0A 1XNTA 3GJBA 4BISA 3HWJA 2O0OA 4IERA 2YBKA 4FAGA 4BMBA 1SFPA 4LBKA 5JPMB 4YVWA 3AP6A 4N90A 5A7PA 4NHLA 2Y6LA 4XYXA 4YNIA 3ZFGC 3ZFEB 2WN2A 1VBA2 3ES1A 5JCTA 1PK6A 1RHI2 3I3DA 4N9HA 5DG2A 5C4WC 1W0PA 3EB7A 4UYBA 2TBVA 1RYYA 4GJZA 4K8FA 2R16A 2WNVC 2VUCA 2QQLA 4N53C 5FV3A 3VBUA 3WOGA 4EQVA 3AK0A 3B69A 3GCWA 4OI2A 2YC0A 3BTAA 4MO3M 3LE0A 4RHV1 4F7ZA 1S0GA 4LITA 3A4UA 3BTYA 1MPXA 1YHFA 2OUJA 1NCQC 3I2GA 3IMNA 2GN3A 4Q26A 5DUWA 5GM0A 3FLRA 4DNYA 1NG0A 4GH4C 5A1AA 1R082 3R0RA 3J7LA 2IXKA 3DUIA 5F2SA 4LBNA 4XDOA 4ZS3A 4QMAA 4S2HA 4YG6A 2QCSB 2ET1A 3H50A 3RG0A 1VAMA 4MADA 5DN2A 2PHUA 1VALA 1PGL1 4Q4V1 4AEJA 1V6JA 1WW7A 4KMQA 3ZYIB 2EIBA 2W2IA 2JG9C 3CDZB 1AUYA 4EN0A 3PNAA 1GZWB 1TQ5A 1AHSA 2WT0A 4FI9A 1V9U2 2YUEA 4MGSA 2VMIA 3MZHA 1CAWA 1O59A 4AHWA 3K3NA 1CJDA 2JIGA 3MO4A 4XBNA 4R9CA 3B93A 1DQ5A 4M3CF 1WWYA 5FK7A 2Z5WA 1UZVA 5I0SA 3M8LA 5A80A 3C7HA 4YVWB 4X6RB 3RJRA 1LR5A 3D4KA 4IV1A 1PM4A 1RHI3 3U0ZA 2JX9A 1VBD2 1CZTA 4NWWA 1NQDA 3LWCA 2P2KA 3VBFC 1X9TA 4KU7A 1WBLA 5EFUA 4CDWC 3MV11 2GMEA 4WZFA 3VBUB 2RE9A 1MVEA 3AP9A 3P3NA 3QH7A 3ZYRA 4ARYA 3AKSA 1TVGA 3L2YA 5E88A 5BNQA 2W39A 1W2UA 3POGA 3WEZA 4LBQA 3WQ0A 1K12A 5F3IA 2VUJA 4C90A 5FUIA 2BRTA 1SLCA 3HIFA 4TXWA 4D69A 5LA1A 1AYN1 5KXDA 3GBGA 3B02A 4D94A 4QDSA 3VGIA 2BDRA 5IATA 2WO3A 1TME2 3IIIA 4HSLA 3HEIA 3SQOA 2WDBA 3WX5A 3RJ2X 5DZGA 2AREA 1UNBA 3MIBA 2JDUA 1AXYA 1LENA 2ETEA 3AJYA 3NO8A 3VB9A 4H14A 4P9JA 4LHKA 1XYPA 4UFKA 2FCTA 2Q1MA 1Q8OA 2DUPA 1ULCA 3EHKA 3WP5A 1X7NA 4ATFA 2YFZA 1GZTA 5JZGA 1MQTB 1NCRC 1XQNA 2J1SA 5FZHA 4MGKE 4LKFA 4P02B 2QDNA 1OLMA 4FCAA 4XJZA 1QMJA 2VQ0A 2D40A 2ZCWA 3SLIA 3ZSJA 1JMUB 2I07B 1AJOA 1X8MA 1XE8A 5L9RA 1DGRA 3MIFA 2BWAA 3KVBA 4P9IA 3NJYA 4R9BA 2RMU1 3M1HA 4XVHA 5K0UA 2Z69A 2WIIB 3LA3A 3PU8A 4W50A 5KWRA 4LULA 2WINB 3H1YA 1TMF3 3PVNA 3ZFFC 1GOFA 1ULOA 3W21A 1IPJA 1Q5OA 5FYBA 2XBO3 3RWKX 3LEMA 1RMU1 2ENRA 3AX4A 3I2KA 2CTVA 2TUNA 1HJGA 3AZVA 2B8MA 3S7EA 2D98A 4DINB 1DGLA 4CP9A 3H0OA 2D93A 3P3PA 4IV1B 5K8SA 5C8CB 4Q4W2 5FYZA 4ET7A 2DBIA 2H6BA 4OYUA 4OZXA 5FZBA 4FPFA 4XJ8A 4MXWA 1C5IA 1VBC3 2VMEA 3BN6A 5FPBA 4Y4RA 2W52A 4P5HA 4HK8A 2JE9A 4GH4B 4LBOA 4D7YA 2XKPA 2R32A 4TSVA 4DPNA 5I0UA 1SDDB 3F95A 3O0WA 4QHBA 4MLOA 5FJKA 3KHCA 4OULA 1VMHA 3MICA 3WZ1A 1SQ4A 3T2OA 1RUE2 5L9BA 2ZHKA 3OYWB 1IS5A 4GWMA 1KXGA 1IPKA 1UYZA 4NMIA 1ZVFA 5IVCA 5JAXA 4RQPB 3PTYA 4QPGC 5D8AA 4L2NA 1FAYA 1LOFA 5CFDA 1LOEA 2A6WA 1G9CA 4UFJA 5FMOS 1O4TA 1OD3A 4MGQA 4CU7A 4AI2A 5A70A 1J3RA 3JBG3 2QQVA 3Q8CA 4IW3A 4XFBA 5C3SA 4LXLA 4FOWA 1X82A 4LBJA 1SBDA 5JSPA 1HV1A 3O0VA 1J3PA 3ZSLA 1VR3A 1X8EA 2XBO2 2XUMA 1H2LA 3AP5A 3DF0A 1QNYA 4RHV2 3CZJA 3AZZA 4QX1A 4AAPA 1WLTA 2JG8A 3WNMA 5FLIA 5A7QA 2XVGA 4H7MA 1GV9A 1LOAA 4EN7B 2HWF1 3AYEA 3WNPA 2L9LA 3ZXEA 2VMCA 1SG3A 2ZXQA 4WM8C 3VKLA 1CONA 2GC3A 3FZ3A 5KXBA 4Y1XA 1WCDJ 1PGL2 1WLWA 1YYNA 3M4FA 1XNCA 1TNRA 2JEMA 4IXLA 1JN2P 4LMFA 4ISQA 1BMV2 2FZ1A 2W1UA 5IFTA 5LA2A 2BNOA 4XQDA 3T3YA 1RJ8A 4Q4X2 1JYCA 4XJ9A 3WQ7A 5T52A 4TYSA 2Y34A 4QX5A 2XWBB 2VBBA 3D82A 1QF3A 1UOJA 4PLNA 4CUBA 1AR83 5IVJA 1ZRRA 2JDZA 2RDSA 4HPKA 5D1IA 4EN8B 5IT6A 2XLFA 3J8F1 1X9PA 2BGOA 1SMVA 5EPAA 3ZIXA 1OLQA 4LBLA 5JMOA 1A8DA 1ZZ8A 3POYA 4Y5Z0 4X8PA 1CVNA 4MX3A 1FPN1 1FX5A 4M01A 1O4ZA 2EXKA 3ZKUA 3ZDSA 3ZKYA 4BPZA 4CCNA 2R073 2DCJA 1ZYBA 5JUVA 2G19A 3ZYPA 1GSLA 3LSDA 5JPNB 5KXEA 3VBRC 1HX6A 2OW4A 5LEKA 5HBAA 1WMEA 1OA4A 3VDAA 5C3QA 3PUIA 2IUWA 4RQPA 3ZFGB 4L97A 4JC1A 3DYMA 4LKEA 4R8HA 3ZXDA 1ULDA 5EJ1B 4QQHA 5FZLA 3C7EA 5IK4A 3ON7A 2HBTA 4XF0A 2WFPA 4QKBA 2ZGLA 2LRPA 2XHKA 1TME1 2ZGRA 4XFGA 4JGYC 3B01A 2D5HA 2RS31 2F6BA 2NMOA 4I02A 2YV8A 4QPWA 4W65A 4XFCA 4A45A 4YZ2A 1COV3 1W05A 3EJKA 3JB4C 1GLHA 3D8CA 3SCGA 2VZ1A 4ASKA 1H9PA 3NV2A 1NZCA 3CEWA 3K4AA 5FLJA 1VB4A 5APAA 4ORFA 3WDTA 1NLQA 5J09A 3PUAA 3ETQA 2CGPA 2EAKA 3Q9OA 4UBGA 1UMZA 3ZN5A 2WWSA 4I3PA 1GQPA 1FOD3 1NCQB 3J26N 3HD8B 4Y20A 1GNZA 1KS5A 1PZ8A 4YYOA 1DQ4A 3LOBA 1UZZA 3OY8B 4F8AA 4KQ7A 1OA3A 1VBE3 2CAUA 3URFA 1RUD2 1SCRA 1ZBA1 4K40A 3W9AA 3H8OA 2VO5A 1UZWA 4TWTA 3LSEA 4F83A 1G7YA 3P5BA 1FYUA 1A78A 1UO9A 3TEXA 3CO2A 3WP4A 4FTBA 3UKVA 2W94A 2ZX4A 4EWDA 1LHUA 3ATGA 1UY3A 2ZGOA 1VAKA 2XJTA 2CDOA 1POQA 3E5QA 3VBFB 1VRH2 4AQTA 2PTMA 1F31A 1J1LA 4BQWA 1W3VA 2V5DA 3CQOA 2JB4A 1JHNA 2E32A 2H0VA 1VBD3 1TE1B 2VTXJ 3T2QA 3WDYA 4AEDB 1DQ1A 2CYFA 2VZVA 4I3GA 5A32A 5F6LB 2W68A 3ZYJB 3W5NA 3IN9A 4S2FA 5C8CA 2Y33A 1RL3A 4XJUA 3ES4A 1OKQA 5E89A 2CAVA 1YQCA 3RZJA 1A34A 1DIWA 4QB6A 4YW4A 5CFCA 2EALA 2AR6A 4YGBA 3BU0A 3ME2A 1UPSA 5BNPC 5FP9A 2ZEWA 2W87A 4AVVA 5LA0A 1O3QA 4QU1A 1UZYA 4FPLA 3VBSA 2WNUA 5EQUA 1QJY1 4NAOA 4HN1A 4RSUA 1HXS2 5FXWA 5FZOA 3ZSKA 4QX8A 3HPNA 1N47A 5CADA 1QDCA 3ZMOA 4CXXA 1H8TA 3J8F3 3ZFEA 3VHOA 3VZKA 2E7TA 1RITA 3M3QA 3MF6A 4WM7B 4LK7A 1LU2A 4MXVA 4Q4Y1 3FHIB 2ID4A 3GZTB 2CWSA 4N7UA 3ABZA 4BQXA 1JW6A 4O9GA 5J96B 3NVCA 4HMZA 1UW8A 4DRVA 3Q8EA 1UIJA 1O5LA 3E6CC 1K5MC 3LAGA 3S30A 4AI0A 3H9AA 2YPDA 3MLKA 4FBFA 1KRIA 3U10A 5HV0A 3HVDA 1RUF1 4GKXA 2HLEA 5DG1A 4OLLA 2ZX1A 4A42A 5KR7A 2ZJCA 2JDMA 4FOQA 4N43B 2HWD3 1WCUA 3AM2A 5B2GB 1X33A 1QOTA 1W8HA 5HV4A 3J9SA 3GF6A 3KMHA 2WN3A 3AYDA 3R4SA 3FHQA 4G3YC 2AUYA 3W58A 1XYOA 2UWCA 3IAQA 2VULA 5FDBA 4C1XA 4M3CA 4NHMA 1W2NA 5FZ8A 1K45A 2C4XA 3JQWA 2R0HA 1W6NB 1R1A2 3WHTA 1W28A 4WBBA 2X5IB 4Y33A 4Y5SA 3RVHA 1QJX1 4A7YA 4BZ4A 2QQOA 2H6CA 1LODA 1UYYA 1WUVA 3BPZA 1ZRCA 1H8TB 5F5AA 1XU2A 3WQ1A 2OUHA 2ARXA 5DDJ2 3ZYHA 4BQYA 5KC6A 4HPKB 5A7WA 3BUCA 3PLQA 4LA2A 1Q8SA 2VL4A 4NWVA 1NUKA 1EPWA 2GC1A 5G05L 2JENA 3C7FA 4H7LA 5ANNA 5GLVA 2ZOEB 1NE4A 1RTVA 2YMZA 4HZFA 4IQPA 1REDA 2HWE2 2EIDA 2C1FA 2A6VA 2WLPA 4E4DX 5LEJA 3BIEA 1LOFC 1VJ2A 5CFDC 4MVTA 4IV3C 2QQWA 2ZKLA 4YGEA 1UOFA 1CN1A 4XQWA 4R4ZA 2FDHA 4KGQA 1J84A 3K2OA 2JICA 2PXJA 3KQ4B 5KHHA 1HRI2 1AXKA 1AR73 1W99A 1WCSA 3R05A 4GAZA 4KH9A 4MH0E 5L73A 3UETA 2WT1A 3NMBA 4D3WA 4D6QA 2WZPP 1HB3A 4YVWC 5LRSA 4OUMA 1PNFA 1PVXA 2Z2SB 3A22A 3NKTA 4XUTA 5AFBA 3FFZA 5GALA 5C3PA 1R092 3WDWA 3O1RA 4YW3A 3H3UA 2G9FA 3VDDB 4QU2A 4Y22B 1ND2C 2W0XA 4FVVA 5FO8B 4LT5A 2PYTA 2ZEYA 3IMMA 2RM23 5FXVA 5J1XA 3QCWA 5CISA 5HXMA 1OMIA 3I59A 4PBPA 4M0HA 4BOWA 3LEIA 3NNMA 2EA7A 4XFIA 2HWC1 4XE9A 4YZ3A 4HLTA 4ASLA 2GU9A 4MSVA 1PGW2 5I0RA 2NM1A 1N1VA 2A6ZA 4HT1T 5JWPA 4RR3C 1AR92
chains in the Genus database with same CATH topology
