5FYDA

Structural and biochemical insights into 7beta-hydroxysteroid dehydrogenase stereoselectivity
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
259
structure length
259
Chain Sequence
MNLREKYGEWGLILGATEGVGKAFCEKIAAGGMNVVMVGRREEKLNVLAGEIRETYGVETKVVRADFSQPGAAETVFAATEGLDMGFMSYVACLHSFGKIQDTPWEKHEAMINVNVVTFLKCFHHYMRIFAAQDRGAVINVSSMTGISSSPWNGQYGAGKAFILKMTEAVACECEGTGVDVEVITLGTTLTPSLLSNLPGGPQGEAVMKIALTPEECVDEAFEKLGKELSVIAGQRNKDSVHDWKANHTEDEYIRYMGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Insights Into 7Beta-Hydroxysteroid Dehydrogenase Stereoselectivity.
pubmed doi rcsb
source organism Collinsella aerofaciens
molecule tags Oxidoreductase
molecule keywords OXIDOREDUCTASE, SHORT CHAIN DEHYDROGENASE/REDUCTASE FAMILY P
total genus 98
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 1.1.1.201: 7-beta-hydroxysteroid dehydrogenase (NADP(+)).
pdb deposition date 2016-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5fydA00
3EHEA 1MGOA 4DC0A 4K6FA 4B7XA 1V35A 3ZH2A 3D1LA 1IE3A 3RBVA 4YJHB 1YL6A 5GZ1A 4L73A 2Q49A 2O3RA 4MVJF 2B0JA 3BXXA 2DM6A 2EW8A 5DULA 3CZMA 4O6VA 2FP4A 1WMAA 1ZEJA 1NYTA 4B4UA 4M1QA 4BIIA 2AEMA 3H5NA 1PGNA 5HM8A 3OIDA 2PH3A 1LEHA 1LRKA 2J5RA 2PK3A 1C0LA 2P5YA 1EVJA 3H9JA 1SBYA 3A1NA 1Y5RA 2XF8A 3UCFA 1DDOA 2Q4EA 2C5EA 3TJRA 4PLGA 2FR0A 3NDJA 4PFJA 4YJFB 5AXDA 4MP8A 1FK8A 4XIYA 1I24A 1RM3A 4DPLA 4IQGA 4KZPA 2EWMA 3DHNA 5CDTA 2GZ3A 2VT2A 3DB2A 3JQFA 1OC4A 4Z0TA 1KS9A 3A14A 2ILTA 4XWYA 1HSZA 1UDCA 3PPIA 3ONDA 3TF5A 3PFFA 1DXYA 3KYCA 4BGIA 5JBIA 5TGDA 1AXEA 4H15A 1VC2A 1VJTA 1F8GA 3ZWWA 3WYBA 3U9LA 2B35A 1DFHA 5EPOA 7MDHA 2X7HA 4LRSB 2PGJA 4HV4A 4YR9A 1O6ZA 2GN8A 2DFVA 4TMFA 3RUFA 5A9RA 3LC7O 2NVWA 5CG2A 1WW8A 3ST7A 4XB2A 4N5MA 3ZWMA 2YDXA 1BMDA 3Q11A 3GNTA 4UVEA 5A3VA 3CINA 4L4SA 2HK9A 1F0YA 5JCJD 4D79A 3JD1A 4CMKA 1JLLA 4JJIA 1ML3A 3S1LA 3AOEC 4ZA2A 2FN7A 3SJ7A 1UP6A 4EJ0A 3FTNA 2JFGA 3ENNA 2HJSA 1N1EA 4J1NA 3IUSA 3ZWOA 3RC7A 1X1EA 2AEJA 2EERA 1U8FO 1NXQA 1I8TA 5F3RA 4XQ9A 3CMCO 4DBVO 4E12A 3OMLA 1GZ3A 1PGQA 3WYCA 4FN4A 3O8QA 1J5PA 1P74A 3VOSA 1CEQA 1DAOA 1HSOA 3S2GA 1W73A 4FOOA 2CF5A 5I8WA 1EBUA 3H3FA 1O9BA 2CF6A 2VTDA 3AU9A 3QV1A 4W7IA 2B5VA 4OO3A 4Q3NA 1VL6A 4IQ0A 5A9SA 2WMDA 1GPJA 3AFNA 1PS8A 4R9RA 1EVZA 5FFFA 1Q1NA 1TVEA 3AM5A 1LSUA 3SC6A 4E13A 5IDQA 4L75A 2NQ8A 2W4QA 1B2LA 3KSDO 1DC5A 3OQ6A 4HFRA 3I9KA 4R4JA 4UAGA 4WLUA 1YJQA 2BH9A 3PIIA 2X0NA 4DUPA 4XEHA 2WYVA 4GPD1 3B1KA 2DUWA 1QV6A 4W9NC 2VWHA 4Y67A 4UUNA 6LDHA 4N5NA 1E3WB 5IDYA 3VH4A 5LCXA 3I6QA 3FCOA 3F46A 4DQUA 1AHIA 2UV8A 2IYOA 3AY7A 4PLYA 5IN4A 4IJKA 3E03A 