5FYDA

Structural and biochemical insights into 7beta-hydroxysteroid dehydrogenase stereoselectivity
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
259
structure length
259
Chain Sequence
MNLREKYGEWGLILGATEGVGKAFCEKIAAGGMNVVMVGRREEKLNVLAGEIRETYGVETKVVRADFSQPGAAETVFAATEGLDMGFMSYVACLHSFGKIQDTPWEKHEAMINVNVVTFLKCFHHYMRIFAAQDRGAVINVSSMTGISSSPWNGQYGAGKAFILKMTEAVACECEGTGVDVEVITLGTTLTPSLLSNLPGGPQGEAVMKIALTPEECVDEAFEKLGKELSVIAGQRNKDSVHDWKANHTEDEYIRYMGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OXIDOREDUCTASE, SHORT CHAIN DEHYDROGENASE/REDUCTASE FAMILY P
publication title Structural and Biochemical Insights Into 7Beta-Hydroxysteroid Dehydrogenase Stereoselectivity.
pubmed doi rcsb
source organism Collinsella aerofaciens
molecule tags Oxidoreductase
total genus 98
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 1.1.1.201: 7-beta-hydroxysteroid dehydrogenase (NADP(+)).
pdb deposition date 2016-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5fydA00
2QW8A 4DL9A 4KZPA 2QQ5A 2X7HA 1E3IA 3IJRA 3IAHA 3VKUA 3OA2A 4XD2A 2VUSA 1E1NA 2POQX 2Y68A 2O3JA 2WD7B 3BMNB 2C0CA 3KSZO 2VNSA 3LT1A 5ES3A 2NTVA 1E7SA 1H0KA 4AJLA 1W0CA 2VZ8A 1K5HA 4F6LA 4C7JA 2DUWA 2B69A 4CM4A 1B14A 5B1YA 1P1IA 1VSVA 5KNLA 1E1MA 2YV2A 1RM5A 3V8BA 3ZWXA 1H6AA 4WNIA 3U0BA 1MFPA 1ZUD1 4Z9XA 1KETA 3HDYA 3NTRA 4DPLA 3RBZA 5L9AA 4HX5A 3C7AA 2GN8A 3VZPA 5BSEA 3EVNA 4D43A 4IQ0A 3GGGA 3AOEC 4CLOB 1P1KA 2EXXA 2O48X 1JA9A 4XIJA 4JP3A 2PLAA 5B37A 3JQBC 1DFGA 3FF4A 3RJ5A 2X22A 2ZQYA 1LQTA 3ZV4A 2X0RA 3QE3A 4Y6SA 2VQ3A 1VL6A 5CDGA 1X1TA 4KTTE 4PFJA 3UKOA 1KVUA 5TLSA 3I9NA 3ROQA 1E0DA 4BNMA 3RUFA 4ND3A 2IDZA 3EZLA 2NQ8A 3EZYA 4TVBA 3H7AA 4MKXA 2W2KB 1GU7A 1UXKA 4YAGA 5DCWA 5IDQA 1FXSA 1E3LA 1H6BA 3VAZA 4EJMA 3P2OA 5L45A 3G49A 3JQ7B 4TKMA 3F3SA 1VSUA 1N8KA 1ORRA 5ITVA 4P4LA 4UVGA 1NNUA 4A0SA 1I3KA 1KIFA 1T26A 1ADBA 5KJFA 4HFMA 4FD3A 1DHRA 4QO8A 2D1YA 1N7HA 3ZW8A 4MVJG 4R68A 4MP6A 1N9GB 3BTOA 4E12A 4BO3A 1I30A 4WUVA 3D3WA 3A06A 4WEQA 3SBOA 1R16A 5TC4A 2VYVD 4YT2A 4QEDA 1MXFA 5JDCC 1KY5A 3S2GA 3RFVA 4J2HA 3KVOA 4CJXA 1VRWA 3C1AA 4K26A 1GD1O 1LA2A 3OIDA 1YE3A 2Y0DA 4N5NA 3U62A 4B3HA 2CF5A 3TDKA 4K6CA 4B79A 1EEHA 4C4OA 2DU8A 1PJSA 5H83A 4RF3A 2AG8A 1GPDG 3AW9A 8LDHA 3PYXA 1UXGA 1IPFA 4UVDA 4CLEA 2C5AA 3JYNA 3EGOA 3GEDA 3C24A 1M75A 4LN1A 1E3WB 1XIVA 2J5KA 3A14A 3NV9A 4MO2A 2C2YA 4XRRA 4M1QA 4Q39A 5L95A 1UXHA 4EBFA 3DBLB 3O8QB 3ZWCA 1VL0A 4XZ3A 5L51A 4OXNA 2ZB4A 3ST7A 4AJEA 5GZ1A 3BXXA 3ZDFA 4BNWA 2WM3A 3GNSA 4CMBA 3OETA 1HE3A 3ZU3A 3BMQB 4BNNA 4BNTA 4GL4A 1KERA 2C59A 4CMEC 4DQUA 5IDWA 1GFSA 2YFQA 4WECA 3KB6A 4BNYA 4MIEA 1T2DA 2X9VA 1WDLA 2CY0A 2AMFA 3PK0A 2FR1A 3WWYA 1ZSVA 5T6BA 3RASA 4E0BA 1KS9A 7ADHA 1Z7EA 3NJ8A 5TS3A 4E13A 2HDHA 1N5DA 4LSMA 2X4GA 3CINA 3G1TA 4BO5A 2AG5A 4YJGB 3VH1A 1I3LA 5HM8A 4LCJA 4A5OA 1PJBA 1LTHR 3BTSA 4Q3DA 5T5QA 1EVJA 1PJQA 5FI5A 1B16A 2DTDA 5KVCA 1M67A 4A73A 1YH3A 2YQ5A 4EW6A 3K2EA 2XOXA 3I83A 1BWSA 1EUDA 1U3TA 2B4RO 2VWPA 1Z6ZA 3HN7A 5HS6A 4CMJA 3C1TA 1PJLA 4BKOA 1PIWA 4E30A 3GDFA 1PL6A 4UVEA 4HFRA 3IC5A 3ZV6A 1GCOA 4YJFB 4D7AA 1MA0A 3GNQA 5GZ3A 1G0NA 3OJFA 3B20A 4XX0A 4CR7A 5IG2A 3PJEA 4WLEA 2G82A 1H93A 1JVBA 3OFSA 4RJTA 3PYMA 1L7DA 5BQFA 3ASUA 1ZMTA 1K6JA 4GKVA 3D4OA 4GSLA 2GZ1A 1WMAA 3P7MA 3SLGA 1BXGA 1O9BA 4BNXA 3NJ4A 4I1IA 1XYGA 4ZRMA 3GZNB 5JY6A 2SCUA 3SEFA 3F1LA 4FIZA 3AM3A 4OL9A 5FF9A 4Q9NA 3QWAA 1RYEA 4JXKA 4II3A 3OH8A 4YWJA 5TT1A 5ILOA 3N7UA 4UEJA 1AHHA 1DIAA 2VHYA 1B0AA 4FOOA 3U5TA 3B1JA 1ONPA 1N1GA 1UP7A 1V0JA 3WTBA 1JKJA 3X2EA 4FDAA 5F21A 5AVOA 4ZQFA 3KYCA 3R6DA 3KM0A 1LDYA 4G5HA 4DMLA 3DWFA 4FB5A 2VWHA 3TZCA 1XHLA 5L7WA 3ZCXA 5JC8A 2NVBA 2BKAA 4CL3A 5I9LA 2O4UX 4RORA 2I67A 3Q2IA 3GG9A 3NDJA 2VTEA 5DBIA 1E7YA 2O3QA 3M1LA 1D3AA 4YT8A 4XDYA 2Q50A 4IIUA 4IUYA 3R0IA 4R51A 3I52A 2ZK7A 2B35A 3L4SO 4JJGA 2H63A 1VE9A 4BNJA 4BMVA 4CV2A 1T2CA 4D79A 4BKPA 2AQIA 4J91A 5HWSA 3ZW9A 4EGFA 3W8DA 3H5AA 4JX8A 1EZ4A 1AGNA 5JFOA 5A04A 2ZB8A 1KC1A 4NJMB 4RCVA 1ENPA 3UF0A 3DBHA 3KLPX 2FWMX 1P0CA 4YA6A 3I6IA 3JYLA 4DBZA 3I9OA 3OP4A 2ZYAA 3ZNPA 2EKQA 1D8AA 3GRKA 1KVRA 2V65A 1EUCA 4J1QA 2JCXA 4PG5A 3F6YA 3RUCA 4F46A 5CEJA 4IJVA 2W90A 2GN4A 5A5FA 1XU7A 4INAA 2HKIA 1Z82A 4JROA 1YGYA 4IS2A 4W7IA 1M76A 2B4QA 1E7MA 1CIVA 3ZHBA 2F00A 2HLPA 1E3JA 3CH6A 3VTZA 1GTMA 3KRTA 1M2WA 2A9FA 4IDCA 3PXXA 4B4WA 1X1EA 3S8MA 1I24A 1YDEA 1HSOA 3H9GA 2ZTMA 1EDZA 2NSDA 3TFOA 4WLVA 1HSZA 2YHUA 2PH3A 1YRLA 3PGXA 4RZHA 3OJOA 1WAMA 3CE6A 5CDSA 4CM9D 2BMAA 3DOJA 3G1UA 2VTDA 5FWNA 3NRCA 1OBFO 3VVBA 3WMWA 2ZB3A 5ENDA 1HRDA 4CMGA 4RV9A 4CODB 4YAEA 1NPTO 3PHHA 3QSGA 4Q3BA 4IBOA 4Y6RA 2PK3A 4WE3A 4CM7A 3FPCA 1PGOA 3RQSA 4JBGA 4A26A 4O6VA 2C82A 4UVIA 3TN7A 4W9NA 4XR4A 3M2PA 4R3NA 3RUEA 3DMTC 1QKIA 2IZ0A 5EL0A 1ULSA 4GVLA 3Q9UA 2H5LA 3ROMA 5DT9A 4OMUA 4CQLB 1CQJA 2QRLA 1I0ZA 3ITKA 4IDBA 4Z0PA 5IZCA 1DRWA 3PTZA 3S2IA 3TJRA 1I01A 3RC1A 1PL7A 2O3SA 1VJ1A 3ABIA 4J0FA 4JGBA 5DBGA 4CQMD 2FZEA 4NDNE 3UAGA 1V6AA 3VKVA 3JQFC 3DEYX 3H5NA 5C37A 3VH4A 4MKRA 1JKIA 2E82A 1EFKA 4YT4A 3TF5A 3WGHA 3ZWNA 1GZ3A 3K31A 4BO9A 1ISJA 3WFIA 3DZFA 5EPOA 2VHZA 1HWYA 1XGKA 