2OS2A 3KV9A 3PURA 4GJYA 5FPLA 5FXXA 4AI9A 4URAA 5F37A 5LW9A 2OT7A 3PUSA 2WWJA 2WWUA 4QXCA 3LD8A 5IVJA 3PU3A 5FXZA 3DXTA 3ZLIA 5FZHA 4DIQA 2XUEA 2GP5A 4Y3OA 3N9PA 4D6SA 5ANQA 2XXZA 4UF0B 5FY7A 5K4LA 4CCLA 5IVVA 5A3PA 3AL5A 4CCNA 2Q8CA 4V2VA 5FP4A 5FY0A 4BISA 4QX7A 3KVBA 3NJYA 2YBKA 2YPDA 5LWBA 3OPTA 3PU8A 3LDBA 5FYYA 5IVYA 5A7PA 5FPUA 4IGPA 3PDQA 3AVSA 5KR7A 4CCJA 2OQ6A 5FZEA 4HOOA 5F2WA 1VRBA 3KVAA 5FYBA 5FBJA 5FYTA 5FZLA 4GD4A 4QWNA 4GJZA 5FV3A 5F32A 4QXHA 4IGOA 5FP8A 5FZ8A 5A1FA 5FY9A 4EZHA 4BU2A 2XMLA 4CCOA 2YU2A 4LITA 3U4SA 4Y33A 4EYUA 5F3EA 5IVBA 4TN7A 2P5BA 5FYZA 3RVHA 4ASKA 3N9LA 3DXUA 5FZDA 5FZBA 5ISLA 5FYHA 4LIVA 5FP3A 5FZOB 2OX0A 3PUAA 5FPBA 4Y4RA 5F5AA 5LY2A 4XDOA 5FZGA 3ZPOA 5FY5A 5FZ3A 3UYJA 4DO0A 5A7NA 5A7WA 4BXFA 3AVRA 5FZIA 5FJKA 4XDPA 3KV6A 5FUPA 4E4HA 2VD7A 2YBSA 2W2IA 4CSWA 5FYUA 5A3TA 5IVCA 5IWFA 5A3WA 5FZ4A 3N9NA 5FYMA 3N9OA 5FY4A 5FZAA 5FUNA 5FYSA 3KV5A 3K3NA 3KV4A 4CCMA 5CEHA 2GP3A 5FP7A 5FYCA 5FPVA 5FY1A 4IGQA 5A1LA 5FZ1A 3K2OA 4CUGA 2PXJA 5A80A 4LXLA 4GAZA 5E6HA 5FZ0A 5FZ6A 5LY1A 4V2WA 5FZ9A 5FZKA 2Q8EA 3N9QA 4D6QA 5F5IA 4D6RA 5A7OA 5A7SA 4NUBA 4CCKA 5FWJA 5FZCA 4AAPA 4UF0A 5IVFA 5A7QA 5FZFA 4HONA 5F39A 5F3GA 2Q8DA 4C8DA 5IVEA 5IW0A 2OQ7A 2XDVA 5F3IA 5FPAA 3PUQA 4QXBA 3N9MA 5FYIA 5FXVA 5FP9A 5FWEA 5F3CA 4QU1A 3U78A 5F2SA 5A7WB 3AL6A 5FYVA 5FY8A 5FZ7A 4LIUA 2YBPA 4EZ4A 3OPWA 5FZMA 5F5CA 3K3OA 2YU1A 5FXWA 5FJHA 5FZOA 4QX8A 5A3NA 3PTRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OS2 A;  3KV9 A;  3PUR A;  4GJY A;  5FPL A;  5FXX A;  4AI9 A;  4URA A;  5F37 A;  5LW9 A;  2OT7 A;  3PUS A;  2WWJ A;  2WWU A;  4QXC A;  3LD8 A;  5IVJ A;  3PU3 A;  5FXZ A;  3DXT A;  3ZLI A;  5FZH A;  4DIQ A;  2XUE A;  2GP5 A;  4Y3O A;  3N9P A;  4D6S A;  5ANQ A;  2XXZ A;  4UF0 B;  5FY7 A;  5K4L A;  4CCL A;  5IVV A;  5A3P A;  3AL5 A;  4CCN A;  2Q8C A;  4V2V A;  5FP4 A;  5FY0 A;  4BIS A;  4QX7 A;  3KVB A;  3NJY A;  2YBK A;  2YPD A;  5LWB A;  3OPT A;  3PU8 A;  3LDB A;  5FYY A;  5IVY A;  5A7P A;  5FPU A;  4IGP A;  3PDQ A;  3AVS A;  5KR7 A;  4CCJ A;  2OQ6 A;  5FZE A;  4HOO A;  5F2W A;  1VRB A;  3KVA A;  5FYB A;  5FBJ A;  5FYT A;  5FZL A;  4GD4 A;  4QWN A;  4GJZ A;  5FV3 A;  5F32 A;  4QXH A;  4IGO A;  5FP8 A;  5FZ8 A;  5A1F A;  5FY9 A;  4EZH A;  4BU2 A;  2XML A;  4CCO A;  2YU2 A;  4LIT A;  3U4S A;  4Y33 A;  4EYU A;  5F3E A;  5IVB A;  4TN7 A;  2P5B A;  5FYZ A;  3RVH A;  4ASK A;  3N9L A;  3DXU A;  5FZD A;  5FZB A;  5ISL A;  5FYH A;  4LIV A;  5FP3 A;  5FZO B;  2OX0 A;  3PUA A;  5FPB A;  4Y4R A;  5F5A A;  5LY2 A;  4XDO A;  5FZG A;  3ZPO A;  5FY5 A;  5FZ3 A;  3UYJ A;  4DO0 A;  5A7N A;  5A7W A;  4BXF A;  3AVR A;  5FZI A;  5FJK A;  4XDP A;  3KV6 A;  5FUP A;  4E4H A;  2VD7 A;  2YBS A;  2W2I A;  4CSW A;  5FYU A;  5A3T A;  5IVC A;  5IWF A;  5A3W A;  5FZ4 A;  3N9N A;  5FYM A;  3N9O A;  5FY4 A;  5FZA A;  5FUN A;  5FYS A;  3KV5 A;  3K3N A;  3KV4 A;  4CCM A;  5CEH A;  2GP3 A;  5FP7 A;  5FYC A;  5FPV A;  5FY1 A;  4IGQ A;  5A1L A;  5FZ1 A;  3K2O A;  4CUG A;  2PXJ A;  5A80 A;  4LXL A;  4GAZ A;  5E6H A;  5FZ0 A;  5FZ6 A;  5LY1 A;  4V2W A;  5FZ9 A;  5FZK A;  2Q8E A;  3N9Q A;  4D6Q A;  5F5I A;  4D6R A;  5A7O A;  5A7S A;  4NUB A;  4CCK A;  5FWJ A;  5FZC A;  4AAP A;  4UF0 A;  5IVF A;  5A7Q A;  5FZF A;  4HON A;  5F39 A;  5F3G A;  2Q8D A;  4C8D A;  5IVE A;  5IW0 A;  2OQ7 A;  2XDV A;  5F3I A;  5FPA A;  3PUQ A;  4QXB A;  3N9M A;  5FYI A;  5FXV A;  5FP9 A;  5FWE A;  5F3C A;  4QU1 A;  3U78 A;  5F2S A;  5A7W B;  3AL6 A;  5FYV A;  5FY8 A;  5FZ7 A;  4LIU A;  2YBP A;  4EZ4 A;  3OPW A;  5FZM A;  5F5C A;  3K3O A;  2YU1 A;  5FXW A;  5FJH A;  5FZO A;  4QX8 A;  5A3N A;  3PTR B; 
#chains in the Genus database with same CATH topology
 5GZE A;  1QJE A;  3RPQ A;  2VW1 A;  2JD9 A;  3AYA A;  1O3S A;  2R30 A;  2RDR A;  1JTZ X;  1AVB A;  1ZX5 A;  4K21 A;  4FSJ A;  2BGC A;  1I1E A;  1C1F A;  3QOP A;  3O1U A;  1RUJ 1;  2PA7 A;  3POB A;  2XUE A;  2JG8 C;  4GXL A;  2WA3 A;  1C8N A;  5K4L A;  3LGR A;  1GAN A;  2R07 2;  4ZXK A;  3UJO A;  2ZML A;  3PVE A;  5C9A C;  5IK8 A;  1WA6 X;  2EF6 A;  4IEU A;  2IVJ A;  4ZY9 A;  1RXG A;  2FBE A;  2KA3 A;  4QT6 A;  3IPV A;  4S2D A;  1GZ9 A;  3LDB A;  2VCM A;  2W92 A;  2DTW A;  4Q0P A;  2W91 A;  1YJK A;  2OQ6 A;  4LO8 A;  3AKQ A;  3T0B A;  1UY4 A;  1W8Z A;  4A6O A;  4CP1 A;  5J7M A;  2LM3 A;  4LQR A;  5JXI A;  5DZF A;  5IHR A;  4QHZ A;  3WF3 A;  1AR6 3;  3FN9 A;  2VZS A;  1POV 1;  3S6P A;  3FUO A;  3VKN A;  3HJR A;  4Y5T A;  3U1X A;  1O7F A;  3LFI A;  5T50 A;  3POW A;  3TRS B;  1FOD 1;  4PDW B;  4BU2 A;  5GZG A;  3USU B;  4WV8 A;  5IVB A;  5JOZ A;  1YCI A;  2P5B A;  1RUG 1;  3LEK A;  3CIH A;  3DXU A;  3Q8F A;  1IPS A;  1AR9 3;  2ZGK A;  5FP3 A;  1EP0 A;  4JTO A;  4NN0 A;  5FZO B;  2OZJ A;  4W6W A;  1H6Y A;  3WDX A;  4QQP A;  3VUO A;  3SCF A;  1UIK A;  2VPV A;  1FOD 2;  4BXF A;  4BLI A;  4K8R B;  4AHX A;  5A3M A;  1IGO A;  1OLR A;  3NAP B;  4JRA A;  5D21 A;  1JZ7 A;  1Y43 B;  3HQR A;  1KFU L;  4RQP C;  1EV1 3;  2R1B A;  2ZX0 A;  2A71 A;  3OUJ A;  1AL2 2;  3LIG A;  4NOT A;  3QBQ A;  4COU A;  1UZ0 A;  3WNX A;  4QPI A;  1CES A;  2HYX A;  2VBD A;  3RZG A;  2PHF A;  1DGW A;  1YI9 A;  2B4K A;  4JGZ C;  1R08 3;  3QLQ A;  3KF5 A;  4AVB A;  1S55 A;  5DAV A;  2CGN A;  4MGY E;  1DDL A;  2D6P A;  4PQQ A;  1SLT A;  5FP7 A;  1W0N A;  2VU9 A;  3IPV B;  3NJX A;  3WW4 A;  5FOJ B;  3OBT A;  3WF4 A;  5JXJ A;  4ZZ8 A;  1F4A A;  2LUW A;  2IFR A;  2X53 S;  5F5I A;  4HET A;  2V4V A;  3AMH A;  4CCK A;  3FHA A;  4ITC A;  4JTN A;  5HCH A;  1F4H A;  1L7R A;  2K9Z A;  4BK5 A;  4QHO A;  4ONU A;  4M3C B;  4XXP A;  1PMH X;  3U11 A;  2WFF 1;  3O1M A;  2RR1 1;  3B7M A;  1PGS A;  3RYR A;  1VBC 1;  4QDQ A;  5K9Y A;  4P9W A;  4NRQ A;  2ARC A;  1YQ2 A;  1FV3 A;  4YW5 A;  4QXB A;  2HWC 3;  1UYP A;  1DGR N;  2BTV C;  1WW6 A;  3VDB A;  5A7W B;  2QNK A;  5FQ0 A;  1HJF A;  4LIU A;  1YQ6 A;  4FOY A;  4IEW A;  4Y4Y A;  1YQ5 A;  2WUH A;  2RS1 3;  1JYN A;  1G6N A;  3GBF A;  1HXS 3;  5A3N A;  2W1W A;  1RXF A;  4A6S A;  3UES A;  3VD3 A;  5IK5 A;  2DU0 A;  4M4R A;  2W1Q A;  3M3E A;  3S5Q A;  4URA A;  1KFX L;  2A3W A;  5F37 A;  1R1Z A;  1W6M B;  5E8A A;  2YG0 A;  2EAA A;  3J7M A;  4NHX A;  5CFD B;  3BB6 A;  1SZB A;  1GWK A;  3GNE A;  5HCB A;  1N1Y A;  2VNO A;  3RQ0 A;  3LB9 A;  4CTE A;  2ZZQ A;  5ANQ A;  4Y24 A;  3SH5 A;  2PHW A;  3HT1 A;  3WT3 A;  4RGK A;  2HEY F;  1XE0 A;  2VQU A;  4OZO A;  3WV6 A;  4C0H A;  2Y6K A;  4UT5 A;  4UI9 L;  4MHU A;  1H8V A;  3SEP A;  1PVC 2;  3WHU A;  1PZ7 A;  