1JAXA 3GRPA 1EUDA 1ARZA 3MZ0A 4TZTA 1E7MA 3PXXA 1P3DA 2Y1DA 2Y93A 1YVEI 1MV8A 1NQOA 1LRLA 5IAAA 1LLDA 1U8XX 1G1AA 4JBIA 1LC0A 4NBTA 3ROPA 4CV0A 3BIOA 3GFBA 3FN4A 2JHGA 4BKOA 1EVYA 2PD6A 2O3QA 4YJDA 2AE2A 3DZGA 3LYLA 4LW8A 1IPEA 1E3JA 2W2KA 4YQZA 4ALMA 2O48X 1XG5A 4RVGA 4ZGWA 3ADPA 1Y9EA 3I52A 3IS3A 5G4KA 3WIDA 1PJ3A 1N2SA 3JQEA 1ZZEA 3QE3A 4EDFA 4CM8B 4J4HA 1GCUA 1X1TA 1A5ZA 4U5QA 1SNYA 1C0IA 1WXDA 2DPHA 2Q50A 2Y0DA 4J91A 2I66A 3H2SA 2H9IA 3Q2KA 1GCOA 5ENVA 4PLTA 2HCTA 3ORFA 1ZK1A 1ZK2A 3DFUA 3KRTA 3PHJA 5I9LA 1PZGA 3VHRA 4QQRA 1QLJA 4MP6A 5CAEA 3VPSA 3M1LA 1UXKA 3F3SA 1I36A 5CG1A 5L40A 2W98A 3OIFA 3DMTA 4KP7A 5I9MA 3WBFA 2AQIA 2G1UA 1BG6A 3PWSA 3DZIA 4ESOA 4EUFA 1KEWA 4IS2A 3L0DA 3NGLA 4NR0A 3JQ9C 4PZCA 4XQEA 3AUSA 2GN6A 3FWNA 3L6OO 4E31A 4D46A 2YW9A 1UH5A 2BMAA 4J0FA 2AMFA 2OMEA 4WOKA 4BMSA 4NQZA 4QSMA 1DLJA 2HMSA 4U0JA 4PZEA 4FD3A 4D45A 2DTDA 1IYZA 3WGGA 3ZWYA 2X5JO 2JL1A 3UKOA 5HS4A 1RPNA 3PHIA 2HJRA 2FPIA 2VRCA 4XCVA 3Q1LA 5IFLA 3JQGB 2NNLD 4BO8A 1LQUA 2EKLA 1QYVA 2OHXA 2VYVD 2NADA 4RDIA 3DFZA 4WCFA 1KVTA 1PWZA 1KBZA 3PQEA 4TROA 4XX0A 2OXIA 3U49A 4GMGA 1D1TA 2I3GA 3GNQA 4FGSA 4LN1A 4Z0HO 3PHHA 1ZK0A 4M89A 3G3EA 4BNFA 4J4BA 2X0IA 3WJ7A 1U7HA 4BNXA 4CM4B 4CUKA 3C7AA 3CTMA 4YAGA 4E2XA 1HDGO 3FR7A 1CWUA 1ZK3A 2PKQO 4OGWA 4UEJA 2RAFA 2WYUA 3AI1A 1BSVA 4PRKA 3DAFA 3KLPX 2JAHA 1E3EA 5LC1A 2VYVA 3NDRA 3V8BA 5G4KB 3JQAB 3A4VA 2HMWA 4P4NA 3M2TA 3ZWNA 4J16A 3JQ8B 3PEFA 5JO9A 1LJ8A 4DC1A 3WQSB 4FSHA 3FPCA 1JTVA 1UDBA 5DBFA 3VZRA 1Y6JA 3L77A 3BMCA 4KQXA 1LDMA 3M6IA 3QP9A 2X5OA 4KWHA 3GEGA 3STHA 5COQA 1I3MA 3INRA 4NJOA 5DP2A 5EJ2A 4BMVA 1R66A 3W8EA 1K6IA 4DYDA 3JYOA 1Q0QA 2C07A 1HT0A 2B36A 3Q9UA 1BTOA 5EESA 4CR7A 1IUKA 3N74A 3K6JA 1A4IA 1O89A 1UZMA 2ZB3A 4FFPA 3IIEA 3JV7A 4FS3A 2NU6A 4PLHA 2D5CA 2I6TA 3SBOA 5F5NA 2FWMX 2WE7A 3GUCA 3F1KA 4IDAA 3UGKA 4FFLA 1GR0A 3UVEA 4E2WA 2XOXA 4CMJA 4OL9A 3GF4A 1Q7CA 2C20A 5ITWA 2WJPA 2YY7A 4CLRB 1HLPA 4CLOB 3HSKA 1Y8QB 4KTTE 1T2DA 2VUTA 1J0XO 1KY5A 4YQYA 2BLLA 3W4IA 2EEZA 2GERA 3RFVA 2ZJ1A 3VPGA 2TMDA 2AQ8A 4YVFA 4BVAA 1M66A 2G76A 5H82A 3AWDA 4TRMA 1YQXA 3AY3A 2BFPA 3MCVA 4GGOA 5DP1A 3E48A 4QTZA 2HMUA 4RF5A 3DMYA 4N18A 1DFGA 4R3WA 1E92A 1HETA 2CFCA 1KEPA 3AUUA 4R3NA 5BNFA 1ZMOA 4II2A 3WR5A 2ZYAA 1CQIA 1HE5A 1PX0A 4NU6A 2QG4A 3RFXA 4YRAA 2WD7B 5KJ1A 3ADOA 3VVBA 2A92A 4KUGA 2VRBA 4LSWA 4CLHA 3OJOA 1SOVA 4MIEA 1I3KA 4CM3A 4RZHA 3WXBA 2NVUA 1DHTA 1Q7GA 2B69A 4XGIA 2PZJA 4CUJA 4JBHA 2QQ5A 1K6JA 3HE3A 2ZCVA 4S1VA 3UHAA 4WLVA 2DTEA 4MP3A 4C4OA 5AYVA 9LDBA 4U6QA 1S6YA 3D64A 1CRWG 1QYWA 2PV7A 5DNAA 1LUAA 3RWBA 3PFWO 4KTVE 1DIGA 4O5OA 