3DB2A 3UVEA 1ISMA 3K2BA 2AEMA 2DTXA 4NR0A 1W73A 1DOHA 1P31A 4KWHA 3FPLA 4CV1A 1I33A 2HU2A 4AL4A 3WGZA 2GGSA 1YONA 3FNGA 2OXIA 2HJRA 4OKNA 2B83A 3IDSA 3PWZA 1RM3A 1S6YA 4R3WA 5JYEA 3RBXA 1HE5A 2PD6A 2OFPA 1HDZA 2EKLA 1KVTA 4LRTB 5COQA 2X5JO 3OSUA 1B15A 1E7RA 4YTEA 5U9CA 4PZDA 3MTJA 4KOAA 3UCEA 5JCJD 1Y8QA 1ADFA 2Q49A 3HG7A 2JCVA 1X14A 4JP2A 3ZWPA 2X5OA 3GF4A 3T7EA 1UAGA 1SC6A 3VH3A 3DDNA 3PPIA 4UVHA 1EBUA 4BV8A 3T4XA 2VT2A 4IDGA 3X2FA 5CAEA 4WCFC 2YUTA 4EYEA 4Q3NA 1CWUA 1M66A 1NVMB 2Y1DA 3Q9NA 4NU5A 1QV6A 1NP3A 1UJMA 5A02A 3M2TA 4KDFA 5IN4A 5JAMA 1H9BA 4FJ1A 1HDOA 1EK5A 2DVMA 4GLOA 4WK6A 1MC5A 2WWRA 2ZYDA 3JQDA 3WJAA 1N2SA 3E9QA 3V1UA 5KTKA 1GL3A 4UUMA 1XG5A 4MVJE 3DZKA 1P9LA 4LGVA 1CERA 3KBOA 4BO1A 3HDQA 1W4ZA 1BDBA 1R12A 1UUFA 3M6IA 4HNGA 3RUAA 4BB5A 3ZGYA 4JN6B 2WJPA 2ET6A 4MOWA 4DTIA 4D41A 4ID9A 4NFYA 3IOYA 2HMWA 2OO5A 3BYZA 4I5GA 3PRJA 1WW8A 1WWKA 3DAGA 4XJSA 1PQWA 1DC4A 2RAFA 5JO9A 4N7RA 1DJNA 1LUAA 3F1KA 3HNPA 4YT5A 1LSUA 1PQUA 2BRUA 2JJYA 3FD8A 2DBQA 2Q2VA 2AQHA 4F45A 3KSDO 3KXDA 4R1NA 3H9EO 3RIHA 4FR5A 3I1JA 1ZK1A 4IDAA 4R54A 1QP8A 4DBVO 1BXZA 4N18A 1HT0A 3GOHA 4WCFA 5L53A 4RVFA 3TOZA 4FSHA 5DNAA 2JHFA 3ORFA 2PH5A 3FR8A 1ZKMA 3DTYA 4Q3CA 3U49A 4BIIA 2VHVA 2YV1A 2AW5A 2GASA 2JAHA 5G4KA 2CMDA 5JBIA 3FSRA 3H65A 1KC3A 3NKLA 3B1KA 1YBVA 3DXFA 1KY4A 1JVSA 4FPXA 3VVCA 2J8ZA 4YPOA 1K2WA 2GYYA 4MVJP 1FK8A 2YY7A 3RI3A 3TRIA 3U09A 4MPDA 3GDGA 4ZVVA 1KVQA 2BGKA 3BMOA 1B3RA 3L77A 2Q4EA 1P1RA 1YBAA 1AUPA 4YAJA 3KYBA 2Y1CA 4O5OA 1X7GA 5BSFA 1D1TA 2OHXA 1ZK2A 2ZJ0A 3PQEA 3ZNQA 4P4GA 2YFHA 4R16A 1PWZA 3JQ8A 2J5QA 3ZV3A 1SBYA 4BL5A 4IS3A 1JQBA 1K6XA 4M8SA 1NX6A 3VZQA 1NPDA 3F47A 2J3IA 5T64A 1U9JA 5KWEA 4YQYA 2Z1NA 3ZN2A 4DLBA 5JC1A 4MVJD 4XKJA 4N5LA 1GEGA 2GN9A 1FDUA 1B26A 1DSSG 3E9MA 3BHMA 3C7CB 3GVIA 1MLDA 1DIBA 3QQPA 1L7EA 3UFXA 2DTEA 1J0XO 2DQ4A 3F5SA 3ASVA 1KEVA 4PG7A 4PLVA 3DAFA 4J7UA 3ZHYA 3FWNA 5KIAA 3SVTA 2FPPA 2FZWA 2PZKA 2G0TA 1GCUA 1IZ0A 4MP3A 1PZEA 2RBEA 4RPGA 5CP8A 2PY6A 1B7GO 1R37A 2D2IA 1NVGA 3JSAA 5I7EA 4K6FA 2R6JA 4RQTA 1IB6A 5CG1A 1IY8A 3HDJA 1O95A 3NGXA 4BNKA 5BSHA 4E2XA 4E2YA 1ZH8A 4L4XA 5IZ4A 3GAFA 3PIDA 4HUJA 3H8VA 3FTNA 4DC1A 4KMSA 2G17A 5JPIA 3SX2A 3SC4A 4U0KA 3AM4A 1LXCA 1VL8A 3SJ7A 1P1FA 3H9JA 3CZMA 3EAGA 1AN9A 1JAXA 2YV3A 3Q3CA 1M6WA 4IJKA 2HO5A 1GV1A 3RVDA 4BNVA 1C0KA 5FEUA 3DONA 1R0KA 2Q3EA 3ZNOA 4LVUA 3I3OA 4URFA 4IMRA 3ADPA 3KYDA 3OICA 3GHHA 1IULA 3WNVA 2BH9A 4E5MA 5A03A 2EEZA 2YDXA 1J5PA 2YZ7A 3BTVA 3ENKA 3CMCO 3KEOA 3MJ4A 5GMOA 1O94A 4B7XA 3E8XA 3F5QA 1GUFA 3L0DA 3OJ0A 2UAGA 4J6FA 3GGOA 1PGJA 1H6CA 5DCUA 4Q3EA 5IN5A 4CUKA 1P33A 5JE8A 1V3TA 1LNQA 5CEEA 2O23A 3TFQA 2QX7A 5TF4A 3CTMA 3PJFA 3QVWA 4E5NA 3G79A 2NLOA 4TQGA 1GUYA 4FFMA 4S3MA 2QZZA 3GA0A 4H3VA 3P2YA 3JQGB 1ZSYA 3GVPA 4L73A 1MX3A 3KEQA 4J4HA 3GNTA 3NTQA 5LCXA 4D3SA 1T2FA 4J3FA 4ZD6A 1JWBB 5CDUA 3L9XA 1O8CA 3NTOA 1BW9B 2JFHA 1G6KA 3IUPA 1NHGA 4FBGA 2W4QA 5TQVA 3GLQA 1PZHA 2DPHA 4XR9A 4C7KA 2HMSA 1YL7A 3KHUA 2DT5A 2Q1TA 1SEVA 1RKXA 2QZ9A 4TROA 5T57A 3VH2A 2NU6A 3DTTA 4CMIB 1A7KA 1H9AA 4L4RA 5A9RA 1C14A 5LC1A 4A10A 4CL8A 5C7LO 3SXPA 2X1HA 1UH5A 4CM1A 5DP1A 3JD4A 5B4VA 4XYGA 3IP3A 4RQUA 4U6QA 4IPTA 4YJDA 1FDWA 2IXBA 2PGJA 3DHYA 4NBUA 3QA9A 3W6ZA 2PGLA 2OUIA 2OBNA 1UXJA 3ZWVA 1EFLA 3BMCA 1YB1A 3WGQA 4E33A 3U4DA 3IUSA 2VN8A 1EDOA 1Y7TA 3FTPA 3H9QA 3IJPA 4WEOA 4DGSA 5K6AC 4ROSA 4BHTA 1JW9B 3WQQA 4W4TA 5L3ZA 4XQCA 2CNBA 4HFNA 1WLYA 2TMGA 3PJGA 3LLSA 4RVHA 2UVDA 3UUWA 3WLEA 4CLHA 2EKPA 4PLWA 2GPTA 1ZZEA 8ADHA 1KYQA 2EWMA 1E3SA 5JMPA 3DFUA 2ZTLA 4DLLA 3GVXA 3KZVA 4R9RA 1MV8A 1Y8RB 5THKA 2CSUA 4DPKA 3U4IA 3TQHA 1EBFA 5L4SA 1P45A 2O2SA 2Y1GA 1ZO8A 1A9YA 5KVQA 5L4NA 4FCCA 1B8VA 1Q7GA 3NAQA 4XGKA 4IXTA 3FBGA 4E5YA 3I9MA 2Y99A 4N54A 1YVEI 1NQAO 3MWDB 3D1LA 3TNLA 1MB4A 1LC0A 4WPGA 4CQMB 3I4CA 1QRRA 1I10A 1HF3A 3JQAB 4Z9FA 2PR2A 1SMKA 2I9PA 1DBVO 3OQ1A 2O7QA 4QXMA 4J9VA 4RVGA 3HFSA 4YAIA 4O1MA 3TZ6A 1A9ZA 3WSVA 2W2LA 3NDRA 4UUNA 2C29D 1Q2XA 2D0IA 2GR9A 4U8GA 1LQUA 1Z74A 1FJHA 2CDAA 1HL3A 2Y05A 5JAIA 5K6AA 2JCYA 3NT5A 3NDIA 4U0JA 1ZEMA 2J6IA 4MKZA 1Y81A 1OOEA 4YJHB 4ALNA 4BNGA 2I66A 3GRPA 1DRUA 2QRJA 5KVSA 2WMDA 2PKRA 2VOEA 3O4RA 3RCBA 3H6KA 1UDCA 4ND5A 3FCOA 1FMCA 4ZQEA 4UUOA 1UZMA 4KDEA 1NR7A 4B4OA 3TSCA 3C8MA 1YJ8A 4BKRA 1ISFA 2C54A 4RF4A 1E7WA 1JDJA 2GD1O 2W8ZA 2YYYA 1PEDA 5JLAA 5ADHA 1GAEO 3LDHA 3DZJA 3GFBA 3GMSA 2NWQA 1C0LA 1ADGA 2E49A 2ZKLA 3S2FA 3C1OA 1Z75A 4ZJUA 1GYQA 4NMHA 2WD7A 3BMNA 4J0EA 1JTVA 2JD0A 2X8LA 1Q0LA 1W8DA 2XXBA 1HE4A 2B4TO 1OC2A 1QV7A 2YW9A 1T1SA 5IDYA 1XLTA 3NEPX 3PZBA 3UOGA 5TGDA 3JD2A 1JU9A 3GC6A 4E2WA 3JQGA 1U8XX 4J4TA 1ZW1A 1QR6A 1U3WA 1E5QA 1LU9A 1UAYA 3GUCA 3E1KA 1QYXA 3E5RA 2NADA 4Z3DA 4IQ8A 1PJ3A 3OJLA 4RDIA 3UICA 4XQ9A 1PR3A 3CPSA 3I6QA 1P77A 3H2ZA 3CSDA 2VRCA 4A03A 4CLOA 3FN4A 3N74A 4RL6A 1X0XA 1TT5B 4A2CA 2YHIB 3WGTA 1BRMA 3LT0A 4GI2A 2NTJA 3GVHA 3RFTA 4YAKA 1C3VA 1ZEJA 3HWRA 1Z45A 5L7TA 4B4UA 3EMKA 4ZQHA 3JYQA 2BFOA 1TEHA 3ONFA 3F9IA 1A5ZA 2UUPA 4O0LA 3UGKA 2P9EA 1CF2O 4DUPA 4EEZA 2W2KA 4J1NA 1J4AA 3WIEA 1MC4A 3ITDA 1OMOA 4AVYA 5IJZA 4GPD1 3CMMA 3EC7A 3JQ7A 1I2BA 3JQ9A 2P91A 