1S2B A;  3FFQ A;  5FYY A;  2G9Z A;  2C26 A;  3LDK A;  1OF4 A;  4FPK A;  5A33 B;  2Z79 A;  3H8R A;  2WAB A;  4UWD A;  4ZHN A;  3ZFF B;  3ZR6 A;  2DUR A;  1O8S A;  1PO2 3;  1ZZB A;  2WLQ A;  4ZON A;  3KCX A;  1GR3 A;  4Y22 A;  3OY8 A;  1A3K A;  1I3H A;  2JG9 A;  1WMX A;  5FPZ A;  1RUC 2;  1LES A;  1YFW A;  2I2S A;  1KDM A;  1BBT 1;  1U12 A;  3D0S A;  4M4P A;  2P1B A;  4IGO A;  3B9C A;  5A1F A;  2G4I A;  3NV3 A;  4XZU G;  2XML A;  1H2N A;  3N4M A;  1QH6 A;  3ORJ A;  4V1P A;  5D8A C;  4ZS2 A;  5FR3 A;  1RB8 G;  4UFM A;  4NRM A;  3AZY A;  1Q8Q A;  1VIW B;  4AG4 A;  1CD3 G;  4CXW A;  4DB5 A;  2YGM A;  1NE6 A;  3PJQ A;  1POV 0;  3ROU A;  5KC5 A;  3MID A;  3PUH A;  1XXN A;  3HQX A;  2P3I A;  2XWJ B;  2Z4F A;  4XFF A;  1EV1 1;  5FZI A;  2W5F A;  1LOC A;  3OGR A;  3V0B B;  3CMG A;  5JZG C;  4AED C;  2BFU S;  3QAC A;  4LPL A;  2PMW B;  1Y9M A;  3H1M A;  1JUI A;  2ARA A;  1MR5 A;  2IXI A;  1WMF A;  4Q4W 3;  3IZO A;  1WCQ A;  5FYM A;  1OD5 A;  1W8T A;  2WNO A;  3ACH A;  2UUR A;  1O8P A;  1H1M A;  4UFH A;  3TYJ A;  4Z1V A;  5T5J A;  2C24 A;  2DBN A;  5CEH A;  3B00 A;  4AVS A;  2WYF A;  1REF A;  2ZKN A;  2FDJ A;  1ULP A;  5DMY A;  3AMM A;  2R04 2;  5LBF A;  4IND A;  5CKQ A;  4XFH A;  2GSY A;  4IE6 A;  2D97 A;  3ZDV A;  5HCA A;  1DQ6 A;  3SCH A;  3H42 B;  3WG1 A;  1LB2 A;  4XCA A;  1AZD A;  4D6R A;  4E8C A;  5J37 A;  1RUC 3;  1FMD 3;  2WO1 A;  5FWJ A;  1CIY A;  4N43 C;  3CBN A;  4DFS A;  3ZSM A;  3HBZ A;  2VZQ A;  5E16 A;  4DXS A;  4TTG A;  1SLA A;  5D8A B;  3NKG A;  4JDM A;  4C1W A;  5B4N A;  4XTM A;  2JDK A;  2A6X A;  2FDI A;  2XVK A;  2QFE A;  3JBG 2;  3OBZ A;  5H9R A;  2Y6J A;  3SH4 A;  4YGD A;  4YLZ A;  1GZW A;  3ZR5 A;  1W8U A;  4DQA A;  4DS0 A;  3U78 A;  1AX2 A;  4Y20 B;  1APN A;  3O1O A;  4RHV 3;  4HAN A;  5FY8 A;  4YFZ A;  3KSC A;  1OQD A;  1YUD A;  2QUO A;  3LF7 A;  4DXT A;  5A6Y A;  4Y26 A;  2JG9 B;  2PAE A;  1ND3 A;  2LTN A;  4ES9 A;  4OHZ A;  3E5U A;  5FXX A;  3WP6 A;  1W9S A;  4U36 A;  2AZ5 A;  4AI1 A;  3R6S A;  4JGZ B;  4QXC A;  2X8K A;  3O0X A;  5I93 A;  4AI8 A;  4R4X A;  1O3T A;  1I5Z A;  1ZA4 A;  1W0O A;  1FNZ A;  1Y3T A;  1ZA7 A;  3UT0 A;  4BM8 A;  1IS3 A;  4DUW A;  3U14 A;  5JIU A;  4QKN A;  4YW1 A;  1MS9 A;  5JIA A;  2PHR A;  1DGW X;  1PZ9 A;  3VZJ A;  3CJX A;  3VDC A;  1UU6 A;  4KWK A;  4OHV A;  2A3X A;  3GHM A;  4MGZ E;  3ACI A;  3ZN4 A;  1V6L A;  2RMU 2;  4HSJ A;  3PL0 A;  3AVS A;  1ODN A;  3HNM A;  5L36 A;  3RS6 A;  3LA2 A;  5JR2 A;  4A7K A;  4B4Q A;  4AFD A;  2QBX A;  4D8M A;  1RUF 3;  4HVQ A;  5J48 A;  3VL9 A;  1FMD 1;  3AMP A;  1U5I A;  2LS6 A;  4OMC A;  1RMU 2;  4FPG A;  4PBO A;  1O4Y A;  5FMC A;  1AR6 2;  2NQY A;  4BB3 A;  1D4M 1;  1W6Q A;  5FQ0 B;  4EWE A;  4XAB A;  1SFY A;  3VHN A;  2VMD A;  4LOR A;  1JUH A;  1XSR A;  4AQ6 A;  2RG4 A;  2YDE A;  5BV6 A;  2ADE A;  2W9X A;  3AMN A;  1WGP A;  3IAP A;  5CNA A;  3T4V A;  3VBS B;  4EYU A;  5JXH A;  3ZXL A;  4KNC A;  3MV0 1;  4O65 A;  4CPB A;  1ND3 B;  1QJY 2;  5FZG A;  1W8F A;  3OGG A;  4CUA A;  1V6I A;  1J83 A;  1XND A;  4AGR A;  2XOM A;  3DYO A;  1CJP A;  3AVR A;  3DKQ A;  5FIX A;  3SH3 A;  1C8M 3;  4CYD A;  2VOX A;  2WZE A;  2D43 A;  2ZGM A;  3IT8 A;  2VBP A;  4CCD A;  1GOH A;  3DCQ A;  5IWF A;  2QQP A;  5FY4 A;  4Q4Y 2;  5HCF A;  1RHI 1;  5KHI A;  4J1W A;  2J1T A;  1ULG A;  5A3L A;  1XNB A;  3VZM A;  2ORX A;  3TEW A;  4LO6 B;  2YHJ A;  5BNN C;  1PNG A;  1MEC 3;  1VMF A;  1ZNP A;  3ZXG A;  4AL9 A;  1NXD 1;  4F3J A;  1ZBE 3;  1DG6 A;  5FZ1 A;  1QOO A;  3CNA A;  3U07 A;  2WO7 A;  1FV2 A;  1N3Q A;  4CU8 A;  3KWV A;  2B5H A;  3B9I A;  4LHN A;  3TNP B;  1VBE 2;  2QKD A;  2ADD A;  5FZ6 A;  1RUF 2;  5FZ9 A;  5FZK A;  1J58 A;  1Y4W A;  2WNV B;  5A7S A;  1RIN A;  3E97 A;  1BKZ A;  4UF0 A;  4DEQ A;  2OXB A;  3T09 A;  3OBR A;  1TMF 1;  4JGY A;  3FE5 A;  1W9T A;  4BIF A;  3ZFE C;  4JKL A;  1DBN A;  2BGP A;  3ILN A;  3N35 A;  4MET A;  4PDW C;  4QD2 A;  5F3G A;  3R4U A;  5EIY B;  3E1F 1;  3VBH A;  3OYW A;  2BUK A;  4KBB A;  1XSQ A;  4XIO A;  2ZPX A;  4Y1U A;  1BEV 3;  2XQR A;  3APB A;  3CKH A;  3FC0 A;  3OD0 A;  2QQJ A;  4YW7 A;  4AOC A;  5C7G A;  3I49 A;  2MEV 2;  1LGN A;  1Q3E A;  2J1V A;  5T54 A;  2YBP A;  4HKO A;  1RUN A;  3M70 A;  3WG3 A;  5K0U B;  1LU1 A;  1DFQ A;  4MXW B;  1CAX A;  4H2A A;  4AGG A;  2BYV E;  1YFY A;  5CYY A;  1VMJ A;  3SXW A;  3TWI A;  3PTR B;  3AMQ A;  3GAL A;  4BE3 A;  2AEY A;  2XB6 C;  3KCC A;  4PLM A;  1UX7 A;  2ZX2 A;  3JU9 A;  1H1A A;  2R04 1;  2R06 2;  1V6O A;  2IXC A;  3E6D A;  4Q29 A;  1NQJ A;  2VM9 A;  2WAA A;  4Q1P A;  4Y3O A;  3MLL A;  3I2O A;  1H2M A;  2KM2 A;  2W46 A;  1OQE A;  1S0C A;  2JG8 B;  4K3U A;  4XF1 A;  1FPN 2;  2WRA A;  1Y7B A;  4YM1 A;  5B4X A;  3RI8 A;  3S7I A;  1GQG A;  3ZN6 A;  1W8O A;  5FP4 A;  5JSO A;  5JDB A;  2ZAH A;  5T5P A;  3GYD A;  3VDD A;  2DF7 A;  1NAE A;  1AYN 2;  1PMJ X;  2JJ6 A;  4XIK A;  3PMS A;  4JVA A;  1JOP A;  3N7J A;  2WQ4 A;  1QGL A;  1V9U 3;  1EPZ A;  1KGY A;  4IGP A;  4QX3 A;  4Q0S A;  3RZM A;  2VZ3 A;  4Z8B A;  3DPR A;  4AI3 A;  3LKJ A;  1ASJ 2;  3MYX A;  2ZHL A;  1QNW A;  4GWI A;  4LA3 A;  4NPR A;  3W5M A;  3M3I A;  4ZPI A;  4GA9 A;  1IS4 A;  5L7O C;  1EY2 A;  4E4S A;  3I2D A;  1ULF A;  2X09 A;  2FZ2 A;  5F32 A;  1HRV 1;  3EO6 A;  2XPJ A;  2J22 A;  2VMH A;  3DEM A;  1MS3 A;  1ENS A;  1UXX X;  1M06 G;  5CG9 A;  1YEW A;  3WW1 A;  1O3R A;  1SAC A;  2ZAA A;  1QJU 3;  1C5H A;  3GCX A;  3UGF A;  3WNK A;  4QGM A;  5BNO B;  4B4P A;  1YQ8 A;  1KJR A;  1OOP A;  3ZO0 B;  4COV A;  4Q4W 1;  4DO0 A;  2VW2 A;  4GUL A;  4KG8 A;  2GC0 A;  3B5L B;  2R06 3;  4GAL A;  3LPF A;  4J25 A;  1HIX A;  1NOV A;  2QZ2 A;  2P3Y A;  1R1A 3;  4BDV B;  4KWJ A;  3UGH A;  4WM7 C;  1AL0 G;  1R64 A;  1ST8 A;  1CPM A;  2BVV A;  1HW5 A;  1IHM A;  1MEC 1;  5CA6 A;  3MW3 A;  3KF3 A;  1PIV 1;  5CFC C;  1F8V A;  4QKF A;  4TLF A;  1DP0 A;  1NY7 1;  1E5S A;  4QB1 A;  1HB1 A;  2WQ8 A;  1UD1 A;  4XW3 A;  1S0I A;  2VUA A;  1I6X A;  2VY0 A;  4V2W A;  1D0G A;  4JCK A;  2FHR A;  3WP3 A;  3CJI C;  4XUR A;  4Q27 A;  1O5U A;  3O5S A;  4N8M A;  5FZC A;  3WCS A;  3AZX A;  1DLL A;  3LQC A;  4WM8 B;  4MHR A;  4ARX A;  1ENX A;  4GIQ A;  1J1T A;  3DYP A;  4PI2 A;  4R9D A;  5FZF A;  1D0H A;  5DAW A;  4L9B A;  3USU A;  4CEW A;  1X50 A;  3NJZ A;  1XNA A;  1D7P M;  3G7D A;  3WIN E;  3RFR A;  2E63 A;  4XC9 A;  5C3O A;  3ECQ A;  1COV 1;  1C4R A;  