3W4JA 2QRLA 2W2LD 5L4NA 2JD0A 5BQFA 4AJJA 4DA9A 4XB1A 2AG8A 1EQUA 3JQCA 1E1LA 1K6XA 2GZ2A 3C7CB 4IIUA 4RPJA 3RVDA 1U5CA 1BXGB 1YS4A 5I7VA 1LXCA 1Z7BA 1ZVMA 3KEOA 1NBOA 1E6WA 1SMKA 4EW6A 1PS9A 4MVJM 1N8KA 1PQUA 1IPFA 1E1MA 3E18A 1LDBA 2Y1FA 4ND1A 4OIMA 4FCCA 3F9IA 2JAPA 3GDFA 2Y99A 1FDSA 3KM0A 4RQTA 1DO8A 1YONA 5ICMA 2OL4A 4Y9DA 4NJMA 3WNQA 1PZHA 1NM5A 3RBZA 1YQGA 3B1JA 4A27A 4BO7A 4RVFA 1V6AA 5I7EA 1R4MA 3AUAA 3RASA 3W6UA 4B8ZA 5CHEA 4K1LA 1B3BA 5AXCA 3IUPA 4ND2A 4R16A 2X0RA 1M2WA 1RJWA 1DPGA 2YQ4A 1LQTA 3QVWA 1C0KA 2BI8A 2XXJA 5EERA 4BO4A 4F45A 4I08A 5IZCC 1HDZA 3PDJA 3KXDA 1UXIA 3ZW9A 4OXYA 3GG9A 1HYEA 4BO5A 4R9SA 5U9CA 1E7WA 3D4PA 2D4AA 4GX1A 4OQYA 1ZW1A 3ROMA 3UCEA 4E33A 5CFZA 5KNLA 3TZQA 3W4KA 4EITA 3JQ9A 1DC4A 1H9BA 1ZSVA 5T57A 1T4BA 1QP8A 4E5YA 2GO1A 2V6FA 3K2BA 4XR4A 1KERA 4E32A 1TA4A 1A7KA 1LLUA 3JD3A 4INAA 4JIGA 3K31A 3EK2A 1UP7A 2VNAA 3CPSA 2RHCA 4ILKA 2Q99A 2NSDA 2NLOA 2HDHA 4YA6A 5THKA 2C7GA 4FB5A 2J8ZA 1U5AA 2AW5A 5CEFA 1GTMA 2ZTVA 4J3FA 1D8AA 1DIHA 3WJAA 1CDOA 1I2BA 3EVNA 1IHXA 3GFGA 1MXHA 4DVJA 4E5KA 2E49A 3OQBA 2GZ1A 3WSWA 2H5LA 5ITVA 4BGUA 5MDHA 1HLDA 3MWEB 1JA9A 5DZSA 5L4LA 3HFSA 4OM8A 1MG0A 1W8DA 4CMEA 5C7IO 1T4DA 2RH8A 4AJLA 3I9JA 4IIVA 4NJMB 1E6UA 1NTOA 1Y8RB 5T64A 5A4DA 3PIDA 3VH3A 2Q4BA 1W4ZA 4G81A 1YQDA 3ANNA 4RLHA 3G1UA 4NI5A 4TVBA 1LSOA 1WDLA 4QX6A 9LDTA 3HNPA 4DWVA 2WE8A 3LSYA 3PJFA 4JBGA 2ZKLA 5ES3A 5HBRA 1VPDA 3NAQA 3K73O 4XIJA 1DRUA 1HYHA 1BXGA 5CDYA 4WNCA 1QLHA 3WMWA 2CMDA 1R16A 7ADHA 4UUMA 1ADFA 2JHFA 1OZAA 4O63O 2Q1SA 3UN1A 3EAGA 2ZCUA 2FSVA 3H5AA 3DOCA 2YHUA 1AE1A 3G49A 3ANLA 3L4SO 3BMOA 3X2EA 4BNWA 3O8QB 1LU9A 3BTOA 3L6EA 3JQBC 3PQFA 1AXGA 1EMDA 3AW9A 3OECA 4YBZA 4YPOA 4IDDA 3LC2O 4ZQEA 2Y67A 1I10A 3V5NA 1LRJA 2A35A 3B70A 1ZEMA 3AI3A 4ALLA 4D44A 1AHHA 4KMSA 3DBRB 1XYGA 1FDVA 3QW2A 4XD2A 4CMCA 4BO3A 1MFZA 4YAEA 1YL7A 4J2HA 4ZVVA 4TRJA 4TZKA 3GN1A 2E48A 3TQHA 2NV6A 3KHUA 4LISA 4NK5A 5AXAA 1TT7A 1P1IA 4UULA 5DOVA 4FFOA 4XYMA 1P31A 4LCEA 4W4TA 1WNTA 4MVJP 2FMUA 4XYGA 1NQ5A 2X9GA 3IC5A 4QUKA 1DOHA 4IDGA 1V8BA 1BHSA 2VOJA 3Q0EA 3ZW8A 1LSJA 3PZRA 2X22A 4JP3A 3WGZA 1O5IA 3GMDA 5TRTA 3W6ZA 5A04A 4OQZA 4BKPA 5JY1A 4PGFA 3KYCB 4XGKA 2PGDA 4LSMA 4I5DA 1E77A 3DZFA 5JLAA 5EIOA 1NAIA 3CMMA 1EUCA 4FQ8A 1J6UA 4B79A 4WJZA 4BNGA 2ZATA 3PYLA 3BMCB 3H8VA 4FR5A 4QFDA 5FYDA 4F6CA 1ZKMA 3WGOA 5ILGA 2HK7A 1T2FA 5THQA 4ZN6A 3DEYX 4FDAA 1FMCA 4GSKA 3TOZA 4CLDA 1B8VA 3PJGA 3EVTA 4FC6A 2W2LA 5JAMA 1PZFA 1ULUA 4DRYA 1RM5A 4HNHA 1ZXBA 1Z82A 1XEAA 4RLSA 2ZB7A 1QMGA 5AXBA 2X58A 3W8FA 4CQLB 1EUZA 1KVUA 4M8SA 4PLVA 3I4FA 3ROQA 1Z45A 3BHJA 4A2CA 3MWDB 