5FYBA

Crystal structure of the catalytic domain of human jarid1b in complex with mc1648
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
462
structure length
455
Chain Sequence
b'SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKLRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B, LYSINE-SPECIFIC DEMETHYLASE
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with Mc1648
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 146
structure length 455
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fybA01
4DO0A 4ASKA 5FPBA 5A7NA 4HONA 2YBKA 5FZIA 5FPUA 5FZ9A 2PXJA 4GJYA 3U4SA 4QU1A 5FYIA 5FYHA 5FZCA 5IVBA 3KV9A 4QX7A 4IGPA 5FYSA 5FZHA 5IVVA 4UF0A 5IVJA 5IVFA 5FYVA 3LD8A 4QXBA 5LW9A 4CCJA 5F37A 5ISLA 5F5AA 5FY5A 5A7PA 5F39A 4D6RA 5FYBA 5A7SA 3PDQA 5F3EA 5FUPA 5FZ8A 5A3WA 5FPAA 5FYTA 5F5CA 4CCLA 2XDVA 4IGOA 3U78A 1VRBA 3ZLIA 4AAPA 4V2WA 5FXZA 5FZFA 5IVYA 5FZ4A 2Q8DA 5FY8A 5FPLA 4UF0B 5F2WA 4C8DA 2GP3A 5FY7A 4CSWA 4Y3OA 5FZOB 5FBJA 5FJKA 2OS2A 5FJHA 5FZ1A 5F32A 4Y4RA 5FZKA 5FP8A 4QXHA 3PTRB 4Y33A 3AL5A 5FXVA 5A3PA 5KR7A 3KV4A 4BISA 2XUEA 3AVSA 5FY9A 4EYUA 3AL6A 5FZ7A 3PURA 3RVHA 4CCNA 5LWBA 4IGQA 2GP5A 4QWNA 3K2OA 5FZEA 3N9MA 4GAZA 2W2IA 5FY0A 5FZAA 3ZPOA 5F3IA 2OQ6A 3OPTA 5FUNA 5FYZA 5A3TA 3DXTA 5FYCA 2XMLA 4CCOA 4V2VA 2Q8EA 4TN7A 3LDBA 4QXCA 2OT7A 5FPVA 3K3NA 2Q8CA 4D6QA 4GJZA 3PU8A 4HOOA 5FP7A 4DIQA 3PU3A 3UYJA 4CCKA 5A7QA 5A7WA 2WWJA 2YPDA 5FY4A 5FZBA 3N9NA 5A7OA 2OQ7A 3N9QA 3KVBA 4LIUA 5F5IA 3PUAA 2VD7A 3OPWA 4GD4A 5FZ3A 5K4LA 4NUBA 4XDPA 4E4HA 4QX8A 3KV6A 5LY2A 5A1FA 5FP4A 5FY1A 5F3GA 2YU2A 4CUGA 5FXWA 5IVCA 5FWEA 2P5BA 3N9PA 3N9OA 5FP3A 4BU2A 5FZGA 4AI9A 4D6SA 5A1LA 3N9LA 4LXLA 3PUQA 5IWFA 5IW0A 5FYYA 5A80A 4EZHA 5FZOA 4CCMA 5FZ0A 5FZDA 5A7WB 4LIVA 5ANQA 5FXXA 5FYMA 3PUSA 2YBSA 2WWUA 3AVRA 2XXZA 3DXUA 2YU1A 5CEHA 5F2SA 3NJYA 5FZLA 5FYUA 4URAA 3KVAA 2YBPA 3KV5A 4LITA 5A3NA 4BXFA 5F3CA 5LY1A 3K3OA 5FV3A 5E6HA 5FZMA 5FWJA 4EZ4A 2OX0A 5IVEA 5FZ6A 5FP9A 4XDOA
chains in the Genus database with same CATH superfamily
2VR4A 4JQRA 1MZFA 1POV0 2BVBA 3ILFA 4RYDA 2HLEA 2R16A 3T30A 1RINA 5IK7A 1U0AA 2CHHA 3IZOA 3WDWA 3LSDA 1XSQA 1WMXA 3JB4C 4TTGA 1W8OA 1H2NA 3ZYRA 4MYEA 2B9VA 4AVAA 3WQ7A 4BQYA 5JDBA 3GZTB 5GLUA 2ZEZA 1JZ7A 2F4PA 2LM3A 2BOJA 1VAVA 4YZ2A 5JIAA 1UPSA 4LBQA 1NZCA 5LASA 2FDKA 3MDPA 2R1DA 3D3AA 3KF3A 4OUMA 2GAUA 3DN7A 4BMBA 1MS4A 2NN8A 2VPVA 2OXBA 1HB3A 3S5AA 3ZPYA 4GWJA 1S4CA 1NZIA 4LOSA 2QNKA 5JXJA 5DZGA 2SLIA 2IXHA 3JBG2 1PMJX 2VGDA 3FJSA 5FY8A 4W6YA 1ZBA1 2XJRA 3MIEA 4K8RB 2FDFA 1NA1B 3GYDA 3SH3A 4Q0SA 4FOVA 4XPVA 1PIV3 1UNBA 1VAKA 2V4AA 5C7GA 3AX4A 4R9DA 4DZGA 1R64A 3TNQA 1L7RA 1JODA 1ENRA 4PDWC 3NW4A 2PHRA 2PQQA 2AGSA 3GCWA 4AEDA 4OMCA 4EYUA 2FCVA 2HWF1 4S2DA 2P6CA 1OI6A 5T55A 4D7TA 3PTYA 3QD6A 4ZHNA 2A3WA 2R073 3V0AB 3VBOB 4M00A 2TUNA 5AVAA 1Q3EA 1REDA 1DGRA 2IXKA 2WLQA 4K9SA 4C0BA 1B09A 3HJRA 1HXS2 3B00A 1XJAA 1FV2A 1WLDA 1FOD3 2VBDA 3A0KA 5ABJB 3NWKA 4RS5A 1BMV1 5AC92 5FYCA 1VIWB 4E2GA 2HEVF 1JI6A 4UFKA 4XCBA 2LROA 3WCRA 4KU8A 4D6QA 3S7EA 1JZ8A 1Y7BA 3POSA 1YFYA 4HOOA 4RHV1 1W04A 3DYPA 4Q0QA 2DUOA 4F7ZA 2JX9A 5BNPA 1ASJ3 3UL2A 2IVJA 5BYNA 1VMHA 4LHKA 3ELNA 4M01A 1I5PA 5A6ZA 2EXKA 5JR2A 1S1AA 1HQLA 1XRUA 4Q4W1 1YFXA 3W5MA 4XFCA 5CFDB 4PQQA 4YZ5A 1OH4A 2D6NA 4CCDA 5CADA 3CHXA 4UW5A 5T5PA 5DUWA 2IC1A 2QQVA 1VBB2 4BQ5A 1QDOA 2OZJA 3MO4A 1AL22 4Q4V2 5F3GA 2YU2A 3OD0A 5C8CA 5HXMA 3OJBA 3VBUC 5IJRA 3ACGA 2V4VA 4BQWA 5FZGA 1KJRA 3TEWA 2FDGA 2VBPA 1SLBA 1QJU3 4GMP3 3LOBA 3AKTA 4CCEA 4IV1C 4MHUA 1JHJA 4XJAA 4DEQA 2WRAA 2RHPA 3I97A 4J1XA 3W59A 3VHOA 1MR5A 1LHVA 2VMCA 3USUA 2HWE2 3WXPA 1RUC2 1W9SA 2OPWA 3VKMA 4AHZA 4XUNA 4LITA 2K0GA 4Q29A 2IFWA 2JB4A 1LGBA 5GALA 3GDBA 3HVDA 4EZ4A 2QQWA 3NJZA 4LBMA 3NAPB 5F5QA 1MQTC 1PO23 3H50A 4KL1A 4DO0A 5LA1A 3VBSA 2E6VA 2A6VA 3LIHA 5FPUA 2CWMA 1LOFC 5C5UA 2EXHA 3POFA 5IAVA 2CGNA 1GUIA 2DBNA 4FP3A 5FZHA 2B7YA 4QHZA 2JG8B 4CUBA 4K1ZA 4YNIA 2R0FA 3HNYM 1UIKA 1S0BA 2XUMA 3H3UA 4LBOA 1D4M3 3AKQA 4YW5A 2UU8A 4LE4A 3WHTA 3WY6A 5GZGA 1RGSA 5ISLA 4ORFA 4Q4Y2 3OYWA 3H9AA 1H1AA 2RDNA 4YPJA 4CDUC 2D44A 2BWCA 5DABA 4JGYA 2P34A 1SBDA 1NX9A 3J4UH 3OTFA 4FPHA 1RJ7A 4X8PA 1W8TA 5EQUA 4AE2A 1CAVB 1TME3 3AYEA 1XYPA 2VU9A 1S0DA 1U12A 2WNUB 2XKPA 3O7OA 3ZM8A 1OH3A 5C4WA 2B4KA 1BBT3 2C5DA 2X5IC 4UF0B 2WS92 3BOWA 3M3QA 5K9YA 1JYXA 3ZDVA 3PMSA 2DF7A 4MLOA 1QJY3 4BLJA 2Z4FA 1MVEA 5I91A 2ZJCA 1AR81 2BTVC 1OSGA 5FTTC 4LHLA 3MW4A 5FXVA 2PHUA 3BTXA 4TWTA 1LAJA 4AEMA 4I3PA 3K48A 1F5FA 3AZVA 4AQ2A 3X29B 1ZYBA 3N3HA 5HV4A 4XMAA 3VZOA 5BNOA 3KLSA 4W65A 5KHKA 3PURA 4FBFA 3AZWA 3WF0A 1XC6A 3ZYBA 4DRRA 3N4MA 5TSWA 1US3A 3ACLA 2RS51 2P1BA 3ETPA 3M1HA 2Z69A 4RD7A 4CDQC 5DMYA 3D4KA 1PK6B 2ORZA 3VDCA 2GU9A 4CU8A 2JE8A 4Q27A 5T3NA 1YHFA 1WCKA 4MZUA 5A3TA 1DP0A 2VW2A 2ZPXA 3L2YA 3MZHA 1H8TB 4WBBA 5DUUA 2R061 4V2VA 3GALA 1I6XA 3H1YA 1DF0A 1UY2A 1GU3A 3CJIC 1CZSA 3BTAA 3OBAA 1SPPA 4R9BA 5IT6A 3QCWA 4NIDA 5JLVA 3WVJA 4IERA 5FY4A 5FZBA 4AXOA 1ULGA 4QPYA 3IMNA 5JAXA 2D97A 1BEV2 5F5IA 1JYCA 4GD4A 3S0MA 4QQ2A 5K4LA 3UV9A 4N53A 3T08A 4YW4A 1EAH3 1OQEA 2AEYA 4ZY9A 1EPWA 4QD2A 2VOTA 1OA2A 2ZMNA 5F8PA 1NXMA 5GJ6A 3BYWA 3PJYA 3RDIA 1ENXA 1TVGA 3W58A 4KWUA 4AI9A 4E4ZA 4QXKA 1AR72 5IW0A 1LOBA 5A80A 2J1TA 3T1LA 1KFUL 1W9WA 4U36A 3VKLA 4PF1A 2P3IA 3A22A 3POIA 3IKWA 4WM7B 1UY4A 2EIDA 3UNPA 1DQ5A 1HB1A 1WLCA 2YC2A 3WW3A 1ST8A 4NHYA 2W0XA 3ZO0B 5CFCB 1REFA 3H8UA 4LE3A 4BXFA 5CB7A 4GWMA 2C6SA 3R6SA 2PHFA 3B3QE 3VHRA 3V0AA 5J09A 4GMP0 2UYAA 1HRV3 2C0ZA 5L7OB 5BNNC 2RMU3 2DBIA 4FPLA 3E6DA 3O0WA 4IEVA 2BNOA 4HONA 4EWDA 2YMZA 4OMDA 3POWA 4IEZA 4QKDA 3WG1A 1COV2 2A70A 4P5YA 4M4PA 4H7MA 3ZXJA 3AZXA 1BVVA 4PBOA 1H4HA 2YXSA 3B9CA 4AI0A 1BCXA 2J22A 2OPKA 4FVVA 4P9IA 3LEKA 3RJ2X 1YQCA 4NJ4A 2E7AA 2Y6LA 4BHPA 4RQPB 2QQIA 1W8NA 3ZXKA 4BJ0A 5ACA3 1PO12 3JBG1 4XETA 3DGTA 1C1LA 1MS0A 4XF0A 1GP5A 3ACHA 3ECQA 4W8JA 1PX4A 3CNAA 5FUPA 4IV3B 4Q0UA 1UAIA 5A3WA 1XB9A 3HEIA 3ZSJA 1RUH3 3U78A 3AP9A 2XWBB 4HXCA 3ZLIA 3QH7A 3CLPA 3U37A 3BB6A 3KSCA 2X05A 3DF0A 2SBAA 2QE3A 1URXA 2WQZC 4LBKA 4Q8LA 4YZ4A 4YZ1A 3NV1A 2DURA 5T5OA 1F9KA 1US2A 4M0HA 3B02A 4A7YA 2PMWB 2PN5A 2HWC3 2J42A 4NMIA 3VL9A 2DVDA 3FHAA 4AEKA 1PM4A 1VP6A 2EXIA 3OBRA 3OUJA 5DG1A 5FUIA 4Y20B 3WG4A 1ZX5A 3WHUA 5AC91 1SEFA 3ME2A 5DAXA 1C8M3 3Q8FA 2DCZA 4P00B 4XJUA 1Q8VA 4AFCA 3T1MA 1VALA 3NAPA 1VBA2 2BOIA 1PGSA 2W94A 4Y1YA 3CMGA 3TN93 1W9FA 3I2HA 1LENA 3OG2A 1W99A 3ZFEC 3RZJA 1ENQA 5DDJ3 1EP0A 4QXCA 3K3NA 1WMFA 4EN0A 2UY8A 4GJZA 4FPEA 3VDDC 1SLAA 2O14A 4DIQA 2EVXA 3KT1A 2ZEXA 2RS12 4AGVA 3O1RA 1W3XA 4CDWC 5A7OA 1G9CA 2GC3A 4AFDA 1AL21 1AR93 4Q4V1 2PELA 1AYM1 5C3RA 3S57A 4MGIE 1ND3B 1F8VA 3EO6A 5A32A 1JXNA 3J8F1 3KGLA 3LA7A 4E4HA 4HT1T 2W91A 4CEYB 3WDVA 3ZX7A 1RMU3 1U5XA 1VBD1 4LORA 1W2AX 3WZ1A 3PUIA 3IMMA 2WNUA 1N3QA 5IVCA 4CDXB 2E33A 2HWE1 2JDMA 1OXCA 1RUC1 3F95A 1PNGA 4HFSA 2W9XA 3VKOA 4ZU4A 5JI7A 5FQ0A 2X29A 4P5HA 2AYHA 1UZVA 1G8WA 2IFRA 4UFIA 1ZZ6A 3THPA 5JSOA 3HIFA 4AZZA 1IS3A 4QDRA 3IDAA 3O0VA 4QAWA 4AR2A 3O1SA 3ZYIB 2WO2A 1KEXA 3ZFGC 1VRH2 2XWJB 3BODA 3CBNA 4JGZB 1SFYA 3RPQA 2D93A 4XUTA 5FYUA 3WNPA 1W8ZA 4AVBA 4QPGB 5F3CA 3RZZA 4FSJA 1F2NA 4CU6A 5CISA 3JQWA 4CDQB 1PMHX 4IEUA 5GLTA 2J1RA 1CONA 2A75A 1SLCA 5K0UB 1O4YA 1PK6A 2YBKA 2CGOA 2R043 5EZWA 2PXJA 2WZPP 4Q4Y1 5FR3A 1I5ZA 3EXUA 1H8TA 3BN6A 2JDHA 5IVJA 1CD3G 5JWPA 1S2BA 3RWNA 1LEDA 4RFT0 5GLWA 1X7NA 4AFMA 4QB1A 1YO8A 2FZ2A 4LUKA 1OA4A 1XNBA 4NOTA 4E9KA 1IG0A 1F31A 4HKWA 1DZQA 2B9UA 4QHBA 3POYA 1RUD2 2WS91 4ZPIA 1G7YA 1C5HA 2W1QA 2JE9A 4XBLA 2D6MA 5FYTA 4LBQD 3WW1A 1V0AA 1OLRA 1WWYA 2VECA 1MS9A 4XFBA 4ISRA 2LALA 1ZBE2 2QQUA 4CUCA 1HB2A 1QH7A 5IK4A 2G9ZA 4RR3A 4P02B 2RM23 1YQ6A 5FJKA 5JOZA 3MV01 4FPYA 1QF3A 5FZKA 1MACA 2DUPA 5C3PA 1JOBA 1D2QA 1R082 4CP2A 5JCTA 5T54A 2LUWA 3ZXGA 4WM7A 1CJPA 1Y9GA 2VUCA 2Y60A 3SISA 4KWLA 1F4HA 1SBFA 1XYNA 2AREA 5GZDA 4QB2A 4HPKB 2BV4A 1YIPA 2VW1A 3BCWA 1RUJ3 2V73A 3JD72 4FQ4A 4I3GA 3UGGA 3WG2A 5E89A 2HYXA 4CCNA 1DLLA 1RUE2 1ZM1A 1JW6A 2YC4A 4NN0A 5T5LA 3VBSC 1CWPA 2ZX4A 1NKGA 5FZEA 4FOYA 4TLGA 3WUCA 5L7OA 1GZ9A 2CDOA 4KBZA 1DG6A 1SDDB 4UXAA 1GKBA 2XH6A 5DG2A 1ZRCA 1IS4A 1BEV1 3UK9A 2Y6HA 3AXDA 2XOMA 1AF9A 2AEZA 1FATA 3AJZA 4QKBA 3ZXDA 1LNSA 1WA4A 4JDMA 3MW3A 2QQKA 3CF6E 1D2SA 1RHI3 2BDRA 3FBYA 2WNVA 3G6JB 4XFIA 2OQ7A 3DYOA 1RUG3 4JGYC 1XNTA 5FREA 4K40A 1FXZA 1PVXA 3AYDA 3RQ0A 1C3HA 4IV3A 4PIYA 3WQ1A 3LE0A 3IAPA 3Q8AA 1GP4A 1OOPB 1WMEA 4WZFA 5GZFA 2Y34A 5A1FA 2P3KA 2WQ8A 2Y6GA 2WO1A 3NV4A 3ON7A 1XE8A 1LGNA 2J1EA 3IWZA 4AG4A 1I3HA 1OLMA 5FWEA 5FOBB 1A34A 3GF6A 2HWF2 3N9LA 4GWIA 4QHOA 1NXD1 5FLHA 4ARXA 1KRIA 1S0CA 2WO7A 5H9PA 2C9KA 1BJQA 5FZ0A 2RE9A 1JU4A 3IBMA 1CAXA 1RYYA 4QQPA 1YQ8A 2ZGMA 1F35A 1SBEA 4XBQA 3O1OA 4KH9A 3U11A 2D40A 1YC61 4PLNA 1W39A 1COV1 2JG9B 2WA4A 4COVA 3OGRA 4Y20A 5LY1A 4WV8A 4YVWC 2E63A 1X36A 3W9AA 1GQGA 5L9RA 3RWKX 3GBGA 1CX4A 3TBDA 4D7SA 1Q43A 1IPJA 1PO11 4HK9A 3T2TA 2HWD2 5IVVA 1N1TA 1R093 3RG0A 1YFUA 4RSUA 2VXJA 2CL2A 2C9AA 4NPMA 4YW1A 2DDUA 2OKXA 1POV3 2J1VA 1P8JA 3RZGA 2VUDA 1W6MB 4IUGA 3HT2A 2B45X 4HKLA 2PTMA 4O9GA 4N53C 4GB33 3O1PA 2W68A 4QB6A 3RJRA 1QHDA 4CCCA 3CQOA 1ZNPA 2ZGQA 1NQJA 2ZGNA 4CEYA 4P9XA 4M4RA 3V0BB 