1HEUA 2IZZA 3AY3A 2GUGA 1U2GA 2W2LD 4I8XA 4JNKA 4JQCA 1TLTA 2BGLA 4NH4A 4L76A 1PJ4A 2ZATA 4UULA 5THQA 3NT4A 1TT7A 1N9GA 1F14A 3BA1A 2OORA 4JK3A 2E37A 4MIOA 3OA0A 1O0SA 3MEQA 1LRLA 4Y67A 4OYRA 3CXRA 3L4BA 4FN4A 4OHUA 4HADA 4FGSA 3JQ6A 3QP9A 4CM8B 1I8TA 3KETA 4NFHA 1ZCJA 3E5MA 1CDOA 5EMHA 5AQ1A 1JLLA 2DBRA 1ENZA 3LT4A 4Q3AA 4WJZA 3RC9A 4XEHA 5JDIC 1ZXLA 1LRKA 1PU2A 4PIVA 1OZAA 2WD8A 4PZEA 3LU1A 4GGOA 4EJ0A 4QQRA 4W9NC 5TJHA 3WQSB 5ICSA 3K5PA 2V6GA 4PRLA 2EJWA 1E3WA 1VI2A 2B5WA 3B6ZA 3HQ4O 3IS3A 3QVSA 4PVDA 6LDHA 1CRWG 3AFNA 4RVSA 2HSDA 3CZRA 3F4BA 1DRVA 4BGEA 4YJHA 3DBLA 4AJOA 1AE1A 2VT3A 3O8QA 4G65A 2EIHA 4OQYA 2HK9A 1PS0A 3TL3A 1DAOA 3O9ZA 1LLUA 1HDYA 2PD3A 1XQ1A 3NGLA 1ADCA 4BO2A 5DP2A 2QYTA 1IHXA 3IQDB 4RVDA 3GDOA 2NVUB 3EUWA 3W8EA 2I3AA 3U9LA 3BMQA 2D5AA 2Q45A 4K1LA 3RD5A 3RC2A 3H9UA 4K28A 2C7GA 3ETEA 1VPDA 4HY3A 3ZHXA 4FJ2A 1MFZA 4RDHA 4BO8A 1NVTA 3OBBA 2Y66A 4RZIA 4PLPA 2Q2QA 2FPGA 1V8BA 3KSUA 4KP7A 2G1UA 1XSEA 4FQ8A 3RKRA 1GUZA 2GN6A 3LC1O 1X15A 3RUDA 1QG6A 2EW2A 5ENVA 5A06A 2VOJA 3EW7A 4BNLA 4LMPA 5KVVA 1GDHA 5DOVA 5AOVA 3MZ0A 1ZVMA 4JBHA 4EEXA 3HUDA 4OAQA 4D42A 2BLLA 2O4CA 5DZSA 1HYEA 2FOIA 2UYYA 4YYZA 3W8FA 3MCVA 4YJGA 4J1TA 4PN3A 5JDIA 4Z0HO 2BELA 1UDBA 2PZJA 3LF1A 3HB5X 4GH5A 4CM3A 1X13A 4TRRA 1WDMA 4RLHA 2H1SA 3D5QA 5F1PA 5EN4A 3ZU2A 3ZWOA 4Z9YA 4TSKA 2NVWA 1C1XB 1NWHA 1VJTA 3PIIA 4OH1A 1GV0A 1R4MB 2R00A 1J6UA 2AEFA 4J43A 3M1AA 4ITUA 4H16A 3GFGA 3DZBA 3GG2A 1ONNA 1UXIA 1HE2A 4DC0A 3OHSX 3JYPA 1GPJA 3VHRA 5CG2A 1DLJA 3JD3A 1ZBQA 3EK2A 1JKFA 4LSWA 4YJFA 3SC6A 1PGQA 2WSBA 4OOFA 5AXDA 4IZIA 2CDCA 3MJTA 5C5IA 3UXYA 4CLRB 1DIGA 2X0JA 2WYUA 5F3RA 2AA3A 1WXDA 4D44A 4DVJA 4AJHA 3GK3A 1VKNA 4B7UA 1ENOA 5K9ZA 1R15A 2GLXA 4KUEA 6ADHA 3GZNA 4WLUA 3CUKA 4JJFA 3MTGA 3W4KA 3ZWMA 4CLDA 2CFCA 4ZICA 5U4QA 1VKOA 5F5LA 3PQDA 3I9LA 2VWQA 1R66A 1HLDA 2NACA 5JW6A 1A71A 2D8AA 2NV6A 1ENYA 3S1LA 4NG5A 4R1TA 2G76A 1LRJA 1X7HA 3WFJA 3I23A 5U1PA 1IZ9A 5JAQA 4QECA 4HNHA 2RCYA 3K8ZA 4IDDA 4II2A 4F3YA 2Y1FA 1SB8A 2IXAA 1KBZA 3ANLA 3TWOA 3MOIA 3Q0EA 4D45A 5FFFA 1G1AA 5KCZA 1GQ2A 3KTDA 1WPQA 4J2OA 1YOVB 4RPHA 3PZRA 1GZ6A 1U3UA 1ZJYA 2V7PA 2Q1UA 5COAA 2HK8A 1LLCA 4GX0A 4JCOA 2J3JA 3FNFA 3WR5A 5EERA 4WOKA 1HYHA 3Q1LA 1O6ZA 1U8FO 2E4AA 1E6UA 2EV9A 5KKCA 1R4NB 1W6UA 2HK7A 2AQKA 3PVZA 1H2HA 2UDPA 4NZ9A 4WKGA 2HAEA 4HBGA 4IGFA 3O26A 1E6WA 1N92A 4MJLA 4J16A 4AJ1A 4PG6A 2FR0A 4B4VA 2EG9A 1ZJZA 1QORA 4XB1A 2A94A 1TVEA 3AOGA 1NASA 3HB4X 2C20A 1VM6A 1NAHA 4NJMA 4RGBA 3HSKA 4X54A 1B3BA 1HTBA 4NI5A 1U7TA 5MDHA 5A9SB 3DBRB 5HS4A 4I5FA 3AUAA 3O03A 5ICMA 2GO1A 4Y9DA 3BZUA 3LZ6A 4YCAA 5KJCA 1J49A 4DIFA 2NU8A 3VPFA 1DC6A 1AXEA 2DPGA 1V35A 2X6TA 1X0VA 3LSYA 5TNXA 4ZHSA 1TA4A 3WS7A 2Z5LA 3KO8A 5HBRA 5CPBA 4YDRA 5JYDA 1O5IA 1U3VA 2AE1A 3QJ5A 1NYTA 4LW8A 4EI2A 3EYWA 1LSJA 2DC1A 4NBTA 5EQFA 3RC7A 3WICA 1BGVA 1F8GA 2Q46A 3S2EA 1HXHA 4BKQA 5LDHA 2LDXA 2J3HA 3KLMX 1HKUA 1V3VA 1IE3A 4BMSA 1U7HA 3HE3A 2IEBA 4HWKA 2IRWA 2PKQP 4E5PA 1F8FA 4KUGA 2FPIA 1I2CA 4BO6A 4CM4B 2E6UX 4QSMA 5AXBA 5T8KA 3RU7A 4R4JA 3LYLA 1UZLA 4I9UA 3ZHZA 2RH4A 1MP0A 4LK3A 2X9GA 2CZCA 3C7DB 4GWKA 4BOYA 4XQGA 1YWGO 4HXYA 4PCVA 5TSDA 1FDVA 4OQZA 4ALMA 4PVCA 3ZU5A 3WGGA 4B8ZA 3AU8A 1N1EA 3HN2A 1PS9A 4M49A 4YB8A 3ROKA 3OECA 4CQLA 3WBBA 1GEEA 4BQRA 4M55A 4PLHA 4YRBA 5A5EA 1LC3A 2ZB7A 4B8WA 1F0YA 1PQPA 3D4NA 1SNYA 4KQXA 4XYBA 2DBZA 5EIOA 1ZK0A 4P4NA 3OM9A 3UN1A 2BFAA 4ND1A 2B5VA 2XPCA 1UDAA 5TJ9A 1G0OA 2O7SA 2PD4A 5ER6A 3U3XA 3AM5A 1CJCA 2YJZA 3R1IA 5C3MA 4CUJA 4BUCA 3WG9A 1BG6A 3FBTA 3PHGA 4ZRNA 4OO3A 1DB3A 4LISA 3D5TA 3ZZNA 5BNIA 3AUSA 1LDMA 2GDZA 1XEAA 5HA5A 5IXSA 4L75A 5G0UA 3PHLA 2BI8A 1H2BA 4TRMA 1UR5A 2GERA 3INTA 2FP4A 4BGVA 3ZWBA 5B4UA 5A05A 2I3GA 5ITWA 4Y98A 2QRKA 4IMPA 1EE2A 4S1VA 1PR9A 2VNAA 2JD2A 3CKYA 4OOEA 4R9SA 2JKVA 2Y0EA 5DBFA 1K3TA 3GZ4A 5FYDA 1YB4A 1ARZA 2P2SA 3WOHA 4XRGA 3PWSA 1DDOA 4HP8A 1NTOA 4JJIA 3V1TC 3D3WB 3OIGA 4PLYA 4B7CA 3Q6IA 3UH1A 1YXMA 1Z73A 3AI3A 1EVIA 4W99A 4CM6A 1ZNQO 4WGGA 2O3UA 4QT0A 1ULUA 4NJOA 3L6DA 3TZQA 2P4HX 1R0SA 3PFFA 1EVYA 1YL6A 2DKNA 4XDZA 5F5NA 1LBEA 4Y6PA 3EY4A 1YQGA 5CDTA 3O38A 4DXHA 4NBWA 5BR7A 4WLFA 1E7QA 4QX6A 1LDEA 1E5LA 2DFVA 4BQPA 3WNQA 3CEAA 4E21A 2NU9A 1WDKA 4YVFA 3K73O 4TRNA 1OFGA 5CPFA 4H15A 4UUPA 1DC3A 3PP8A 4IIVA 4M87A 3QHAA 4FFPA 2LDBA 1WP4A 4GBJA 3WJ7A 3U4HA 4WLOA 3STHA 4NU6A 5TX7A 4ESOA 1PS8A 1ONOA 3QVXA 3TOXA 5AXAA 1JN0A 1T2AA 1NM5A 3AFMA 3GT0A 3PJDA 2QIOA 4F6CA 5KOIA 2VYVA 4M86A 2P68A 3BHJA 2PZMA 7MDHA 4MIYA 1DHTA 1HETA 1B8PA 2F1KA 3QWFA 2HCTA 3OQBA 5I9MA 4BNZA 1LDNA 3B70A 4NNJA 2D4AA 1M6HA 3GMDA 3GPDG 1QYCA 2Z1MA 3AK4A 3IKTA 1H6DA 3DR3A 9LDBA 3RJ9A 3HJAA 2Z95A 3VDQA 2X0IA 3OF2A 3UCFA 3HDHA 1GADO 3DOOA 4IQGA 1Y9EA 3ENNA 3RKUA 4KWIA 2GCGA 1YO6A 4GQAA 1HZZA 2I6TA 5IDXA 1Z7BA 1YQDA 1KVSA 3GN2A 1OAAA 3DOCA 2EF1A 1HZJA 5I8WA 5JNLA 2Y93A 3ZV5A 2I5PO 4E2ZA 2QYSA 1I36A 2GSDA 1EK6A 4RVUA 2XF8A 1QYVA 3ROPA 1I5RA 1LEHA 4IXWA 5I7FA 5KJ1A 1Q0QA 5JS6A 4CV0A 4NQZA 1XDWA 2ZTVA 3PDUA 3JYOA 4TMFA 3QY9A 4OJNA 4A27A 1OC4A 5JY1A 2R2GA 5DOZA 2P9CA 4CR6A 3RFXA 4M54A 2UV8A 4CMKA 2B36A 3IP1A 1KEUA 1ISGA 3ON5A 4XQEA 2VHWA 4AFNA 