4R68A 3WGQA 2ZQZA 2B4RO 1H9AA 3DDNA 2VTEA 4XQCA 5A1TA 4RJTA 5FI3A 5EMHA 1UDAA 3OSUA 3UFXA 5CP8A 3GR6A 4FJ0A 3GK3A 3LT1A 2IEDA 2O4UX 3SXPA 1EE2A 4WKGA 5U1PA 1WAMA 3GGOA 4XJTA 4E2ZA 4P4LA 2ZYDA 2VOEA 3AU8A 3V2GA 3ZHBA 2G5CA 2NTVA 2ZK7A 2RBEA 3JD0A 1O94A 5C5IA 3DBRA 1BGVA 3SJUA 4NIMA 1JDJA 1CF2O 2CSUA 3ZWAA 1E6EA 4YTEA 3RROA 4RDHA 1P9LA 2PD3A 3ZU4A 1CERA 1U3VA 1MX3A 1XQ6A 4LRTB 3BMQB 4AJIA 2G82A 1JKJA 5A03A 1I3NA 1X7DA 3NT4A 3A28A 3INTA 1UXJA 3U0BA 3PGXA 2VHWA 4JQCA 2HU2A 4D42A 1YXMA 3BZUA 1ISHA 2PH5A 4OMUA 3GVPA 1ADBA 4U8GA 3RJ9A 4BO0A 5C7OO 5I7SA 1GPDG 3IKVA 4BNZA 3TFOA 1B3RA 2H6EA 2I65A 1KVSA 3ANMA 3DBLB 3RUAA 3NX4A 2VUSA 1X15A 2OFPA 2QYSA 1D4FA 2GASA 2E4AA 3ZWXA 1PJSA 2FSSA 1UXHA 3QVSA 4WK6A 4F3YA 1XQ1A 2ZJ0A 1I0ZA 4GX2A 1YGYA 1NFRA 3VTFA 3A9WA 4NU5A 3C24A 4M54A 4E6PA 5L53A 2OUIA 3BMQA 4KWIA 4IPTA 4R01A 2D59A 3GA0A 2BRUA 1N9GA 3JTMA 1XCBA 3Q6IA 3M1AA 4E0BA 5CPBA 1OBFO 3IDSA 4S3MA 3TZCA 3TFQA 2JCXA 4GLLA 2EP7A 4CM8A 2BI7A 4ZQGA 5JE8A 4U0KA 1U3TA 1DLIA 4BNVA 3E82A 5BSHA 3W8DA 1GQQA 3EY4A 1NR1A 4BO6A 1HE3A 2VWGA 3NT2A 2Y0EA 1YBVA 3PP8A 1ID1A 2PLAA 4EBFA 1DJNA 3WS7A 2FZEA 2BFOA 1BVRA 2EF1A 1KETA 1ORRA 1YDWA 2QHXA 2QW8A 3NT5A 4FW8A 4A26A 4ZQHA 4BUCA 1XWFA 4E5MA 1XKQA 3SX2A 1JW9B 3WGYA 2RHRA 5EQDA 2J3IA 4ZRNA 1EVIA 4GQAA 3ZU2A 5T67A 4CLXA 4EUHA 1MXFA 5L7YA 5GZ3A 4IJWA 4Q3AA 1SEPA 5IDWA 4DYVA 5BSFA 3ROKA 3VC7A 3U5TA 2YV1A 4HUJA 1H0KA 3JQBA 4WLOA 1OFGA 2EKQA 4MVJE 3ZI0A 2UYYA 1DBVO 3FWZA 2O3TA 1B26A 4HKTA 4ZHSA 5A05A 4RL6A 5ADHA 4AFNA 3JD4A 3AJRA 2OZPA 1TT5B 5JC1A 4D0RA 3QVXA 4HXYA 5JYDA 2QIOA 4BNYA 4ND3A 1K89A 3D4NA 1ENOA 4EI2A 1LX6A 4DIOA 3DWFA 1AUPA 4NBUA 1X0XA 3GZNA 4NNJA 4RZIA 5T6BA 4IDBA 4RF4A 2NWQA 2QZZA 4NBVA 4CMIB 1KEUA 1ZJZA 3GZ4A 4N54A 4RVSA 1XU9A 2X5KO 1HF3A 3WQRA 2FPPA 2G0TA 1NWHA 2UAGA 4OOFA 4CMEC 3DHYA 4Y6RA 5CDGA 3UF0A 4E5PA 3WTBA 3K5PA 3TZHA 2GN9A 3GPIA 2W8ZA 2P2SA 2D0IA 3ON5A 4GKVA 4ALKA 2I67A 3CZRA 3R6DA 4L0QA 1A4UA 3H5RA 4BNMA 1VJ0A 3DO5A 3LC1O 3CSDA 2OBYA 3U4CA 2JFHA 3V2HA 4MO2A 2ZIZA 1XIVA 3WSVA 4NFSA 1H5QA 3BHIA 3I83A 2V6GA 2AQHA 1RKXA 4YACA 4AL4A 4NMHA 3UCXA 1VKOA 5EQFA 1DEHA 4B4OA 2IE0A 1H2BA 2FPGA 4WCDA 2E6UX 3JYLA 1O95A 2YFQA 3SEFA 4P38A 2PKRA 4RF2A 3D5TA 4PLWA 2C82A 3RU7A 3DBHA 4MVJD 2NU8A 4AJNA 4CUZA 4LCJA 1Q7BA 4Z9YA 2Y66A 2HSDA 5A3JA 3K8ZA 4Q9NA 4U7WA 4GWKA 5JCJA 4BHTA 3KETA 3GUYA 5DN9A 4BNUA 2X0JA 1A27A 2CVQA 4P4GA 2I9PA 3FHLA 2WEKA 3QVTA 3NGXA 3WMXA 2Q2VA 2J3HA 2BFMA 3P2OA 4CV2A 5IF3A 4EEZA 1XLTA 3QA9A 1KY4A 2E37A 2DFDA 2IEBA 1ONPA 4FOSA 1IULA 1M67A 3ZNPA 2YV2A 3FPLA 4RVUA 5G0TA 4KUHA 3WIEA 4DLLA 5TX7A 1VL8A 2ZTLA 3PZBA 4PVCA 