4NAOA 4Z2AA 1Q5OA 4HK8A 2ERFA 4DQAA 5LBFA 3BPZA 1UD1A 4C8DA 4EN9B 2DU1A 5EJ1B 3LKJA 2JWPA 1W03A 1YJKA 3KHBA 3OCPA 2EICA 3FHQA 4NIIA 1T6GC 4QXHA 1GSLA 3AXEA 2FCTA 2WYFA 2OIIA 3AL5A 3N7JA 4BYYA 2NQYA 1VBA1 1VBC2 2XKOA 2MPFA 4BISA 2XUEA 4S2HA 4B4RA 3B9IA 1IKPA 1V6LA 1VBE3 2BNMA 4OUSA 2J1SA 3AL6A 4JGZA 4QGLA 4QPIA 3I2OA 1J3RA 5FO7B 4GIQA 1NCQC 4MXWB 1YYNA 2GMMA 4QPGA 4FTSA 4IGQA 2VQUA 5FKCA 3TEYA 1ZREA 4AFAA 5JPNB 2RS11 4BQ1A 2H6CA 5GM0A 3TOJA 1IZ3A 1DQ2A 2ZGTA 4AF9A 4N43B 1CN1A 3WNOA 3W20A 2WUHA 4GALA 3AKRA 3AKPA 4IEWA 4GH4C 2YGMA 2VNOA 1HV1A 2XQRA 4JTOA 3THDA 3LDKA 2K46A 2ZGLA 3USSA 1JZ4A 3MEPA 4W50A 1O5LA 1GZCA 1RUF2 2XJQA 1XE7A 1NY72 3AKSA 2WSVA 3L9JT 4MGYE 1FYUA 5GLVA 2CGPA 1SG3A 2VOWA 2YB7A 4JQTA 3OPWA 5C9AC 2TEPA 4IL7A 4B1MA 1GFF2 4QX8A 3ALQA 4E2SA 4E2QA 1HJGA 1E57A 1WCUA 2P3JA 4UBHA 1AR82 4Y4YA 2ZHKA 4O7XA 4QKFA 3SKJE 3D5OA 5FY1A 5I8SA 1AVBA 5A3OA 2GZWA 1XBFA 5LK5A 3K46A 4OFGA 4DOUA 1MS5A 1NG0A 1HRI2 1VRH1 3N9OA 1S0IA 4Z82A 1LULA 2XLFA 4LXLA 4PQ9A 4ES9A 2FZ1A 4ZKTB 4FFFA 4YARA 2VW0A 5FPXA 3E5QA 3I8TA 5DXDA 2HWB3 3ZFFC 2F4LA 1LOAA 4YYOA 4XAEA 1X50A 4LO4B 5FXXA 4IQPA 2YBSA 1A78A 2VVDA 2ARXA 1NAEA 1H4GA 1UY1A 3DXUA 3OD4A 2MHFA 1KD7A 2E9QA 5KWRA 2R49A 2OZ6A 2WBKA 1N1YA 1CJDA 3HQUA 5EXOA 4HPKA 1JYNA 3VBFB 3O1UA 4XJ9A 3ZDSA 3ZIWA 5FV3A 1GV9A 4AHXA 2WFPA 2JEMA 2ZCWA 2VOVA 3B93A 1CPMA 2O0OA 2QBXA 5CG8A 3I2KA 1RUI1 5FYHA 3WP3A 3A0NA 5I0RA 3IDBB 2ZGSA 4IGPA 5M0TA 3T2PA 3VHNA 4F3JA 4LHNA 3BIWE 4CCJA 1FI2A 4QGMA 5C33A 4HN0A 1QWRA 3UKVA 2VG9A 3AP5A 3WDTA 2Q4SA 1OHFA 2VL4A 5A7SA 5FLJA 3E5XA 4CTEA 1N1SA 5KHHA 1W6NB 2D5HA 1W90A 1UMHA 1XQNA 1OOPA 2QDNA 3R4SA 1KQRA 1R081 4OCTA 3U0ZA 1UOFA 1B35A 2ARAA 4LBNA 4V2WA 5FZFA 3WX5A 2W1WA 4D69A 3UKNA 1W8WA 5CNAA 2G19A 3TRSB 2X09A 1PM7A 4MSVA 2TNFA 4BPZA 2JDYA 2VCAA 3JD71 3B94A 4XURA 5CA6A 3RZLA 1QKQA 4A45A 5FP8A 1RUE1 4OHVA 1O4TA 2Y8KA 1PVC3 3NL1A 5APAA 3VBHC 2DYCA 4FOQA 1JHNA 3O5SA 5JXHA 1CESA 3LA2A 1GNYA 4K6BA 2WN2A 4R8HA 1HX6A 2YV8A 4IEXA 2DTWA 3WSOA 5EFUA 3ZR5A 4LKFA 2JG9A 3SHRA 2WFF1 1Z7S3 3EYPA 4ASLA 4I0WB 4BE3A 3QBQA 1GYKA 3MICA 1NLQA 3ILNA 4Q0VA 1GQPA 3MUY1 4NIHA 2JDUA 1ULCA 1PIV2 2EAAA 2WLPA 2Y0IA 3WQ0A 1C57A 3MF6A 4GAZA 1H2LA 1OD3A 4XQ4A 3VL8A 4DXRA 5FYZA 3OPTA 1AJOA 1YEWA 1O59A 4XDQA 3ZVXA 3LIGA 1EUUA 2Q8EA 1C4RA 4CXYA 2ADDA 3PVBB 3PU8A 1GOHA 2PLV3 4Q1RA 3B7MA 4LHSA 2BBVA 3VZKA 1I9RA 4M0NA 3CL1A 4IW3A 2R072 1W6MA 3BIEA 1YQ2A 2BGPA 2WINB 3M3IA 4YM1A 4A3XA 5LA9A 1FOD2 3P1IA 4NUBA 3VN4A 4D7YA 1VAMA 3URFA 1X9PA 1UQXA 2EIEA 4RFRB 4HSLA 5A70A 1E5SA 2AZ5A 1QOTA 4HG6B 3V0BA 1XNKA 1T6BX 4H7LA 2QVSB 2CU5A 2OW4A 4RR3C 2WAOA 5LY2A 3ZMNA 2FMYA 2W1UA 2B39A 4GULA 4PBPA 3ZYGA 5A33B 1ASJ2 3JXSA 3N9PA 4YG3A 5KC6A 3DPRA 2QZ2A 1ZRRA 5IWFA 5J1XA 4N7UA 1SLTA 4DUXA 4YVSB 2ZX0A 5A7WB 1AZDA 1JBCA 1QXJA 4KU7A 1SFPA 4IESA 3VBRC 4NIGA 1UX6A 2JKBA 1UY0A 2JKXA 4BDVB 4Q4X1 2R30A 1D4VB 5JZGB 5KC5A 3E5UA 2YBPA 3PIJA 2A3XA 2MEV3 1WLTA 2HWD1 3UETA 2XGXA 5EIYB 5FAXA 3AMHA 4MXWA 3SCFA 1UZWA 1X8EA 3KQ4B 4URTA 5D8AB 1X33A 3JZVA 1QJU2 3LEIA 1WBLA 1ZZ8A 3POJA 1D0HA 3NNGA 4TYSA 5JPMB 5KXCA 5A7NA 2BPA2 3FL7A 4Y5SA 2A7AA 4N43A 1AYM2 1RL3A 3ACFA 4I09A 3ROUA 2HBUA 4QM9A 1HW5A 4MGSA 4GH4B 4LKSA 1HXS3 3J8F2 3KCYA 5FYVA 1QJX1 3DECA 2BQPA 1JTZX 4RA0A 3OBZA 2VTFA 4ES8A 1VBD2 2CSGA 2V72A 4FAHA 1S2KA 2E51A 4XAAA 1PO22 4XOGA 3ZMOA 4XF3A 1V6IA 2L9LA 3E6CC 4CXWA 3AYCA 5FO9B 4Y22B 1AXYA 4CCLA 4OHXA 4QU2A 1O5UA 2EAKA 1HDKA 5JXGA 1RXGA 3OY8B 4PCRA 2XBO3 1VBC1 2FDIA 5IVYA 2ZMLA 1RC6A 1D4M2 2VZQA 2ZHMA 5JOXA 5K7PA 1OA3A 3PVNA 1CZVA 1YIFA 1XSRA 4A41A 4F83A 3EMRA 4YM3A 5JMCA 1JZ6A 1VBB3 1A6CA 5FZ1A 1Y4WA 2KD7A 2MNGA 1MZ6A 2VUJA 3BI3A 1EV13 2BGCA 5L73A 3BU7A 4JDNA 1W6OB 5A3PA 1T2XA 2V5YA 2XJPA 3WEZA 4KG8A 1TME2 1CAWA 2D6LX 4AGGA 2QJVA 2ZOEB 3MIHA 1O4ZA 1JYWA 1BBT2 2XLGA 1KDMA 2EXJA 4ISQA 4N9IA 5J48A 1FMD3 4BXSV 1QJY2 1W0PA 1S2EA 2XHNA 2VMEA 4J1WA 2D43A 4PF5A 5EYXA 5FK8A 1RUF1 2Y33A 2JB8A 5J37A 1NY71 1O7FA 1UWWA 3DXTA 2RS31 4R4XA 4Y1VA 2XMLA 5A3MA 5HI0A 3CJXA 4TN7A 2YY1A 2GMPA 5E1RA 4GWNA 3BTYA 1ND2C 2GNDA 3I3EA 3E97A 3OSDA 3GGLA 4E27A 4CU7A 5F1RA 5A7QA 1JYIA 2YPDA 3VZMA 3SC7X 2HJIA 2BERA 1JH5A 3KVBA 4TLFA 2DVGA 5DQ0A 3B69A 4WM8C 1HRI1 4FAGA 5CKNA 2VD7A 5J7MA 2R32A 3IIIA 1UF2C 3ZYFA 2WT2A 3ZYHA 3WG3A 2AUYA 1O91A 2BGOA 2AH2A 1W6NA 4ITCA 3WOGA 4A6SA 1DZRA 4LO7A 5F6KA 1UN1A 4YW3A 3OGGA 3U14A 4A4AA 1J84A 2Z79A 3AP7A 4FCAA 1IS6A 1AXZA 2UWBA 3WP6A 4NR1A 4XCAA 5A1LA 1S0FA 2ET7A 1IPKA 4COYA 1GNZA 2RJKA 3J26N 4EN6B 4ET7A 2JDPA 1H1MA 1CR7A 2XVKA 3KD4A 1YCIA 3NSTA 5B2GB 4H55A 4QX3A 1EAH2 2FD8A 3ES4A 3D0JA 3WF3A 4LBLA 4JRLA 3MGUA 4B7EA 2LTNA 2FDJA 3AMQA 4PI2A 3I3MA 1UY3A 1AJKA 1K5MC 5GZEA 4WVMB 1CZTA 1REEA 2CAUA 2VJXA 1Y3TA 2E26A 1L7QA 4JV4A 4AI1A 4MADA 1R1ZA 5FP9A 5CKMA 3WF2A 4CUAA 5JXIA 4B7KA 1DIWA 4FTBA 2O1QA 3W21A 1PX3A 4KQ7A 4NRQA 5LBEA 4EN8B 1AYN3 1NOVA 4QU1A 1WCSA 3Q8BA 4UAPA 3WW4A 5A6YA 1GANA 4LOTA 1LJ7A 4BM8A 1GICA 1NA1A 1XXNA 4FXGB 4MG2A 4IXLA 4XHXA 3LWCA 4UBGA 3SEEA 5LW9A 1V70A 3B01A 4ATFA 2PQSA 1WBFA 4PDWB 2VQTA 3MIFA 2A5ZA 5F5AA 4CPBA 3VDAA 1H6YA 1HRV2 1WZXA 1AL0G 2RMU2 1DLCA 2H6BA 2XJVA 1DGRN 4XUPA 4K3UA 4XFFA 1IG3A 2BU9A 4N9HA 4EQVA 2VMGA 3A21A 3DUIA 4QPWA 4NHMA 5IK8A 4XZUG 4A42A 3SLIA 1FT9A 3VBOA 3RI9A 1S0EA 1SQ4A 4MVTA 4P9WA 3NJXA 5ABJA 5EP9A 4XACA 1WW5A 2GP3A 4UWDA 4CEWC 4CSWA 1J58A 1H6XA 2C26A 4KGGA 1MEC3 4YVSA 1JZ2A 5BXXA 3LQCA 1LECA 3LSEA 1AR73 1XNDA 3O12A 1PIV1 3VBRB 2WZR3 1H30A 4XJWA 4CU9A 1ONAA 1RUH2 3GJAA 1N3OA 4PI0A 1FNZA 5B4XA 1CAUB 2BBAA 2W87A 4PT6A 4B3NA 5JZGA 2KM2A 4IE0A 3RFRA 2YUEA 1K12A 4KGQA 1DU3D 1N47A 2C1FA 3HNBM 1ZA4A 3NKGA 1NCRC 5CFDA 5CAZA 4JHTA 3PMEA 3K4AA 1GWMA 4G3YC 4P9LA 2R071 1K42A 1WW7A 3ZXEA 4AHWA 4P9GA 5CU1A 1EYBA 2HWC2 5LBCA 3U07A 3VBUB 2XB6C 3U10A 1FOD1 2EA7A 1HQNA 2BZDA 3LOIA 3POBA 5E16A 4B1LA 4FTEA 2QCSB 4IV1B 5EJ3A 3GJBA 4WVWA 1DZTA 5CBLA 2E7TA 2HYKA 3KM5A 3AB0A 1I1EA 4LIUA 1ASJ1 2GC0A 1AR63 2YPJA 2E31A 1X9TA 4HVRA 3TN92 1MS8A 2RR13 4XFGA 4FT8A 1B35C 1J83A 2ZEWA 3MYXA 3NNLA 4XQWA 2YZ4A 3AMMA 5DDJ2 5A3LA 3IAQA 1OPOA 3ZIXA 3VDBA 2ZZJA 3OY8A 1MQTB 4RL7A 4JHZA 5FFOC 3ZXFA 3K77A 1G9BA 1BXHA 2DVFA 4D6SA 4BU2A 1E5IA 1QXPA 2ZHLA 3V56A 2FBEA 3D82A 1AR92 2RJ2A 3MIGA 3ZN6B 5BNQA 5LZ6A 2JG8A 2ZKNA 1BK0A 2ZABA 1IOAA 2GC2A 1QJU1 1H2KA 1W6OA 3AVRA 3MLKA 4GMP1 4K7JA 4B8EA 1E5RA 1QQP3 3POGA 4XZPA 4AI8A 5F2SA 4SBVA 4I0BA 5HCFA 1RMU2 2JIJA 3KVAA 4A7KA 4CDUB 3RGBA 2Q1ZB 2VQAA 3EHKA 3FLTA 4XW3A 5FZMA 4C90A 5KXEA 1XYOA 3IPVB 5IHRA 2WA3A 1DQ0A 1FPN3 1D0GA 1CAVA 1JN2P 4ASKA 4LO8A 1W6QB 2WJSA 4ASMB 5A6QA 1G86A 3R05A 5FYIA 1PO21 2VZ3A 2X5IB 4KWKA 4UF0A 3OOXA 4EV0A 2X8KA 2YFUA 5KHGA 1V6JA 2J1UA 2DCYA 4CE8A 1YRZA 4Q26A 4AEDC 3FZ3A 5FMOS 4JTNA 2XQXA 1Y43B 3MPBA 1J1LA 5F39A 1D4M1 1G9DA 2PAEA 2C24A 1Q8OA 3GZEA 2R042 3APBA 5FCCA 2OUHA 4MHRA 5IFPA 5L19A 3IM0A 1QY4A 3OB8A 1NYWA 1XNAA 2NMNA 3C7FA 1JUHA 5HCBA 5JI9A 5FXZA 2QQMA 3DPRC 3E6BA 3ABZA 3HMYA 4RS5C 4XTPA 5H9SA 1UMIA 3WW2A 2P3YA 1TME1 1VR3A 3AZYA 5KHJA 4OI0A 2PHDA 3HR9A 5FZOB 5BNPC 4YGEA 4DB5A 1BBT1 3CJIB 4XFAA 1WMDA 1LHNA 2GH2A 2NM1A 2IXCA 3OGVA 1OQDA 1QJY1 2BNNA 4FPOB 4W6WA 3SXWA 2QDRA 2WO3A 1H8VA 2VMIA 1BKZA 3OGSA 1RUI2 2QKDA 1HIXA 2ZXQA 2EALA 1UW8A 5LBBA 4D94A 3QH6A 4HANA 4P9YA 5JMOA 1ZRDA 2QQNA 1CPNA 4G9SB 2RM22 2VC9A 2GP5A 4XMIA 2WNEA 4MGTA 5C8CC 3P3NA 2VNRA 3ZOIA 3ZPOA 2A6XA 2A73B 1LB2A 3ZYJB 1R1A3 2BP6A 4NWVA 1ZRIA 3CKHA 4UW4A 4CCOA 1UKRA 2PFWA 1YNAA 2XHKA 2ZGPA 4QQHA 3RSJA 1GZTA 4COZA 1OKOA 5J3UA 1TMF3 4RN5A 3C7GA 3ZSEA 3NV2A 1AX1A 1JU3A 3P3PA 1Z0HA 4CCKA 1L3JA 2XPJA 1C28A 3THTA 4PDWA 3LDRA 4MGZE 1O3RA 1DFQA 1H2MA 3RI8A 2HH9A 3WNNA 1HB4A 5CFCA 2FQPA 2JICA 5A1AA 3JU9A 1S0GA 3KV6A 3N35A 4K21A 4MGKE 2FDHA 4HBNA 3MI8A 4IETA 4JKMA 1RUD3 5FP4A 1LU2A 1EAH1 5BNNB 2O8OA 4Q1PA 2VVFA 3ES1A 4YLZA 4LKDA 1RHI2 1QMJA 2KA3A 4CEWB 5FYYA 2WFF2 4EZHA 1RUG2 3ST7A 1ZBE3 2CYFA 4AEJA 3U4XA 1ULFA 4PJYA 5DZEA 5ANQA 4UW6A 3RS6A 4UI9L 3NRUA 3PUSA 4RQPA 4LUMA 1V6MA 5FZLA 2LS6A 3NKTA 4XIOA 3RYKA 4BMEA 2JENA 4Y1XA 5A3NA 3IDCB 3TYJA 4WZCA 2WNOA 4J25A 1PHMA 2RDQA 2WKKA 3MLLA 4UFLA 3VLBB 1K3IA 5C4WC 5DAPA 2ZMKA 2BW8A 2GC1A 2KR2A 5FZIA 3M3CA 1ACCA 1HRV1 1LHUA 1YJLA 2ORXA 2RMU1 4LMFA 3VV1A 3VUOA 3T0BA 3T09A 3I2JA 2VCMA 4XFHA 4CYDA 2HEYF 3LGRA 1UU4A 3FMGA 4RGGA 5I0TA 1QNYA 4IV1A 2VMFA 5FY9A 1IKQA 4BK4A 1ULOA 5GZCA 4AGRA 5IK5A 3HBZA 4GZ9A 1U5YA 1MS3A 5BNOC 4BIFA 2VZOA 1GBGA 3J7LA 4AI2A 1W9TA 4A6OA 1JZ3A 5ACA1 2YHJA 2XJUA 5CIRA 1BYHA 1CQ9A 1VPHA 2N7GA 3JB8A 1R092 1ZBA3 4DXZA 3H8XA 1CVNA 1HQWA 3HT1A 1MQTA 3HWJA 4ZS2A 1GWKA 1PGW1 2A6WA 3BOPA 3Q8CA 1RUH1 4QMAA 3VD5A 3IIAA 4Q4X2 4GKYA 3VKNA 5FPLA 2CDPA 1V6NA 1LOFA 4AVVA 4AL9A 5F9TA 2G4IA 2AENA 2DCJA 4OZXA 4UT5A 3ZFEB 3ZN6A 3I3QA 4GB32 3WD5A 1CIWA 2E32A 1DQ1A 4Y33A 3VDDB 3SITA 1WCQA 3TAYA 2DU0A 4LBQB 1JYTA 1FV3A 3KZ4C 4CDWB 1CX1A 2R6QA 3H1MA 3P6BA 2R7EB 4Y5Z0 2HWC1 3LEMA 3NNJA 3RVHA 4QX0A 1ND3A 3N7KA 4WVZA 4CDUA 4ZXKA 2D6OX 2PHXA 1QJX2 2VZRA 4GQ7A 5L36A 2V5DA 1QH6A 2VE1A 3DYMA 3K2OA 2ZZQA 2NPIA 3LFMA 1ZRFA 1OT5A 4YRDA 1QJFA 2G9GA 2UY9A 2W2IA 4Q0PA 1C8M1 5FY0A 3WT3A 5FUNA 1PMIA 4L11A 4RHV3 4CDXA 2XJTA 2HKXA 5I0UA 2X5IA 1VBE2 3PHMA 1UO9A 3TN91 1SLLA 1BLZA 5FPVA 2Q8CA 5FP7A 5AVPA 1IGOA 2UURA 1VB2A 5DDJ1 4YW7A 