5TIIA 4MP8A 3WX0A 1F12A 2XAAA 2CDBA 4BNUA 2PA3A 1DLIA 2B0JA 3WIDA 4B3JA 5A3JA 5CDYA 4WNCA 3OIFA 2PZLA 4DREA 1Y9AA 3C3XA 4OSPA 4J7CA 3LF2A 3RU9A 3H3FA 4HV4A 4WOJA 3ULKA 1SCUA 1V3UA 2VUTA 4NK5A 3RBVA 1GYPA 2CF6A 2VHXA 3G3EA 4XGNA 2VRBA 1BXGB 2OL4A 3DMYA 1U5AA 1VLLA 3IL2A 4MINA 4EUHA 2PTGA 4LVCA 3TL2A 4I08A 1T4DA 1ZK4A 4PLTA 4R41A 1KEPA 3ONEA 2O3RA 3L6OO 1DIRA 1PSDA 4GVXA 3V2HA 2Y1EA 4OM8A 4ALKA 2V6FA 4RF5A 1BSVA 2TMDA 1DO8A 1PJ2A 5KJ6A 2WE8A 5GY7A 5DCYA 3GN1A 3WGOA 3ANMA 1YL5A 3KYCB 1FF9A 1I3MA 4JBIA 4NBVA 1PZFA 3ZNNA 3FI9A 4DQVA 3DBVO 3VZSA 1BMDA 1PZGA 1WVGA 3ANNA 1XELA 2PGDA 5A9TA 4IY1A 1A4UA 3AOEA 3JV7A 3W1VA 4PLCA 3GH3A 1DFIA 5JSFA 3JQBA 1LDGA 3PEFA 4MVJH 1QXSA 1O89A 3G0OA 3WTCA 4FJ0A 4Z6KA 1BHSA 4OSOA 5B12A 2AE2A 2UUOA 4DIBA 4D0RA 1HLPA 1ZK3A 5F1OA 1YB5A 3AUUA 2O50A 2OBYA 3GUYA 1NXQA 3DHNA 3DZHA 4XB2A 1TI7A 4UREA 4LCEA 4YRAA 3E9NA 5C7IO 1T25A 2BGMA 2WEKA 1LSSA 2I65A 1BDMA 1RJWA 1P74A 4MVJF 2OGUA 3ZWAA 4UAGA 1WZEA 4XIYA 1DJQA 4BVAA 3DBHB 4FFNA 1PJCA 5IF3A 4QTZA 3QW2A 2P5UA 2JD1A 3QWIA 1H5QA 1D4FA 4AJNA 4BKUA 4ZQBA 1QSGA 3SJUA 4FOSA 2Q4BA 2A35A 2J5RA 2D5CA 1D1SA 1UZNA 1TXGA 2BFMA 2NM0A 3QLJA 3ONDA 1FDTA 2A4KA 3RUIA 4E4YA 1PL8A 2JFFA 2Y67A 5H82A 4L9RA 1C1DB 1Q7CA 5ILGA 3W4IA 5I8ZA 1NPYA 4ZGWA 2FRDA 2Y1OA 4BGUA 1LLQA 2ZCUA 3FHLA 5KKAA 3JQ9C 1PGPA 4J4BA 4Z0TA 4NFSA 3DAPA 4BMNA 2BI7A 4XCVA 3PHIA 5G0SA 1CEQA 5JDCA 1YQXA 3R3JA 1BXKA 3T7CA 4QFDA 4ZQGA 2VZ0A 4NIMA 1HDXA 3AWDA 3ZI0A 5TRTA 1QLHA 2WE7A 3C85A 5DF1A 1DPGA 2AQ8A 4FC6A 1BW9A 1T4BA 2AEJA 1R0LA 4GSKA 2EP7A 3A9WA 3RROA 1LDBA 1IL0A 2B37A 4R1SA 3L4BC 5G0TA 3KOUA 5HRUA 1NFRA 2EGGA 4CMIA 3WGYA 4EJ6A 3AUTA 4HFJA 1Y6JA 4DIOA 1I3NA 2PFGA 4FGWA 3LC7O 1ZSNA 4ZA2A 3DL2A 1SEPA 2VWGA 4N5MA 3E6AA 2DM6A 2YQ4A 1V9LA 4CMAA 1UP4A 1PTJA 3FNEA 1T2EA 4PGFA 3SLKA 4W82A 1DAPA 1DIHA 3WYEA 1NWCA 3VPSA 1Y5RA 3INRA 2RIRA 3WDSA 3DZIA 4D3FA 3D3EA 3V1YA 1GYRA 2JHGA 4PLGA 4CM9A 5B4TA 5CEFA 5KJEA 4BO7A 5L4LA 2EJVA 1EMDA 4ALIA 4CMEA 4AG3A 4OIMA 3JQCA 1U4OA 3WYBA 2X23A 5HTOA 4PZCA 4I5DA 4RPJA 1L1FA 4R5MA 1Y8RA 5L7YA 4CM5A 4TZKA 3HHPA 1YDWA 3QWHA 3RWBA 2HMVA 3K9QO 4IINA 3DO5A 3GY0A 4O63O 1HDGO 4RPLA 4D3DA 3PDJA 3PQFA 5G2OA 3A4VA 1XCBA 4NK4A 1T24A 4H7PA 1U2DA 5F1KA 4DWVA 4BV9A 4J49A 4EITA 2I76A 4PLFA 2H6EA 4K9DA 3W4JA 1P44A 4CQMA 3JQEA 4R5HA 3JQAA 2HRBA 3NX4A 2FN7A 1C0IA 3QVTA 3PLNA 3QVOA 4KUHA 4IJUA 5JO0A 1Y8QB 1LJ8A 1EQ2A 5C7OO 4FS3A 1SOWA 2CD9A 2A92A 4BNHA 4B3IA 4AJKA 2ZYGA 3QWBA 5IXYA 4E31A 4TZTA 4JLWA 1I2ZA 3IMFA 1TB4A 2BFPA 3F46A 4ND4A 2R00C 4EZBA 1E3EA 2PKQO 3LT2A 4W7HA 3DQPA 4FFOA 4GMGA 3MJCA 2NUAA 3L9WA 3LLVA 3OJEA 5L40A 4DLAA 5I7SA 1B8UA 1CQIA 3FWZA 2WDZA 3OEYA 4LMRA 4MVJI 4YR9A 3VPGA 4YACA 5JCXA 3A28A 1VC2A 5AYVA 3VZRA 2V6BA 2X5KO 1PX0A 1U1IA 1DEHA 3EVTA 1E92A 5JCJA 3ICCA 3L6EA 5BT9A 1IUKA 3Q2KA 2VRCD 4R01A 4AJIA 2OMEA 2C7VA 2J3KA 3MJSA 3MOGA 9LDTA 3WGIA 1SO8A 1BVUA 2P4QA 2FR8A 2V6MA 2EERA 1CETA 3KUXA 4LRSB 1A7AA 2I99A 3D0OA 4YEDA 3UW3A 2PWZA 1A72A 1NQ5A 1C1DA 1QYDA 3E48A 4FW8A 1RWBA 1YS4A 4TRJA 3UHAA 4P8RA 5K0ZA 3GAZA 4PRKA 1RM0A 3VPXA 3G17A 2D3TA 1MUUA 1U4SA 3U4CA 1E77A 5DULA 5CFZA 2OP1A 3HADA 1GR0A 4I9HA 3OMLA 1RPNA 2P9GA 4GGPA 4WCFB 1Q7BA 1Q1NA 4G81A 1XQ6A 2E48A 5T67A 1LLDA 4RPKA 3D7LA 1EUZA 4XGIA 2X0NA 2ZTUA 5G4KB 2IODA 4YQZA 2VYNA 2HMTA 1NFQA 4IGEA 1BTOA 1TT5A 1WZIA 3RSHA 3PFWO 3OEWA 4L8VA 2YHIA 4DPMA 2GZ2A 2HUNA 2ZCVA 3H2SA 1SPXA 1ML3A 1ID1A 1MXHA 3AJRA 1P0FA 4FC7A 4GLLA 1ZXBA 1NFFA 4TVOA 3BHIA 4OXKA 5GZ6A 3TZHA 3BMOB 1ZFNA 4Z3KA 4KQWA 5EQDA 2RHCA 1PWXA 2O2YA 1SZJG 3ETGA 1YKFA 4QO7A 1Y1PA 4OXYA 3NYWA 2PNFA 4ND2A 4D0SA 3E82A 1AHIA 4PG4A 3BIOA 3JQ8B 4CR8A 3UCXA 3JQAD 1VJ0A 2DUUA 2FSVA 3TZKA 1A4IA 2OP0A 3LK7A 3PI7A 4CUZA 1DC5A 1F06A 3E18A 5AXCA 5LDGA 3AY7A 1P3DA 3JCZA 3V5NA 2G5CA 4BO4A 4IDEA 4RO0A 1GQQA 4BS9A 1KEWA 3ZWYA 3OQ6A 3V2GA 4E6PA 1PJTA 5I9NA 4GX1A 4AJPA 2Q2WA 3K30A 4CLXA 3H4VA 3VOSA 2BHLA 2EW8A 4DMMA 2VCYA 3WSWA 4EUFA 1T1RA 4ALLA 1DFHA 2AXQA 4UEKA 3EHEA 1WMBA 2VZ9A 2WYWA 3ZWWA 1I32A 3AY6A 1HYGA 1FDSA 2Q1SA 4AICA 2DFDA 3GVCA 4I9NA 4ZN6A 3LVFO 4FFRA 1OI7A 3DMTA 2GZ3A 4M89A 4YBZA 4CM8A 1SB9A 1LX6A 3I4FA 5JMWA 4YRDA 5T8KC 3PHJA 2ILTA 1NQOA 1SOVA 1SAYA 2P5YA 3DFZA 4MDHA 4MVJA 4GX5A 2FY8A 3HFGA 1IPEA 1X7DA 4ALJA 4J90A 1K89A 1ISIA 4GAEA 3A1NA 4IJWA 1EVZA 5JAZA 4I5EA 3S55A 5COBA 3JQFA 2PV7A 5BNFA 1XWFA 1WNTA 1U28A 3PLRA 4BNIA 4NHEA 4J9UE 3VTFA 3WBFA 4ILKA 3QIVA 4P22A 3KYDB 5G0WA 3LQFA 5CHEA 4NPCA 3K96A 4WCDA 3AI2A 2C07A 1K6IA 2YDYA 2JL1A 2NVUA 1XA0A 4L0QA 1AXGA 1XU9A 4GKBA 3HZZA 2IZ1A 1IOLA 4CMCA 4EUEA 3P5SA 3GR6A 3H5RA 2BD0A 3F4LA 4G2NA 3BTUA 2OOSA 4W6ZA 4XJTA 1H94A 4L74A 3B1FA 3PYLA 1XKQA 2VYND 4BB6A 2IEDA 1D7OA 3ICPA 4D46A 2NU7A 2QG4A 1R6DA 2OZPA 4A7PA 5MGBA 4E32A 2XXJA 5DDIP 2FMUA 4O59O 2IE0A 3N58A 2EP5A 2EHDA 5IAAA 4OKIA 2Y0CA 3RAJA 3WYCA 1E6EA 3IIEA 2W98A 3JD1A 3ZH2A 4CPDA 3K92A 3I5MA 4QUKA 2DBVO 1ZMOA 2BF7A 1C1XA 3AU9A 4OGWA 1F17A 1R4MA 3GPIA 4BNFA 1PGNA 3IKVA 4TWRA 4DA9A 1K0UA 2JFGA 3WB9A 1MGOA 1U5CA 3PWKA 1ISHA 3GHYA 5TT0A 1EE9A 1NBOA 1C0PA 5EJ2A 2O3TA 4QFCA 2GNAA 3WQRA 2HMUA 5A4DA 2EGHA 3AI1A 1EQUA 2WYVA 3NUGA 5JXWA 2D59A 4J7XA 4DYVA 1QMGA 