3AM3A 2NACA 2I99A 5B1YA 3IL2A 3TL2A 4YWJA 1MB4A 4CLRA 1V0JA 4RORA 1NVTA 1HDXA 4B3HA 1DIBA 4XZ3A 3Q9NA 1NHWA 1UZLA 2X8LA 2Z1NA 3DQPA 1I2ZA 1R15A 1ZSYA 4GMFA 1LLCA 4BNTA 3T7CA 1QG6A 1Y7TA 2BKAA 4EJ6A 3CKYA 3RIHA 1K0UA 3OBBA 3ZV4A 1DHRA 3BTUA 4J1SA 4BQRA 4Y8VA 1UJMA 2DLDA 5I8ZA 3WOHA 2VZ9A 5TT1A 3WBBA 5ILOA 1A72A 2BELA 2HRBA 4Y6PA 2Q45A 2Z5LA 5A02A 1EDZA 3JQAA 1H6DA 2VUUA 2CDBA 1N92A 1ISJA 1FDWA 4ALJA 3PGJA 3QWHA 4BMNA 2OGUA 4E30A 8LDHA 2OP0A 2OORA 2NTJA 4KOAA 1PGPA 1S7CA 3QWFA 4BNHA 1NAHA 1MLDA 2NU7A 4CM4A 2EJWA 1Z73A 3PK0A 1GYQA 1PWXA 3ICCA 3CE6A 5ER6A 2GCGA 1HE2A 2A9FA 3U4HA 3E5MA 4Z6KA 1GV1A 5G2OA 5KWEA 4WE3A 3U3XA 4ZQBA 1E5QA 1GY8A 1LBEA 1MUUA 3I5MA 4W6ZA 3H9EO 4I8XA 3HB4X 3PVZA 1ULSA 3JQAD 4QT0A 3WICA 5IXYA 1DRWA 4O59O 4R1SA 1TB4A 2LDBA 1JQBA 1Q0LA 3K96A 3GPDG 1N7GA 3K2EA 4CJXA 1WLYA 2GR9A 4PN3A 5JY6A 3ZNNA 5K6AC 1E1NA 1IZ0A 4MKZA 1C0PA 4DBZA 2DBZA 1YE3A 3M2PA 1LDYA 1YBAA 3E9QA 3TZKA 4IZIA 4HADA 2X4GA 3NTOA 2CDAA 2RCYA 1DRVA 2P68A 1DB3A 4L9RA 1NNUA 1P44A 4WNIA 1EK5A 1YJ8A 1E3LA 4J1QA 5L45A 2SCUA 3X2FA 3L9XA 1NP3A 5TNXA 4BB6A 3GVCA 3GH3A 1E3SA 1LTHR 1U7TA 2VZ8A 4GWGA 4L76A 4EJMA 4L4XA 1GEGA 1HDOA 3GVHA 4JNKA 3SLGA 1GQYA 3C1AA 5DDIP 3VKUA 4E4YA 2PKQP 3RFTA 2CUKA 2WYWA 3TL3A 3ZV6A 2B37A 3DZHA 4NK4A 1F14A 4XRGA 2A4KA 3UH1A 1T2AA 1I32A 4PZDA 3OM9A 1J4AA 1GD1O 4E5NA 4MIYA 1KC1A 1PJBA 2P4HX 3O03A 1NX6A 3E6AA 3C1OA 4B7CA 3RUDA 4AJHA 4UVGA 4AJEA 2Y68A 1ZJYA 2D5AA 4IXTA 2DQ4A 3ZWVA 1WPQA 4NFYA 4YRBA 5BSGA 4K9DA 3SLKA 1N5DA 1XA0A 2GYYA 5TIIA 4WGGA 1NWCA 2EKPA 3F4BA 4OYRA 3D4OA 3VPXA 3L4BA 3PLNA 5JDIA 2VNSA 2NVUB 1VSUA 2DAPA 3OJLA 2Y0CA 3ONFA 3C1TA 3PJEA 1R0SA 1JWBB 4JJFA 3GDGA 4RO0A 4NFHA 1P33A 3HWRA 3OEYA 5ICSA 4ND5A 3TDKA 4J7UA 4UVHA 3F1LA 1BWSA 3D7LA 1E7SA 1PQPA 5IJZA 4ZU3A 1NVGA 4EGFA 2P5UA 5G0WA 3GVXA 1ZNQO 3WGTA 3DZKA 3WWYA 4CPDA 5IG2A 1HKUA 3ZHXA 3VH1A 2Y1OA 4RQUA 4BB5A 1PR9A 5L3ZA 2C59A 1R12A 5KVCA 3KZVA 4DTIA 3VZSA 3KEQA 2VHVA 1MFPA 1SC6A 2UVDA 1GEEA 1RM4A 2Q1UA 4WLNA 2B4TO 1GADO 3OETA 4MINA 5DCYA 1ZUD1 2Q3EA 2QRJA 1GFSA 3NDIA 4O0LA 2HLPA 5KVQA 4ROSA 1IHYA 2HO5A 4CMAA 2GF2A 1B8PA 2GLXA 1OAAA 1HWYA 5A9SB 3I6IA 4X54A 2P9CA 3JQFC 1GUFA 4R41A 1RYEA 2JKVA 3ZHZA 4Y98A 1PQWA 1NHGA 2PY6A 4NBRA 3ZNQA 3WLEA 3GEMA 3KTDA 3L9WA 1R0LA 4IMPA 2YHIB 1Y5MA 3OQ1A 2WWRA 4YDRA 2I5PO 3OJEA 5TJHA 3JQ8A 4RGBA 3EUWA 3FD8A 4AJ1A 1IL0A 3GC6A 3ITDA 4OH1A 5EINA 4ONEA 4IINA 4ZQFA 1U2GA 4YAJA 3I9OA 3FBGA 3RCBA 3RUHA 3T7EA 4EUEA 3O4RA 5L4SA 2J5QA 4TRRA 5C37A 3WGHA 4CV1A 1UUFA 3TZ6A 4GSLA 1IZ9A 1Z74A 2O7SA 5LDGA 4DL9A 4FBGA 1HXHA 2YQ5A 4JLWA 1SZJG 3ZV3A 3TSCA 4OJNA 1VI2A 4AVYA 1U9JA 