4D0QA 1ZZ7A 4Q4W3 4MV2A 4AW7A 3DL3A 1Q56A 4AYUA 3EQEA 1HLCA 3K75B 3ZFGB 5HV0A 1WCDJ 4MOAA 2ZGUA 3L2HA 4NRMA 5FZ3A 3B5LB 1AR91 2YROA 3VBOC 4P08A 4AFBA 4FXKB 4ZONA 2BFUS 3M70A 1V9U3 2DCTA 5ABJC 1QXRA 3NVCA 4H3WA 4CDQA 4WVVA 3N36A 5JOYA 1EUTA 5K0UA 4LEJA 2YG0A 4XUQA 3LFIA 5FP3A 1RMU1 2VH9A 5JOWA 3AC0A 3GZAA 1RUOA 5G04L 2ES3A 5FZOA 2AR6A 1XPWA 3ZSKA 2DUQA 1BHGA 4UOJA 4B4PA 2PHTA 2VY0A 2YU1A 3PVEA 2JXAA 4QX2A 1J3QA 1AHSA 4COWA 5H9QA 3SCGA 2RS32 2A1XA 2YGLA 5JSRA 2PAKA 4XYXA 1LR5A 2Q5TA 4DFSA 1UMZA 2IXIA 4UW3A 5L9BA 3WF4A 4AQTA 3CU7A 4ONUA 3NV3A 5HPOA 4IDZA 2HWB2 2XR4A 4UFJA 3WUDA 4BIOA 2CTVA 1EPZA 3PLQA 5DUXA 3AYAA 2DWRA 4EWAA 2W92A 5FYSA 2WAAA 1K5JA 2DTYA 1HN1A 4CP0A 2R041 5G05L 1DGWA 1RJ8A 2IUWA 4AHYA 4JC1A 1LHOA 3ORJA 4OI4A 2Y6KA 2QTWB 3C2UA 1W0OA 2VBBA 3KCCA 4PLOA 2X53S 5LRRA 4P9JA 1K45A 2P6HA 5I8YA 2CWSA 2HBTA 2Q30A 5A7PA 4ZU7A 2Z42A 4TZDA 1LRHA 1QOSA 1YI9A 1GLHA 3ACIA 4Z92B 3HPNA 3NAPC 2GALA 2XDVA 3H0OA 3VBSB 4XUOA 2ZACA 4AOCA 5IFTA 2GDFA 3KT7A 1MZEA 1W8UA 5EHDA 5BNNA 1C8NA 2WL1A 3OEAA 1W9YA 2IZWA 3M3OA 3VZLA 1AR83 2JDZA 2JG8C 4R9CA 2OS2A 4MGQA 5FDBA 1TG7A 5EV7A 5DN2A 2RM21 3MFCA 3RNSA 1AXKA 3BALA 4C0HA 3AVSA 2ZA9A 1IQAA 2I45A 4Z07A 4AQ6A 2PHLA 3KF5A 4R52A 1NE4A 3ZSMA 4JGYB 2I74A 4LA3A 5FZ7A 2RS53 1YFWA 4LLFA 4DMIA 3WDYA 1ZA7A 1W2TA 4QQOA 3T0AA 3ZXLA 1WUVA 1S0JA 1ULEA 2DVAA 1A8MA 2GNTA 4Y24A 1UYPA 5ERLA 4R9AA 1RUJ1 1G6NA 2WNUC 4I01A 2R063 4N90A 5F3IA 2XL9A 3FC0A 5F6LB 1UZ0A 4OHWA 4H14A 4YGDA 4XF9A 2VMDA 1H9PA 1OF4A 1HN0A 3MIBA 4X8NA 4NHKA 1Z7S2 3ILRA 3PU3A 4NHLA 5FRAA 2OYZA 3VZNA 4XABA 5HCAA 2ZGOA 4E8CA 2GN3A 1W8HA 4LR4A 2H0BA 3FLRA 2QUOA 3PJQA 1N3PA 3AFKA 1RHI1 4NRPA 4Q8KA 3H1WA 2AACA 2AC1A 1RUG1 4L9BA 1UZZA 3UGHA 2B46X 3T2OA 4YVWB 1PK6C 2XVGA 3HQXA 3NNMA 3RMXA 1TNRA 2XL7A 2PLV2 2D3SA 1H8TC 1O3SA 1HV0A 1OLME 1UYYA 1SZBA 5A3UA 5KBFA 1RVF3 1SPPB 4CCMA 3ZFEA 4YW2A 4LULA 1QOOA 1XU1A 5JUVA 2ZTNA 3C7HA 3VDDA 3GHMA 5FPZA 2OA2A 5CEHA 1UXZA 4B4QA 4J6GA 4C1WA 4CDWA 4Z2WA 4FFIA 3INAA 3I2DA 2XLAA 3KS7A 2Z2SB 2ZEYA 4N53B 2Z5WA 4CP1A 3OEBA 4RGKA 1ZZ9A 2ZGRA 3R4UA 3H7YA 1NUKA 3ZKUA 3RYRA 5FWJA 2OX0A 5FBZA 4BA6A 3LZZA 3NNFA 4XVHA 3WNLA 5FZ6A 1GWLA 2W08A 3M4FA 3QACA 4ZU5A 4XILA 4G4FA 4YWAA 4GJYA 4YFWA 4DPNA 5IVEA 1A8DA 4YFZA 5J36A 3GXUA 4H2AA 2FHRA 5I0DA 2EIGA 4JRAA 5LRSA 3IN9A 3HAGA 3KWVA 2MEV2 3JBG3 4QXBA 2WSUA 4WM7C 2D3PA 1ENSA 3Q9OA 1YWKA 2ZHNA 1R091 3K4DA 5GKAC 2RJLA 3J7MA 1GOGA 5C5TA 4GA9A 3MHZA 4INDA 1GZWB 3MBWA 4JCKA 5CFCC 3DCQA 1POV1 3ZFGA 1UU6A 5T52A 2BUKA 3UGFA 4N8MA 1NCQB 3PUHA 5IUQA 5HCHA 5FPAA 2RVAA 1OQ1A 4GB31 5L7OC 2H0VA 5D2AA 4A7ZA 3VGIA 2WABA 2FMDA 5F2WA 5FY7A 4Y3OA 5FBJA 3EB7A 3D6EA 2ZX2A 4RQPC 5IATA 4XJ8A 2WNVC 4KG0A 1RXFA 2GH8A 2VMHA 3FFQA 5AC93 5T50A 1LESA 2WN3A 4AVCA 5LCWL 1UIJA 4UFMA 1H0BA 4K20A 1MVQA 2XBO2 1JOJA 4IV3C 1OUXA 2VTXJ 5C9AB 1VBE1 3LPFA 4IE4A 2Y0OA 4XQDA 4XBNA 4CZSA 4MX3A 1PNFA 1W6PB 2XONA 4JKLA 5EJZB 4FO9A 4OYUA 1EV12 4OULA 2CAVA 1DQ6A 4AAXA 1UXXX 1V9U1 2VTXA 3A4UA 5B4NA 2NP0A 1L7LA 1O8SA 3H7JA 3UT0A 3WF1A 4AK3A 1KS5A 2VCCA 2OT7A 3KGZA 3KMHA 5BY5A 1WW6A 1LTEA 2WIIB 1AL23 2JECA 4Q4V3 2PYTA 5FLIA 3ZFFB 4BQ2A 4EJRA 1AYM3 3LF7A 3LPGA 4HKOA 2ATFA 2WWJA 3T4HB 4XTMA 5CZKA 3I49A 3WP5A 4XHBA 3J8F3 1FMD2 3C7EA 1MPXA 4S2FA 1W05A 2XJSA 2BRTA 1V00A 3SEPA 5I8TA 1Q8PA 1VBD3 5KHIA 4XDPA 3VBFA 1XNCA 3V65A 5KXDA 1NT0A 1QDCA 5FMOL 5FK7A 4CP9B 2HWE3 2VOXA 1RUC3 2QQLA 4KWJA 2ZS6B 1RIRA 1DHKB 2D5FA 2OUJA 1OC1A 3EBRA 3SMHA 5DZFA 2IXJA 4ARYA 3PUQA 5DAWA 1LGCA 2LRPA 2VQ0A 3VD7A 4HVOA 3J9SA 4O65A 1O6UA 1KFXL 3VD4A 3BU0A 4DUWA 2HWB1 5JR7B 4QKNA 4DEVA 2ZAHA 1ND3C 3TB0A 2JDKA 5A32B 2RG4A 3AP4A 2ARCA 5JSPA 1NQDA 3AK0A 4DY3A 3HD8B 1TNFA 4CEYC 1SHWB 5DPNA 3DKQA 2Y6JA 5DAVA 3RMYA 3KT4A 4KI5M 3NJVA 4Q4Y3 3RZKA 2VZSA 4CDXC 5F7UA 4BQXA 4JVAA 2ZAAA 3T4VA 5T5JA 5FQ0B 5IVBA 3AFGA 1OURA 3ASIA 1PZ8A 1DYKA 5D21A 1OVSA 3PIGA 4YGBA 2TBVA 4F8AA 2DFCA 4M3CE 3LA3A 4R4ZA 4LO6B 4MH0E 2Q1FA 3DEMA 2WS93 2CY6A 1A3KA 4JGZC 4QPIC 1CIYA 3QLQA 3VBHB 4FQZA 5LWBA 4E4DX 3CZJA 4QPGC 5FYBA 1SCRA 4IEYA 4BK5A 2JDNA 5FZ8A 3S7IA 1AYN2 1VJ2A 2Q1MA 4DRVA 1DCSA 4IGOA 2ENRA 1QJEA 1VRBA 2NMOA 4YVWA 1N1VA 3JUUA 4IE5A 5K0UC 2VZUA 2PAMA 1UOBA 2HEWF 2D7FA 1VE0A 4LO5B 3HN3A 1WD4A 3SQOA 3GBWA 2QQJA 1UOJA 4BB3A 5F32A 3TEZA 3OPZA 1PGL2 4YM0A 4LT5A 1ZVFA 4FP2A 1W2OA 1YUDA 3TEXA 3KV4A 1W2UA 4C1XA 1SACA 3I2IA 3WNMA 4YSFA 5FO8B 1PVC1 2UWAA 2VCBA 1FNYA 1OUSA 3DV8A 3MV11 3K51A 3OF1A 1VB4A 4QWNA 1Z7S1 3O14A 4JAAA 4LK6A 1BEV3 2D6KA 2W46A 4RR3B 4TXWA 3THCA 1MEC2 1E5HA 5LEKA 1OPMA 1GR3A 5A33A 2WZR2 2VOKA 3S5QA 1NE6A 4AWDA 4YW6A 2ZBJA 3Q8EA 2ET1A 5ACA2 4META 1RVF1 2VZ1A 3FUOA 3UYJA 4O9EA 4L99A 5A7WA 3E1F1 5EWSA 2C4XA 4LK7A 1NLRA 3N9NA 3JQXA 1PGW2 2PLV1 4FPKA 4GKXA 1HKDA 1W06A 3ZXAC 3FFZA 1GZWA 3C7OA 1TEIA 3OUIA 2WZ8A 1HJFA 3RRDA 1NCQA 5EYYA 3OUHA 5SV8A 3AZZA 2GMEA 1W28A 1WGPA 4BCUA 4GXLA 4XE9A 5D8AA 2IXLA 3MW2A 5IYYA 5LEJA 3NQHA 3WQBA 4CUGA 3AMNA 5FXWA 5C8WA 1H9WA 3MF9A 2A3YA 3SCHA 3M3EA 4GH4A 1AR62 1KXGA 2DVBA 3ZYPA 1DYOA 2A6ZA 4BLIA 3CDZB 4A3ZA 1COV3 2WNVB 4JDOA 4ZXEA 2RR12 3A7QA 1LOEA 4N7IA 2Q0AA 1C8M2 4LNVA 1V6OA 4BQ4A 3BGAA 3POEA 5CG9A 2X10A 3MUZ1 3I54A 2VNGA 1OBNA 3FHIB 3H8OA 5C9AA 5AFBA 1OOPC 2NZ9A 3QOPA 4Y22A 4NIAA 1PO13 2MEV1 1M4WA 3ITQA 4SLIA 2J7MA 4NE9A 4XDOA 4UFHA 5FPBA 4Z1VA 1W6PA 3F2ZA 4JX0A 5FZ9A 4DUVA 5FZCA 4HN1A 2J1AA 5C70A 1QQP2 2UWCA 3LD8A 3OBTA 1CAXB 2JD9A 4HL0A 4Y5TA 2WT1A 2ZX3A 4I0AA 3ZFFA 4A44A 4BZ4A 5F37A 2O8QA 3OGJA 1HXS1 3VHPA 5D1IA 1Q8SA 2XVLA 1YLLA 2JG9C 5FY5A 2DCKA 2F6BA 4D6RA 4JKKA 1FPN2 4YG0A 5F3EA 4L92A 1JMUB 2BYVE 4L97A 4EN7B 1AX0A 3RZMA 4CP9A 4C91A 1JS9A 4AAPA 3HNMA 5IAXA 4NPLA 1POQA 3C8XA 5FZ4A 2EIBA 2XBO1 3BVCA 1QU0A 1VBA3 4XC9A 1XE0A 1YQ5A 3FUQA 2BFUL 4DXTA 4Y4RA 3WNXA 5BUVA 2D6PA 1ND2B 1F5JA 4A2UA 5KR7A 1CGPA 3S30A 3ENRA 1VBB1 2WZEA 5AFEA 2BVVA 1GNHA 3D8CA 5E8AA 3T2QA 3O1TA 2NYYA 1EV11 5C71A 3GZUC 5CVRA 3I59B 3S6PA 2RDSA 2VZTA 1BQPA 3ZR6A 4WM8B 2RS13 3BKZA 3O1MA 3VZJA 4S2GA 4LQRA 4Y26A 2F17A 5J98B 1OVPA 3MPPG 3FX3A 4DNYA 1DDLA 1XU2A 3N9MA 2E7QA 1UYZA 4AVSA 4W4ZA 1YXWA 4MUVA 1FMD1 1QEXA 1SCSA 4BWOA 1WW4A 4E4SA 5C3QA 4CXXA 3SH5A 4QX5A 4OVEA 4DINB 2QQPA 2ARBA 4AQSA 1KS4A 2WR9A 4B29A 1SDWA 3I3BA 1DBNA 1H1IA 4XEZA 4Q2FA 2GNBA 4OQ9A 4QPIB 3CIHA 4NHXA 1VMFA 2Q8OA 3VBHA 4XJZA 1SFNA 2ADEA 3PUAA 2G9FA 3P5BA 5ANNA 1R1A2 5GLZA 4DS0A 1K5MB 4JZRA 1VRH3 1RUNA 3EJKA 4WVMA 2JIGA 1TMF2 4I2OA 4N43C 5CKQA 2RV9A 2Y26A 4P14A 3H8RA 2YYOA 3JCIA 3NMBA 1XOYA 1ZZBA 4W6XA 3WR0A 2D98A 5FZDA 1OF3A 4FPCA 2ZKLA 1V6KA 1RUJ2 2BWAA 4IEQA 2ZGKA 5C3OA 4XXAA 3H3LA 3I7DA 3NJYA 5FIXA 4Z8BA 3NO8A 4IEOA 1JOPA 1C1FA 2WWSA 4DXSA 1BVP1 1O8PA 1GMMA 1YI7A 4HZFA 1F4AA 4U2AA 1LKNA 3AMPA 3FE5A 5L9VA 1RUI3 3CZUA 4HMZA 4D8MA 1O3TA 4FPFA 1LU1A 2VULA 1UX7A 1SMVA 2YDEA 4OZOA 4ZS3A 3U4SA 4HETA 3UESA 4L8QA 4QX7A 5HXVA 4QT6A 3VKFC 2A6YA 1WD3A 3I4IA 1AYN1 4FPGA 2I07B 5FOJB 2P17A 2G1MA 2XG3A 4I02A 4LLOA 1QNWA 3LCPA 1AUYA 2QQOA 4NAMA 3VBRA 1RITA 4QDSA 3BUCA 3VBFC 4KBBA 5HBAA 3PNAA 1CAUA 5LK7B 1R083 3PDQA 2W1SA 3I2GA 5CYYA 4OLLA 2W39A 1Z78A 5F5CA 3KHCA 1PGL1 1Q8QA 1NCRB 3SH4A 1C5IA 3J7NA 1Y9MA 3DKWA 3JD73 4QDQA 4BH9A 2JE7A 1U5IA 2Q8DA 1RB8G 2I2SA 4OI2A 3TWIA 1RUE3 5LB6A 2WDBA 4Q5OA 1MZ5A 4M3CB 3VBUA 3BTZA 4O61A 4XXPA 1OFNA 3TNPB 3GNEA 2Y64A 1WLWA 3CEWA 1W3VA 1PZ7A 3LAGA 3O1VA 2WFF3 2GSYA 4RGAA 1MEC1 2B8MA 3ETQA 1ZBA2 4ZZ5A 2VVEA 4PHZA 3U75A 1AR71 1UCXA 2WZR1 1UKGA 3AP6A 1NLSA 3FWEA 4OI1A 1IS5A 3M7AA 5C3SA 1B35B 4FPJA 1IHMA 1X82A 2VZPA 4KMQA 5FZAA 1OMIA 2D3RA 2V09A 2P2KA 2VAUA 1W8FA 3KB5A 4TSVA 3AM2A 3M2MA 1UOGA 3WINE 1UPIA 2E53A 4XF4A 4YZ3A 4COUA 2WC2A 5SV5A 4AI3A 2NLRA 2CV6A 4I30A 4DY5A 3C3VA 2IVIB 4LJHA 2HWF3 2K2SA 1QJZA 3ZKYA 3N7LA 3PVOA 1BZWA 1LODA 1BMV2 1LCLA 3K4ZA 3IB3A 4OHYA 2ETEA 1F15A 1QGLA 1LHWA 4RHV2 1O3QA 3VB9A 1KGYA 2WYSA 4IE6A 4PIZA 5J96B 3ZN4A 1AR61 1KITA 5K8SA 4YM2A 3IPVA 3U1XA 3WNKA 1ZZCA 4QX1A 2RR11 4XIKA 2WQ4A 4K1YA 3FLPA 1DQ4A 4EROA 1W6QA 4EE2A 4BQ3A 2VZVA 1JUIA 1NA1C 3I2FA 4Q4W2 4LBJA 4M3CF 5FMCA 4OHZA 3H3ZA 3G7DA 3T3YA 3D0SA 5EPAA 1W0NA 4Q4X3 5FYMA 1Y9QA 4CVUA 1ND2A 4KNCA 2WT0A 2WWUA 4AEDB 2HWD3 1DYPA 1STMA 4EWEA 3WP4A 3KCXA 1V9U2 4URAA 3I59A 3O0XA 3KV5A 3SNMA 4WM8A 1QQP1 4CA9A 3K3OA 1JZ5A 4PIXA 3WLUA 2W52A 3BPSA 5E88A 5E6HA 4E8DA 2B5HA 5LA0A 3IDEA 4MXVA 2DV9A 1UU5A 1S55A 1FX5A 1GOFA 3DPRB 4RS5B 1QJX3 5DAQA 3R0RA 3M8LA 2ILMA 1APNA 5C6CA 1FPN1 3KV9A 1MS1A 4LA2A 5BV6A 3N7MA 5JVVA 5IVFA 3PL0A 1GP6A 4IEPA 4YVSC 4CRQA 3HN1A 3UJQA 5BNPB 1GQHA 1OLQA 3WV6A 3FN9A 3I3DA 1J3PA 3CJIA 4X6RB 1SLIA 2GNMA 2W47A 4NPRA 1PZ9A 4QM8A 4ZZ8A 5JZGC 1DGLA 1BK1A 4V1PA 4L0PA 1QIQA 2LW8A 4YG6A 4AVTA 4BOWA 3UJOA 2W3JA 3WDUA 1VBC3 5H9RA 4LKEA 5D8AC 5CFDC 1AX2A 3GCXA 3MLJA 1K5MA 4FFGA 4NWWA 4QQLA 3AJYA 4UYBA 4OQ8A 4K8FA 2ID4A 4FOWA 5C8CB 3HBKA 2B42B 4IE7A 5LA2A 1KDKA 3W5NA 3GBFA 4Y1UA 2VM9A 3H42B 5FJHA 2P37A 2VXRA 2A71A 1G9AA 1X8MA 4HSJA 1FAYA 3PTRB 4LTAA 2PHWA 3ATGA 2VUAA 1ODNA 2R1BA 5BPXA 3USUB 1OFSA 4YGCA 4ATEA 1LOCA 3HOBA 2DFBA 2VO5A 4X6QB 2PA7A 4FI9A 1UZYA 2K9ZA 2YFZA 4NROA 1D7PM 3IT8A 1RUF3 4OUEA 4CPBD 2CNAA 2FCUA 4NVPA 2RS33 1KJLA 2QFEA 1TZOA 1G9FA 1W2NA 2VNVA 2OQ6A 4XF1A 5FMDA 1LOGA 3RZHA 3MIDA 1ULDA 5A6XA 3GHNA 2QZ3A 3LDBA 1R1A1 3WDXA 4CEWA 1DGWX 2KXLA 3ZSLA 5LATA 2RS52 2RDRA 3LEGA 2JDAA 2ZX1A 1HRI3 2R0HA 3LB9A 4FFHA 4MO3M 1IPSA 1J1TA 1CAWB 1OKQA 1TMF1 2W5FA 5DUVA 4D3WA 3J7HA 3N9QA 3OYWB 2W95A 1UYXA 2R062 2JJ6A 4HLTA 5JIUA 2UYBA 2Y6FA 1WKYA 3VD3A 3WCSA 2P4EA 3SKVA 3MFAA 1ODMA 2JD4A 4NO4A 1JYVA 1NCRA 3T0DA 5FKBA 3UKTA 3R4DB 5C4WB 1M06G 1ALYA 4Y1ZA 3ZN5A 2P5BA 2EF6A 1RTVA 1PVC2 1RUD1 2BEOA 2IWGB 5FMBA 1VMJA 4M3CA 4HVQA 3V64A 3KQRA 4QGNA 1LEMA 4L2NA 4LIVA 1VLNA 5I93A 1J59A 5I0SA 4PLMA 1EY2A 3VD9A 1ZBE1 2XXZA 2BJSA 3FBMA 4LPLA 2GN7A 2YC0A 2Y38A 5BNOB 2OVUA 3HQRA 3RYPA 1OD5A 1UL9A 1WA6X 1ULPA 1IQDC 3GM8A 5KXBA 1RVF2 3CO2A 1TE1B 1TQ5A 1U5ZA 3A23A