4IZHA 4DRYA 2X9NA 1QYWA 1Q0HA 3NT2A 3KV3O 3VDRA 3I9KA 4GMFA 3WMXA 4ONEA 3VPHA 2Q99A 4GWGA 4CLRA 3QV1A 3ZU4A 2C2XA 3BMCB 2RHRA 1S7CA 3QRWA 3BAZA 3I9JA 4NBRA 4U7WA 2FHSA 4AJJA 4UEOA 1CYDA 2NTNA 3WXBA 2HRZA 4RF2A 4R1UA 5BNTA 2DAPA 3L07A 3W6UA 3GQVA 4RLSA 5A1TA 2NQTA 2WTBA 4DYDA 3GEGA 5G0VA 3R3SA 3FRJA 4YXFA 1IYZA 5BSGA 1P1HA 3MWEB 2IYPA 3LC2O 1A27A 3EDMA 5EINA 1BVRA 4L4SA 3T4EA 1E1KA 1Y5MA 1KOLA 4IM7A 2CVQA 4AJ4A 4XYLA 2RH8A 5EESA 4P38A 2ZJ1A 3ETDA 1JWAB 5I7VA 3DZGA 1YBMA 3E03A 2JAPA 1RM4A 1LI4A 3D64A 4Y8VA 5G4LA 1HDRA 1P1JA 3D4PA 3H3JA 1YOVA 2ZQZA 3FR7A 4KTVE 5DN9A 1LSOA 5IFLA 3JTMA 3RUHA 4BGIA 1XR3A 2DLDA 2Q1WA 2X86A 1NHWA 2FSSA 3WWZA 1GZ4A 3INGA 4IDFA 4JIGA 1E1LA 4XYEA 4TKLA 2H9IA 1R4NA 1B2LA 1NR1A 1GQYA 3CIFA 1MG5A 1IHYA 1QLJA 1DXYA 2GF2A 2AHRA 3DHEA 4J1SA 4XA8A 3VC7A 5ER9A 3JD0A 3K6JA 1MG0A 1NQTA 3ADOA 4XYMA 2IYOA 4WLNA 4E3ZA 2HQ1A 1ZIDA 2CVOA 4U6SA 4WASA 3COSA 3DC2A 4CV3A 2GRAA 4CMHA 3MJVA 4FFLA 3PGJA 4PLZA 4XWYA 3MJEA 4GX2A 1N7GA 2CVZA 4EDFA 5A9SA 3DBRA 3GGPA 3P19A 2C5EA 4ZU3A 4DQXA 3Q11A 5J23A 4HKTA 2X58A 5FI3A 2QHXA 2CUKA 1YJQA 4BO0A 3V2UA 4MVJM 2ZIZA 4U5QA 3GEMA 4R69A 1GY8A 5IZCC 1JAYA 2NNLD 2VUUA 5H81A 4PG8A 5A3VA 1RYDA 2HJSA 4E5KA 3FNHA 3WLFA 1HDCA 4AJ2A 1UP6A 1NAIA 3TPCA
chains in the Genus database with same CATH superfamily
3TBKA 1P0QA 2QW8A 2YCLA 2JLYA 4KZPA 5D51S 4EQ6B 3ZTWA 5BN3B 1YMQA 1XCGB 4FK8A 4AQYB 1A82A 2A7QA 3IJRA 3F98A 1QDLB 1C3JA 4MRPA 4RTOA 2BM9A 2H1HA 1GL6A 1WHTB 1YJXA 3MS7A 3V8EA 4AO7A 1P7PA 2O3JA 3BMNB 2QVBA 3KSZO 5K8CA 3DV9A 4FNGA 1OTHA 1JPUA 4ANFA 2NTVA 4O4JA 1I6KA 2WJ4A 4ZVOA 3UENA 1H0KA 1WZ2A 4O2BB 1JIUA 1J06A 1QF6A 2DUWA 1E9EA 1I7NA 1FMFA 4W1PA 5B1YA 1Y7PA 3L2OB 1VSVA 1B8OA 3NALA 4A4DA 5HDQA 2WF8A 1U04A 1HQYE 3L6CA 2JLVA 2RHMA 4WNIA 3U0BA 5GM1A 1KETA 3NTRA 2AYYA 4UZEA 1LPOA 4KAFA 4C0XA 3C7AA 3UJ6A 3UZUA 3ILVA 4Q4CA 2BT4A 2Q9CA 3JWEA 2GD2A 5BSEA 4D43A 5C4MA 3AOEC 4EIWA 4R6WA 5LDDC 1C9JA 2FG5A 5KPJA 2ZRFA 4JP3A 5TGTA 1P6XA 5B37A 2OV3A 3RFCA 4LWOA 1G60A 1USVA 2ZQYA 1LQTA 4JLUA 4MI9A 4TS3A 4FZ5A 3ZV4A 3FZNA 4CVNA 4BVHA 4IICA 4QPCA 3TTWA 2J46A 3QU9A 5CDGA 1NRIA 2P3QA 1TM2A 4C5AA 3HSYA 4L08A 4OJYA 4HS9A 4PFJA 4QPJC 3IUBA 3CBQA 5TLSA 3UMMA 2WA1A 5KTSA 3IT3A 5ALOA 1E0DA 1P4AA 3O0TA 2FMTA 1JUDA 1YMUA 4XAQA 4C14A 2IDZA 3EZLA 3EQ8A 2NQ8A 3O4FA 2PXAA 3EZYA 1R6TA 3FZYA 4J2TA 1NBWB 2VLBA 3GGCA 4GT1A 3V9AA 1XVAA 2BLNA 3D8HA 1QWSA 1VLMA 3EQZA 4I19A 1A9XB 4RJ2A 5DW0A 4ZT5A 4Z3OA 1MT3A 4D3ZA 4D6XA 4Q19A 4YAGA 5DCWA 1FXSA 1E3LA 2AXPA 1KDRA 3KJQA 5TQ2B 4D4HA 3KJFA 4DV3B 3P2OA 3QLUA 1BRTA 2QU8A 4W8GA 4TKMA 3TNYA 5L45A 1VSUA 4DXDA 1N8KA 3O74A 1L5LA 1VL5A 2XVAA 4P4LA 2PE5A 4RHCA 2PCLA 2QKYA 1KIFA 3VU3A 4UHJA 3BWVA 1X1AA 2ZOSA 2J7PD 3EOBI 1TVKB 3M6MD 3SJZA 2CXXA 2AEEA 2PGIA 2ZUTA 3EF3A 3K0CC 4D82A 4DBLC 1ZI8A 1QGZA 3QPVA 3OZIA 1Z2PX 2OAQ1 4HAXA 4LMAA 1Z0DA 3WYFA 4BO3A 4CTMA 1T5HX 4OQLA 3SBOA 4MI3A 2AD5A 3EVCA 2VYVD 3X1XA 4QD3A 4CTJA 5KO2A 1MXFA 1J7KA 2GB4A 1KY5A 5IM4F 3IA2A 3RFVA 3RVMA 4ZO9A 3NDBB 3ZK8A 3C1AA 4K26A 2AWOA 1MO5A 2Q28A 1YE3A 3AEZA 1P0MA 10MHA 2H4JA 3QFRA 4DSZA 4CGZA 3EQ6A 4B79A 4AIRA 4AP9A 2DHCA 4JB0A 3MQ4A 4BAZA 1JH8A 2JJQA 1GPDG 3OJXA 4L9SA 3ZX4A 3LRTA 4G07A 1TK9A 5JLJA 1KWKA 2UXBB 1G5QA 1UXGA 1MB9A 2C5AA 3D6MA 3K2IA 5CHYA 4YV2A 5GM2A 3AETB 3C24A 1M75A 4YJ3F 4TUYB 1E3WB 1JT9A 4CG3A 1UK6A 2C2YA 2NTEA 4GXNA 4CF3A 3ASYA 2BFBB 4RL4A 4PQYA 3T7IA 2CXUA 3V32A 3VO9A 4DJFC 3RADC 1JSLA 1PTJC 2WTEA 4LTNA 1HNZB 4EBFA 2EATA 3O8QB 2PXHA 1VL0A 4XZ3A 3KR9A 3N0RA 3C74A 5L51A 5K2OA 4OXNA 5B3AA 2ASEA 2ZB4A 3DV0B 4M7RA 2FMKA 4TTRA 4OV6B 2P9JA 3X1JA 3BXXA 1DZ3A 1HT1E 2BMFA 2FMFA 2QN1A 3UK6A 2VSFA 3ZDFA 5IJWA 2Z4SA 2VH5R 3BE5A 2Z43A 3PC8C 4US0R 1PHRA 5FPTA 1HMPA 3OETA 3RVSA 2DXIA 4MMYB 1I9CA 1UQTA 3RLFA 5T4FA 4CMEC 1NJ6A 1JIKA 2AKAB 1GTL1 1MIOA 2HPAA 1ZD3A 2I2WA 3A11A 3EXHB 4RKFA 2O14A 4WECA 4YRCA 3W04A 4C05A 3ACBA 4MIEA 1K1EA 1E4VA 1LFDB 2FPGB 4ER0A 3BOSA 3MBKA 2XGJA 1DQNA 1XC7A 3QEMA 1A0OA 3FTEA 2QENA 5JI3E 5IMBA 1ZSVA 2R65A 1P72A 4E0BA 5C53B 2G9QA 5DNYB 2I78A 4PAOA 4PSCA 2REBA 3E58A 4PX2A 3NJ8A 1WG8A 5TS3A 1PUXA 1XJ0A 2PGXA 4CFSA 4V0SA 2FNAA 4ZWNA 4FHFA 3BFVA 3QA3E 4DG8A 1U2DC 2HC9A 5J63A 1Q19A 1OXBB 1WCIB 4URXR 3VH1A 2H57A 1W5FA 1PJBA 2FWPA 3BTSA 3TTTA 1SQGA 4JKYA 3ZKWA 5AUNB 5KX5F 1VCNA 5C31A 2EDCA 1HFEL 2RSLA 4A73A 4M0EA 1QG2A 3H9BA 3K2EA 5AVKA 5TEVA 1DMRA 4N0PA 5AKZA 4P84A 1NATA 4UNRA 2GZAA 4FUQA 3KQTA 5HS6A 3OF3A 2V5AA 3I1IA 1F2UA 1BWQA 1HH4A 1NBME 3IMCA 2VA9A 3P32A 4OHBA 1W85A 4RY2A 5A6SA 3RT1A 5BVHB 4NYMQ 3ZV6A 3IC5A 3WDMA 4D7AA 2DHQA 1G0NA 3OJFA 4M76B 4DCCA 1RT9A 4CR7A 3PJEA 3UH0A 2G82A 2CXHA 1L7DA 3PF9A 3NM4A 2C3YA 1XZEA 2J9XB 3CX3A 3VDXA 1EB9A 1MQ9A 3D4OA 4YASA 2ZB2A 5AW4A 1O03A 3B1XA 1SRQA 1BXGA 1O9BA 2VI5A 3F5DA 2ZFUA 3WADA 3MGBA 3HO8A 4ZRMA 3OJCA 1RI2A 3RC3A 1M2VB 3D2CA 4G1BA 4OL9A 4P4TA 5FF9A 1DCFA 4N47A 5JRJA 1FNNA 1TC1A 3BIJA 5KQPA 3CLUC 3N7UA 1AHHA 1JFVA 2SNIE 3CR3C 1DBIA 3TR6A 3U5TA 2P0YA 1V7QA 4HTAA 4QELA 1UMKA 5DXAA 3HVJA 1N1GA 1QHEA 1CTQA 5JECA 5B58C 1V0JA 3WTBA 5E6UA 1Q57A 2A5GA 5CUQA 1JHVA 3R6DA 1JMKC 3WVNA 3DWFA 3L6BA 4XQ0A 1GZ7A 1H5UA 1VRCA 4YV0A 