3LF2A 3H65A 2GDZA 3OIGA 3OJ0A 1Y9AA 1HYGA 2PZLA 3JYQA 4TSKA 3W1VA 4URFA 2IYPA 2V6MA 1UAGA 3GQVA 4JX8A 1G0NA 1PJCA 4PG5A 3ETEA 1KVQA 1PJTA 2X9VA 3JQGA 4WLEA 1LI4A 4HFMA 5L9AA 4OKNA 4J6FA 2JJYA 1HL3A 3VAZA 2HMTA 4HY3A 1QYDA 1HZJA 4R1NA 5TT0A 1Z7EA 1P45A 3CUKA 3ZWPA 3A06A 2PR2A 3HHPA 3JQ6A 3LK7A 3JYNA 1JKIA 5JO0A 5IZCA 3RC1A 3WQQA 4HBGA 2CVZA 2UUPA 1RYDA 2HAEA 3MJCA 1PJ2A 1EBFA 1X7GA 4IDCA 4NDNE 5G4LA 4AJPA 2EJVA 4BKRA 1ISFA 1C1XB 4ND4A 2AQKA 4RV9A 5G0UA 1M6WA 4YJFA 3WNVA 3S2IA 1Z75A 4MKXA 4E21A 2JCVA 1FJHA 3GHYA 3I9MA 4WLFA 1HRDA 5B4TA 4NH4A 3S8MA 1PZEA 4J7CA 4TRNA 3QJ5A 1CYDA 3DAPA 5HTOA 5A9TA 2JD1A 3RQSA 3AFMA 3HZZA 2D3TA 4MVJH 5G0SA 4Z9XA 3WGIA 1HDYA 2WSBA 3EDMA 3AY6A 4Y6SA 3JYPA 3DZJA 3WYEA 4IXWA 3F6YA 1L7DA 3R3SA 2VCYA 3CIFA 3RU9A 1BRMA 1YRLA 1F06A 2P4QA 3I3OA 5KJEA 4R51A 4E3ZA 1PU2A 2O3JA 3KV3O 4YB8A 2R00A 3ICPA 5HWSA 3DHEA 1I33A 3DMTC 3IP3A 4XYEA 1YWGO 2AEFA 3E9MA 4J9VA 3KYDA 3N7UA 3QIVA 3ETGA 4IDEA 3LT4A 2C7VA 1ZK4A 3EZLA 4FFRA 4WPGA 2DVMA 1CJCA 2GNAA 3LDHA 1EEHA 3PI7A 5CEEA 5KVSA 4YRDA 1LNQA 1MC5A 1X14A 4J9UE 1B8UA 1BW9B 3AOGA 4PLCA 1XDWA 4IJVA 5IDXA 1IOLA 3QWBA 3KYDB 4NPCA 4KDFA 3AUTA 2W2KB 2JD2A 5JDCC 3GGGA 1KEVA 2I3AA 2QZ9A 4DMMA 4YEDA 3R3JA 1JAYA 2DPGA 4J4TA 5GMOA 1Y1PA 1BDBA 2VYND 3RI3A 4DIBA 1M76A 1SO8A 2POQX 3CXRA 1ENPA 4K28A 2C54A 4JCOA 3IAHA 1PIWA 2C0CA 1UR5A 1KYQA 3GGPA 4LMRA 1LDEA 1FDTA 2O50A 2NU9A 5BNIA 4B3JA 4ID9A 1A7AA 2GGSA 4AJOA 1ISIA 1DAPA 5DT9A 3EMKA 5BR7A 2EGHA 5JS6A 1Q0HA 5TSDA 1UXGA 3DZBA 3WWZA 5TF4A 5KCZA 2Y05A 1HDRA 5TJ9A 4A73A 1V3UA 4YT8A 2OOSA 2VT3A 3B1FA 3E8XA 1WMBA 1I01A 1R4MB 2R6JA 3D0OA 3PLRA 5JAZA 2VRCD 1ENYA 2G17A 3FNHA 4EYEA 4GAEA 4DIFA 2TMGA 1ENZA 1B0AA 4N5LA 3V1TC 2DKNA 3DXFA 3IP1A 4YCAA 4BNKA 4RCVA 1EDOA 2DUUA 3KO8A 4KDEA 3F5QA 1HTBA 3DBHB 2EIHA 3RJ5A 1LLQA 1M6HA 3LZ6A 4PLPA 5FF9A 2EW2A 2FHSA 1OI7A 1T2EA 2GPTA 2HRZA 1QKIA 1MG5A 1U28A 5T8KC 3KVOA 3RKUA 5L7WA 2XAAA 4CMHA 1YDEA 1WVGA 1SOWA 3KUXA 4RPGA 4PG6A 5EN4A 3FNEA 4B3IA 3MJ4A 4DPMA 3N58A 2BHLA 1NASA 1E3IA 4UREA 5CPFA 4DQVA 4AG3A 4KUEA 4BO9A 4C7JA 1EZ4A 5TS3A 2VQ3A 3DTTA 4FC7A 3LF1A 3RAJA 4D3DA 1YB1A 3FI9A 3GOHA 2HMVA 3OJFA 3HDHA 5JFOA 2X86A 3KB6A 3F5SA 4CM9A 4R69A 4JXKA 4DXHA 1KVRA 1NPDA 1JN0A 1C14A 3PQDA 3KSUA 3TRIA 1ZCJA 4Q39A 1UAYA 3FNGA 4XQGA 3UW3A 4U6SA 3NRCA 3ZN2A 4CMIA 1HE4A 1ADCA 1IY8A 2O7QA 3C3XA 1E0DA 4GI2A 5A06A 1PR3A 2QX7A 2F1KA 1TXGA 1I5RA 4BO1A 2O2SA 5I7FA 3BA1A 1U3UA 3FBTA 3QVOA 1U4OA 5AOVA 3WDSA 3P2YA 1GZ4A 3KSZO 1T24A 2CVOA 1D3AA 3NEPX 4Q3DA 3NJ8A 3HFGA 2DT5A 2WD8A 2HKIA 4YJGB 2LDXA 4LK3A 3RBXA 5HS6A 2DBRA 2Y1GA 4MJLA 4CODB 2RIRA 1L1FA 4DQXA 