chains in the Genus database with same CATH topology
4DO0A 4ASKA 5FPBA 5A7NA 4HONA 2YBKA 5FZIA 5FPUA 5FZ9A 2PXJA 4GJYA 3U4SA 4QU1A 5FYIA 5FYHA 5FZCA 5IVBA 3KV9A 4QX7A 4IGPA 5FYSA 5FZHA 5IVVA 4UF0A 5IVJA 5IVFA 5FYVA 3LD8A 4QXBA 5LW9A 4CCJA 5F37A 5ISLA 5F5AA 5FY5A 5A7PA 5F39A 4D6RA 5FYBA 5A7SA 3PDQA 5F3EA 5FUPA 5FZ8A 5A3WA 5FPAA 5FYTA 5F5CA 4CCLA 2XDVA 4IGOA 3U78A 1VRBA 3ZLIA 4AAPA 4V2WA 5FXZA 5FZFA 5IVYA 5FZ4A 2Q8DA 5FY8A 5FPLA 4UF0B 5F2WA 4C8DA 2GP3A 5FY7A 4CSWA 4Y3OA 5FZOB 5FBJA 5FJKA 2OS2A 5FJHA 5FZ1A 5F32A 4Y4RA 5FZKA 5FP8A 4QXHA 3PTRB 4Y33A 3AL5A 5FXVA 5A3PA 5KR7A 3KV4A 4BISA 2XUEA 3AVSA 5FY9A 4EYUA 3AL6A 5FZ7A 3PURA 3RVHA 4CCNA 5LWBA 4IGQA 2GP5A 4QWNA 3K2OA 5FZEA 3N9MA 4GAZA 2W2IA 5FY0A 5FZAA 3ZPOA 5F3IA 2OQ6A 3OPTA 5FUNA 5FYZA 5A3TA 3DXTA 5FYCA 2XMLA 4CCOA 4V2VA 2Q8EA 4TN7A 3LDBA 4QXCA 2OT7A 5FPVA 3K3NA 2Q8CA 4D6QA 4GJZA 3PU8A 4HOOA 5FP7A 4DIQA 3PU3A 3UYJA 4CCKA 5A7QA 5A7WA 2WWJA 2YPDA 5FY4A 5FZBA 3N9NA 5A7OA 2OQ7A 3N9QA 3KVBA 4LIUA 5F5IA 3PUAA 2VD7A 3OPWA 4GD4A 5FZ3A 5K4LA 4NUBA 4XDPA 4E4HA 4QX8A 3KV6A 5LY2A 5A1FA 5FP4A 5FY1A 5F3GA 2YU2A 4CUGA 5FXWA 5IVCA 5FWEA 2P5BA 3N9PA 3N9OA 5FP3A 4BU2A 5FZGA 4AI9A 4D6SA 5A1LA 3N9LA 4LXLA 3PUQA 5IWFA 5IW0A 5FYYA 5A80A 4EZHA 5FZOA 4CCMA 5FZ0A 5FZDA 5A7WB 4LIVA 5ANQA 5FXXA 5FYMA 3PUSA 2YBSA 2WWUA 3AVRA 2XXZA 3DXUA 2YU1A 5CEHA 5F2SA 3NJYA 5FZLA 5FYUA 4URAA 3KVAA 2YBPA 3KV5A 4LITA 5A3NA 4BXFA 5F3CA 5LY1A 3K3OA 5FV3A 5E6HA 5FZMA 5FWJA 4EZ4A 2OX0A 5IVEA 5FZ6A 5FP9A 4XDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DO0 A;  4ASK A;  5FPB A;  5A7N A;  4HON A;  2YBK A;  5FZI A;  5FPU A;  5FZ9 A;  2PXJ A;  4GJY A;  3U4S A;  4QU1 A;  5FYI A;  5FYH A;  5FZC A;  5IVB A;  3KV9 A;  4QX7 A;  4IGP A;  5FYS A;  5FZH A;  5IVV A;  4UF0 A;  5IVJ A;  5IVF A;  5FYV A;  3LD8 A;  4QXB A;  5LW9 A;  4CCJ A;  5F37 A;  5ISL A;  5F5A A;  5FY5 A;  5A7P A;  5F39 A;  4D6R A;  5FYB A;  5A7S A;  3PDQ A;  5F3E A;  5FUP A;  5FZ8 A;  5A3W A;  5FPA A;  5FYT A;  5F5C A;  4CCL A;  2XDV A;  4IGO A;  3U78 A;  1VRB A;  3ZLI A;  4AAP A;  4V2W A;  5FXZ A;  5FZF A;  5IVY A;  5FZ4 A;  2Q8D A;  5FY8 A;  5FPL A;  4UF0 B;  5F2W A;  4C8D A;  2GP3 A;  5FY7 A;  4CSW A;  4Y3O A;  5FZO B;  5FBJ A;  5FJK A;  2OS2 A;  5FJH A;  5FZ1 A;  5F32 A;  4Y4R A;  5FZK A;  5FP8 A;  4QXH A;  3PTR B;  4Y33 A;  3AL5 A;  5FXV A;  5A3P A;  5KR7 A;  3KV4 A;  4BIS A;  2XUE A;  3AVS A;  5FY9 A;  4EYU A;  3AL6 A;  5FZ7 A;  3PUR A;  3RVH A;  4CCN A;  5LWB A;  4IGQ A;  2GP5 A;  4QWN A;  3K2O A;  5FZE A;  3N9M A;  4GAZ A;  2W2I A;  5FY0 A;  5FZA A;  3ZPO A;  5F3I A;  2OQ6 A;  3OPT A;  5FUN A;  5FYZ A;  5A3T A;  3DXT A;  5FYC A;  2XML A;  4CCO A;  4V2V A;  2Q8E A;  4TN7 A;  3LDB A;  4QXC A;  2OT7 A;  5FPV A;  3K3N A;  2Q8C A;  4D6Q A;  4GJZ A;  3PU8 A;  4HOO A;  5FP7 A;  4DIQ A;  3PU3 A;  3UYJ A;  4CCK A;  5A7Q A;  5A7W A;  2WWJ A;  2YPD A;  5FY4 A;  5FZB A;  3N9N A;  5A7O A;  2OQ7 A;  3N9Q A;  3KVB A;  4LIU A;  5F5I A;  3PUA A;  2VD7 A;  3OPW A;  4GD4 A;  5FZ3 A;  5K4L A;  4NUB A;  4XDP A;  4E4H A;  4QX8 A;  3KV6 A;  5LY2 A;  5A1F A;  5FP4 A;  5FY1 A;  5F3G A;  2YU2 A;  4CUG A;  5FXW A;  5IVC A;  5FWE A;  2P5B A;  3N9P A;  3N9O A;  5FP3 A;  4BU2 A;  5FZG A;  4AI9 A;  4D6S A;  5A1L A;  3N9L A;  4LXL A;  3PUQ A;  5IWF A;  5IW0 A;  5FYY A;  5A80 A;  4EZH A;  5FZO A;  4CCM A;  5FZ0 A;  5FZD A;  5A7W B;  4LIV A;  5ANQ A;  5FXX A;  5FYM A;  3PUS A;  2YBS A;  2WWU A;  3AVR A;  2XXZ A;  3DXU A;  2YU1 A;  5CEH A;  5F2S A;  3NJY A;  5FZL A;  5FYU A;  4URA A;  3KVA A;  2YBP A;  3KV5 A;  4LIT A;  5A3N A;  4BXF A;  5F3C A;  5LY1 A;  3K3O A;  5FV3 A;  5E6H A;  5FZM A;  5FWJ A;  4EZ4 A;  2OX0 A;  5IVE A;  5FZ6 A;  5FP9 A;  4XDO A; 
#chains in the Genus database with same CATH topology
 2VR4 A;  4JQR A;  1MZF A;  1POV 0;  2BVB A;  3ILF A;  4RYD A;  2HLE A;  2R16 A;  3T30 A;  1RIN A;  5IK7 A;  1U0A A;  2CHH A;  3IZO A;  3WDW A;  3LSD A;  1XSQ A;  1WMX A;  3JB4 C;  4TTG A;  1W8O A;  1H2N A;  3ZYR A;  4MYE A;  2B9V A;  4AVA A;  3WQ7 A;  4BQY A;  5JDB A;  3GZT B;  5GLU A;  2ZEZ A;  1JZ7 A;  2F4P A;  2LM3 A;  2BOJ A;  1VAV A;  4YZ2 A;  5JIA A;  1UPS A;  4LBQ A;  1NZC A;  5LAS A;  2FDK A;  3MDP A;  2R1D A;  3D3A A;  3KF3 A;  4OUM A;  2GAU A;  3DN7 A;  4BMB A;  1MS4 A;  2NN8 A;  2VPV A;  2OXB A;  1HB3 A;  3S5A A;  3ZPY A;  4GWJ A;  1S4C A;  1NZI A;  4LOS A;  2QNK A;  5JXJ A;  5DZG A;  2SLI A;  2IXH A;  3JBG 2;  1PMJ X;  2VGD A;  3FJS A;  5FY8 A;  4W6Y A;  1ZBA 1;  2XJR A;  3MIE A;  4K8R B;  2FDF A;  1NA1 B;  3GYD A;  3SH3 A;  4Q0S A;  4FOV A;  4XPV A;  1PIV 3;  1UNB A;  1VAK A;  2V4A A;  5C7G A;  3AX4 A;  4R9D A;  4DZG A;  1R64 A;  3TNQ A;  1L7R A;  1JOD A;  1ENR A;  4PDW C;  3NW4 A;  2PHR A;  2PQQ A;  2AGS A;  3GCW A;  4AED A;  4OMC A;  4EYU A;  2FCV A;  2HWF 1;  4S2D A;  2P6C A;  1OI6 A;  5T55 A;  4D7T A;  3PTY A;  3QD6 A;  4ZHN A;  2A3W A;  2R07 3;  3V0A B;  3VBO B;  4M00 A;  2TUN A;  5AVA A;  1Q3E A;  1RED A;  1DGR A;  2IXK A;  2WLQ A;  4K9S A;  4C0B A;  1B09 A;  3HJR A;  1HXS 2;  3B00 A;  1XJA A;  1FV2 A;  1WLD A;  1FOD 3;  2VBD A;  3A0K A;  5ABJ B;  3NWK A;  4RS5 A;  1BMV 1;  5AC9 2;  5FYC A;  1VIW B;  4E2G A;  2HEV F;  1JI6 A;  4UFK A;  4XCB A;  2LRO A;  3WCR A;  4KU8 A;  4D6Q A;  3S7E A;  1JZ8 A;  1Y7B A;  3POS A;  1YFY A;  4HOO A;  4RHV 1;  1W04 A;  3DYP A;  4Q0Q A;  2DUO A;  4F7Z A;  2JX9 A;  5BNP A;  1ASJ 3;  3UL2 A;  2IVJ A;  5BYN A;  1VMH A;  4LHK A;  3ELN A;  4M01 A;  1I5P A;  5A6Z A;  2EXK A;  5JR2 A;  1S1A A;  1HQL A;  1XRU A;  4Q4W 1;  1YFX A;  3W5M A;  4XFC A;  5CFD B;  4PQQ A;  4YZ5 A;  1OH4 A;  2D6N A;  4CCD A;  5CAD A;  3CHX A;  4UW5 A;  5T5P A;  5DUW A;  2IC1 A;  2QQV A;  1VBB 2;  4BQ5 A;  1QDO A;  2OZJ A;  3MO4 A;  1AL2 2;  4Q4V 2;  5F3G A;  2YU2 A;  3OD0 A;  5C8C A;  5HXM A;  3OJB A;  3VBU C;  5IJR A;  3ACG A;  2V4V A;  4BQW A;  5FZG A;  1KJR A;  3TEW A;  2FDG A;  2VBP A;  1SLB A;  1QJU 3;  4GMP 3;  3LOB A;  3AKT A;  4CCE A;  4IV1 C;  4MHU A;  1JHJ A;  4XJA A;  4DEQ A;  2WRA A;  2RHP A;  3I97 A;  4J1X A;  3W59 A;  3VHO A;  1MR5 A;  1LHV A;  2VMC A;  3USU A;  2HWE 2;  3WXP A;  1RUC 2;  1W9S A;  2OPW A;  3VKM A;  4AHZ A;  4XUN A;  4LIT A;  2K0G A;  4Q29 A;  2IFW A;  2JB4 A;  1LGB A;  5GAL A;  3GDB A;  3HVD A;  4EZ4 A;  2QQW A;  3NJZ A;  4LBM A;  3NAP B;  5F5Q A;  1MQT C;  1PO2 3;  3H50 A;  4KL1 A;  4DO0 A;  5LA1 A;  3VBS A;  2E6V A;  2A6V A;  3LIH A;  5FPU A;  2CWM A;  1LOF C;  5C5U A;  2EXH A;  3POF A;  5IAV A;  2CGN A;  1GUI A;  2DBN A;  4FP3 A;  5FZH A;  2B7Y A;  4QHZ A;  2JG8 B;  4CUB A;  4K1Z A;  4YNI A;  2R0F A;  3HNY M;  1UIK A;  1S0B A;  2XUM A;  3H3U A;  4LBO A;  1D4M 3;  3AKQ A;  4YW5 A;  2UU8 A;  4LE4 A;  3WHT A;  3WY6 A;  5GZG A;  1RGS A;  5ISL A;  4ORF A;  4Q4Y 2;  3OYW A;  3H9A A;  1H1A A;  2RDN A;  4YPJ A;  4CDU C;  2D44 A;  2BWC A;  5DAB A;  4JGY A;  2P34 A;  1SBD A;  1NX9 A;  3J4U H;  3OTF A;  4FPH A;  1RJ7 A;  4X8P A;  1W8T A;  5EQU A;  4AE2 A;  1CAV B;  1TME 3;  3AYE A;  1XYP A;  2VU9 A;  1S0D A;  1U12 A;  2WNU B;  2XKP A;  3O7O A;  3ZM8 A;  1OH3 A;  5C4W A;  2B4K A;  1BBT 3;  2C5D A;  2X5I C;  4UF0 B;  2WS9 2;  3BOW A;  3M3Q A;  5K9Y A;  1JYX A;  3ZDV A;  3PMS A;  2DF7 A;  4MLO A;  1QJY 3;  4BLJ A;  2Z4F A;  1MVE A;  5I91 A;  2ZJC A;  1AR8 1;  2BTV C;  1OSG A;  5FTT C;  4LHL A;  3MW4 A;  5FXV A;  2PHU A;  3BTX A;  4TWT A;  1LAJ A;  4AEM A;  4I3P A;  3K48 A;  1F5F A;  3AZV A;  4AQ2 A;  3X29 B;  1ZYB A;  3N3H A;  5HV4 A;  4XMA A;  3VZO A;  5BNO A;  3KLS A;  4W65 A;  5KHK A;  3PUR A;  4FBF A;  3AZW A;  3WF0 A;  1XC6 A;  3ZYB A;  4DRR A;  3N4M A;  5TSW A;  1US3 A;  3ACL A;  2RS5 1;  2P1B A;  3ETP A;  3M1H A;  2Z69 A;  4RD7 A;  4CDQ C;  5DMY A;  3D4K A;  1PK6 B;  2ORZ A;  3VDC A;  2GU9 A;  4CU8 A;  2JE8 A;  4Q27 A;  5T3N A;  1YHF A;  1WCK A;  4MZU A;  5A3T A;  1DP0 A;  2VW2 A;  2ZPX A;  3L2Y A;  3MZH A;  1H8T B;  4WBB A;  5DUU A;  2R06 1;  4V2V A;  3GAL A;  1I6X A;  3H1Y A;  1DF0 A;  1UY2 A;  1GU3 A;  3CJI C;  1CZS A;  3BTA A;  3OBA A;  1SPP A;  4R9B A;  5IT6 A;  3QCW A;  4NID A;  5JLV A;  3WVJ A;  4IER A;  5FY4 A;  5FZB A;  4AXO A;  1ULG A;  4QPY A;  3IMN A;  5JAX A;  2D97 A;  1BEV 2;  5F5I A;  1JYC A;  4GD4 A;  3S0M A;  4QQ2 A;  5K4L A;  3UV9 A;  4N53 A;  3T08 A;  4YW4 A;  1EAH 3;  1OQE A;  2AEY A;  4ZY9 A;  1EPW A;  4QD2 A;  2VOT A;  1OA2 A;  2ZMN A;  5F8P A;  1NXM A;  5GJ6 A;  3BYW A;  3PJY A;  3RDI A;  1ENX A;  1TVG A;  3W58 A;  4KWU A;  4AI9 A;  4E4Z A;  4QXK A;  1AR7 