2V4A A;  4BQ1 A;  5JXG A;  3AL6 A;  1RUG 2;  3JQX A;  3VD5 A;  2EIC A;  2QQK A;  2JDY A;  3NAP A;  1K5J A;  3ZSE A;  2IXL A;  2YU1 A;  4BLJ A;  1CX1 A;  1YIF A;  1F2N A;  3O7O A;  2VOT A;  1FI2 A;  5CKM A;  3TBD A;  1U5X A;  3I8T A;  1DU3 D;  4FXG B;  4CDX B;  3RZH A;  4FP2 A;  3OEA A;  2VE1 A;  4BYY A;  1UMI A;  2GDF A;  2VZR A;  4AVA A;  1CX4 A;  1TNF A;  2E6V A;  5TSW A;  4DIQ A;  4B7E A;  2R1D A;  4AZZ A;  5T55 A;  1W6Q B;  5GZF A;  3HNY M;  4OQ8 A;  5A3P A;  4R52 A;  4NID A;  2VMF A;  1RUE 3;  2YYO A;  2HWB 3;  3TN9 3;  2YXS A;  4OI0 A;  2ZMN A;  4A4A A;  3TNQ A;  1UN1 A;  5FRE A;  4LTA A;  4QX0 A;  5CFC B;  1OSG A;  1M4W A;  3OPT A;  2WSV A;  1MS0 A;  3UK9 A;  5IVY A;  2VH9 A;  5C5U A;  2RR1 3;  3ASI A;  2VXR A;  4D0Q A;  2ES3 A;  2ZEZ A;  4G9S B;  4P14 A;  3VBO B;  4C91 A;  4EJR A;  2E31 A;  2XR4 A;  1W03 A;  1CZS A;  1GBG A;  2JE7 A;  4PIX A;  2EVX A;  4QWN A;  2Y0I A;  4KWU A;  4AGV A;  4K7J A;  3A7Q A;  3HOB A;  1XRU A;  5FOB B;  2DWR A;  2DVD A;  4CCO A;  1U5Z A;  2XJP A;  2E51 A;  5A6Z A;  2EIG A;  1ZZ9 A;  1K42 A;  1GP5 A;  3NWK A;  4UXA A;  2VOV A;  3UKN A;  1G86 A;  2R6Q A;  5FZD A;  1S0E A;  1WD3 A;  3OGV A;  5E1R A;  2OPK A;  1CAX B;  5DZE A;  4JHZ A;  4XFA A;  5EYY A;  1JS9 A;  4E27 A;  5BNO A;  1ZZ6 A;  1BLZ A;  3GDB A;  4RL7 A;  3VKM A;  4FTS A;  1HV0 A;  2BNN A;  5LAS A;  1RC6 A;  2BVB A;  1W6M A;  2JEC A;  3WXP A;  2PEL A;  4R9A A;  5DPN A;  5FUP A;  3ILF A;  4Y1Y A;  1PK6 B;  2XHN A;  3RSJ A;  1REE A;  5FYU A;  4QPG B;  3BGA A;  1IS6 A;  5LCW L;  1GP6 A;  1UOG A;  2D6M A;  2QQI A;  2VCA A;  3I3B A;  1SEF A;  4BQ5 A;  4WVZ A;  1MAC A;  2RDN A;  3VLB B;  4Q4X 3;  1MVQ A;  3ACG A;  5FYS A;  2MPF A;  1UAI A;  1ZRI A;  2CGO A;  3KV4 A;  1ND2 A;  4QKD A;  3HAG A;  4XUQ A;  1UY2 A;  4QGN A;  5DAB A;  1VBA 1;  1W39 A;  1OOP B;  3C8X A;  4S2G A;  1J3Q A;  2WT2 A;  3AXD A;  1AL2 3;  3CZU A;  1ZZ7 A;  2GN7 A;  2XJV A;  4UOJ A;  3N36 A;  4O61 A;  4BK4 A;  2HYK A;  2WJS A;  1XJA A;  3UV9 A;  3KCY A;  3L2H A;  4RD7 A;  4XAA A;  3CU7 A;  3FUQ A;  2PFW A;  1OVP A;  1A6C A;  1OPO A;  2B9U A;  4I01 A;  4ASM B;  3S5A A;  1AXZ A;  1WKY A;  1P8J A;  3AFG A;  4OUS A;  1D2S A;  1GMM A;  1H30 A;  4GZ9 A;  4LKS A;  3I2I A;  4CDW B;  4P9Y A;  2XDV A;  2VAU A;  5FPA A;  2RDQ A;  4GMP 3;  1HB4 A;  2GH8 A;  3P6B A;  1UCX A;  2GAU A;  1IQA A;  3CF6 E;  3OCP A;  1BEV 2;  3NNJ A;  4HKW A;  2BWC A;  3CLP A;  5ACA 3;  1NKG A;  4NJ4 A;  1J59 A;  3VBS C;  2UYA A;  3ILR A;  5AC9 2;  1OVS A;  1DZR A;  1W6O A;  4AQ2 A;  1BK0 A;  4YVS B;  4A44 A;  2IXH A;  3KZ4 C;  1JBC A;  4GQ7 A;  5ERL A;  5C33 A;  3OEB A;  3LDR A;  3K51 A;  3V0A A;  1AX1 A;  1DYK A;  1VRH 1;  2BOI A;  2ZA9 A;  3AKT A;  1QHD A;  1B35 C;  1KJL A;  2P37 A;  4FFF A;  1KIT A;  2OT7 A;  2WWU A;  3VD7 A;  4XET A;  4CPB D;  3EBR A;  3MUZ 1;  1MQT C;  1EUT A;  4IV3 B;  2D6L X;  2CSG A;  2JXA A;  5JOY A;  1JZ3 A;  1G9B A;  5IYY A;  3JUU A;  3OB8 A;  1SCS A;  4PF5 A;  5EWS A;  4AWD A;  1MS1 A;  4QAW A;  4COZ A;  5K7P A;  1JYT A;  3L9J T;  1WLD A;  5FY7 A;  4KL1 A;  4YZ1 A;  1W2A X;  1OF3 A;  1FPN 3;  1V70 A;  2X5I A;  4LOS A;  3ZXJ A;  4EN6 B;  2R07 1;  2YB7 A;  4GKY A;  5HI0 A;  4DMI A;  1V6M A;  5LWB A;  1RUD 3;  2WNU C;  5C8W A;  3VN4 A;  1STM A;  4ZZ5 A;  1JOJ A;  4I2O A;  1JZ4 A;  1QDO A;  2XKO A;  5IAX A;  4LEJ A;  4RGG A;  3V56 A;  2WNU B;  1Z0H A;  3WDU A;  1RJ7 A;  3NJV A;  2V5Y A;  4MGI E;  4XAE A;  3OBA A;  1JH5 A;  1TEI A;  2HEV F;  4H55 A;  3ZYB A;  4ES8 A;  2DV9 A;  3P1I A;  4LHS A;  4WM8 A;  4DY3 A;  4JGY B;  4EZH A;  5AC9 3;  1QIQ A;  4JGZ A;  4QM8 A;  5JI7 A;  4HFS A;  4Q2F A;  1E57 A;  4HN0 A;  1L3J A;  2FCU A;  4COY A;  3BYW A;  4B1M A;  4LIV A;  1YJL A;  1Q56 A;  3K46 A;  5LY2 A;  1T6G C;  1HQW A;  3A23 A;  2Q30 A;  2HKX A;  4DXR A;  3BPS A;  5CBL A;  3CJI A;  4GWJ A;  5A7N A;  2VZO A;  1VBB 2;  3FBM A;  3FLP A;  5SV8 A;  1UL9 A;  1YRZ A;  3MLJ A;  2YPJ A;  4E4H A;  4YVS C;  2NPI A;  2VTF A;  3NRU A;  4CEY B;  4LR4 A;  1ENR A;  5A3T A;  1EAH 1;  1OT5 A;  2QQM A;  3GHN A;  2ATF A;  1AR7 1;  1MZ6 A;  3T2T A;  2KR2 A;  4RN5 A;  3GBW A;  4CRQ A;  1VBB 1;  2BEO A;  5IAV A;  5GZC A;  4FOV A;  3A0N A;  1OPM A;  1VBA 3;  3J8F 2;  5DAP A;  5FYC A;  5BNN B;  4XCB A;  1WCK A;  3VBR A;  4FAH A;  1SFN A;  1WD4 A;  2WR9 A;  2ZGS A;  1BBT 3;  2GZW A;  4JDO A;  4Z07 A;  1C1L A;  5SV5 A;  4C0B A;  4CP9 B;  4ZKT B;  3LPG A;  5GLT A;  4B7K A;  4SLI A;  5DUX A;  3RGB A;  1OA2 A;  3MI8 A;  2Q8E A;  2AYH A;  5I0T A;  1DYP A;  4MV2 A;  4YSF A;  1OOP C;  3WLU A;  3OUH A;  4YG0 A;  4X6Q B;  1W3X A;  4K9S A;  5IVF A;  3NNF A;  5M0T A;  4KBZ A;  5H9P A;  2J1E A;  1JYI A;  4YGC A;  3MUY 1;  1UX6 A;  1OHF A;  4QQL A;  3T30 A;  3FX3 A;  3AP4 A;  1W6P A;  5DAX A;  4A41 A;  4PLO A;  5AFE A;  2VQT A;  2RJK A;  3N9M A;  1CIW A;  5L19 A;  4MUV A;  5FWE A;  3UKT A;  3I2H A;  2VZP A;  4HVO A;  4K1Y A;  3BVC A;  2YY1 A;  2X29 A;  2Y64 A;  4JDN A;  3BTX A;  3WG4 A;  1VP6 A;  2ZTN A;  4LOT A;  1NZI A;  5LB6 A;  2VZT A;  1QQP 1;  5I8S A;  4BWO A;  3ZFG A;  4HBN A;  3BTZ A;  1BVP 1;  1GWM A;  1HRI 1;  4Q4V 3;  5EHD A;  5J98 B;  2XL9 A;  3PUS A;  3VBO A;  2A5Z A;  2A7A A;  1W2O A;  2H0B A;  3DXT A;  4KI5 M;  4XMA A;  3D5O A;  3RWN A;  5GJ6 A;  3WSO A;  5F7U A;  4ZU4 A;  2E7Q A;  4QM9 A;  4RS5 C;  5H9S A;  2DVB A;  5DDJ 3;  5C70 A;  2PLV 1;  4YWA A;  1ALY A;  4FPJ A;  1ZRE A;  3VBR B;  1LUL A;  3SIT A;  4CCL A;  1JZ6 A;  1BBT 2;  1L7L A;  5KXC A;  3KT7 A;  1JOB A;  1QOS A;  1NCR B;  2AEN A;  3GJA A;  1CQ9 A;  2CV6 A;  2ERF A;  3BOW A;  2HWB 2;  3TN9 2;  3I54 A;  1JYX A;  4IEQ A;  2ZEX A;  4LBQ B;  4QB2 A;  4U2A A;  4M00 A;  4PI0 A;  2QJV A;  1QJF A;  2HWE 3;  4BCU A;  4P9G A;  2Q1F A;  1H6X A;  1CAU A;  4O7X A;  2WNE A;  5CIR A;  3RRD A;  4IEO A;  3E5X A;  3V65 A;  5FZE A;  4QPI C;  1ZBA 3;  4A3Z A;  2Q4S A;  4LUM A;  4RYD A;  3C7O A;  4OCT A;  2E33 A;  1IOA A;  5C8C C;  5JI9 A;  4B4R A;  5C4W B;  1RUC 1;  3SEE A;  1L7Q A;  1OUX A;  1GYK A;  1WW4 A;  2BOJ A;  3BU7 A;  1KEX A;  3EXU A;  4FQZ A;  4HKL A;  4OI1 A;  3VHR A;  1UU5 A;  4DY5 A;  5A6Q A;  4WVM A;  1DQ0 A;  4Y1V A;  3MIH A;  2NN8 A;  3MFC A;  3VDD C;  2Y8K A;  1W06 A;  2D3S A;  4Q4V 2;  2OX0 A;  2VVE A;  1R09 3;  1D4V B;  2WS9 2;  2LAL A;  2J42 A;  2DCK A;  1NLS A;  3THT A;  2A3Y A;  3DPR C;  4B29 A;  1LJ7 A;  1CR7 A;  1US3 