5G0VA 3U4DA 1U1IA 3E1KA 4FGWA 6ADHA 4IUYA 1R4NA 1TT5A 2JCYA 2PZMA 3ZZNA 4DLBA 1EE9A 2IZ0A 5J23A 3VDRA 1J49A 1FXSA 1VLLA 4RVHA 2IRWA 2VN8A 2PNFA 3DR3A 4JJGA 5L7TA 1W0CA 4YAKA 1HZZA 4A0SA 5U4QA 1YB5A 1NQTA 2O3SA 4ALIA 3VVCA 2VZ0A 2EHDA 4XR9A 3OHSX 2J6IA 2F00A 3U62A 3H9QA 4J90A 1P77A 2PA3A 1NPYA 4IMRA 4NBWA 1PGOA 1QYXA 3HQ4O 5DBIA 3PDUA 4WEQA 1QORA 4XA8A 1VM6A 4CV3A 1YB4A 2PFGA 1GV0A 4HP8A 3QRWA 4CM1A 4XYBA 5HA5A 3FF4A 4IQ8A 2GD1O 1QXSA 2BGLA 3C7DB 4WECA 2X1HA 3JQ7B 4MVJG 3WX0A 4QECA 4A5OA 4B7UA 3OF2A 1XGKA 4XGNA 1O8CA 4WCFB 3DBVO 4IZHA 3MJEA 3P5SA 4RPHA 3BTSA 3KLMX 3RC2A 1TLTA 4AJKA 1XHLA 3LQFA 4JP2A 1AN9A 4WUVA 2A94A 3P19A 5EL0A 4BNJA 4KQWA 1WWKA 1FF9A 3HUDA 4D3FA 4M87A 1PTJA 2W90A 1RWBA 1JVSA 3K92A 2YDYA 3MTGA 4BV9A 2Y1CA 2NUAA 4CLEA 3VPHA 2VYNA 3MOGA 3Q3CA 5TC4A 4D7AA 2YYYA 2BF7A 4LVUA 3NV9A 5TQVA 1WZIA 1V3TA 3G0OA 3DBLA 5DBGA 4AJ2A 5KKCA 1E7YA 4O1MA 1C1XA 3GG2A 3C85A 4J7XA 2ZB8A 2VWPA 3MJVA 4R54A 1RM0A 1GQ2A 2Q46A 3RD5A 3E5RA 5JNLA 3UAGA 2GUGA 5JDCA 3VTZA 2Z1MA 4PRLA 3ZGYA 3MTJA 5AQ1A 3S55A 1PJQA 3OICA 5IN5A 4RPKA 3AK4A 3BAZA 5FEUA 1DSSG 1PL6A 3EW7A 1EFKA 3JQDA 3WTCA 5AVOA 2RH4A 4UEKA 1R4NB 4DGSA 5JW6A 5KKAA 3TOXA 4Z0PA 5T8KA 1VSVA 4RVDA 1MA0A 2NQTA 4GGPA 3ZHYA 1NR7A 2P9GA 2QYTA 3VH2A 3B6ZA 5CDSA 4GVLA 3ZV5A 1A71A 2OBNA 3BMNB 4XYLA 3JQ7A 4F46A 1MP0A 4QEDA 3H7AA 3NTRA 1NVMB 1ZMTA 5HRUA 2AG5A 1E3WA 1LA2A 3PTZA 1D7OA 3QSGA 4PG8A 2CNBA 2YFHA 3D3WB 3VDQA 2H1SA 3HG7A 2B4QA 2HQ1A 4CQLA 3QQPA 1EK6A 3IJPA 1T1RA 1UZNA 5A5FA 1BDMA 2OO5A 1VJ1A 3ZCXA 2Q2QA 1JWAB 4JGBA 4YT4A 4HFJA 1R6DA 4D41A 1ZXLA 3INGA 2B83A 4D3SA 1B16A 1FDUA 2YUTA 1WP4A 1UP4A 2IXBA 3R1IA 4BQPA 1N1GA 2D1YA 5JXWA 3DTYA 2Z95A 1WZEA 3AM4A 3HDQA 1G0OA 4CM9D 3HN2A 3ETDA 3G79A 3OA2A 4K26A 2FR1A 4OXNA 3UXYA 4MVJI 2EP5A 5GY7A 3PYMA 1H94A 2FRDA 4JN6B 1LDGA 1K5HA 4J0EA 4ITUA 4YJGA 5KTKA 4R5MA 2FOIA 4GX0A 4YYZA 4ZD6A 4CQMB 2Q2WA 4PLFA 3RUIA 4H7PA 3CH6A 3ABIA 4QO7A 4LGVA 4L74A 3WFIA 3PJDA 3VKVA 1OOEA 3LT2A 2I76A 1SAYA 1O0SA 5F1KA 3H4VA 1YBMA 4BNLA 4EEXA 4OOEA 1DC6A 3GAFA 2PZKA 1NPTO 1ZFNA 4YT5A 1QYCA 3GHHA 1V3VA 3V1UA 4ALNA 5LDHA 4J2OA 1VRWA 4C7KA 4UEOA 2C2YA 3H3JA 5COBA 3E9NA 1NFFA 2AXQA 3O9ZA 4CR8A 3ENKA 1BVUA 3KBOA 4CQMD 3ZDFA 1DJQA 3QWIA 5KOIA 1KIFA 1ONOA 2P9EA 3IJRA 4OKIA 1EQ2A 2IODA 3DONA 4IGEA 4I5FA 2BGKA 3RC9A 1YKFA 2YJZA 2FZWA 1P1RA 3BMOB 4I5EA 1IB6A 3CEAA 4M49A 3RUEA 2Y1EA 1AGNA 1Y8QA 4CLOA 3IMFA 1SB9A 5KJCA 1WDMA 1GUYA 1T1SA 2GRAA 3V2UA 2D2IA 4PG7A 4WOJA 4PLZA 1ISMA 1PS0A 1YO6A 4Q3BA 2ZYGA 4CQMA 4BNIA 1X13A 2C5AA 1V9LA 2X23A 5KJ6A 1ZSNA 3SVTA 1F12A 3LLSA 3PWZA 3LLVA 4Z3KA 4TQGA 4R5HA 3G17A 5H83A 