2;  5IW0 A;  1LOB A;  5A80 A;  2J1T A;  3T1L A;  1KFU L;  1W9W A;  4U36 A;  3VKL A;  4PF1 A;  2P3I A;  3A22 A;  3POI A;  3IKW A;  4WM7 B;  1UY4 A;  2EID A;  3UNP A;  1DQ5 A;  1HB1 A;  1WLC A;  2YC2 A;  3WW3 A;  1ST8 A;  4NHY A;  2W0X A;  3ZO0 B;  5CFC B;  1REF A;  3H8U A;  4LE3 A;  4BXF A;  5CB7 A;  4GWM A;  2C6S A;  3R6S A;  2PHF A;  3B3Q E;  3VHR A;  3V0A A;  5J09 A;  4GMP 0;  2UYA A;  1HRV 3;  2C0Z A;  5L7O B;  5BNN C;  2RMU 3;  2DBI A;  4FPL A;  3E6D A;  3O0W A;  4IEV A;  2BNO A;  4HON A;  4EWD A;  2YMZ A;  4OMD A;  3POW A;  4IEZ A;  4QKD A;  3WG1 A;  1COV 2;  2A70 A;  4P5Y A;  4M4P A;  4H7M A;  3ZXJ A;  3AZX A;  1BVV A;  4PBO A;  1H4H A;  2YXS A;  3B9C A;  4AI0 A;  1BCX A;  2J22 A;  2OPK A;  4FVV A;  4P9I A;  3LEK A;  3RJ2 X;  1YQC A;  4NJ4 A;  2E7A A;  2Y6L A;  4BHP A;  4RQP B;  2QQI A;  1W8N A;  3ZXK A;  4BJ0 A;  5ACA 3;  1PO1 2;  3JBG 1;  4XET A;  3DGT A;  1C1L A;  1MS0 A;  4XF0 A;  1GP5 A;  3ACH A;  3ECQ A;  4W8J A;  1PX4 A;  3CNA A;  5FUP A;  4IV3 B;  4Q0U A;  1UAI A;  5A3W A;  1XB9 A;  3HEI A;  3ZSJ A;  1RUH 3;  3U78 A;  3AP9 A;  2XWB B;  4HXC A;  3ZLI A;  3QH7 A;  3CLP A;  3U37 A;  3BB6 A;  3KSC A;  2X05 A;  3DF0 A;  2SBA A;  2QE3 A;  1URX A;  2WQZ C;  4LBK A;  4Q8L A;  4YZ4 A;  4YZ1 A;  3NV1 A;  2DUR A;  5T5O A;  1F9K A;  1US2 A;  4M0H A;  3B02 A;  4A7Y A;  2PMW B;  2PN5 A;  2HWC 3;  2J42 A;  4NMI A;  3VL9 A;  2DVD A;  3FHA A;  4AEK A;  1PM4 A;  1VP6 A;  2EXI A;  3OBR A;  3OUJ A;  5DG1 A;  5FUI A;  4Y20 B;  3WG4 A;  1ZX5 A;  3WHU A;  5AC9 1;  1SEF A;  3ME2 A;  5DAX A;  1C8M 3;  3Q8F A;  2DCZ A;  4P00 B;  4XJU A;  1Q8V A;  4AFC A;  3T1M A;  1VAL A;  3NAP A;  1VBA 2;  2BOI A;  1PGS A;  2W94 A;  4Y1Y A;  3CMG A;  3TN9 3;  1W9F A;  3I2H A;  1LEN A;  3OG2 A;  1W99 A;  3ZFE C;  3RZJ A;  1ENQ A;  5DDJ 3;  1EP0 A;  4QXC A;  3K3N A;  1WMF A;  4EN0 A;  2UY8 A;  4GJZ A;  4FPE A;  3VDD C;  1SLA A;  2O14 A;  4DIQ A;  2EVX A;  3KT1 A;  2ZEX A;  2RS1 2;  4AGV A;  3O1R A;  1W3X A;  4CDW C;  5A7O A;  1G9C A;  2GC3 A;  4AFD A;  1AL2 1;  1AR9 3;  4Q4V 1;  2PEL A;  1AYM 1;  5C3R A;  3S57 A;  4MGI E;  1ND3 B;  1F8V A;  3EO6 A;  5A32 A;  1JXN A;  3J8F 1;  3KGL A;  3LA7 A;  4E4H A;  4HT1 T;  2W91 A;  4CEY B;  3WDV A;  3ZX7 A;  1RMU 3;  1U5X A;  1VBD 1;  4LOR A;  1W2A X;  3WZ1 A;  3PUI A;  3IMM A;  2WNU A;  1N3Q A;  5IVC A;  4CDX B;  2E33 A;  2HWE 1;  2JDM A;  1OXC A;  1RUC 1;  3F95 A;  1PNG A;  4HFS A;  2W9X A;  3VKO A;  4ZU4 A;  5JI7 A;  5FQ0 A;  2X29 A;  4P5H A;  2AYH A;  1UZV A;  1G8W A;  2IFR A;  4UFI A;  1ZZ6 A;  3THP A;  5JSO A;  3HIF A;  4AZZ A;  1IS3 A;  4QDR A;  3IDA A;  3O0V A;  4QAW A;  4AR2 A;  3O1S A;  3ZYI B;  2WO2 A;  1KEX A;  3ZFG C;  1VRH 2;  2XWJ B;  3BOD A;  3CBN A;  4JGZ B;  1SFY A;  3RPQ A;  2D93 A;  4XUT A;  5FYU A;  3WNP A;  1W8Z A;  4AVB A;  4QPG B;  5F3C A;  3RZZ A;  4FSJ A;  1F2N A;  4CU6 A;  5CIS A;  3JQW A;  4CDQ B;  1PMH X;  4IEU A;  5GLT A;  2J1R A;  1CON A;  2A75 A;  1SLC A;  5K0U B;  1O4Y A;  1PK6 A;  2YBK A;  2CGO A;  2R04 3;  5EZW A;  2PXJ A;  2WZP P;  4Q4Y 1;  5FR3 A;  1I5Z A;  3EXU A;  1H8T A;  3BN6 A;  2JDH A;  5IVJ A;  1CD3 G;  5JWP A;  1S2B A;  3RWN A;  1LED A;  4RFT 0;  5GLW A;  1X7N A;  4AFM A;  4QB1 A;  1YO8 A;  2FZ2 A;  4LUK A;  1OA4 A;  1XNB A;  4NOT A;  4E9K A;  1IG0 A;  1F31 A;  4HKW A;  1DZQ A;  2B9U A;  4QHB A;  3POY A;  1RUD 2;  2WS9 1;  4ZPI A;  1G7Y A;  1C5H A;  2W1Q A;  2JE9 A;  4XBL A;  2D6M A;  5FYT A;  4LBQ D;  3WW1 A;  1V0A A;  1OLR A;  1WWY A;  2VEC A;  1MS9 A;  4XFB A;  4ISR A;  2LAL A;  1ZBE 2;  2QQU A;  4CUC A;  1HB2 A;  1QH7 A;  5IK4 A;  2G9Z A;  4RR3 A;  4P02 B;  2RM2 3;  1YQ6 A;  5FJK A;  5JOZ A;  3MV0 1;  4FPY A;  1QF3 A;  5FZK A;  1MAC A;  2DUP A;  5C3P A;  1JOB A;  1D2Q A;  1R08 2;  4CP2 A;  5JCT A;  5T54 A;  2LUW A;  3ZXG A;  4WM7 A;  1CJP A;  1Y9G A;  2VUC A;  2Y60 A;  3SIS A;  4KWL A;  1F4H A;  1SBF A;  1XYN A;  2ARE A;  5GZD A;  4QB2 A;  4HPK B;  2BV4 A;  1YIP A;  2VW1 A;  3BCW A;  1RUJ 3;  2V73 A;  3JD7 2;  4FQ4 A;  4I3G A;  3UGG A;  3WG2 A;  5E89 A;  2HYX A;  4CCN A;  1DLL A;  1RUE 2;  1ZM1 A;  1JW6 A;  2YC4 A;  4NN0 A;  5T5L A;  3VBS C;  1CWP A;  2ZX4 A;  1NKG A;  5FZE A;  4FOY A;  4TLG A;  3WUC A;  5L7O A;  1GZ9 A;  2CDO A;  4KBZ A;  1DG6 A;  1SDD B;  4UXA A;  1GKB A;  2XH6 A;  5DG2 A;  1ZRC A;  1IS4 A;  1BEV 1;  3UK9 A;  2Y6H A;  3AXD A;  2XOM A;  1AF9 A;  2AEZ A;  1FAT A;  3AJZ A;  4QKB A;  3ZXD A;  1LNS A;  1WA4 A;  4JDM A;  3MW3 A;  2QQK A;  3CF6 E;  1D2S A;  1RHI 3;  2BDR A;  3FBY A;  2WNV A;  3G6J B;  4XFI A;  2OQ7 A;  3DYO A;  1RUG 3;  4JGY C;  1XNT A;  5FRE A;  4K40 A;  1FXZ A;  1PVX A;  3AYD A;  3RQ0 A;  1C3H A;  4IV3 A;  4PIY A;  3WQ1 A;  3LE0 A;  3IAP A;  3Q8A A;  1GP4 A;  1OOP B;  1WME A;  4WZF A;  5GZF A;  2Y34 A;  5A1F A;  2P3K A;  2WQ8 A;  2Y6G A;  2WO1 A;  3NV4 A;  3ON7 A;  1XE8 A;  1LGN A;  2J1E A;  3IWZ A;  4AG4 A;  1I3H A;  1OLM A;  5FWE A;  5FOB B;  1A34 A;  3GF6 A;  2HWF 2;  3N9L A;  4GWI A;  4QHO A;  1NXD 1;  5FLH A;  4ARX A;  1KRI A;  1S0C A;  2WO7 A;  5H9P A;  2C9K A;  1BJQ A;  5FZ0 A;  2RE9 A;  1JU4 A;  3IBM A;  1CAX A;  1RYY A;  4QQP A;  1YQ8 A;  2ZGM A;  1F35 A;  1SBE A;  4XBQ A;  3O1O A;  4KH9 A;  3U11 A;  2D40 A;  1YC6 1;  4PLN A;  1W39 A;  1COV 1;  2JG9 B;  2WA4 A;  4COV A;  3OGR A;  4Y20 A;  5LY1 A;  4WV8 A;  4YVW C;  2E63 A;  1X36 A;  3W9A A;  1GQG A;  5L9R A;  3RWK X;  3GBG A;  1CX4 A;  3TBD A;  4D7S A;  1Q43 A;  1IPJ A;  1PO1 1;  4HK9 A;  3T2T A;  2HWD 2;  5IVV A;  1N1T A;  1R09 3;  3RG0 A;  1YFU A;  4RSU A;  2VXJ A;  2CL2 A;  2C9A A;  4NPM A;  4YW1 A;  2DDU A;  2OKX A;  1POV 3;  2J1V A;  1P8J A;  3RZG A;  2VUD A;  1W6M B;  4IUG A;  3HT2 A;  2B45 X;  4HKL A;  2PTM A;  4O9G A;  4N53 C;  4GB3 3;  3O1P A;  2W68 A;  4QB6 A;  3RJR A;  1QHD A;  4CCC A;  3CQO A;  1ZNP A;  2ZGQ A;  1NQJ A;  2ZGN A;  4CEY A;  4P9X A;  4M4R A;  3V0B B;  4NAO A;  4Z2A A;  1Q5O A;  4HK8 A;  2ERF A;  4DQA A;  5LBF A;  3BPZ A;  1UD1 A;  4C8D A;  4EN9 B;  2DU1 A;  5EJ1 B;  3LKJ A;  2JWP A;  1W03 A;  1YJK A;  3KHB A;  3OCP A;  2EIC A;  3FHQ A;  4NII A;  1T6G C;  4QXH A;  1GSL A;  3AXE A;  2FCT A;  2WYF A;  2OII A;  3AL5 A;  3N7J A;  4BYY A;  2NQY A;  1VBA 1;  1VBC 2;  2XKO A;  2MPF A;  4BIS A;  2XUE A;  4S2H A;  4B4R A;  3B9I A;  1IKP A;  1V6L A;  1VBE 3;  2BNM A;  4OUS A;  2J1S A;  3AL6 A;  4JGZ A;  4QGL A;  4QPI A;  3I2O A;  1J3R A;  5FO7 B;  4GIQ A;  1NCQ C;  4MXW B;  1YYN A;  2GMM A;  4QPG A;  4FTS A;  4IGQ A;  2VQU A;  5FKC A;  3TEY A;  1ZRE A;  4AFA A;  5JPN B;  2RS1 1;  4BQ1 A;  2H6C A;  5GM0 A;  3TOJ A;  1IZ3 A;  1DQ2 A;  2ZGT A;  4AF9 A;  4N43 B;  1CN1 A;  3WNO A;  3W20 A;  2WUH A;  4GAL A;  3AKR A;  3AKP A;  4IEW A;  4GH4 C;  2YGM A;  2VNO A;  1HV1 A;  2XQR A;  4JTO A;  3THD A;  3LDK A;  2K46 A;  2ZGL A;  3USS A;  1JZ4 A;  3MEP A;  4W50 A;  1O5L A;  1GZC A;  1RUF 2;  2XJQ A;  1XE7 A;  1NY7 2;  3AKS A;  2WSV A;  3L9J T;  4MGY E;  1FYU A;  5GLV A;  2CGP A;  1SG3 A;  2VOW A;  2YB7 A;  4JQT A;  3OPW A;  5C9A C;  2TEP A;  4IL7 A;  4B1M A;  1GFF 2;  4QX8 A;  3ALQ A;  4E2S A;  4E2Q A;  1HJG A;  1E57 A;  1WCU A;  2P3J A;  4UBH A;  1AR8 2;  4Y4Y A;  2ZHK A;  4O7X A;  4QKF A;  3SKJ E;  3D5O A;  5FY1 A;  5I8S A;  1AVB A;  5A3O A;  2GZW A;  1XBF A;  5LK5 A;  3K46 A;  4OFG A;  4DOU A;  1MS5 A;  1NG0 A;  1HRI 2;  1VRH 1;  3N9O A;  1S0I A;  4Z82 A;  1LUL A;  2XLF A;  4LXL A;  4PQ9 A;  4ES9 A;  2FZ1 A;  4ZKT B;  4FFF A;  4YAR A;  2VW0 A;  5FPX A;  3E5Q A;  3I8T A;  5DXD A;  2HWB 3;  3ZFF C;  2F4L A;  1LOA A;  4YYO A;  4XAE A;  1X50 A;  4LO4 B;  5FXX A;  4IQP A;  2YBS A;  1A78 A;  2VVD A;  2ARX A;  1NAE A;  1H4G A;  1UY1 A;  3DXU A;  3OD4 A;  2MHF A;  1KD7 A;  2E9Q A;  5KWR A;  2R49 A;  2OZ6 A;  2WBK A;  1N1Y A;  1CJD A;  3HQU A;  5EXO A;  4HPK A;  1JYN A;  3VBF B;  3O1U A;  4XJ9 A;  3ZDS A;  3ZIW A;  5FV3 A;  1GV9 A;  4AHX A;  2WFP A;  2JEM A;  2ZCW A;  2VOV A;  3B93 A;  1CPM A;  2O0O A;  2QBX A;  5CG8 A;  3I2K A;  1RUI 1;  5FYH A;  3WP3 A;  3A0N A;  5I0R A;  3IDB B;  2ZGS A;  4IGP A;  5M0T A;  3T2P A;  3VHN A;  4F3J A;  4LHN A;  3BIW E;  4CCJ A;  1FI2 A;  4QGM A;  5C33 A;  4HN0 A;  1QWR A;  3UKV A;  2VG9 A;  3AP5 A;  3WDT A;  2Q4S A;  1OHF A;  2VL4 A;  5A7S A;  5FLJ A;  3E5X A;  4CTE A;  1N1S A;  5KHH A;  1W6N B;  2D5H A;  1W90 A;  1UMH A;  1XQN A;  1OOP A;  2QDN A;  3R4S A;  1KQR A;  1R08 1;  4OCT A;  3U0Z A;  1UOF A;  1B35 A;  2ARA A;  4LBN A;  4V2W A;  5FZF A;  3WX5 A;  2W1W A;  4D69 A;  3UKN A;  1W8W A;  5CNA A;  2G19 A;  3TRS B;  2X09 A;  1PM7 A;  4MSV A;  2TNF A;  4BPZ A;  2JDY A;  2VCA A;  3JD7 1;  3B94 A;  4XUR A;  5CA6 A;  3RZL A;  1QKQ A;  4A45 A;  5FP8 A;  1RUE 1;  4OHV A;  1O4T A;  2Y8K A;  1PVC 3;  3NL1 A;  5APA A;  3VBH C;  2DYC A;  4FOQ A;  1JHN A;  3O5S A;  5JXH A;  1CES A;  3LA2 A;  1GNY A;  4K6B A;  2WN2 A;  4R8H A;  1HX6 A;  2YV8 A;  4IEX A;  2DTW A;  3WSO A;  5EFU A;  3ZR5 A;  4LKF A;  2JG9 A;  3SHR A;  2WFF 1;  1Z7S 3;  3EYP A;  4ASL A;  4I0W B;  4BE3 A;  3QBQ A;  1GYK A;  3MIC A;  1NLQ A;  3ILN A;  4Q0V A;  1GQP A;  3MUY 1;  4NIH A;  2JDU A;  1ULC A;  1PIV 2;  2EAA A;  2WLP