1GAXA 1PVVA 3B2QA 3FYUB 3PPXA 3M6WA 4HSEA 4HQKA 1TU4A 2NVBA 1ZOLA 2BKAA 2Y1WA 4A2QA 4DLYA 3R3YA 1MQAA 4Y1FA 2PVPA 2FW0A 1QK4A 5YASA 1YR7A 4MQLA 1FW6A 2X9QA 3M1LA 3BULA 3PCTA 4XDYA 4KE8A 3TLJA 2Q50A 4JYMA 5DTMA 3UWDA 1TD1A 1F2VA 1ZMXA 3AINA 2PMKA 3QV2A 3JVEA 3R0IA 4EM6A 1C8KA 4M6WB 5AW2A 4LYAA 1U1DA 4TTSA 3TTYA 4TXJA 4X9XA 3L0OA 1D4AA 1MO3A 5K8VA 2QTLA 4MWGA 2AQIA 4IDHA 5HWSA 1ZA1A 4A1FA 1JG3A 1XRJA 3Q5EA 4LGCA 3H5AA 3VPBA 2A0KA 4BZXA 4DWJA 4S2EA 1VE6A 4A15A 5JZOA 4NJEB 1GKUB 5AJTA 4EFLA 4CEHB 1HM5A 3DMNA 3ESXA 3CJQA 4ER7A 3PDHA 3GGDA 3INNA 3QK7A 3B9RA 3DBHA 1CY7A 2UZIR 4PIPA 1AKUA 2ID4A 2XDQA 5IF9A 3KSBC 4BP9A 3NHUA 1U2PA 4DBZA 3I9OA 3LGXA 1W9MA 2ZYAA 1AF7A 3GRKA 1KVRA 3C3DA 1JJBA 2GK4A 2BTQA 2JCXA 3DGEC 3F6YA 3IPRA 4NONA 4X97A 4Y9TA 5CEJA 3EXFB 3GIDA 1CUXA 4IJVA 3ND7A 3CVJA 4FYHA 4J0DA 2ACEA 4MV4A 3ZLTA 3ER6A 1NJ8A 2HKIA 2R5NA 3B3AA 1QTIA 1ZNXA 4DZZA 2WKPA 3MUEA 3R0ZA 3O4HA 1FCJA 2CXRA 2FSVC 1QDUA 1F4LA 1YGYA 4WY5A 4W7IA 1M76A 2B4QA 1BU8A 1E7MA 3TUIC 1EFDN 2WYOA 3G68A 3IXQA 3ZHBA 1E3JA 1KDPA 1GTMA 3ZV7A 1CE8A 1USUA 1X1EA 3H83A 3S8MA 2J3EA 1IN5A 1I24A 3TD9A 5IUNC 1HSOA 1FJGB 3KDAA 521PA 5BRAA 1EDZA 2NSDA 4OA5A 4Q4HB 3TGWA 4B4KA 3QHPA 1ZOOA 4JEUA 4RZHA 4DA8A 3PGXA 3SYNA 3P0EA 2ECKA 4PPGA 1KMMA 3Q3VA 2VRNA 4C2UA 1QE0A 3DOJA 2VTDA 3NRCA 4JDPA 4P5DA 4AJ9A 3U40A 3VVBA 1WCWA 1DI0A 2R87A 4JBYA 3V48A 3WMWA 4JL6A 5FL7D 5KU1A 1RXWA 1ORIA 2OO3A 3I8XA 2XDWA 3GPCA 3ZY3A 4CM7A 4EKIA 3E7XA 4ZVUA 3AEKB 3IOCA 2ZBRA 1WXEA 2ZEJA 4DV1B 4O6VA 5KSOA 1Y9DA 5KTYA 4G1MB 2ODAA 2DF8A 3RUEA 3TXXA 2LTAA 5I3ZA 2OSBA 4RDXA 4EATA 2WSLA 3IR7A 1EHIA 1H22A 2IBTA 1T15A 2CNNA 1NLZA 2YWCA 3OTIA 4GPIB 5DT9A 1CQJA 2JIBA 1J0BA 4G5QA 1I0ZA 2C1ZA 4AG5A 4RTKA 3IQIX 4Z0PA 3HR7A 3VR2A 5IZCA 3M9LA 3PTZA 3TJRA 5CFPA 3RC1A 3KZMA 2EAUA 1G8PA 4Q7KA 4W1RA 4BE9A 4J0FA 4O2AB 4JLJA 5DBGA 4CEIA 5IP5A 3ZHCA 2XXAA 3E3NA 1IDN1 1U3CA 3EQ7A 2FWBA 4BLOA 4RTMA 1BCSB 4NDNE 1V6AA 2PX3A 4QGFA 2BP7B 2VXCA 2R8XA 2ONZA 1RBZA 3DEYX 3H5NA 3O6VA 3P71T 4RH1A 4YP1A 3ZPXA 5K45A 5E8JA 5EHGA 1YFJA 2Y2UA 2IS4A 3VTKA 1FSSA 1KMHA 4YT4A 1U0JA 1RADA 4YR7A 1W25A 1CUVA 3OX4A 5HNKA 3EE6A 2XNSA 4JLOA 4US2R 2RGGA 4ZT3A 2PWPA 2EIXA 3H2IA 3I2GA 1SXPA 6GPBA 2VHZA 1HWYA 1F4VA 3H4IA 1H2EA 4MVWA 1E61A 4LVNA 2YXPX 1HEYA 2AL7A 4LEIA 4MHOA 4WH0A 1L4MA 2ZWAA 3QVJA 4C6TB 4KJXA 1F51E 4CV1A 1CJSA 3D2AA 1ETHA 2FP4B 2WOJA 1VHQA 3F7OA 3PPVA 5CJJA 3QBJA 2Z56A 4B3SB 3WGZA 1YONA 4D9HA 3M5CA 3S81A 2N0SA 1NDQA 2ZRMA 3IHLA 4RHTA 2EARA 3FPJA 3IDSA 3MSCA 5EP2A 4WZAA 2H1CA 2OQVA 4BLPA 1EDEA 4R3WA 4EG1A 1QRDA 1NXWA 2CBZA 2WJYA 2YYZA 3VU9A 1S2DA 4K81B 2PD6A 121PA 1JQDA 3KVVA 3AL2A 4WZ6A 1B43A 3E7WA 1A9SA 5CX1A 1QVAA 4C22A 3OSUA 5ALSA 3PHBE 1B15A 4M0UA 4YTEA 4X7RA 5FOUA 1X7ZA 4BAGA 5L3SB 1NI5A 3LT5A 5B53A 2PSJA 1G19A 3UCEA 4QUIA 1ADFA 5HX7A 5AK3A 1E64A 1H0SA 3VDMA 5G53C 1GRNA 1XMSA 3GF4A 3QHQA 4H1TA 4YJ3A 1NVVQ 2EYUA 2XYGA 2HO4A 1TCBA 1N5KA 4YRQA 1ZR2A 3FUUA 3LQQA 1EBUA 2Q3JA 3ABZA 1AQNA 3BERA 4M2LA 3VR6H 3REFA 3L7NA 2GJAA 4KL8S 1TJ4A 5K3CA 3UMGA 4ECEA 3EIWA 4C2AA 5CBPB 4LFBB 4EYEA 1CDDA 2JI6A 1J21A 4H6PA 4KQCA 4KV9A 4N65A 4NU5A 1E2NA 2QLLA 1FLDA 2HNAA 3MPUA 4IWXA 5ALDA 5IN4A 3PL1A 2APJA 4OD0A 5FX2A 4RTPA 4LBWA 5HMMA 2DVMA 4WK6A 3THWB 3LUGA 4AF6A 3WJAA 1R10A 2CMHA 3JQDA 4M38A 2PN1A 3TQQA 2A7XA 2BUAA 2ZULA 5BPHA 4FHZA 1GL3A 3FGOA 2YJ4A 4UUMA 3DZKA 5NULA 4LGVA 3DP9A 4D4GA 2X19A 2N1MA 4EP1A 1LBQA 1ZIXA 3LUFA 4B7ZA 4G56A 4GYKA 5K0LA 2CLHB 1P2SA 3GGJA 3RUAA 1LGYA 2W93A 3AJEA 4MOWA 3TINA 2BGRA 4ID9A 2PUJA 3TDMA 3K70D 3EPKA 2FOLA 2NX2A 3IOYA 1E9BA 3KSRA 4I99A 3BYZA 5GONF 1JEJA 3W78A 4GM1A 4YUWA 3L46A 1XNRB 1XCLA 3DAGA 1M2OA 2JAUA 1L7QA 2XUZA 5JO9A 3QFSA 1ZH4A 4N7RA 5JAPA 3F1KA 1ZESA 3HNPA 3FD8A 2YINC 3FWHA 2Q2VA 5KX5A 1MEOA 1UBRS 4G24A 4LF4B 1QZUA 4LOIA 4F45A 3ENQA 3IDQA 5HJ2A 2COKA 4FR5A 1L4BA 3I1JA 1ZK1A 3L1VA 4IDAA 4ISBA 1OBOA 4E5SA 1QP8A 2Y1XA 4K9KA 1NW9B 2Q6LA 4YV7A 5AI8A 2EWVA 4N18A 1HT0A 1IWBB 3GOHA 1QVZA 4LJYA 4WCFA 3SDSA 2WB2A 3VKGA 1YULA 3KAQA 3I32A 3MWJA 4AS3A 1CUUA 3GU3A 4ZIRB 3E1GA 2PH5A 4MYUA 4OLHA 3TFWA 3FR8A 2QUKA 1JQKA 4IFTA 1DRJA 2H51A 5TMEA 1JEOA 1SA0A 1YQUA 2L18A 4O2BF 2YV1A 2MDTA 5FQNA 5AKGA 2E21A 1OXVA 2CMDA 3OCUA 4KYIB 3WV4A 2YMMA 3DE4X 1F9AA 3N8HA 1UIMA 5DM60 2B99A 1YBVA 1E79D 1E58A 1QE5A 1U6IA 1YDGA 1HFJA 2ODQA 1JVSA 4FPXA 3VAAA 2GZSA 4EPYA 5CK4A 3TH5A 4YPOA 5IVPA 1FK8A 4PYKA 3TRIA 5JYCA 1GU1A 2W83A 1OVMA 1NC3A 3W8NA 4HNSA 1OB2A 3BMOA 3F6EX 1B0PA 1KSFX 1O2DA 1P1RA 4K9PA 3TG2A 4LZWA 1D6JA 4QDXA 2KW5A 2Y1CA 2QX4A 4A8JC 1X7GA 2C78A 1W48A 4LDNA 2XNKA 2VHEA 4H7EA 5CVDA 2ZJ0A 5BSFA 5EKXA 3MXOA 4MW6A 3IO3A 3GX1A 3WA6A 1PWZA 2HNKA 5KWVA 4KAXA 2OD9A 2AYXA 5I9BA 4C4RA 1ESEA 4WNAA 4EY7A 4KCGA 1K6XA 2VP3A 4JJZA 2V0NA 3AF4A 1HNWB 4MVXA 1PR6A 5TY0A 3VNUA 2W00A 1U9JA 3U3ZA 1UFKA 3ZN2A 4D9JA 1Z3IX 4DLBA 4MVJD 4B46A 1CF4A 2J9ZB 3TRDA 2GN9A 3F6CA 4ZC8A 1FDUA 4WL0A 2IFTA 3C7CB 4TN1A 1II0A 3E9DA 4DIEA 1GPH1 1K0FA 1JZSA 2EKDA 3QF4B 2DTEA 3PXUA 3QNUA 1J0XO 3RWMB 1N32B 1U7XA 2FI1A 1ETUA 4D0GA 5LLDA 2H00A 3U60B 4JD5A 4RTJA 2YIJA 1F6WA 3LECA 4PG7A 2AJCA 1TJNA 3TLCA 4BN0A 3SVTA 3SQXA 2G0TA 5BRJA 2GF9A 