A;  2PHT A;  1Z7S 2;  2BZD A;  2Q1Z B;  2R49 A;  4FPH A;  5T5L A;  3TB0 A;  4O9E A;  1XOY A;  1IZ3 A;  1HXS 1;  2V73 A;  3DN7 A;  3T2P A;  3BOD A;  3JD7 1;  2WS9 1;  5FZ4 A;  1C8M 1;  2R06 1;  4Q8L A;  1ENQ A;  3T1M A;  5F6K A;  2JWP A;  5T3N A;  4COW A;  5F9T A;  4CDQ C;  3ENR A;  3B3Q E;  4BME A;  3KV5 A;  5JR7 B;  3KGZ A;  3RI9 A;  5FCC A;  3WF2 A;  1SHW B;  4NR1 A;  2WAO A;  5CAZ A;  4CCM A;  2ILM A;  2VG9 A;  4FQ4 A;  4IE0 A;  4XHB A;  5C9A B;  5A3O A;  3K4Z A;  4XF9 A;  1W8N A;  2O8Q A;  1C8M 2;  1BVV A;  4IGQ A;  1RUH 2;  4OHW A;  5IK7 A;  3OJB A;  2GNT A;  3ZX7 A;  4OHY A;  3KGL A;  1G9D A;  3BOP A;  3ZPY A;  1NCQ A;  5FZ0 A;  1Y9G A;  1F5J A;  3CJI B;  1GWL A;  1B35 A;  2B39 A;  3N9Q A;  5LA9 A;  3BKZ A;  4NRO A;  4CEW C;  3THD A;  3AZW A;  4OI4 A;  1AF9 A;  1NCR A;  4A3X A;  4YFW A;  5FAX A;  3WF0 A;  2YC2 A;  1ZBE 2;  4C8D A;  2N7G A;  1PHM A;  4G4F A;  4AF9 A;  3OG2 A;  1WA4 A;  1SLB A;  1W9Y A;  2FD8 A;  2JE8 A;  3TAY A;  3RMX A;  3DKW A;  1BZW A;  1RUO A;  4DUV A;  1F9K A;  5FYV A;  1H4G A;  5ACA 2;  5FO7 B;  3ITQ A;  5K0U C;  4EZ4 A;  1EAH 2;  1RVF 2;  1Z7S 3;  2QE3 A;  3C2U A;  3CHX A;  1R1A 1;  4IES A;  2YZ4 A;  4XMI A;  2YC4 A;  2VUD A;  1NXM A;  2V72 A;  3LZZ A;  1DHK B;  3AJZ A;  3LOI A;  3POE A;  1QJX 2;  2WL1 A;  1JYW A;  4FTE A;  4GJY A;  1BJQ A;  1GZC A;  3GXU A;  3O12 A;  3ZMN A;  5FO9 B;  3ZXF A;  3IB3 A;  5LW9 A;  4PDW A;  2DVG A;  3LA7 A;  4IE4 A;  2WYS A;  1H2K A;  3D6E A;  3VD4 A;  2GH2 A;  1UWW A;  1TG7 A;  4KU8 A;  3VD9 A;  1PO1 3;  3O1T A;  1KQR A;  2TNF A;  4A7Z A;  1W6P B;  4AEK A;  1DLC A;  1PX3 A;  5BNN A;  5LBE A;  1IKP A;  1D2Q A;  5G04 L;  1RUH 3;  2PAK A;  1JHJ A;  5GKA C;  5C71 A;  1D4M 2;  3C7G A;  1LHV A;  1LAJ A;  3M2M A;  3O1S A;  2NYY A;  1LRH A;  1GU3 A;  3KS7 A;  3IDA A;  5GZD A;  4AQS A;  2IFW A;  5JVV A;  3OPZ A;  3U37 A;  2P6H A;  3ELN A;  2IZW A;  3VZO A;  1PMI A;  3RZZ A;  1OKO A;  2F4P A;  3IDE A;  4CEW B;  1MS4 A;  4Q0U A;  5JSR A;  3E6B A;  4AYU A;  2FQP A;  5FYT A;  2C6S A;  3UNP A;  4QDR A;  1GOG A;  2TEP A;  2WO2 A;  4EN9 B;  4DXZ A;  2BNM A;  1JU4 A;  3HN3 A;  4K6B A;  1DZQ A;  2RS5 3;  4L0P A;  1AYN 3;  1UYX A;  4PT6 A;  1RVF 3;  1EUU A;  1ND2 B;  2B9V A;  3I2J A;  2D44 A;  4J1X A;  4WM7 A;  4PJY A;  4X8N A;  3U75 A;  5DUU A;  1R08 1;  1QJX 3;  1ASJ 3;  4XF3 A;  5EYX A;  3HBK A;  4CDX C;  2VMG A;  3IWZ A;  2PAM A;  2X5I C;  5FZ3 A;  2EXH A;  2Q5T A;  1XBF A;  4RR3 A;  4XBQ A;  4YAR A;  2XG3 A;  1PVC 1;  1WMD A;  1JZ8 A;  4NRP A;  4UW6 A;  4XDP A;  2BER A;  1VBE 1;  3I4I A;  2HWC 2;  2UY8 A;  1S2K A;  2VD7 A;  2YBS A;  4FT8 A;  4FPC A;  3WCR A;  4XUO A;  1GKB A;  1ZM1 A;  2R0F A;  4CSW A;  3V0A B;  3HT2 A;  2YRO A;  3N9N A;  3WF1 A;  1CZV A;  2A75 A;  4K1Z A;  2MHF A;  5ABJ A;  2DU1 A;  2CWM A;  4E2G A;  2RS1 2;  1IKQ A;  4PIY A;  4EWA A;  2AH2 A;  1HN1 A;  2B42 B;  2Q8O A;  5IFP A;  1GQH A;  4XF4 A;  4J6G A;  5J36 A;  5FY1 A;  2C0Z A;  4Q4X 1;  4CUG A;  3UL2 A;  1W8W A;  1HRV 3;  2B45 X;  2ZGT A;  1CGP A;  2LRO A;  5FTT C;  2BPA 2;  1PX4 A;  4IL7 A;  1OLM E;  4WZC A;  3SMH A;  1VBD 1;  2BBV A;  4ZU7 A;  4YZ5 A;  2IXJ A;  3D0J A;  5EJ3 A;  2YFU A;  4W6Y A;  4AVC A;  3MIE A;  4B1L A;  3LEG A;  1V9U 1;  2RS5 2;  1F5F A;  3IIA A;  4HON A;  4URT A;  5F39 A;  1VE0 A;  5I8Y A;  4KGG A;  1H1I A;  1NA1 C;  1S4C A;  2OPW A;  1NLR A;  2OII A;  4XBL A;  3MEP A;  1LEM A;  5IW0 A;  2OQ7 A;  3S0M A;  1QQP 3;  2VC9 A;  3NW4 A;  3SKV A;  3VBU C;  4BH9 A;  4P08 A;  4H3W A;  1HN0 A;  3C3V A;  1Z7S 1;  2VR4 A;  1V6N A;  4L8Q A;  1O6U A;  4QPG A;  3T0A A;  4JZR A;  1S0F A;  2RS5 1;  2ZGU A;  3JD7 2;  2WQZ C;  5L9V A;  3RNS A;  4PCR A;  1C57 A;  1VLN A;  4XUN A;  1LOB A;  5F1R A;  2K0G A;  2ZX3 A;  4IEZ A;  2P4E A;  5FPL A;  2VZU A;  1SBF A;  4BHP A;  4I0B A;  2VTX A;  3DPR B;  4AFA A;  1URX A;  4AFM A;  4Q8K A;  2ZGP A;  2BQP A;  3DL3 A;  5EXO A;  2E9Q A;  4NE9 A;  5GLZ A;  2KXL A;  5JMC A;  2RS3 2;  3W59 A;  4ISR A;  4RFT 0;  1VRH 3;  2CNA A;  1MZE A;  2F4L A;  2VQA A;  4FFG A;  3K75 B;  3WUC A;  2QDR A;  1RUG 3;  2KD7 A;  3ZYF A;  1MZ5 A;  2ZAB A;  1HRV 2;  2DUO A;  3GZA A;  3AC0 A;  2Q8C A;  3JBG 1;  2UWB A;  5GLU A;  3SC7 X;  2K46 A;  2K2S A;  3X29 B;  2ZAC A;  1GIC A;  4L11 A;  2YGL A;  1W2T A;  2SLI A;  1VAV A;  4P9X A;  4QPI B;  5FLH A;  5JLV A;  1OBN A;  1OH3 A;  2FMY A;  2Y6G A;  3EYP A;  5FKB A;  3H8X A;  2VJX A;  1ZBA 2;  2JDH A;  1BQP A;  3KVA A;  5KHJ A;  4KG0 A;  1GP4 A;  3KD4 A;  2OVU A;  3I3Q A;  2FDK A;  1SPP A;  2CHH A;  3Q8B A;  4CDW A;  2P3K A;  4OHX A;  2R7E B;  1C28 A;  2HJI A;  2J7M A;  4N53 B;  2RHP A;  2OYZ A;  5BNP B;  2CY6 A;  3CL1 A;  1FMD 2;  1Y9Q A;  2HH9 A;  3QD6 A;  2RR1 2;  1AR9 1;  1BMV 1;  5ISL A;  2WC2 A;  2ZS6 B;  1T6B X;  2PQQ A;  2CU5 A;  4UFL A;  1CAV B;  4OMD A;  5GLW A;  4NIG A;  4FFI A;  3SNM A;  1LHW A;  2WS9 3;  5FY5 A;  1AR8 1;  1HLC A;  1OFN A;  2IWG B;  3MHZ A;  4N7I A;  5FK8 A;  3VZL A;  5BYN A;  5I91 A;  2RS3 3;  2VOK A;  3ETP A;  3FWE A;  2WA4 A;  3TOJ A;  3PME A;  2WNV A;  1UPI A;  3AFK A;  1MS8 A;  4IE7 A;  5C3R A;  1UU4 A;  4P00 B;  4AXO A;  3T4H B;  1N3O A;  1SDW A;  4HL0 A;  1GFF 2;  1FNY A;  3N9O A;  3EQE A;  1VPH A;  4LLF A;  3G6J B;  4Q5O A;  3I97 A;  1LOG A;  2JD4 A;  1GNY A;  4QPY A;  4ZU5 A;  5HXV A;  2AEZ A;  3ZOI A;  3U4X A;  4YZ4 A;  2VW0 A;  1PIV 2;  1K3I A;  2JDA A;  2HWD 2;  4YG3 A;  4LLO A;  2HBU A;  4IEX A;  3N7M A;  1NY7 2;  4JKK A;  5A1L A;  1H4H A;  3GM8 A;  1OXC A;  1RUI 3;  1YC6 1;  4LBM A;  2A70 A;  1AYM 3;  1SLI A;  4GB3 3;  5E6H A;  3GGL A;  1DZT A;  3JZV A;  3KQR A;  5A7O A;  2HWD 1;  1QH7 A;  2XJU A;  1TME 3;  3V0B A;  5LBB A;  2JIJ A;  1F15 A;  3F2Z A;  3H3Z A;  4N53 A;  5FMB A;  2ZBJ A;  2PQS A;  2HWF 2;  4AFC A;  3HMY A;  2WBK A;  5T5O A;  4JX0 A;  5ABJ B;  5BXX A;  3MGU A;  2RMU 3;  1ODM A;  3ALQ A;  3KT1 A;  5CU1 A;  2UWA A;  4XUP A;  4B3N A;  4YM3 A;  3H7Y A;  2W1S A;  4IV1 C;  5I8T A;  2I74 A;  1LHO A;  4PIZ A;  4NAM A;  4RR3 B;  4Y1Z A;  5BNO C;  4Z2A A;  1QY4 A;  2W47 A;  3OPW A;  2PHX A;  1T2X A;  1YI7 A;  5F5C A;  1RMU 3;  1EAH 3;  3K3O A;  4BJ0 A;  3SIS A;  3MDP A;  1EYB A;  3IKW A;  1PO1 1;  5F2W A;  3WNL A;  5DAQ A;  1H0B A;  4RS5 B;  1BCX A;  4L99 A;  3S57 A;  2BV4 A;  2XJR A;  2JKX A;  5KBF A;  4E2S A;  1Q43 A;  4MGT A;  1HRI 3;  5I0D A;  3PVO A;  1AR7 2;  1QJY 3;  2XGX