A;  2Y0I A;  3WQ0 A;  1C57 A;  3MF6 A;  4GAZ A;  1H2L A;  1OD3 A;  4XQ4 A;  3VL8 A;  4DXR A;  5FYZ A;  3OPT A;  1AJO A;  1YEW A;  1O59 A;  4XDQ A;  3ZVX A;  3LIG A;  1EUU A;  2Q8E A;  1C4R A;  4CXY A;  2ADD A;  3PVB B;  3PU8 A;  1GOH A;  2PLV 3;  4Q1R A;  3B7M A;  4LHS A;  2BBV A;  3VZK A;  1I9R A;  4M0N A;  3CL1 A;  4IW3 A;  2R07 2;  1W6M A;  3BIE A;  1YQ2 A;  2BGP A;  2WIN B;  3M3I A;  4YM1 A;  4A3X A;  5LA9 A;  1FOD 2;  3P1I A;  4NUB A;  3VN4 A;  4D7Y A;  1VAM A;  3URF A;  1X9P A;  1UQX A;  2EIE A;  4RFR B;  4HSL A;  5A70 A;  1E5S A;  2AZ5 A;  1QOT A;  4HG6 B;  3V0B A;  1XNK A;  1T6B X;  4H7L A;  2QVS B;  2CU5 A;  2OW4 A;  4RR3 C;  2WAO A;  5LY2 A;  3ZMN A;  2FMY A;  2W1U A;  2B39 A;  4GUL A;  4PBP A;  3ZYG A;  5A33 B;  1ASJ 2;  3JXS A;  3N9P A;  4YG3 A;  5KC6 A;  3DPR A;  2QZ2 A;  1ZRR A;  5IWF A;  5J1X A;  4N7U A;  1SLT A;  4DUX A;  4YVS B;  2ZX0 A;  5A7W B;  1AZD A;  1JBC A;  1QXJ A;  4KU7 A;  1SFP A;  4IES A;  3VBR C;  4NIG A;  1UX6 A;  2JKB A;  1UY0 A;  2JKX A;  4BDV B;  4Q4X 1;  2R30 A;  1D4V B;  5JZG B;  5KC5 A;  3E5U A;  2YBP A;  3PIJ A;  2A3X A;  2MEV 3;  1WLT A;  2HWD 1;  3UET A;  2XGX A;  5EIY B;  5FAX A;  3AMH A;  4MXW A;  3SCF A;  1UZW A;  1X8E A;  3KQ4 B;  4URT A;  5D8A B;  1X33 A;  3JZV A;  1QJU 2;  3LEI A;  1WBL A;  1ZZ8 A;  3POJ A;  1D0H A;  3NNG A;  4TYS A;  5JPM B;  5KXC A;  5A7N A;  2BPA 2;  3FL7 A;  4Y5S A;  2A7A A;  4N43 A;  1AYM 2;  1RL3 A;  3ACF A;  4I09 A;  3ROU A;  2HBU A;  4QM9 A;  1HW5 A;  4MGS A;  4GH4 B;  4LKS A;  1HXS 3;  3J8F 2;  3KCY A;  5FYV A;  1QJX 1;  3DEC A;  2BQP A;  1JTZ X;  4RA0 A;  3OBZ A;  2VTF A;  4ES8 A;  1VBD 2;  2CSG A;  2V72 A;  4FAH A;  1S2K A;  2E51 A;  4XAA A;  1PO2 2;  4XOG A;  3ZMO A;  4XF3 A;  1V6I A;  2L9L A;  3E6C C;  4CXW A;  3AYC A;  5FO9 B;  4Y22 B;  1AXY A;  4CCL A;  4OHX A;  4QU2 A;  1O5U A;  2EAK A;  1HDK A;  5JXG A;  1RXG A;  3OY8 B;  4PCR A;  2XBO 3;  1VBC 1;  2FDI A;  5IVY A;  2ZML A;  1RC6 A;  1D4M 2;  2VZQ A;  2ZHM A;  5JOX A;  5K7P A;  1OA3 A;  3PVN A;  1CZV A;  1YIF A;  1XSR A;  4A41 A;  4F83 A;  3EMR A;  4YM3 A;  5JMC A;  1JZ6 A;  1VBB 3;  1A6C A;  5FZ1 A;  1Y4W A;  2KD7 A;  2MNG A;  1MZ6 A;  2VUJ A;  3BI3 A;  1EV1 3;  2BGC A;  5L73 A;  3BU7 A;  4JDN A;  1W6O B;  5A3P A;  1T2X A;  2V5Y A;  2XJP A;  3WEZ A;  4KG8 A;  1TME 2;  1CAW A;  2D6L X;  4AGG A;  2QJV A;  2ZOE B;  3MIH A;  1O4Z A;  1JYW A;  1BBT 2;  2XLG A;  1KDM A;  2EXJ A;  4ISQ A;  4N9I A;  5J48 A;  1FMD 3;  4BXS V;  1QJY 2;  1W0P A;  1S2E A;  2XHN A;  2VME A;  4J1W A;  2D43 A;  4PF5 A;  5EYX A;  5FK8 A;  1RUF 1;  2Y33 A;  2JB8 A;  5J37 A;  1NY7 1;  1O7F A;  1UWW A;  3DXT A;  2RS3 1;  4R4X A;  4Y1V A;  2XML A;  5A3M A;  5HI0 A;  3CJX A;  4TN7 A;  2YY1 A;  2GMP A;  5E1R A;  4GWN A;  3BTY A;  1ND2 C;  2GND A;  3I3E A;  3E97 A;  3OSD A;  3GGL A;  4E27 A;  4CU7 A;  5F1R A;  5A7Q A;  1JYI A;  2YPD A;  3VZM A;  3SC7 X;  2HJI A;  2BER A;  1JH5 A;  3KVB A;  4TLF A;  2DVG A;  5DQ0 A;  3B69 A;  4WM8 C;  1HRI 1;  4FAG A;  5CKN A;  2VD7 A;  5J7M A;  2R32 A;  3III A;  1UF2 C;  3ZYF A;  2WT2 A;  3ZYH A;  3WG3 A;  2AUY A;  1O91 A;  2BGO A;  2AH2 A;  1W6N A;  4ITC A;  3WOG A;  4A6S A;  1DZR A;  4LO7 A;  5F6K A;  1UN1 A;  4YW3 A;  3OGG A;  3U14 A;  4A4A A;  1J84 A;  2Z79 A;  3AP7 A;  4FCA A;  1IS6 A;  1AXZ A;  2UWB A;  3WP6 A;  4NR1 A;  4XCA A;  5A1L A;  1S0F A;  2ET7 A;  1IPK A;  4COY A;  1GNZ A;  2RJK A;  3J26 N;  4EN6 B;  4ET7 A;  2JDP A;  1H1M A;  1CR7 A;  2XVK A;  3KD4 A;  1YCI A;  3NST A;  5B2G B;  4H55 A;  4QX3 A;  1EAH 2;  2FD8 A;  3ES4 A;  3D0J A;  3WF3 A;  4LBL A;  4JRL A;  3MGU A;  4B7E A;  2LTN A;  2FDJ A;  3AMQ A;  4PI2 A;  3I3M A;  1UY3 A;  1AJK A;  1K5M C;  5GZE A;  4WVM B;  1CZT A;  1REE A;  2CAU A;  2VJX A;  1Y3T A;  2E26 A;  1L7Q A;  4JV4 A;  4AI1 A;  4MAD A;  1R1Z A;  5FP9 A;  5CKM A;  3WF2 A;  4CUA A;  5JXI A;  4B7K A;  1DIW A;  4FTB A;  2O1Q A;  3W21 A;  1PX3 A;  4KQ7 A;  4NRQ A;  5LBE A;  4EN8 B;  1AYN 3;  1NOV A;  4QU1 A;  1WCS A;  3Q8B A;  4UAP A;  3WW4 A;  5A6Y A;  1GAN A;  4LOT A;  1LJ7 A;  4BM8 A;  1GIC A;  1NA1 A;  1XXN A;  4FXG B;  4MG2 A;  4IXL A;  4XHX A;  3LWC A;  4UBG A;  3SEE A;  5LW9 A;  1V70 A;  3B01 A;  4ATF A;  2PQS A;  1WBF A;  4PDW B;  2VQT A;  3MIF A;  2A5Z A;  5F5A A;  4CPB A;  3VDA A;  1H6Y A;  1HRV 2;  1WZX A;  1AL0 G;  2RMU 2;  1DLC A;  2H6B A;  2XJV A;  1DGR N;  4XUP A;  4K3U A;  4XFF A;  1IG3 A;  2BU9 A;  4N9H A;  4EQV A;  2VMG A;  3A21 A;  3DUI A;  4QPW A;  4NHM A;  5IK8 A;  4XZU G;  4A42 A;  3SLI A;  1FT9 A;  3VBO A;  3RI9 A;  1S0E A;  1SQ4 A;  4MVT A;  4P9W A;  3NJX A;  5ABJ A;  5EP9 A;  4XAC A;  1WW5 A;  2GP3 A;  4UWD A;  4CEW C;  4CSW A;  1J58 A;  1H6X A;  2C26 A;  4KGG A;  1MEC 3;  4YVS A;  1JZ2 A;  5BXX A;  3LQC A;  1LEC A;  3LSE A;  1AR7 3;  1XND A;  3O12 A;  1PIV 1;  3VBR B;  2WZR 3;  1H30 A;  4XJW A;  4CU9 A;  1ONA A;  1RUH 2;  3GJA A;  1N3O A;  4PI0 A;  1FNZ A;  5B4X A;  1CAU B;  2BBA A;  2W87 A;  4PT6 A;  4B3N A;  5JZG A;  2KM2 A;  4IE0 A;  3RFR A;  2YUE A;  1K12 A;  4KGQ A;  1DU3 D;  1N47 A;  2C1F A;  3HNB M;  1ZA4 A;  3NKG A;  1NCR C;  5CFD A;  5CAZ A;  4JHT A;  3PME A;  3K4A A;  1GWM A;  4G3Y C;  4P9L A;  2R07 1;  1K42 A;  1WW7 A;  3ZXE A;  4AHW A;  4P9G A;  5CU1 A;  1EYB A;  2HWC 2;  5LBC A;  3U07 A;  3VBU B;  2XB6 C;  3U10 A;  1FOD 1;  2EA7 A;  1HQN A;  2BZD A;  3LOI A;  3POB A;  5E16 A;  4B1L A;  4FTE A;  2QCS B;  4IV1 B;  5EJ3 A;  3GJB A;  4WVW A;  1DZT A;  5CBL A;  2E7T A;  2HYK A;  3KM5 A;  3AB0 A;  1I1E A;  4LIU A;  1ASJ 1;  2GC0 A;  1AR6 3;  2YPJ A;  2E31 A;  1X9T A;  4HVR A;  3TN9 2;  1MS8 A;  2RR1 3;  4XFG A;  4FT8 A;  1B35 C;  1J83 A;  2ZEW A;  3MYX A;  3NNL A;  4XQW A;  2YZ4 A;  3AMM A;  5DDJ 2;  5A3L A;  3IAQ A;  1OPO A;  3ZIX A;  3VDB A;  2ZZJ A;  3OY8 A;  1MQT B;  4RL7 A;  4JHZ A;  5FFO C;  3ZXF A;  3K77 A;  1G9B A;  1BXH A;  2DVF A;  4D6S A;  4BU2 A;  1E5I A;  1QXP A;  2ZHL A;  3V56 A;  2FBE A;  3D82 A;  1AR9 2;  2RJ2 A;  3MIG A;  3ZN6 B;  5BNQ A;  5LZ6 A;  2JG8 A;  2ZKN A;  1BK0 A;  2ZAB A;  1IOA A;  2GC2 A;  1QJU 1;  1H2K A;  1W6O A;  3AVR A;  3MLK A;  4GMP 1;  4K7J A;  4B8E A;  1E5R A;  1QQP 3;  3POG A;  4XZP A;  4AI8 A;  5F2S A;  4SBV A;  4I0B A;  5HCF A;  1RMU 2;  2JIJ A;  3KVA A;  4A7K A;  4CDU B;  3RGB A;  2Q1Z B;  2VQA A;  3EHK A;  3FLT A;  4XW3 A;  5FZM A;  4C90 A;  5KXE A;  1XYO A;  3IPV B;  5IHR A;  2WA3 A;  1DQ0 A;  1FPN 3;  1D0G A;  1CAV A;  1JN2 P;  4ASK A;  4LO8 A;  1W6Q B;  2WJS A;  4ASM B;  5A6Q A;  1G86 A;  3R05 A;  5FYI A;  1PO2 1;  2VZ3 A;  2X5I B;  4KWK A;  4UF0 A;  3OOX A;  4EV0 A;  2X8K A;  2YFU A;  5KHG A;  1V6J A;  2J1U A;  2DCY A;  4CE8 A;  1YRZ A;  4Q26 A;  4AED C;  3FZ3 A;  5FMO S;  4JTN A;  2XQX A;  1Y43 B;  3MPB A;  1J1L A;  5F39 A;  1D4M 1;  1G9D A;  2PAE A;  2C24 A;  1Q8O A;  3GZE A;  2R04 2;  3APB A;  5FCC A;  2OUH A;  4MHR A;  5IFP A;  5L19 A;  3IM0 A;  1QY4 A;  3OB8 A;  1NYW A;  1XNA A;  2NMN A;  3C7F A;  1JUH A;  5HCB A;  5JI9 A;  5FXZ A;  2QQM A;  3DPR C;  3E6B A;  3ABZ A;  3HMY A;  4RS5 C;  4XTP A;  5H9S A;  1UMI A;  3WW2 A;  2P3Y A;  1TME 1;  1VR3 A;  3AZY A;  5KHJ A;  4OI0 A;  2PHD A;  3HR9 A;  5FZO B;  5BNP C;  4YGE A;  4DB5 A;  1BBT 1;  3CJI B;  4XFA A;  1WMD A;  1LHN A;  2GH2 A;  2NM1 A;  2IXC A;  3OGV A;  1OQD A;  1QJY 1;  2BNN A;  4FPO B;  4W6W A;  3SXW A;  2QDR A;  2WO3 A;  1H8V A;  2VMI A;  1BKZ A;  3OGS A;  1RUI 2;  2QKD A;  1HIX A;  2ZXQ A;  2EAL A;  1UW8 A;  5LBB A;  4D94 A;  3QH6 A;  4HAN A;  4P9Y A;  5JMO A;  1ZRD A;  2QQN A;  1CPN A;  4G9S B;  2RM2 2;  2VC9 A;  2GP5 A;  4XMI A;  2WNE A;  4MGT A;  5C8C C;  3P3N A;  2VNR A;  3ZOI A;  3ZPO A;  2A6X A;  2A73 B;  1LB2 A;  3ZYJ B;  1R1A 3;  2BP6 A;  4NWV A;  1ZRI A;  3CKH A;  4UW4 A;  4CCO A;  1UKR A;  2PFW A;  1YNA A;  2XHK A;  2ZGP A;  4QQH A;  3RSJ A;  1GZT A;  4COZ A;  1OKO A;  5J3U A;  1TMF 3;  4RN5 A;  3C7G A;  3ZSE A;  3NV2 A;  1AX1 A;  1JU3 A;  3P3P A;  1Z0H A;  4CCK A;  1L3J A;  2XPJ A;  1C28 A;  3THT A;  4PDW A;  3LDR A;  4MGZ E;  1O3R A;  1DFQ A;  1H2M A;  3RI8 A;  2HH9 A;  3WNN A;  1HB4 A;  5CFC A;  2FQP A;  2JIC A;  5A1A A;  3JU9 A;  1S0G A;  3KV6 A;  3N35 A;  4K21 A;  4MGK E;  2FDH A;  4HBN A;  3MI8 A;  4IET A;  4JKM A;  1RUD 3;  5FP4 A;  1LU2 A;  1EAH 1;  5BNN B;  2O8O A;  4Q1P A;  2VVF A;  3ES1 A;  4YLZ A;  4LKD A;  1RHI 2;  1QMJ A;  2KA3 A;  4CEW B;  5FYY A;  2WFF 2;  4EZH A;  1RUG 2;  3ST7 A;  1ZBE 3;  2CYF A;  4AEJ A;  3U4X A;  1ULF A;  4PJY A;  5DZE A;  5ANQ A;  4UW6 A;  3RS6 A;  4UI9 L;  3NRU A;  3PUS A;  4RQP A;  4LUM A;  1V6M A;  5FZL A;  2LS6 A;  3NKT A;  4XIO A;  3RYK A;  4BME A;  2JEN A;  4Y1X A;  5A3N A;  3IDC B;  3TYJ A;  4WZC A;  2WNO A;  4J25 A;  1PHM A;  2RDQ A;  2WKK A;  3MLL A;  4UFL A;  3VLB B;  1K3I A;  5C4W C;  5DAP A;  2ZMK A;  2BW8 A;  2GC1 A;  2KR2 A;  5FZI A;  3M3C A;  1ACC A;  1HRV 1;  1LHU A;  1YJL A;  2ORX A;  2RMU 1;  4LMF A;  3VV1 A;  3VUO A;  3T0B A;  3T09 A;  3I2J A;  2VCM A;  4XFH A;  4CYD A;  2HEY F;  3LGR A;  1UU4 A;  3FMG A;  4RGG A;  5I0T A;  1QNY A;  4IV1 A;  2VMF A;  5FY9 A;  1IKQ A;  4BK4 A;  1ULO A;  5GZC A;  4AGR