1KAEA 2CXOA 3OT1A 3QU4A 5MHTA 2XECA 2OQ2A 1MPXA 4D8TA 2WKRA 2XZPA 2RBEA 2GVDC 1R37A 2D2IA 1NVGA 5I7EA 4YRLA 5B3JA 3DUFA 3H5VA 3DNMA 1EHCA 3OFKA 4DV4B 1EAYA 5CG1A 3FMIA 3ROEA 2E4YA 4LJSA 2XYPA 3DF9A 4MS3B 5BSHA 4E2YA 3ORHA 1ZH8A 4KAAA 4I1PA 1TZBA 3A6LA 3JATA 1Y3BE 5IZ4A 1RXVA 3PIDA 2GQ0A 3GJYA 4FFSA 2BV3A 1YCDA 2C2WA 2V3WA 2XE8A 3FTNA 3IIIA 3IPLA 4N4AA 1ABEA 4DWWA 4YDQA 1SKAA 1UJ5A 2QYHA 3AM4A 4U0KA 5KHOC 1VL8A 3SJ7A 2ZU6A 1EXWA 3Q3CA 3QSYA 4V0ME 3RVDA 4ZXFA 4UE6A 3DONA 2FFJA 2B7BA 2Q3EA 3ZNOA 3DW3X 4LVUA 3I3OA 4PYOA 3M5WA 2EX0A 5IWAB 4O2LA 3IPYA 1MAHA 4MUAA 3GLHA 1IULA 3L8CA 2FSFA 2JHAA 3OF5A 4NH0A 2RONA 1V5WA 2YXBA 1WXFA 1A9PA 3DLAA 3JASA 4O3FA 5BY2A 5LZ9A 3MJ4A 3CZCA 1XXLA 2XGMA 5GMOA 4OXIA 1MJNA 1O94A 2XQGA 4CTKA 1BO6A 4TUYF 4B7XA 1N0VC 3E8XA 1AKQA 1GUFA 3LL4A 1H6CA 3FZQA 4CUKA 2JIPA 2WYIA 5IN5A 3ZR4B 3RS3A 5DTIA 1JXOA 1V3TA 3MN1A 1LNQA 4HB3A 1GRQA 2FXIA 3I2FA 3TFQA 1V43A 3CTMA 1QAOA 1L7AA 3ADCA 1Y5NA 3AHDA 1XZNA 3M1YA 2P2ZA 3PQ3A 4NCBA 2XOEA 3G79A 3FUWA 3B2EA 3FE2A 4NXNB 1GUYA 3G5TA 3QG5A 4HDSA 4P4SA 5LNK6 4PXAA 1CEYA 1SHKA 5EAIA 4RZ3A 1FVHA 3GWZA 4H3VA 3H2YA 4K0RA 2IPNA 3GVPA 5GV8A 2X6RA 1L4HA 1NGSA 4CDGA 1KFJB 1MX3A 3LDAA 4M37A 2HM7A 5SY4A 3ZY4A 1EWYA 1NL3A 3ONVA 1J8QA 2C5HA 3ZDQA 2YVLA 1T2FA 4J3FA 1E5VA 1SFRA 1G4AE 3QUBA 4JB2A 2M6SA 3GLGA 1O8CA 3ICEA 2NO5A 3OZ7A 3R7FA 1BW9B 4WSOA 5E2BA 3UJDA 1XZCA 5AJHA 4J0GA 2W4QA 1IEXA 2FSPA 2R6R1 3CLKA 2GZDA 4OUDB 5TQVA 4B3CA 1PZHA 2DPHA 5IS2A 2HMSA 3EWNA 3W3AH 1ISRA 4DEVA 3KPWA 1IY0A 5T57A 4F3RA 3FPGA 1O1YA 4CIVA 3AG6A 3CLRD 4L4RA 4KK3A 5A9RA 2FW7A 5LC1A 2I7TA 4EPXA 4HLUA 4A10A 3U4QB 3FWPA 1GNLA 4LHYA 3N6VA 2HCBA 5DP1A 4XYGA 2E7ZA 2XBMA 2CJFA 3SJCA 4K05A 2OCAA 4PTYA 4MHSA 5IJ0B 5I4KA 2H2HA 1S02A 1VMIA 4EI8A 4X44A 3TLYA 2GH1A 2CE2X 3ZHOA 3OMXA 3Q7SA 3GLGE 1EFLA 3CT6A 3BBLA 3EXEA 1YB1A 5AK4A 4ROTA 1X9IA 2PSHA 1YKSA 3IUSA 3IJPA 1Y7TA 3NR2A 3H9QA 4WEOA 3R3HA 4EB8A 1E89A 4ROSA 2C4VA 1CUDA 1JW9B 1S2MA 4W4TA 4BHTA 4XQCA 2CNBA 2VKQA 2QN6A 2XWJI 3NYIA 3V8NA 3BAFA 3E3LA 2UVDA 2F59A 5CT9A 3WLEA 1XAGA 2Y9PB 3VBEA 1R0YA 1UBOS 1O95D 1E3SA 2EWMA 2BVNA 3QEKA 5LKAA 3T35A 1XJWA 4R9RA 1NYLA 4ZJZA 1RJEA 2CKMA 4ZCLA 3RQIA 3RS4A 4DE5A 1A2OA 4FOPA 5B1IA 3VX3A 3B1VA 4B45A 1S3SA 3BUSA 3H86A 3KPJA 2Z9CA 3QX9A 5KVQA 1XRRA 4TTTS 1ODTC 4IXTA 3HMQA 2OM2A 4G0UA 3ETCA 3I9MA 1GN8A 4N54A 4KQEA 1ODFA 4TMTA 5B1DA 2QYOA 2ZIFA 3GP5A 3CM0A 4HXEB 3SWWA 2OGSA 2QDXA 4Y2PA 4HGPA 2VO1A 2VJQA 5LYYA 1LX7A 1GXSA 1WMSA 1ZXXA 3I4CA 2QN8A 5HIJA 4UC0A 1SUWA 2WUWE 4YRKA 2V8BA 2C7OA 3EVEA 3CLSC 3BT7A 3JPWA 4PSVA 1DBVO 2WT9A 2ZGVA 1S5PA 3JYHA 3HACA 3KQYA 3KUKA 3OQ1A 4R2KA 3AGQA 2BR3A 3I45A 1BDJA 1JG1A 1RE1A 1XCPA 3DE2X 5JNWA 3SF0A 1Y3IA 2HGSA 2GAIA 4MYRA 3FPKA 3FHOA 1A9ZA 3NBAA 3HXPA 4UUNA 4RENA 1KI4A 2ERXA 4RSMA 4KXYA 1R5NA 1JDNA 3LJKA 4Q24A 1WULS 4XM2A 3ADBA 3PKIA 1W36D 4WX2B 5HE9A 3MCZA 2Y05A 4WIAA 5JAIA 1V4VA 4LY6A 4R2HA 5DYTA 3BPSA 3VYSB 3W05A 1W6RA 3RU2A 1WOYA 4ZEVA 4QHYA 4YJHB 1CW2B 4BNGA 3GRPA 5JADA 1GTG1 2QUIA 3A0RB 3KCNA 3TXAA 2WMDA 2W0MA 3IEPA 3TDNA 5KVSA 2IELA 5J2UA 4OLFA 1OKKA 4UD2A 2ZRJA 3HZRA 4PO8A 3O75A 4CFZA 1OFHA 3ETLA 3PGMA 5GONA 1FMCA 3WRWA 2FZ5A 4ZQEA 2QM3A 1AK9A 4L4UA 1N3LA 2CNDA 1UZMA 3CUEF 4QQNA 4UUOA 4L9WA 2PX8A 4IAOA 1NR7A 1QZ3A 1SHUX 2P6OA 4DDTA 1WDTA 5J5AA 5J43A 2IS1A 2J32A 2XRMA 2GS9A 1Z16A 2BEUA 3WBKA 2NPOA 4ON9A 2PL9A 4XDHA 4BKRA 1FXWA 1NW5A 1SXJC 4B81A 3NVMB 1YJBA 2NNWB 2GD1O 2GPBA 4FE4A 3LV8A 3LDHA 3KKLA 2YS6A 5BN3A 1ADGA 1C0LA 3L7YA 3S2FA 3TUJC 5E7MA 4CF4A 3GD5A 4OATA 1Z75A 1FMJA 2FJ0A 2JLBA 1GYQA 1WHTA 2OXTA 1ZRMA 2V6IA 3IOBA 3WOHA 3BMNA 3C6ZA 4KQIA 1I3CA 1U1CA 4MLZA 1BMFA 3VZBA 2WUVA 5CFQA 1Q0LA 2CYCA 4O2BA 4QULA 2B4TO 3JXEA 4KG7A 4R71A 3F74A 2PSSA 1RRKA 2R84A 1NUTA 5IDYA 4D9MA 5CA1B 1XLTA 3UMYA 3GJXC 3PZBA 1XL1A 1MOZA 3JD2A 1JU9A 3NBMA 2H52A 2N75A 3HRKA 2J4CA 1QR6A 2QQFA 4FSXA 3SXJA 2DULA 1B8NA 1XOIA 5ESRA 2NZ8A 2ORYA 2JA2A 3E5RA 2VJYA 4NV1A 4B32A 2NADA 5KU7A 5BXQC 3U1VA 2VNIA 4IQ8A 4KQGA 4PICA 4NCHA 1UMDB 3UICA 3ZOZA 4EKNB 1CEEA 1PR3A 1QH1B 1BOOA 4U3JB 3I6QA 1N0IA 1ZI9A 2P11A 4KEAA 1FP2A 3I2YX 2VIIA 5IT5A 3A10A 5DYWA 2E5LB 4JI8B 3LBNA 1GLGA 4LZNA 5KYTA 4ZU1X 3N74A 4RL6A 2JDID 2H1IA 3VNAA 3K70B 1JPJA 1TT5B 2BMVA 2IOHA 3BZWA 3G59A 1TAGA 4JXXA 2Y92A 1F0PA 3SIPA 1WXWA 5C8DA 1J0EA 4M1SA 2PFKA 3IP6A 1XRLA 4C89A 3RFTA 2YY6A 1V9CA 1VPEA 2GEKA 4N6NA 1DQZA 1C3VA 2MTBA 5B36A 1REQB 1U3GA 2JBAB 4ZU6X 4BDSA 3E4CA 4HGZA 4RMJA 3PLAE 3DT6A 4ENWA 1I7DA 1A5ZA 1XZDA 2UUPA 1SCJA 1BHJA 2V7XA 4GFDA 1O96B 1T2UA 4NYJR 1XT6A 1Y1LA 4L8FA 1A9XA 4O2AF 5CGQB 4DMFA 5LIPA 1G21B 4L5CA 4RADA 1J4AA 4V2UA 4EYOA 4FDLA 4QBKA 3OWOA 4NTZA 4QOGA 1H85A 5TQ2A 3WGKA 2C7PA 3N0VA 1L5HB 5DO9A 1MCZA 4UE3S 1GRCA 1NLMA 3OU7A 5HCIA 1HEUA 1FP7A 4JVMA 4ZT6A 4R2WA 2R1ZA 4I8XA 1XDBA 4JQCA 3H16A 4EGAA 4L76A 1Z5PA 1PJ4A 4QYTA 2ORIA 2CMFA 4ZZIA 1RFGE 3QLVA 5BQ5A 5EJ6A 1F1BA 4NU0A 2QX6A 1JR3A 2KLBA 3KVYA 3W1WA 1TT7A 3A9TA 4OHCA 2WSIA 3HXTA 4ZAZA 3F73A 4KPGA 5BV1A 3P1JA 3QXGA 4POAA 1A8QA 4D9KA 5AVXA 4B3RB 2ZBGA 1XCOA 5JS7A 4MDFA 1M34E 1LRLA 3QYPA 3ECCA 4C6SA 3CXRA 3I2JA 4WXMA 4XFDA 3PG5A 4IHQA 2AG0A 4M1YA 