A;  1PO1 2;  2D5F A;  2J1U A;  2Y38 A;  5D2A A;  4AVT A;  4D6S A;  3NST A;  2W3J A;  2OA2 A;  2RV9 A;  5KHG A;  1QKQ A;  1V0A A;  1WLC A;  5IVV A;  4GMP 0;  2BFU L;  4YPJ A;  2BP6 A;  1AX0 A;  1WBF A;  2VCC A;  3ACL A;  3IM0 A;  1D4M 3;  3D3A A;  2PLV 3;  5LK5 A;  3J7H A;  1E5I A;  4FXK B;  4ERO A;  2DFB A;  1XPW A;  4Q4Y 3;  1YFU A;  1MZF A;  4LUK A;  4LO5 B;  1JYV A;  2UY9 A;  1XB9 A;  3LCP A;  3SKJ E;  3I59 B;  2HWF 3;  3HN1 A;  4IET A;  4NPL A;  2ZZJ A;  2RM2 2;  4AW7 A;  1VBC 2;  2GAL A;  2QTW B;  1KDK A;  4JRL A;  5L7O A;  2E7A A;  2QZ3 A;  5LZ6 A;  4QXK A;  5F5Q A;  4AFB A;  2Y26 A;  3VBH B;  4QXH A;  4ATE A;  3THC A;  3WVJ A;  1SLL A;  4CVU A;  1N3P A;  4GWN A;  4EE2 A;  2RM2 1;  3RZK A;  2FMD A;  4YW2 A;  2YU2 A;  2B46 X;  4UW3 A;  3O1V A;  4QQO A;  4E2Q A;  2O14 A;  1UKR A;  5F3E A;  4DEV A;  2VVD A;  3MIG A;  2QQU A;  2J1R A;  3BAL A;  4W4Z A;  3Q8A A;  5IJR A;  3AXE A;  3HQU A;  2BW8 A;  3JCI A;  5FYH A;  5CZK A;  3NL1 A;  3FBY A;  4PHZ A;  3B94 A;  4LJH A;  3M3C A;  1HB2 A;  1UQX A;  2NZ9 A;  3ZXK A;  1ND3 C;  3RDI A;  3O1P A;  2DDU A;  4Z2W A;  2JKB A;  1UOB A;  1IG0 A;  3RYK A;  1POV 3;  4XIL A;  2QVS B;  3KV6 A;  3WD5 A;  3ZIW A;  3OSD A;  3WR0 A;  2MEV 3;  2WZR 1;  2OKX A;  2XLG A;  2P34 A;  3FLT A;  4HG6 B;  3T1L A;  2DTY A;  4XQ4 A;  4CDU C;  4MOA A;  5FRA A;  3POJ A;  3K48 A;  5FZA A;  2FDG A;  3ST7 A;  1PM7 A;  1X36 A;  1ONA A;  2PLV 2;  4Q0V A;  1NT0 A;  5KHK A;  4SBV A;  5CKN A;  1GUI A;  1RGS A;  3HNB M;  3IDC B;  1H9W A;  3W20 A;  2VCB A;  2EXJ A;  4BQ2 A;  4LO7 A;  4IDZ A;  1O91 A;  1PGW 1;  3OGS A;  4LNV A;  1VBB 3;  4JHT A;  2HWB 1;  1LTE A;  2F17 A;  2MNG A;  4JQR A;  3TN9 1;  5AVA A;  2O8O A;  1DQ2 A;  4YVS A;  1IQD C;  4D7S A;  1DCS A;  5AC9 1;  1YIP A;  2W95 A;  1N1S A;  1RIR A;  2XVL A;  5LAT A;  2IC1 A;  4BIO A;  4BXS V;  2WZ8 A;  5L7O B;  4NIH A;  1SPP B;  4QQ2 A;  4CP0 A;  4I0A A;  1ZRD A;  1RUJ 2;  1WZX A;  1YFX A;  4AE2 A;  1UKG A;  1S0B A;  3H1W A;  4E9K A;  3RYP A;  3EMR A;  3I3M A;  5LBC A;  4NO4 A;  1QXJ A;  3KT4 A;  5FBZ A;  1AR8 2;  4IE5 A;  1XNK A;  5IVE A;  1BK1 A;  1CAV A;  3UGG A;  1JU3 A;  2G9G A;  1E5H A;  3FMG A;  3MFA A;  4OVE A;  4WVV A;  5FKC A;  5ABJ C;  5F3C A;  1EV1 2;  1QJU 1;  3JXS A;  3RZL A;  2ZHN A;  5AVP A;  4I09 A;  4YM0 A;  4XDQ A;  4E8D A;  3JD7 3;  1UMH A;  1S0D A;  1H8T C;  5FJH A;  1S2E A;  4RFR B;  1DYO A;  2BU9 A;  4JV4 A;  4UFI A;  1OQ1 A;  3MF9 A;  1HKD A;  4OQ9 A;  3PUR A;  4HXC A;  4KWL A;  1FAT A;  2WFF 3;  1QJU 2;  2WWJ A;  2X05 A;  5EV7 A;  1CAW B;  1BHG A;  2D7F A;  2XQX A;  4P9L A;  2X10 A;  5LK7 B;  4FPE A;  4LHL A;  1B35 B;  2ET7 A;  4Q1R A;  3VV1 A;  5EZW A;  1HQL A;  4YRD A;  2XXZ A;  2GND A;  3DGT A;  2GC2 A;  4ZXE A;  4TLG A;  1LNS A;  4OFG A;  1G9F A;  2WKK A;  3AL5 A;  1NA1 A;  2BBA A;  2PN5 A;  3K77 A;  3N7L A;  4XJA A;  4QX2 A;  2B7Y A;  1QXP A;  4B8E A;  2D6K A;  2XJQ A;  5H9Q A;  1RUH 1;  1UXZ A;  1COV 2;  5EJZ B;  4YW6 A;  2XBO 1;  3ZYG A;  3MW2 A;  1RUJ 3;  3AP7 A;  3PDQ A;  2ZGN A;  1C3H A;  4Z82 A;  3PVB B;  3WDV A;  4LBQ D;  2ORZ A;  4HOO A;  1LCL A;  5BUV A;  5JOX A;  3JB8 A;  1JOD A;  1DF0 A;  1LKN A;  2ZHM A;  3NNG A;  5LRR A;  3UJQ A;  2VNR A;  3K4D A;  3AKR A;  4GD4 A;  4XHX A;  2EXI A;  4CU9 A;  1CPN A;  1QWR A;  4JKM A;  4D7T A;  1HQN A;  1OH4 A;  4UBH A;  5FP8 A;  4RA0 A;  2RJL A;  3VBH C;  3LFM A;  4CXY A;  3WUD A;  2VGD A;  2VOW A;  3U4S A;  4N9I A;  2VVF A;  3KHB A;  3SHR A;  3V64 A;  3PJY A;  2Q0A A;  1FXZ A;  2ZMK A;  3I7D A;  1OI6 A;  4GMP 1;  4IEY A;  3VBF A;  5EP9 A;  1OUS A;  1RVF 1;  4BQ4 A;  3LIH A;  1W6O B;  4NVP A;  3KM5 A;  3BI3 A;  5JOW A;  3KLS A;  4FP3 A;  1NYW A;  1JXN A;  2MEV 1;  2VXJ A;  2WZR 3;  4BQ3 A;  4MG2 A;  3BCW A;  4DUX A;  2UU8 A;  4NHY A;  1IG3 A;  1LGB A;  2P6C A;  1W90 A;  2A1X A;  3AB0 A;  3J7N A;  5A32 B;  4AED A;  1YLL A;  2GNB A;  4CEY C;  2NP0 A;  1PK6 C;  5A3W A;  4FPO B;  1ACC A;  1PVC 3;  2XON A;  5C4W A;  1G9A A;  2NMN A;  4IV3 A;  4IEV A;  1V6K A;  2P3J A;  3USS A;  5FUN A;  2VEC A;  4BA6 A;  4XXA A;  1RUI 1;  3FL7 A;  2RVA A;  2XLA A;  1PO2 2;  2E26 A;  1PIV 3;  1AJK A;  3ZM8 A;  2D6O X;  5FPV A;  1CAU B;  3INA A;  3M3O A;  4CDX A;  4LK6 A;  3DEC A;  4PQ9 A;  2VNV A;  4GH4 A;  5BNP A;  1K5M B;  4E4Z A;  3RMY A;  5HPO A;  3IDB B;  1I5P A;  1FT9 A;  1RUI 2;  1U5Y A;  2JDN A;  1AYM 2;  1YNA A;  4GB3 2;  5LY1 A;  2Y60 A;  1WW5 A;  2W08 A;  3ZVX A;  1AR6 1;  1PO2 1;  4NUB A;  4OUE A;  3GZE A;  1W04 A;  3N3H A;  1W9W A;  3OUI A;  4CA9 A;  1UY0 A;  3ZN6 B;  1B09 A;  3VBO C;  1NA1 B;  1R09 1;  5CB7 A;  2BJS A;  3R4D B;  1S0J A;  4FO9 A;  3QH6 A;  3WQB A;  1G8W A;  1ASJ 1;  4CUC A;  2G1M A;  3TEY A;  1YWK A;  4XOG A;  3OOX A;  5FYI A;  1LEC A;  3WY6 A;  2PHD A;  1OUR A;  2Y0O A;  1MS5 A;  5FZ7 A;  2HEW F;  2WZR 2;  4XPV A;  2A6Y A;  4NPM A;  5FZM A;  1QJZ A;  3OF1 A;  1NX9 A;  5CG8 A;  2SBA A;  4P5Y A;  1KS4 A;  5BY5 A;  2OS2 A;  3POF A;  3N7K A;  4AI9 A;  1LHN A;  3WW3 A;  1JZ2 A;  3A0K A;  2VNG A;  4IUG A;  2EIE A;  2AAC A;  2R04 3;  3LD8 A;  2DVF A;  5FMO L;  1ULE A;  3POI A;  4CEY A;  1RUD 1;  3ZLI A;  5F8P A;  2QQN A;  3H7J A;  1CWP A;  4IEP A;  4AK3 A;  1BYH A;  4MZU A;  2RS1 1;  1XYN A;  1W9F A;  4CDU B;  2DUQ A;  5FMD A;  3WNO A;  2XH6 A;  4I30 A;  1GNH A;  3AKP A;  5FFO C;  3FJS A;  4QX7 A;  4DOU A;  2Z42 A;  1BEV 1;  3POS A;  4AAX A;  3VKO A;  4WVW A;  1TMF 2;  5FPU A;  4UW4 A;  3PIG A;  2FDF A;  4YM2 A;  5FPX A;  1V00 A;  4CCJ A;  1LGC A;  2V09 A;  1JI6 A;  4HVR A;  1VRB A;  4UAP A;  4L92 A;  5DUV A;  5FBJ A;  1XE7 A;  2NLR A;  3TEZ A;  3VL8 A;  5C5T A;  2IVI B;  1MQT A;  4EV0 A;  2PHL A;  3WW2 A;  2C9K A;  2UYB A;  5BPX A;  5FY9 A;  1ZZC A;  3I2F A;  4UW5 A;  4CDQ A;  1QXR A;  5C6C A;  1LED A;  4JAA A;  2XJS A;  4MYE A;  4I0W B;  4JQT A;  4TN7 A;  2DCT A;  2J1A A;  3N9L A;  5C9A A;  3T08 A;  3OD4 A;  3NAP C;  3BIW E;  4CP2 A;  2P17 A;  4LE4 A;  1A8M A;  3ZPO A;  2A73 B;  3UYJ A;  3VHP A;  1US2 A;  2DCY A;  3NV1 A;  4M3C E;  4QGL A;  3MPB A;  5JZG B;  3ZFF A;  2I45 A;  4DZG A;  2ARB A;  1AL2 1;  2DYC A;  4HK9 A;  4W8J A;  1Z78 A;  3M7A A;  2GMP A;  4CDU A;  5A3U A;  1N1T A;  1UF2 C;  4DRR A;  1JZ5 A;  3H8U A;  4RGA A;  2E53 A;  3OTF A;  1S1A A;  4FPY A;  4CCC A;  1ZBE 1;  2O1Q A;  2XL7 A;  3J4U H;  3PHM A;  2GP3 A;  1XC6 A;  2DCZ A;  3O14 A;  3MW4 A;  