A;  5IK5 A;  3HBZ A;  4GZ9 A;  1U5Y A;  1MS3 A;  5BNO C;  4BIF A;  2VZO A;  1GBG A;  3J7L A;  4AI2 A;  1W9T A;  4A6O A;  1JZ3 A;  5ACA 1;  2YHJ A;  2XJU A;  5CIR A;  1BYH A;  1CQ9 A;  1VPH A;  2N7G A;  3JB8 A;  1R09 2;  1ZBA 3;  4DXZ A;  3H8X A;  1CVN A;  1HQW A;  3HT1 A;  1MQT A;  3HWJ A;  4ZS2 A;  1GWK A;  1PGW 1;  2A6W A;  3BOP A;  3Q8C A;  1RUH 1;  4QMA A;  3VD5 A;  3IIA A;  4Q4X 2;  4GKY A;  3VKN A;  5FPL A;  2CDP A;  1V6N A;  1LOF A;  4AVV A;  4AL9 A;  5F9T A;  2G4I A;  2AEN A;  2DCJ A;  4OZX A;  4UT5 A;  3ZFE B;  3ZN6 A;  3I3Q A;  4GB3 2;  3WD5 A;  1CIW A;  2E32 A;  1DQ1 A;  4Y33 A;  3VDD B;  3SIT A;  1WCQ A;  3TAY A;  2DU0 A;  4LBQ B;  1JYT A;  1FV3 A;  3KZ4 C;  4CDW B;  1CX1 A;  2R6Q A;  3H1M A;  3P6B A;  2R7E B;  4Y5Z 0;  2HWC 1;  3LEM A;  3NNJ A;  3RVH A;  4QX0 A;  1ND3 A;  3N7K A;  4WVZ A;  4CDU A;  4ZXK A;  2D6O X;  2PHX A;  1QJX 2;  2VZR A;  4GQ7 A;  5L36 A;  2V5D A;  1QH6 A;  2VE1 A;  3DYM A;  3K2O A;  2ZZQ A;  2NPI A;  3LFM A;  1ZRF A;  1OT5 A;  4YRD A;  1QJF A;  2G9G A;  2UY9 A;  2W2I A;  4Q0P A;  1C8M 1;  5FY0 A;  3WT3 A;  5FUN A;  1PMI A;  4L11 A;  4RHV 3;  4CDX A;  2XJT A;  2HKX A;  5I0U A;  2X5I A;  1VBE 2;  3PHM A;  1UO9 A;  3TN9 1;  1SLL A;  1BLZ A;  5FPV A;  2Q8C A;  5FP7 A;  5AVP A;  1IGO A;  2UUR A;  1VB2 A;  5DDJ 1;  4YW7 A;  4D0Q A;  1ZZ7 A;  4Q4W 3;  4MV2 A;  4AW7 A;  3DL3 A;  1Q56 A;  4AYU A;  3EQE A;  1HLC A;  3K75 B;  3ZFG B;  5HV0 A;  1WCD J;  4MOA A;  2ZGU A;  3L2H A;  4NRM A;  5FZ3 A;  3B5L B;  1AR9 1;  2YRO A;  3VBO C;  4P08 A;  4AFB A;  4FXK B;  4ZON A;  2BFU S;  3M70 A;  1V9U 3;  2DCT A;  5ABJ C;  1QXR A;  3NVC A;  4H3W A;  4CDQ A;  4WVV A;  3N36 A;  5JOY A;  1EUT A;  5K0U A;  4LEJ A;  2YG0 A;  4XUQ A;  3LFI A;  5FP3 A;  1RMU 1;  2VH9 A;  5JOW A;  3AC0 A;  3GZA A;  1RUO A;  5G04 L;  2ES3 A;  5FZO A;  2AR6 A;  1XPW A;  3ZSK A;  2DUQ A;  1BHG A;  4UOJ A;  4B4P A;  2PHT A;  2VY0 A;  2YU1 A;  3PVE A;  2JXA A;  4QX2 A;  1J3Q A;  1AHS A;  4COW A;  5H9Q A;  3SCG A;  2RS3 2;  2A1X A;  2YGL A;  5JSR A;  2PAK A;  4XYX A;  1LR5 A;  2Q5T A;  4DFS A;  1UMZ A;  2IXI A;  4UW3 A;  5L9B A;  3WF4 A;  4AQT A;  3CU7 A;  4ONU A;  3NV3 A;  5HPO A;  4IDZ A;  2HWB 2;  2XR4 A;  4UFJ A;  3WUD A;  4BIO A;  2CTV A;  1EPZ A;  3PLQ A;  5DUX A;  3AYA A;  2DWR A;  4EWA A;  2W92 A;  5FYS A;  2WAA A;  1K5J A;  2DTY A;  1HN1 A;  4CP0 A;  2R04 1;  5G05 L;  1DGW A;  1RJ8 A;  2IUW A;  4AHY A;  4JC1 A;  1LHO A;  3ORJ A;  4OI4 A;  2Y6K A;  2QTW B;  3C2U A;  1W0O A;  2VBB A;  3KCC A;  4PLO A;  2X53 S;  5LRR A;  4P9J A;  1K45 A;  2P6H A;  5I8Y A;  2CWS A;  2HBT A;  2Q30 A;  5A7P A;  4ZU7 A;  2Z42 A;  4TZD A;  1LRH A;  1QOS A;  1YI9 A;  1GLH A;  3ACI A;  4Z92 B;  3HPN A;  3NAP C;  2GAL A;  2XDV A;  3H0O A;  3VBS B;  4XUO A;  2ZAC A;  4AOC A;  5IFT A;  2GDF A;  3KT7 A;  1MZE A;  1W8U A;  5EHD A;  5BNN A;  1C8N A;  2WL1 A;  3OEA A;  1W9Y A;  2IZW A;  3M3O A;  3VZL A;  1AR8 3;  2JDZ A;  2JG8 C;  4R9C A;  2OS2 A;  4MGQ A;  5FDB A;  1TG7 A;  5EV7 A;  5DN2 A;  2RM2 1;  3MFC A;  3RNS A;  1AXK A;  3BAL A;  4C0H A;  3AVS A;  2ZA9 A;  1IQA A;  2I45 A;  4Z07 A;  4AQ6 A;  2PHL A;  3KF5 A;  4R52 A;  1NE4 A;  3ZSM A;  4JGY B;  2I74 A;  4LA3 A;  5FZ7 A;  2RS5 3;  1YFW A;  4LLF A;  4DMI A;  3WDY A;  1ZA7 A;  1W2T A;  4QQO A;  3T0A A;  3ZXL A;  1WUV A;  1S0J A;  1ULE A;  2DVA A;  1A8M A;  2GNT A;  4Y24 A;  1UYP A;  5ERL A;  4R9A A;  1RUJ 1;  1G6N A;  2WNU C;  4I01 A;  2R06 3;  4N90 A;  5F3I A;  2XL9 A;  3FC0 A;  5F6L B;  1UZ0 A;  4OHW A;  4H14 A;  4YGD A;  4XF9 A;  2VMD A;  1H9P A;  1OF4 A;  1HN0 A;  3MIB A;  4X8N A;  4NHK A;  1Z7S 2;  3ILR A;  3PU3 A;  4NHL A;  5FRA A;  2OYZ A;  3VZN A;  4XAB A;  5HCA A;  2ZGO A;  4E8C A;  2GN3 A;  1W8H A;  4LR4 A;  2H0B A;  3FLR A;  2QUO A;  3PJQ A;  1N3P A;  3AFK A;  1RHI 1;  4NRP A;  4Q8K A;  3H1W A;  2AAC A;  2AC1 A;  1RUG 1;  4L9B A;  1UZZ A;  3UGH A;  2B46 X;  3T2O A;  4YVW B;  1PK6 C;  2XVG A;  3HQX A;  3NNM A;  3RMX A;  1TNR A;  2XL7 A;  2PLV 2;  2D3S A;  1H8T C;  1O3S A;  1HV0 A;  1OLM E;  1UYY A;  1SZB A;  5A3U A;  5KBF A;  1RVF 3;  1SPP B;  4CCM A;  3ZFE A;  4YW2 A;  4LUL A;  1QOO A;  1XU1 A;  5JUV A;  2ZTN A;  3C7H A;  3VDD A;  3GHM A;  5FPZ A;  2OA2 A;  5CEH A;  1UXZ A;  4B4Q A;  4J6G A;  4C1W A;  4CDW A;  4Z2W A;  4FFI A;  3INA A;  3I2D A;  2XLA A;  3KS7 A;  2Z2S B;  2ZEY A;  4N53 B;  2Z5W A;  4CP1 A;  3OEB A;  4RGK A;  1ZZ9 A;  2ZGR A;  3R4U A;  3H7Y A;  1NUK A;  3ZKU A;  3RYR A;  5FWJ A;  2OX0 A;  5FBZ A;  4BA6 A;  3LZZ A;  3NNF A;  4XVH A;  3WNL A;  5FZ6 A;  1GWL A;  2W08 A;  3M4F A;  3QAC A;  4ZU5 A;  4XIL A;  4G4F A;  4YWA A;  4GJY A;  4YFW A;  4DPN A;  5IVE A;  1A8D A;  4YFZ A;  5J36 A;  3GXU A;  4H2A A;  2FHR A;  5I0D A;  2EIG A;  4JRA A;  5LRS A;  3IN9 A;  3HAG A;  3KWV A;  2MEV 2;  3JBG 3;  4QXB A;  2WSU A;  4WM7 C;  2D3P A;  1ENS A;  3Q9O A;  1YWK A;  2ZHN A;  1R09 1;  3K4D A;  5GKA C;  2RJL A;  3J7M A;  1GOG A;  5C5T A;  4GA9 A;  3MHZ A;  4IND A;  1GZW B;  3MBW A;  4JCK A;  5CFC C;  3DCQ A;  1POV 1;  3ZFG A;  1UU6 A;  5T52 A;  2BUK A;  3UGF A;  4N8M A;  1NCQ B;  3PUH A;  5IUQ A;  5HCH A;  5FPA A;  2RVA A;  1OQ1 A;  4GB3 1;  5L7O C;  2H0V A;  5D2A A;  4A7Z A;  3VGI A;  2WAB A;  2FMD A;  5F2W A;  5FY7 A;  4Y3O A;  5FBJ A;  3EB7 A;  3D6E A;  2ZX2 A;  4RQP C;  5IAT A;  4XJ8 A;  2WNV C;  4KG0 A;  1RXF A;  2GH8 A;  2VMH A;  3FFQ A;  5AC9 3;  5T50 A;  1LES A;  2WN3 A;  4AVC A;  5LCW L;  1UIJ A;  4UFM A;  1H0B A;  4K20 A;  1MVQ A;  2XBO 2;  1JOJ A;  4IV3 C;  1OUX A;  2VTX J;  5C9A B;  1VBE 1;  3LPF A;  4IE4 A;  2Y0O A;  4XQD A;  4XBN A;  4CZS A;  4MX3 A;  1PNF A;  1W6P B;  2XON A;  4JKL A;  5EJZ B;  4FO9 A;  4OYU A;  1EV1 2;  4OUL A;  2CAV A;  1DQ6 A;  4AAX A;  1UXX X;  1V9U 1;  2VTX A;  3A4U A;  5B4N A;  2NP0 A;  1L7L A;  1O8S A;  3H7J A;  3UT0 A;  3WF1 A;  4AK3 A;  1KS5 A;  2VCC A;  2OT7 A;  3KGZ A;  3KMH A;  5BY5 A;  1WW6 A;  1LTE A;  2WII B;  1AL2 3;  2JEC A;  4Q4V 3;  2PYT A;  5FLI A;  3ZFF B;  4BQ2 A;  4EJR A;  1AYM 3;  3LF7 A;  3LPG A;  4HKO A;  2ATF A;  2WWJ A;  3T4H B;  4XTM A;  5CZK A;  3I49 A;  3WP5 A;  4XHB A;  3J8F 3;  1FMD 2;  3C7E A;  1MPX A;  4S2F A;  1W05 A;  2XJS A;  2BRT A;  1V00 A;  3SEP A;  5I8T A;  1Q8P A;  1VBD 3;  5KHI A;  4XDP A;  3VBF A;  1XNC A;  3V65 A;  5KXD A;  1NT0 A;  1QDC A;  5FMO L;  5FK7 A;  4CP9 B;  2HWE 3;  2VOX A;  1RUC 3;  2QQL A;  4KWJ A;  2ZS6 B;  1RIR A;  1DHK B;  2D5F A;  2OUJ A;  1OC1 A;  3EBR A;  3SMH A;  5DZF A;  2IXJ A;  4ARY A;  3PUQ A;  5DAW A;  1LGC A;  2LRP A;  2VQ0 A;  3VD7 A;  4HVO A;  3J9S A;  4O65 A;  1O6U A;  1KFX L;  3VD4 A;  3BU0 A;  4DUW A;  2HWB 1;  5JR7 B;  4QKN A;  4DEV A;  2ZAH A;  1ND3 C;  3TB0 A;  2JDK A;  5A32 B;  2RG4 A;  3AP4 A;  2ARC A;  5JSP A;  1NQD A;  3AK0 A;  4DY3 A;  3HD8 B;  1TNF A;  4CEY C;  1SHW B;  5DPN A;  3DKQ A;  2Y6J A;  5DAV A;  3RMY A;  3KT4 A;  4KI5 M;  3NJV A;  4Q4Y 3;  3RZK A;  2VZS A;  4CDX C;  5F7U A;  4BQX A;  4JVA A;  2ZAA A;  3T4V A;  5T5J A;  5FQ0 B;  5IVB A;  3AFG A;  1OUR A;  3ASI A;  1PZ8 A;  1DYK A;  5D21 A;  1OVS A;  3PIG A;  4YGB A;  2TBV A;  4F8A A;  2DFC A;  4M3C E;  3LA3 A;  4R4Z A;  4LO6 B;  4MH0 E;  2Q1F A;  3DEM A;  2WS9 3;  2CY6 A;  1A3K A;  4JGZ C;  4QPI C;  1CIY A;  3QLQ A;  3VBH B;  4FQZ A;  5LWB A;  4E4D X;  3CZJ A;  4QPG C;  5FYB A;  1SCR A;  4IEY A;  4BK5 A;  2JDN A;  5FZ8 A;  3S7I A;  1AYN 2;  1VJ2 A;  2Q1M A;  4DRV A;  1DCS A;  4IGO A;  2ENR A;  1QJE A;  1VRB A;  2NMO A;  4YVW A;  1N1V A;  3JUU A;  4IE5 A;  5K0U C;  2VZU A;  2PAM A;  1UOB A;  2HEW F;  2D7F A;  1VE0 A;  4LO5 B;  3HN3 A;  1WD4 A;  3SQO A;  3GBW A;  2QQJ A;  1UOJ A;  4BB3 A;  5F32 A;  3TEZ A;  3OPZ A;  1PGL 2;  4YM0 A;  4LT5 A;  1ZVF A;  4FP2 A;  1W2O A;  1YUD A;  3TEX A;  3KV4 A;  1W2U A;  4C1X A;  1SAC A;  3I2I A;  3WNM A;  4YSF A;  5FO8 B;  1PVC 1;  2UWA A;  2VCB A;  1FNY A;  1OUS A;  3DV8 A;  3MV1 1;  3K51 A;  3OF1 A;  1VB4 A;  4QWN A;  1Z7S 1;  3O14 A;  4JAA A;  4LK6 A;  1BEV 3;  2D6K A;  2W46 A;  4RR3 B;  4TXW A;  3THC A;  1MEC 2;  1E5H A;  5LEK A;  1OPM A;  1GR3 A;  5A33 A;  2WZR 2;  2VOK A;  3S5Q A;  1NE6 A;  4AWD A;  4YW6 A;  2ZBJ A;  3Q8E A;  2ET1 A;  5ACA 2;  4MET A;  1RVF 1;  2VZ1 A;  3FUO A;  3UYJ A;  4O9E A;  4L99 A;  5A7W A;  3E1F 1;  5EWS A;  2C4X A;  4LK7 A;  1NLR A;  3N9N A;  3JQX A;  1PGW 2;  2PLV 1;  4FPK A;  4GKX A;  1HKD A;  1W06 A;  3ZXA C;  3FFZ A;  1GZW A;  3C7O A;  1TEI A;  3OUI A;  2WZ8 A;  1HJF A;  3RRD A;  1NCQ A;  5EYY A;  3OUH A;  5SV8 A;  3AZZ A;  2GME A;  1W28 A;  1WGP A;  4BCU A;  4GXL A;  4XE9 A;  5D8A A;  2IXL A;  3MW2 A;  5IYY A;  5LEJ A;  3NQH A;  3WQB A;  4CUG A;  3AMN A;  5FXW A;  5C8W A;  1H9W A;  3MF9 A;  2A3Y A;  3SCH A;  3M3E A;  4GH4 A;  1AR6 2;  1KXG A;  2DVB A;  3ZYP A;  1DYO A;  2A6Z A;  4BLI A;  3CDZ B;  4A3Z A;  1COV 3;  2WNV B;  4JDO A;  4ZXE A;  2RR1 2;  3A7Q A;  1LOE A;  4N7I A;  2Q0A A;  1C8M 2;  4LNV A;  1V6O A;  4BQ4 A;  3BGA A;  3POE A;  5CG9 A;  2X10 A;  3MUZ 1;  3I54 A;  2VNG A;  1OBN A;  3FHI B;  3H8O A;  5C9A A;  5AFB A;  1OOP C;  2NZ9 A;  3QOP A;  4Y22 A;  4NIA A;  1PO1 3;  2MEV 1;  1M4W