2NYRA 5DPMA 2F43B 2W5UA 3OESA 3DLPX 5CJ2A 4B1FA 2NAFA 4HLQB 3DNFA 4MJXA 5DK6A 4BBPA 3JQ6A 5EWJB 1I8TA 4Q12A 5AVSA 4RS4A 3KETA 3JRXA 1ZCJA 2XJ4A 5D8DA 3ES9A 2C9BA 3HB0A 2DBRA 3MWFA 4G0VA 2I4IA 4W5NA 3DWEX 4AKEA 1PSZA 4J1TC 4Q3AA 4OTZA 4XEHA 1U0TA 1LRKA 2A9RA 4FT4A 3N2IA 4FIDA 4GC9A 4HEHA 3VX4A 1JR3E 1LPAB 3N8NA 4JY7A 4QQRA 4W9NC 2B1RA 3NHPA 3WQSB 4DAOA 3K5PA 1JZQA 4OAPA 3KPUA 3AETA 3REOA 3I61A 3T1YB 1C9EA 3GWGA 4CU5A 4TUYA 1E3WA 1VI2A 2YOFA 2PBLA 1DG1G 1U4NA 3IS3A 4AC9A 4EJ0A 4MW5A 6LDHA 4MMZB 1TM4E 2BFBA 3E9CA 1YF3A 1P2DA 1EGAA 4AJOA 3O8QA 4WFQA 4EMTA 1PS0A 4IJQA 3LO8A 3Q3IA 3PFHA 4J7AA 3DV0A 1LLUA 1N8TA 3NGLA 1ADCA 2E9SA 2O07A 2JIOA 2JZOA 5EE0A 4PV7A 3GDOA 3EUWA 4Q37A 3W6OA 5D7BA 2I7XA 2CV0A 1C41A 3VUEA 1FLAA 3C3WA 4P92A 4Z1MD 2HQOA 4OKSA 3GV0A 4GPZA 1ZHHA 1TUBB 1BIFA 4TWZA 3WISA 4BO8A 4UTPA 3VGJA 4O4IF 3H9CA 4P7FA 2XMPA 5FWAA 4RZIA 2W37A 2FPGA 3DMPA 1V8BA 1M0EA 2QJTA 3T9FA 4FQ8A 1GUZA 5DLDA 1HX7A 4DT1B 3RUDA 2ZVDA 4UUBA 1JBQA 1D0SA 1E4YA 1CRLA 2YW2A 3D6NB 2PH1A 3D6UA 5A06A 3G02A 1CJBA 5KVVA 5DOVA 1RZRA 5JMOA 2CV2A 1ZVMA 2JATA 3HUDA 2K7FA 5JS1A 1COWA 2C61A 2XNDA 4CETA 4CXMA 1D07A 3CNNA 4LBYA 3WLTA 1NT4A 1SUFA 4AB1A 1Y7IA 3H6HA 3MCVA 1NF3A 3MGAA 5H02A 5JDIA 4Z0HO 2BELA 2XTNA 3N59A 1PJ8A 3C16C 1US8B 3LF1A 2ZUUA 1AKVA 4LTDA 3HB5X 5K51A 4CM3A 4AXXA 1WDMA 4F12A 2H1SA 1KBQA 5F1PA 4P80A 5EN4A 2WIDA 3MAAC 4Z9YA 1K66A 1NI3A 2NVWA 4HS4A 3IELA 1COZA 3G9XA 3T06B 3Q98A 1GV0A 3HXLA 5K5EA 3V7WA 3WLIA 4NE9A 4J43A 3BE4A 3JR3A 4H16A 4ZI5A 1BEUB 3T94A 3AONB 2DKOA 4PHCA 1ONNA 4DC0A 3Q41A 3NONA 3JYPA 5CB4B 1GPJA 1DIOB 5JJCA 4IXMA 3VHRA 4YROA 2AFHB 1DLJA 4BV3A 5CG2A 5BVHA 4CKWB 1VHJA 1Y6RA 5DHSA 3K16A 3KKEA 4AUKA 4EG7A 4UEQA 1Z9BA 3X43A 1PBNA 4N76A 2N1BA 1MKYA 3KJXA 1NBEA 1DX6A 3BIFA 4IVNA 2JGAA 4OQFA 2YXLA 1OPRA 4ER6A 1NVKA 5C5IA 1EQAA 3OX1A 4CLRB 4LDRA 1BD4A 1UJBA 3PC6A 2QBYB 2MSKA 1S1MA 2QVZX 3MLAA 1TYAE 2OCKA 2VP5A 3INYA 1C4KA 4N0EA 4ES6A 3GK3A 2MMCA 1VKNA 1ZINA 2PL5A 1W0JA 3MINB 3N2YA 4KUEA 3DNPA 4KLCA 3RTGA 6ADHA 1V2GA 4RJIA 4ETMA 3M4YA 4B5LA 4S24A 2WKQA 2FQ1A 1M2VA 3IXLA 4KWTA 4Q9IA 1FYVA 4P83A 4UAJA 4YFVA 3I9LA 3ZDCA 4FLEA 4RU1A 4DNFA 1XZQA 5E6SB 1AKNA 1HLDA 1R66A 3GJ4A 3MAJA 4JSRA 5JW6A 1KO5A 2D8AA 3Q7EA 3S1LA 3TEMA 1P2VA 4NG5A 3MWYW 5D5HA 2MSCB 4MYTA 4DMCA 3BK7A 5HIAA 1PRYA 1LRJA 2JFUA 2P2CA 3O92A 2OO5C 1X7HA 2P6PA 4MPPA 4P35A 4WBXC 4A0QA 5C4GB 3I37X 4IQ4A 2QRUA 2XQVA 4QECA 4REQA 5AKKA 1I13A 3AUKA 5IVHA 3K8ZA 4JT8A 3PJRA 5LUBA 1YK0A 3SU8A 1DAKA 2ZJ7A 1DWPA 2H0RA 2QXTA 3FYUA 2EVWX 4IWYA 4Y6GB 1Y6ZA 3EEQA 5FXMA 3ZS8A 2VF2A 3MG9A 1NVDA 1GQ2A 4HDQB 2AF3C 2E2WA 1CNMA 1YOVB 3K4QA 1NRWA 2XZOA 2WUEA 4J0JA 1ZJYA 2V7PA 1RLUA 3Q85A 5CVJA 1P6UA 2HK8A 1LLCA 3G0BA 4ZOCA 1CZUA 1EJBA 1RWQA 4JCOA 5CTJA 4F1JA 2HXYA 3LDFA 5KSWB 2R5FA 4WOKA 1KJ9A 4ADSG 1Z0JA 2EV9A 2E4AA 4LHWA 5KKCA 5FO0A 4BJ3A 1W6UA 4NZ9A 2UDPA 3SQDA 1E6WA 4MJLA 4M0PA 2WWIA 1MR3F 3FHJA 1EZZA 1GOTA 2FW6A 2KYRA 4J0IA 4NJEA 4C0QC 2EG9A 1ZJZA 2P6RA 4CEHA 4JKOA 4UU1A 1GZSA 4RSGA 3UK7A 2Q5FA 4WMLA 2X8WA 2XQIA 3P2KA 5CIWA 4DOMA 4PYJA 4PZYA 3E9YA 4PFQA 4DCOA 3WL5A 2BKLA 2YJ6A 3PNBA 4YDHB 1JAIA 5A7HA 3IALA 2BR5A 4BUZA 5MDHA 5A9SB 4PYMA 1CULC 4IIDA 1OI2A 3K09A 2BCGY 2XMZA 5F7XA 3O03A 5LWQA 3D8BA 5ICMA 3BZUA 4Q05A 3RWOA 2J5BA 1PFGA 4RQAA 3EXFA 1DOAA 3BILA 1W94A 3COYA 4C1NA 1DC6A 1JG6A 1AXEA 3JU3A 1UANA 5DX1A 2C03A 1C29B 3DKPA 1PEKE 3DP7A 3DCIA 2Z5LA 5H3CA 4UMFA 4B71A 3SD7A 4IG9A 3GPBA 3A3NA 4LZLA 1O5IA 1P19A 4EI2A 6Q21A 2NPIA 4LW8A 4ND8B 3EYWA 2JLQA 3RC7A 4NBTA 1V95A 3WICA 4CL2A 1BGVA 1JSCA 2Q46A 3S2EA 5JXIA 4QWMA 4BQEA 1U8CB 3GUVA 5TQ0B 2LDXA 2J3HA 2Y1LA 3DGFC 1W36B 1DXHA 1HKUA 4Q4HA 3UHOA 2QXUA 1TFUA 4CCYB 1G8SA 3RIXA 1E2DA 2X40A 1YZFA 2ZUDA 3T9BA 3EOAI 1F8FA 1BGWA 1SVKA 2FPIA 1OV6A 2I7CA 1N1DA 2VQ6A 4CM4B 5T8KA 1VJ5A 3AKYA 5CJPA 4R4JA 2ZRPA 2D2XA 2IEZA 3UANA 3CF4A 3EA4A 2F9MA 2RH4A 3K0KA 3TW0A 1A7JA 2I2XB 1YVRA 1MP0A 3C6BA 4JOSA 4Y6QA 1UEXC 4LDAA 4BOYA 1KYWA 4FZJA 4LBZA 4XQGA 4GMXA 5E1OA 4X00A 4RZUA 5CW1A 5C7OO 4ALMA 1NRJB 3HLYA 3K0HA 4B8ZA 1X38A 4R1MA 3UW1A 3R5FA 3LP8A 3O91A 3HN2A 4LPSA 1Q50A 4OQMA 3UAXA 1P81A 3PFKA 3Q0IA 3ROKA 5JNRA 3BL8A 4RWEA 4GQIA 3NV7A 4U2FA 1HDIA 4M55A 4PLHA 1RLMA 3UJ7A 3VR3D 3EHDA 5CNIA 5A5EA 2PSEA 5JNUA 2FSIA 1Y6FA 3T3NA 2VNJA 2GYVA 1I5OA 1SNYA 1GUBA 4O2AA 3MWGA 3E1SA 3ZXXA 1QH8B 1BCSA 1XMQB 3WDLA 2BP7A 2PO5A 3GL9A 3OCYA 4H59A 5M3BA 5ALTA 2BFAA 4ZYWA 1JMYA 1KDOA 4MRMB 5A4MS 2O0KA 5H7XA 4ENUA 3AEQB 5TJ9A 5DEOA 2OYSA 5DJ5A 3U31A 1OYYA 3U3XA 3TLAA 2QTBA 3AM5A 5JD5A 2EKBA 4HDNB 1G20B 3O4VA 3R3XA 1RYBA 1XBTA 1R7RA 1RI3A 1JJIA 2VDMB 2CJPA 3K9HA 3PHGA 4G67A 4LISA 4OO3A 4ZRNA 2FPXA 4JT4A 2HXGA 5BNIA 3QVVA 4GKJB 4MI6A 2GDZA 2QEQA 4Q1VA 1YNSA 4MV8A 5HA5A 3SR3A 1MZVA 1XQXA 2GBGA 5G0UA 3PHLA 4C6TA 5B55A 5LOVB 1PG0A 3KFXA 1A69A 1UR5A 4QE3A 2FP4A 4TMYA 3FYCA 5EIHA 5BV2P 1B73A 3HVKA 4F8EA 4TMKA 4EL5A 1KRHA 3NG1A 2B92A 4L27A 5FBRB 1KI7A 2QTCA 4S1VA 1PR9A 2ADOA 3B53X 3NHJA 3KKMA 4L5BA 2VNHA 4ND6A 4ZCQA 1C9NA 1QCCA 1SQ6A 4R9SA 5KOHB 1CRPA 3DMGA 4OJMX 1RBYA 2FPKA 5CD9A 1K3TA 5F2NA 2H5IA 3C0KA 5FYDA 1YB4A 2F3RA 4G8BA 1IEVA 1OXKB 4OK3A 4A6DA 3GFFA