2ZGQ A;  1E5R A;  4AHZ A;  3VZN A;  4PF1 A;  3MBW A;  4AR2 A;  4CCE A;  2OZ6 A;  1OC1 A;  5A33 A;  2D6N A;  3GZU C;  3VKF C;  1XU1 A;  2LW8 A;  1I9R A;  2DFC A;  3AYC A;  2JDP A;  3NQH A;  5DQ0 A;  1Q8V A;  1BXH A;  4RS5 A;  5CVR A;  4AHY A;  1QU0 A;  3MPP G;  4XJW A;  4NIA A;  4XAC A;  5J3U A;  1OFS A;  3I3E A;  4CZS A;  4N43 A;  2FCV A;  3NNL A;  5DXD A;  1U0A A;  5IUQ A;  4FFH A;  4Z92 B;  1SBE A;  2Q8D A;  4CU6 A;  2C9A A;  2D3R A;  2D3P A;  3PIJ A;  1VB2 A;  2CL2 A;  4XZP A;  3WNN A;  3PUQ A;  4LKD A;  1QEX A;  2RJ2 A;  1YO8 A;  1W6N A;  2AC1 A;  1F35 A;  2GMM A;  4Q0Q A;  4W6X A;  3DV8 A;  4WVM B;  3OGJ A;  1TZO A;  4M0N A;  4XEZ A;  1UY1 A;  2CDP A;  5ACA 1;  5DDJ 1;  2C5D A;  1K5M A;  3THP A;  1ZRF A;  3HR9 A;  3ACF A;  2GNM A;  1Q8P A;  3WG2 A;  3IBM A;  3KB5 A;  1HDK A;  3KV9 A;  4NHK A;  2AGS A;  1MEC 2;  2WFF 2;  2DVA A;  4A2U A;  2Y6H A;  2JB8 A;  4LO4 B;  3PU3 A;  5FXZ A;  4CDQ B;  1KD7 A;  1QQP 2;  4XTP A;  3ZXA C;  4TZD A;  4CE8 A;  2HWE 1;  3H3L A;  4K20 A;  4NII A;  3T0D A;  4LE3 A;  3NV4 A;  2GP5 A;  1YXW A;  2Y6F A;  3N9P A;  4UF0 B;  1AYM 1;  4GB3 1;  5A6X A;  1RUE 1;  3A21 A;  2WSU A;  4AEM A;  4V2V A;  5FY0 A;  1XNT A;  3GJB A;  4BIS A;  3HWJ A;  2O0O A;  4IER A;  2YBK A;  4FAG A;  4BMB A;  1SFP A;  4LBK A;  5JPM B;  4YVW A;  3AP6 A;  4N90 A;  5A7P A;  4NHL A;  2Y6L A;  4XYX A;  4YNI A;  3ZFG C;  3ZFE B;  2WN2 A;  1VBA 2;  3ES1 A;  5JCT A;  1PK6 A;  1RHI 2;  3I3D A;  4N9H A;  5DG2 A;  5C4W C;  1W0P A;  3EB7 A;  4UYB A;  2TBV A;  1RYY A;  4GJZ A;  4K8F A;  2R16 A;  2WNV C;  2VUC A;  2QQL A;  4N53 C;  5FV3 A;  3VBU A;  3WOG A;  4EQV A;  3AK0 A;  3B69 A;  3GCW A;  4OI2 A;  2YC0 A;  3BTA A;  4MO3 M;  3LE0 A;  4RHV 1;  4F7Z A;  1S0G A;  4LIT A;  3A4U A;  3BTY A;  1MPX A;  1YHF A;  2OUJ A;  1NCQ C;  3I2G A;  3IMN A;  2GN3 A;  4Q26 A;  5DUW A;  5GM0 A;  3FLR A;  4DNY A;  1NG0 A;  4GH4 C;  5A1A A;  1R08 2;  3R0R A;  3J7L A;  2IXK A;  3DUI A;  5F2S A;  4LBN A;  4XDO A;  4ZS3 A;  4QMA A;  4S2H A;  4YG6 A;  2QCS B;  2ET1 A;  3H50 A;  3RG0 A;  1VAM A;  4MAD A;  5DN2 A;  2PHU A;  1VAL A;  1PGL 1;  4Q4V 1;  4AEJ A;  1V6J A;  1WW7 A;  4KMQ A;  3ZYI B;  2EIB A;  2W2I A;  2JG9 C;  3CDZ B;  1AUY A;  4EN0 A;  3PNA A;  1GZW B;  1TQ5 A;  1AHS A;  2WT0 A;  4FI9 A;  1V9U 2;  2YUE A;  4MGS A;  2VMI A;  3MZH A;  1CAW A;  1O59 A;  4AHW A;  3K3N A;  1CJD A;  2JIG A;  3MO4 A;  4XBN A;  4R9C A;  3B93 A;  1DQ5 A;  4M3C F;  1WWY A;  5FK7 A;  2Z5W A;  1UZV A;  5I0S A;  3M8L A;  5A80 A;  3C7H A;  4YVW B;  4X6R B;  3RJR A;  1LR5 A;  3D4K A;  4IV1 A;  1PM4 A;  1RHI 3;  3U0Z A;  2JX9 A;  1VBD 2;  1CZT A;  4NWW A;  1NQD A;  3LWC A;  2P2K A;  3VBF C;  1X9T A;  4KU7 A;  1WBL A;  5EFU A;  4CDW C;  3MV1 1;  2GME A;  4WZF A;  3VBU B;  2RE9 A;  1MVE A;  3AP9 A;  3P3N A;  3QH7 A;  3ZYR A;  4ARY A;  3AKS A;  1TVG A;  3L2Y A;  5E88 A;  5BNQ A;  2W39 A;  1W2U A;  3POG A;  3WEZ A;  4LBQ A;  3WQ0 A;  1K12 A;  5F3I A;  2VUJ A;  4C90 A;  5FUI A;  2BRT A;  1SLC A;  3HIF A;  4TXW A;  4D69 A;  5LA1 A;  1AYN 1;  5KXD A;  3GBG A;  3B02 A;  4D94 A;  4QDS A;  3VGI A;  2BDR A;  5IAT A;  2WO3 A;  1TME 2;  3III A;  4HSL A;  3HEI A;  3SQO A;  2WDB A;  3WX5 A;  3RJ2 X;  5DZG A;  2ARE A;  1UNB A;  3MIB A;  2JDU A;  1AXY A;  1LEN A;  2ETE A;  3AJY A;  3NO8 A;  3VB9 A;  4H14 A;  4P9J A;  4LHK A;  1XYP A;  4UFK A;  2FCT A;  2Q1M A;  1Q8O A;  2DUP A;  1ULC A;  3EHK A;  3WP5 A;  1X7N A;  4ATF A;  2YFZ A;  1GZT A;  5JZG A;  1MQT B;  1NCR C;  1XQN A;  2J1S A;  5FZH A;  4MGK E;  4LKF A;  4P02 B;  2QDN A;  1OLM A;  4FCA A;  4XJZ A;  1QMJ A;  2VQ0 A;  2D40 A;  2ZCW A;  3SLI A;  3ZSJ A;  1JMU B;  2I07 B;  1AJO A;  1X8M A;  1XE8 A;  5L9R A;  1DGR A;  3MIF A;  2BWA A;  3KVB A;  4P9I A;  3NJY A;  4R9B A;  2RMU 1;  3M1H A;  4XVH A;  5K0U A;  2Z69 A;  2WII B;  3LA3 A;  3PU8 A;  4W50 A;  5KWR A;  4LUL A;  2WIN B;  3H1Y A;  1TMF 3;  3PVN A;  3ZFF C;  1GOF A;  1ULO A;  3W21 A;  1IPJ A;  1Q5O A;  5FYB A;  2XBO 3;  3RWK X;  3LEM A;  1RMU 1;  2ENR A;  3AX4 A;  3I2K A;  2CTV A;  2TUN A;  1HJG A;  3AZV A;  2B8M A;  3S7E A;  2D98 A;  4DIN B;  1DGL A;  4CP9 A;  3H0O A;  2D93 A;  3P3P A;  4IV1 B;  5K8S A;  5C8C B;  4Q4W 2;  5FYZ A;  4ET7 A;  2DBI A;  2H6B A;  4OYU A;  4OZX A;  5FZB A;  4FPF A;  4XJ8 A;  4MXW A;  1C5I A;  1VBC 3;  2VME A;  3BN6 A;  5FPB A;  4Y4R A;  2W52 A;  4P5H A;  4HK8 A;  2JE9 A;  4GH4 B;  4LBO A;  4D7Y A;  2XKP A;  2R32 A;  4TSV A;  4DPN A;  5I0U A;  1SDD B;  3F95 A;  3O0W A;  4QHB A;  4MLO A;  5FJK A;  3KHC A;  4OUL A;  1VMH A;  3MIC A;  3WZ1 A;  1SQ4 A;  3T2O A;  1RUE 2;  5L9B A;  2ZHK A;  3OYW B;  1IS5 A;  4GWM A;  1KXG A;  1IPK A;  1UYZ A;  4NMI A;  1ZVF A;  5IVC A;  5JAX A;  4RQP B;  3PTY A;  4QPG C;  5D8A A;  4L2N A;  1FAY A;  1LOF A;  5CFD A;  1LOE A;  2A6W A;  1G9C A;  4UFJ A;  5FMO S;  1O4T A;  1OD3 A;  4MGQ A;  4CU7 A;  4AI2 A;  5A70 A;  1J3R A;  3JBG 3;  2QQV A;  3Q8C A;  4IW3 A;  4XFB A;  5C3S A;  4LXL A;  4FOW A;  1X82 A;  4LBJ A;  1SBD A;  5JSP A;  1HV1 A;  3O0V A;  1J3P A;  3ZSL A;  1VR3 A;  1X8E A;  2XBO 2;  2XUM A;  1H2L A;  3AP5 A;  3DF0 A;  1QNY A;  4RHV 2;  3CZJ A;  3AZZ A;  4QX1 A;  4AAP A;  1WLT A;  2JG8 A;  3WNM A;  5FLI A;  5A7Q A;  2XVG A;  4H7M A;  1GV9 A;  1LOA A;  4EN7 B;  2HWF 1;  3AYE A;  3WNP A;  2L9L A;  3ZXE A;  2VMC A;  1SG3 A;  2ZXQ A;  4WM8 C;  3VKL A;  1CON A;  2GC3 A;  3FZ3 A;  5KXB A;  4Y1X A;  1WCD J;  1PGL 2;  1WLW A;  1YYN A;  3M4F A;  1XNC A;  1TNR A;  2JEM A;  4IXL A;  1JN2 P;  4LMF A;  4ISQ A;  1BMV 2;  2FZ1 A;  2W1U A;  5IFT A;  5LA2 A;  2BNO A;  4XQD A;  3T3Y A;  1RJ8 A;  4Q4X 2;  1JYC A;  4XJ9 A;  3WQ7 A;  5T52 A;  4TYS A;  2Y34 A;  4QX5 A;  2XWB B;  2VBB A;  3D82 A;  1QF3 A;  1UOJ A;  4PLN A;  4CUB A;  1AR8 3;  5IVJ A;  1ZRR A;  2JDZ A;  2RDS A;  4HPK A;  5D1I A;  4EN8 B;  5IT6 A;  2XLF A;  3J8F 1;  1X9P A;  2BGO A;  1SMV A;  5EPA A;  3ZIX A;  1OLQ A;  4LBL A;  5JMO A;  1A8D A;  1ZZ8 A;  3POY A;  4Y5Z 0;  4X8P A;  1CVN A;  4MX3 A;  1FPN 1;  1FX5 A;  4M01 A;  1O4Z A;  2EXK A;  3ZKU A;  3ZDS A;  3ZKY A;  4BPZ A;  4CCN A;  2R07 3;  2DCJ A;  1ZYB A;  5JUV A;  2G19 A;  3ZYP A;  1GSL A;  3LSD A;  5JPN B;  5KXE A;  3VBR C;  1HX6 A;  2OW4 A;  5LEK A;  5HBA A;  1WME A;  1OA4 A;  3VDA A;  5C3Q A;  3PUI A;  2IUW A;  4RQP A;  3ZFG B;  4L97 A;  4JC1 A;  3DYM A;  4LKE A;  4R8H A;  3ZXD A;  1ULD A;  5EJ1 B;  4QQH A;  