A;  3ITQ A;  4SLI A;  2J7M A;  4NE9 A;  4XDO A;  4UFH A;  5FPB A;  4Z1V A;  1W6P A;  3F2Z A;  4JX0 A;  5FZ9 A;  4DUV A;  5FZC A;  4HN1 A;  2J1A A;  5C70 A;  1QQP 2;  2UWC A;  3LD8 A;  3OBT A;  1CAX B;  2JD9 A;  4HL0 A;  4Y5T A;  2WT1 A;  2ZX3 A;  4I0A A;  3ZFF A;  4A44 A;  4BZ4 A;  5F37 A;  2O8Q A;  3OGJ A;  1HXS 1;  3VHP A;  5D1I A;  1Q8S A;  2XVL A;  1YLL A;  2JG9 C;  5FY5 A;  2DCK A;  2F6B A;  4D6R A;  4JKK A;  1FPN 2;  4YG0 A;  5F3E A;  4L92 A;  1JMU B;  2BYV E;  4L97 A;  4EN7 B;  1AX0 A;  3RZM A;  4CP9 A;  4C91 A;  1JS9 A;  4AAP A;  3HNM A;  5IAX A;  4NPL A;  1POQ A;  3C8X A;  5FZ4 A;  2EIB A;  2XBO 1;  3BVC A;  1QU0 A;  1VBA 3;  4XC9 A;  1XE0 A;  1YQ5 A;  3FUQ A;  2BFU L;  4DXT A;  4Y4R A;  3WNX A;  5BUV A;  2D6P A;  1ND2 B;  1F5J A;  4A2U A;  5KR7 A;  1CGP A;  3S30 A;  3ENR A;  1VBB 1;  2WZE A;  5AFE A;  2BVV A;  1GNH A;  3D8C A;  5E8A A;  3T2Q A;  3O1T A;  2NYY A;  1EV1 1;  5C71 A;  3GZU C;  5CVR A;  3I59 B;  3S6P A;  2RDS A;  2VZT A;  1BQP A;  3ZR6 A;  4WM8 B;  2RS1 3;  3BKZ A;  3O1M A;  3VZJ A;  4S2G A;  4LQR A;  4Y26 A;  2F17 A;  5J98 B;  1OVP A;  3MPP G;  3FX3 A;  4DNY A;  1DDL A;  1XU2 A;  3N9M A;  2E7Q A;  1UYZ A;  4AVS A;  4W4Z A;  1YXW A;  4MUV A;  1FMD 1;  1QEX A;  1SCS A;  4BWO A;  1WW4 A;  4E4S A;  5C3Q A;  4CXX A;  3SH5 A;  4QX5 A;  4OVE A;  4DIN B;  2QQP A;  2ARB A;  4AQS A;  1KS4 A;  2WR9 A;  4B29 A;  1SDW A;  3I3B A;  1DBN A;  1H1I A;  4XEZ A;  4Q2F A;  2GNB A;  4OQ9 A;  4QPI B;  3CIH A;  4NHX A;  1VMF A;  2Q8O A;  3VBH A;  4XJZ A;  1SFN A;  2ADE A;  3PUA A;  2G9F A;  3P5B A;  5ANN A;  1R1A 2;  5GLZ A;  4DS0 A;  1K5M B;  4JZR A;  1VRH 3;  1RUN A;  3EJK A;  4WVM A;  2JIG A;  1TMF 2;  4I2O A;  4N43 C;  5CKQ A;  2RV9 A;  2Y26 A;  4P14 A;  3H8R A;  2YYO A;  3JCI A;  3NMB A;  1XOY A;  1ZZB A;  4W6X A;  3WR0 A;  2D98 A;  5FZD A;  1OF3 A;  4FPC A;  2ZKL A;  1V6K A;  1RUJ 2;  2BWA A;  4IEQ A;  2ZGK A;  5C3O A;  4XXA A;  3H3L A;  3I7D A;  3NJY A;  5FIX A;  4Z8B A;  3NO8 A;  4IEO A;  1JOP A;  1C1F A;  2WWS A;  4DXS A;  1BVP 1;  1O8P A;  1GMM A;  1YI7 A;  4HZF A;  1F4A A;  4U2A A;  1LKN A;  3AMP A;  3FE5 A;  5L9V A;  1RUI 3;  3CZU A;  4HMZ A;  4D8M A;  1O3T A;  4FPF A;  1LU1 A;  2VUL A;  1UX7 A;  1SMV A;  2YDE A;  4OZO A;  4ZS3 A;  3U4S A;  4HET A;  3UES A;  4L8Q A;  4QX7 A;  5HXV A;  4QT6 A;  3VKF C;  2A6Y A;  1WD3 A;  3I4I A;  1AYN 1;  4FPG A;  2I07 B;  5FOJ B;  2P17 A;  2G1M A;  2XG3 A;  4I02 A;  4LLO A;  1QNW A;  3LCP A;  1AUY A;  2QQO A;  4NAM A;  3VBR A;  1RIT A;  4QDS A;  3BUC A;  3VBF C;  4KBB A;  5HBA A;  3PNA A;  1CAU A;  5LK7 B;  1R08 3;  3PDQ A;  2W1S A;  3I2G A;  5CYY A;  4OLL A;  2W39 A;  1Z78 A;  5F5C A;  3KHC A;  1PGL 1;  1Q8Q A;  1NCR B;  3SH4 A;  1C5I A;  3J7N A;  1Y9M A;  3DKW A;  3JD7 3;  4QDQ A;  4BH9 A;  2JE7 A;  1U5I A;  2Q8D A;  1RB8 G;  2I2S A;  4OI2 A;  3TWI A;  1RUE 3;  5LB6 A;  2WDB A;  4Q5O A;  1MZ5 A;  4M3C B;  3VBU A;  3BTZ A;  4O61 A;  4XXP A;  1OFN A;  3TNP B;  3GNE A;  2Y64 A;  1WLW A;  3CEW A;  1W3V A;  1PZ7 A;  3LAG A;  3O1V A;  2WFF 3;  2GSY A;  4RGA A;  1MEC 1;  2B8M A;  3ETQ A;  1ZBA 2;  4ZZ5 A;  2VVE A;  4PHZ A;  3U75 A;  1AR7 1;  1UCX A;  2WZR 1;  1UKG A;  3AP6 A;  1NLS A;  3FWE A;  4OI1 A;  1IS5 A;  3M7A A;  5C3S A;  1B35 B;  4FPJ A;  1IHM A;  1X82 A;  2VZP A;  4KMQ A;  5FZA A;  1OMI A;  2D3R A;  2V09 A;  2P2K A;  2VAU A;  1W8F A;  3KB5 A;  4TSV A;  3AM2 A;  3M2M A;  1UOG A;  3WIN E;  1UPI A;  2E53 A;  4XF4 A;  4YZ3 A;  4COU A;  2WC2 A;  5SV5 A;  4AI3 A;  2NLR A;  2CV6 A;  4I30 A;  4DY5 A;  3C3V A;  2IVI B;  4LJH A;  2HWF 3;  2K2S A;  1QJZ A;  3ZKY A;  3N7L A;  3PVO A;  1BZW A;  1LOD A;  1BMV 2;  1LCL A;  3K4Z A;  3IB3 A;  4OHY A;  2ETE A;  1F15 A;  1QGL A;  1LHW A;  4RHV 2;  1O3Q A;  3VB9 A;  1KGY A;  2WYS A;  4IE6 A;  4PIZ A;  5J96 B;  3ZN4 A;  1AR6 1;  1KIT A;  5K8S A;  4YM2 A;  3IPV A;  3U1X A;  3WNK A;  1ZZC A;  4QX1 A;  2RR1 1;  4XIK A;  2WQ4 A;  4K1Y A;  3FLP A;  1DQ4 A;  4ERO A;  1W6Q A;  4EE2 A;  4BQ3 A;  2VZV A;  1JUI A;  1NA1 C;  3I2F A;  4Q4W 2;  4LBJ A;  4M3C F;  5FMC A;  4OHZ A;  3H3Z A;  3G7D A;  3T3Y A;  3D0S A;  5EPA A;  1W0N A;  4Q4X 3;  5FYM A;  1Y9Q A;  4CVU A;  1ND2 A;  4KNC A;  2WT0 A;  2WWU A;  4AED B;  2HWD 3;  1DYP A;  1STM A;  4EWE A;  3WP4 A;  3KCX A;  1V9U 2;  4URA A;  3I59 A;  3O0X A;  3KV5 A;  3SNM A;  4WM8 A;  1QQP 1;  4CA9 A;  3K3O A;  1JZ5 A;  4PIX A;  3WLU A;  2W52 A;  3BPS A;  5E88 A;  5E6H A;  4E8D A;  2B5H A;  5LA0 A;  3IDE A;  4MXV A;  2DV9 A;  1UU5 A;  1S55 A;  1FX5 A;  1GOF A;  3DPR B;  4RS5 B;  1QJX 3;  5DAQ A;  3R0R A;  3M8L A;  2ILM A;  1APN A;  5C6C A;  1FPN 1;  3KV9 A;  1MS1 A;  4LA2 A;  5BV6 A;  3N7M A;  5JVV A;  5IVF A;  3PL0 A;  1GP6 A;  4IEP A;  4YVS C;  4CRQ A;  3HN1 A;  3UJQ A;  5BNP B;  1GQH A;  1OLQ A;  3WV6 A;  3FN9 A;  3I3D A;  1J3P A;  3CJI A;  4X6R B;  1SLI A;  2GNM A;  2W47 A;  4NPR A;  1PZ9 A;  4QM8 A;  4ZZ8 A;  5JZG C;  1DGL A;  1BK1 A;  4V1P A;  4L0P A;  1QIQ A;  2LW8 A;  4YG6 A;  4AVT A;  4BOW A;  3UJO A;  2W3J A;  3WDU A;  1VBC 3;  5H9R A;  4LKE A;  5D8A C;  5CFD C;  1AX2 A;  3GCX A;  3MLJ A;  1K5M A;  4FFG A;  4NWW A;  4QQL A;  3AJY A;  4UYB A;  4OQ8 A;  4K8F A;  2ID4 A;  4FOW A;  5C8C B;  3HBK A;  2B42 B;  4IE7 A;  5LA2 A;  1KDK A;  3W5N A;  3GBF A;  4Y1U A;  2VM9 A;  3H42 B;  5FJH A;  2P37 A;  2VXR A;  2A71 A;  1G9A A;  1X8M A;  4HSJ A;  1FAY A;  3PTR B;  4LTA A;  2PHW A;  3ATG A;  2VUA A;  1ODN A;  2R1B A;  5BPX A;  3USU B;  1OFS A;  4YGC A;  4ATE A;  1LOC A;  3HOB A;  2DFB A;  2VO5 A;  4X6Q B;  2PA7 A;  4FI9 A;  1UZY A;  2K9Z A;  2YFZ A;  4NRO A;  1D7P M;  3IT8 A;  1RUF 3;  4OUE A;  4CPB D;  2CNA A;  2FCU A;  4NVP A;  2RS3 3;  1KJL A;  2QFE A;  1TZO A;  1G9F A;  1W2N A;  2VNV A;  2OQ6 A;  4XF1 A;  5FMD A;  1LOG A;  3RZH A;  3MID A;  1ULD A;  5A6X A;  3GHN A;  2QZ3 A;  3LDB A;  1R1A 1;  3WDX A;  4CEW A;  1DGW X;  2KXL A;  3ZSL A;  5LAT A;  2RS5 2;  2RDR A;  3LEG A;  2JDA A;  2ZX1 A;  1HRI 3;  2R0H A;  3LB9 A;  4FFH A;  4MO3 M;  1IPS A;  1J1T A;  1CAW B;  1OKQ A;  1TMF 1;  2W5F A;  5DUV A;  4D3W A;  3J7H A;  3N9Q A;  3OYW B;  2W95 A;  1UYX A;  2R06 2;  2JJ6 A;  4HLT A;  5JIU A;  2UYB A;  2Y6F A;  1WKY A;  3VD3 A;  3WCS A;  2P4E A;  3SKV A;  3MFA A;  1ODM A;  2JD4 A;  4NO4 A;  1JYV A;  1NCR A;  3T0D A;  5FKB A;  3UKT A;  3R4D B;  5C4W B;  1M06 G;  1ALY A;  4Y1Z A;  3ZN5 A;  2P5B A;  2EF6 A;  1RTV A;  1PVC 2;  1RUD 1;  2BEO A;  2IWG B;  5FMB A;  1VMJ A;  4M3C A;  4HVQ A;  3V64 A;  3KQR A;  4QGN A;  1LEM A;  4L2N A;  4LIV A;  1VLN A;  5I93 A;  1J59 A;  5I0S A;  4PLM A;  1EY2 A;  3VD9 A;  1ZBE 1;  2XXZ A;  2BJS A;  3FBM A;  4LPL A;  2GN7 A;  2YC0 A;  2Y38 A;  5BNO B;  2OVU A;  3HQR A;  3RYP A;  1OD5 A;  1UL9 A;  1WA6 X;  1ULP A;  1IQD C;  3GM8 A;  5KXB A;  1RVF 2;  3CO2 A;  1TE1 B;  1TQ5 A;  1U5Z A;  3A23 A; 
#chains in the Genus database with same CATH homology
 4DO0 A;  4ASK A;  5FPB A;  5A7N A;  4HON A;  2YBK A;  5FZI A;  5FPU A;  5FZ9 A;  2PXJ A;  4GJY A;  3U4S A;  4QU1 A;  5FYI A;  5FYH A;  5FZC A;  5IVB A;  3KV9 A;  4QX7 A;  4IGP A;  5FYS A;  5FZH A;  5IVV A;  4UF0 A;  5IVJ A;  5IVF A;  5FYV A;  3LD8 A;  4QXB A;  5LW9 A;  4CCJ A;  5F37 A;  5ISL A;  5F5A A;  5FY5 A;  5A7P A;  5F39 A;  4D6R A;  5FYB A;  5A7S A;  3PDQ A;  5F3E A;  5FUP A;  5FZ8 A;  5A3W A;  5FPA A;  5FYT A;  5F5C A;  4CCL A;  2XDV A;  4IGO A;  3U78 A;  1VRB A;  3ZLI A;  4AAP A;  4V2W A;  5FXZ A;  5FZF A;  5IVY A;  5FZ4 A;  2Q8D A;  5FY8 A;  5FPL A;  4UF0 B;  5F2W A;  4C8D A;  2GP3 A;  5FY7 A;  4CSW A;  4Y3O A;  5FZO B;  5FBJ A;  5FJK A;  2OS2 A;  5FJH A;  5FZ1 A;  5F32 A;  4Y4R A;  5FZK A;  5FP8 A;  4QXH A;  3PTR B;  4Y33 A;  3AL5 A;  5FXV A;  5A3P A;  5KR7 A;  3KV4 A;  4BIS A;  2XUE A;  3AVS A;  5FY9 A;  4EYU A;  3AL6 A;  5FZ7 A;  3PUR A;  3RVH A;  4CCN A;  5LWB A;  4IGQ A;  2GP5 A;  4QWN A;  3K2O A;  5FZE A;  3N9M A;  4GAZ A;  2W2I A;  5FY0 A;  5FZA A;  3ZPO A;  5F3I A;  2OQ6 A;  3OPT A;  5FUN A;  5FYZ A;  5A3T A;  3DXT A;  5FYC A;  2XML A;  4CCO A;  4V2V A;  2Q8E A;  4TN7 A;  3LDB A;  4QXC A;  2OT7 A;  5FPV A;  3K3N A;  2Q8C A;  4D6Q A;  4GJZ A;  3PU8 A;  4HOO A;  5FP7 A;  4DIQ A;  3PU3 A;  3UYJ A;  4CCK A;  5A7Q A;  5A7W A;  2WWJ A;  2YPD A;  5FY4 A;  5FZB A;  3N9N A;  5A7O A;  2OQ7 A;  3N9Q A;  3KVB A;  4LIU A;  5F5I A;  3PUA A;  2VD7 A;  3OPW A;  4GD4 A;  5FZ3 A;  5K4L A;  4NUB A;  4XDP A;  4E4H A;  4QX8 A;  3KV6 A;  5LY2 A;  5A1F A;  5FP4 A;  5FY1 A;  5F3G A;  2YU2 A;  4CUG A;  5FXW A;  5IVC A;  5FWE A;  2P5B A;  3N9P A;  3N9O A;  5FP3 A;  4BU2 A;  5FZG A;  4AI9 A;  4D6S A;  5A1L A;  3N9L A;  4LXL A;  3PUQ A;  5IWF A;  5IW0 A;  5FYY A;  5A80 A;  4EZH A;  5FZO A;  4CCM A;  5FZ0 A;  5FZD A;  5A7W B;  4LIV A;  5ANQ A;  5FXX A;  5FYM A;  3PUS A;  2YBS A;  2WWU A;  3AVR A;  2XXZ A;  3DXU A;  2YU1 A;  5CEH A;  5F2S A;  3NJY A;  5FZL A;  5FYU A;  4URA A;  3KVA A;  2YBP A;  3KV5 A;  4LIT A;  5A3N A;  4BXF A;  5F3C A;  5LY1 A;  3K3O A;  5FV3 A;  5E6H A;  5FZM A;  5FWJ A;  4EZ4 A;  2OX0 A;  5IVE A;  5FZ6 A;  5FP9 A;  4XDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...