5FZL A;  3C7E A;  5IK4 A;  3ON7 A;  2HBT A;  4XF0 A;  2WFP A;  4QKB A;  2ZGL A;  2LRP A;  2XHK A;  1TME 1;  2ZGR A;  4XFG A;  4JGY C;  3B01 A;  2D5H A;  2RS3 1;  2F6B A;  2NMO A;  4I02 A;  2YV8 A;  4QPW A;  4W65 A;  4XFC A;  4A45 A;  4YZ2 A;  1COV 3;  1W05 A;  3EJK A;  3JB4 C;  1GLH A;  3D8C A;  3SCG A;  2VZ1 A;  4ASK A;  1H9P A;  3NV2 A;  1NZC A;  3CEW A;  3K4A A;  5FLJ A;  1VB4 A;  5APA A;  4ORF A;  3WDT A;  1NLQ A;  5J09 A;  3PUA A;  3ETQ A;  2CGP A;  2EAK A;  3Q9O A;  4UBG A;  1UMZ A;  3ZN5 A;  2WWS A;  4I3P A;  1GQP A;  1FOD 3;  1NCQ B;  3J26 N;  3HD8 B;  4Y20 A;  1GNZ A;  1KS5 A;  1PZ8 A;  4YYO A;  1DQ4 A;  3LOB A;  1UZZ A;  3OY8 B;  4F8A A;  4KQ7 A;  1OA3 A;  1VBE 3;  2CAU A;  3URF A;  1RUD 2;  1SCR A;  1ZBA 1;  4K40 A;  3W9A A;  3H8O A;  2VO5 A;  1UZW A;  4TWT A;  3LSE A;  4F83 A;  1G7Y A;  3P5B A;  1FYU A;  1A78 A;  1UO9 A;  3TEX A;  3CO2 A;  3WP4 A;  4FTB A;  3UKV A;  2W94 A;  2ZX4 A;  4EWD A;  1LHU A;  3ATG A;  1UY3 A;  2ZGO A;  1VAK A;  2XJT A;  2CDO A;  1POQ A;  3E5Q A;  3VBF B;  1VRH 2;  4AQT A;  2PTM A;  1F31 A;  1J1L A;  4BQW A;  1W3V A;  2V5D A;  3CQO A;  2JB4 A;  1JHN A;  2E32 A;  2H0V A;  1VBD 3;  1TE1 B;  2VTX J;  3T2Q A;  3WDY A;  4AED B;  1DQ1 A;  2CYF A;  2VZV A;  4I3G A;  5A32 A;  5F6L B;  2W68 A;  3ZYJ B;  3W5N A;  3IN9 A;  4S2F A;  5C8C A;  2Y33 A;  1RL3 A;  4XJU A;  3ES4 A;  1OKQ A;  5E89 A;  2CAV A;  1YQC A;  3RZJ A;  1A34 A;  1DIW A;  4QB6 A;  4YW4 A;  5CFC A;  2EAL A;  2AR6 A;  4YGB A;  3BU0 A;  3ME2 A;  1UPS A;  5BNP C;  5FP9 A;  2ZEW A;  2W87 A;  4AVV A;  5LA0 A;  1O3Q A;  4QU1 A;  1UZY A;  4FPL A;  3VBS A;  2WNU A;  5EQU A;  1QJY 1;  4NAO A;  4HN1 A;  4RSU A;  1HXS 2;  5FXW A;  5FZO A;  3ZSK A;  4QX8 A;  3HPN A;  1N47 A;  5CAD A;  1QDC A;  3ZMO A;  4CXX A;  1H8T A;  3J8F 3;  3ZFE A;  3VHO A;  3VZK A;  2E7T A;  1RIT A;  3M3Q A;  3MF6 A;  4WM7 B;  4LK7 A;  1LU2 A;  4MXV A;  4Q4Y 1;  3FHI B;  2ID4 A;  3GZT B;  2CWS A;  4N7U A;  3ABZ A;  4BQX A;  1JW6 A;  4O9G A;  5J96 B;  3NVC A;  4HMZ A;  1UW8 A;  4DRV A;  3Q8E A;  1UIJ A;  1O5L A;  3E6C C;  1K5M C;  3LAG A;  3S30 A;  4AI0 A;  3H9A A;  2YPD A;  3MLK A;  4FBF A;  1KRI A;  3U10 A;  5HV0 A;  3HVD A;  1RUF 1;  4GKX A;  2HLE A;  5DG1 A;  4OLL A;  2ZX1 A;  4A42 A;  5KR7 A;  2ZJC A;  2JDM A;  4FOQ A;  4N43 B;  2HWD 3;  1WCU A;  3AM2 A;  5B2G B;  1X33 A;  1QOT A;  1W8H A;  5HV4 A;  3J9S A;  3GF6 A;  3KMH A;  2WN3 A;  3AYD A;  3R4S A;  3FHQ A;  4G3Y C;  2AUY A;  3W58 A;  1XYO A;  2UWC A;  3IAQ A;  2VUL A;  5FDB A;  4C1X A;  4M3C A;  4NHM A;  1W2N A;  5FZ8 A;  1K45 A;  2C4X A;  3JQW A;  2R0H A;  1W6N B;  1R1A 2;  3WHT A;  1W28 A;  4WBB A;  2X5I B;  4Y33 A;  4Y5S A;  3RVH A;  1QJX 1;  4A7Y A;  4BZ4 A;  2QQO A;  2H6C A;  1LOD A;  1UYY A;  1WUV A;  3BPZ A;  1ZRC A;  1H8T B;  5F5A A;  1XU2 A;  3WQ1 A;  2OUH A;  2ARX A;  5DDJ 2;  3ZYH A;  4BQY A;  5KC6 A;  4HPK B;  5A7W A;  3BUC A;  3PLQ A;  4LA2 A;  1Q8S A;  2VL4 A;  4NWV A;  1NUK A;  1EPW A;  2GC1 A;  5G05 L;  2JEN A;  3C7F A;  4H7L A;  5ANN A;  5GLV A;  2ZOE B;  1NE4 A;  1RTV A;  2YMZ A;  4HZF A;  4IQP A;  1RED A;  2HWE 2;  2EID A;  2C1F A;  2A6V A;  2WLP A;  4E4D X;  5LEJ A;  3BIE A;  1LOF C;  1VJ2 A;  5CFD C;  4MVT A;  4IV3 C;  2QQW A;  2ZKL A;  4YGE A;  1UOF A;  1CN1 A;  4XQW A;  4R4Z A;  2FDH A;  4KGQ A;  1J84 A;  3K2O A;  2JIC A;  2PXJ A;  3KQ4 B;  5KHH A;  1HRI 2;  1AXK A;  1AR7 3;  1W99 A;  1WCS A;  3R05 A;  4GAZ A;  4KH9 A;  4MH0 E;  5L73 A;  3UET A;  2WT1 A;  3NMB A;  4D3W A;  4D6Q A;  2WZP P;  1HB3 A;  4YVW C;  5LRS A;  4OUM A;  1PNF A;  1PVX A;  2Z2S B;  3A22 A;  3NKT A;  4XUT A;  5AFB A;  3FFZ A;  5GAL A;  5C3P A;  1R09 2;  3WDW A;  3O1R A;  4YW3 A;  3H3U A;  2G9F A;  3VDD B;  4QU2 A;  4Y22 B;  1ND2 C;  2W0X A;  4FVV A;  5FO8 B;  4LT5 A;  2PYT A;  2ZEY A;  3IMM A;  2RM2 3;  5FXV A;  5J1X A;  3QCW A;  5CIS A;  5HXM A;  1OMI A;  3I59 A;  4PBP A;  4M0H A;  4BOW A;  3LEI A;  3NNM A;  2EA7 A;  4XFI A;  2HWC 1;  4XE9 A;  4YZ3 A;  4HLT A;  4ASL A;  2GU9 A;  4MSV A;  1PGW 2;  5I0R A;  2NM1 A;  1N1V A;  2A6Z A;  4HT1 T;  5JWP A;  4RR3 C;  1AR9 2; 
#chains in the Genus database with same CATH homology
 2OS2 A;  3KV9 A;  3PUR A;  4GJY A;  5FPL A;  5FXX A;  4AI9 A;  4URA A;  5F37 A;  5LW9 A;  2OT7 A;  3PUS A;  2WWJ A;  2WWU A;  4QXC A;  3LD8 A;  5IVJ A;  3PU3 A;  5FXZ A;  3DXT A;  3ZLI A;  5FZH A;  4DIQ A;  2XUE A;  2GP5 A;  4Y3O A;  3N9P A;  4D6S A;  5ANQ A;  2XXZ A;  4UF0 B;  5FY7 A;  5K4L A;  4CCL A;  5IVV A;  5A3P A;  3AL5 A;  4CCN A;  2Q8C A;  4V2V A;  5FP4 A;  5FY0 A;  4BIS A;  4QX7 A;  3KVB A;  3NJY A;  2YBK A;  2YPD A;  5LWB A;  3OPT A;  3PU8 A;  3LDB A;  5FYY A;  5IVY A;  5A7P A;  5FPU A;  4IGP A;  3PDQ A;  3AVS A;  5KR7 A;  4CCJ A;  2OQ6 A;  5FZE A;  4HOO A;  5F2W A;  1VRB A;  3KVA A;  5FYB A;  5FBJ A;  5FYT A;  5FZL A;  4GD4 A;  4QWN A;  4GJZ A;  5FV3 A;  5F32 A;  4QXH A;  4IGO A;  5FP8 A;  5FZ8 A;  5A1F A;  5FY9 A;  4EZH A;  4BU2 A;  2XML A;  4CCO A;  2YU2 A;  4LIT A;  3U4S A;  4Y33 A;  4EYU A;  5F3E A;  5IVB A;  4TN7 A;  2P5B A;  5FYZ A;  3RVH A;  4ASK A;  3N9L A;  3DXU A;  5FZD A;  5FZB A;  5ISL A;  5FYH A;  4LIV A;  5FP3 A;  5FZO B;  2OX0 A;  3PUA A;  5FPB A;  4Y4R A;  5F5A A;  5LY2 A;  4XDO A;  5FZG A;  3ZPO A;  5FY5 A;  5FZ3 A;  3UYJ A;  4DO0 A;  5A7N A;  5A7W A;  4BXF A;  3AVR A;  5FZI A;  5FJK A;  4XDP A;  3KV6 A;  5FUP A;  4E4H A;  2VD7 A;  2YBS A;  2W2I A;  4CSW A;  5FYU A;  5A3T A;  5IVC A;  5IWF A;  5A3W A;  5FZ4 A;  3N9N A;  5FYM A;  3N9O A;  5FY4 A;  5FZA A;  5FUN A;  5FYS A;  3KV5 A;  3K3N A;  3KV4 A;  4CCM A;  5CEH A;  2GP3 A;  5FP7 A;  5FYC A;  5FPV A;  5FY1 A;  4IGQ A;  5A1L A;  5FZ1 A;  3K2O A;  4CUG A;  2PXJ A;  5A80 A;  4LXL A;  4GAZ A;  5E6H A;  5FZ0 A;  5FZ6 A;  5LY1 A;  4V2W A;  5FZ9 A;  5FZK A;  2Q8E A;  3N9Q A;  4D6Q A;  5F5I A;  4D6R A;  5A7O A;  5A7S A;  4NUB A;  4CCK A;  5FWJ A;  5FZC A;  4AAP A;  4UF0 A;  5IVF A;  5A7Q A;  5FZF A;  4HON A;  5F39 A;  5F3G A;  2Q8D A;  4C8D A;  5IVE A;  5IW0 A;  2OQ7 A;  2XDV A;  5F3I A;  5FPA A;  3PUQ A;  4QXB A;  3N9M A;  5FYI A;  5FXV A;  5FP9 A;  5FWE A;  5F3C A;  4QU1 A;  3U78 A;  5F2S A;  5A7W B;  3AL6 A;  5FYV A;  5FY8 A;  5FZ7 A;  4LIU A;  2YBP A;  4EZ4 A;  3OPW A;  5FZM A;  5F5C A;  3K3O A;  2YU1 A;  5FXW A;  5FJH A;  5FZO A;  4QX8 A;  5A3N A;  3PTR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...