5C3MA 3TNLA 4WCFC 1P0FA 3EC7A 1P1FA 4W82A 2EV9A 3I9NA 2VHZA 2D8AA 4GKBA 3H9UA 3NYWA 4XRRA 3LVFO 3WFJA 4BL5A 3BTVA 1L7EA 2HK8A 1NFQA 1SCUA 1LSSA 1Y81A 3HDJA 1DIRA 3OFSA 2PTGA 3PHLA 5DOZA 2CY0A 3GZNB 1BW9A 1YOVA 1QV7A 3WLFA 3MEQA 1H6AA 5B4VA 4I1IA 1C3VA 1CQJA 3VZPA 3RKRA 3OH8A 4GL4A 1I3LA 3H6KA 3K30A 4J43A 1E1KA 1LDNA 2AE1A 3QY9A 2DBQA 5JMPA 5JSFA 1XR3A 5JYEA 1GU7A 1YOVB 2GSDA 4J49A 3FR8A 1XSEA 2O2YA 2QRKA 3D3EA 3FRJA 4YJHA 4FFNA 4II3A 4OHUA 1A9ZA 3JCZA 4R1UA 2CZCA 1U3WA 4XJSA 3TPCA 3COSA 3LU1A 2NVBA 4IM7A 5BT9A 1SEVA 4CMGA 1Q2XA 2C29D 2YV3A 5DF1A 5B37A 1PGJA 4TKMA 4K6CA 1R37A 1P1HA 4J1TA 1GYRA 3BHMA 4W7HA 1PL8A 4Q3CA 4D43A 4E2YA 3L07A 1N9GB 2IDZA 4GLOA 3DOOA 4HX5A 1ONNA 1ZIDA 4MIOA 1GUZA 2B5WA 2EXXA 4CL3A 5FWNA 4WASA 2WTBA 1C1DA 3GT0A 4XKJA 2DBVO 4IBOA 1GYPA 3OEWA 4XDZA 3IKTA 2P91A 3DL2A 2C2XA 1MC4A 5F5LA 2XXBA 1ZH8A 4ZICA 1PJLA 2BGMA 4IS3A 3PYXA 4YT2A 4DREA 3HDYA 4XDYA 4BO2A 3B20A 2DTXA 4B8WA 3EZYA 3ZWBA 4TWRA 1GZ6A 1PL7A 1T2CA 3F4LA 3UICA 5GZ6A 4BKQA 2PGLA 4NZ9A 1ADGA 1D1SA 1EFLA 4F6LA 4JK3A 3MJTA 5DCUA 4DPKA 3ZWCA 3GVIA 3VPFA 5I9NA 5JPIA 1M75A 3D5QA 2DU8A 3GEDA 3I4CA 1P0CA 1PJ4A 1H93A 3UOGA 4AICA 4P8RA 1H2HA 1OMOA 2X6TA 3TN7A 4YXFA 5KJFA 5BNTA 3H9GA 5CEJA 3UUWA 1DC3A 1VL0A 2ZTMA 1ZBQA 3L4BC 5JDIC 2J3KA 2UUOA 3PHGA 4OSPA 3VZQA 2BD0A 4JROA 4IDFA 1R0KA 4TVOA 2EG9A 4UUOA 1QSGA 2WD7A 3TWOA 4BNNA 3BYZA 3LT0A 3QHAA 4BKUA 3L6DA 2NTNA 5ER9A 3O38A 1OC2A 4UVIA 4NG5A 5F1OA 1X7HA 2ZQYA 2VHXA 4L4RA 3EYWA 1TI7A 4DLAA 4GX5A 5B12A 1BXZA 3DC2A 4FJ2A 3I23A 5KIAA 3IQDB 3GDOA 3FSRA 1LC3A 2AHRA 5L51A 2VWQA 1BXKA 4MVJA 8ADHA 4I9UA 1PSDA 2O3UA 4RPLA 1GDHA 4GBJA 1JU9A 2YHIA 1F17A 3ASUA 4GVXA 4MPDA 3WB9A 4HFNA 2X9NA 2V7PA 2VHYA 4IY1A 4FFMA 2CD9A 1H6BA 1T25A 5CDUA 2JFFA 3WG9A 3PWKA 4IJUA 5IXSA 5FI5A 4BV8A 2V6BA 4PCVA 4PVDA 5JCXA 1K2WA 5K0ZA 4B4WA 3NJ4A 5ENDA 4D0SA 3C8MA 1HDCA 2EGGA 5BSEA 1VE9A 4OXKA 3ZU5A 3ASVA 4FIZA 5JAQA 3I1JA 2GN4A 3AOEA 3U4IA 3MOIA 3RSHA 1KOLA 2WM3A 1P1KA 1TEHA 3HB5X 4FPXA 4HNGA 2H63A 2PD4A 3GAZA 3FTPA 4G5HA 5F1PA 4RF3A 4Z3DA 1DIAA 2FR8A 1N7HA 5JAIA 5K6AA 5KVVA 4P22A 3OA0A 4N7RA 3S2EA 4CM6A 1K3TA 1ISGA 3GN2A 1QRRA 2J3JA 4IGFA 1P1JA 1VKNA 4I9NA 3R0IA 3D3WA 3DAGA 1B15A 2J5KA 3IOYA 2IXAA 3HN7A 3NKLA 2AA3A 4H16A 4MKRA 3OP4A 2OP1A 1T26A 2O23A 1CETA 1U2DA 3DOJA 4W99A 4EZBA 1XELA 2XPCA 2DC1A 4LMPA 1QR6A 3F47A 4UVDA 1WDKA 1HEUA 4ZRMA 1KC3A 3O26A 4WEOA 1A9YA 5B4UA 1Z6ZA 2IZ1A 3NUGA 3QWAA 5IZ4A 4G65A 1E7RA 3GY0A 2V65A 4QO8A 5DCWA 4M86A 5K9ZA 4YAIA 3KOUA 3GRKA 1W6UA 3P7MA 4QXMA 2O4CA 3BMNA 3G1TA 3RUCA 3U09A 5MGBA 3KYBA 4LVCA 3HADA 4QFCA 4NHEA 2R00C 2Q1WA 3JD2A 4MDHA 2ZTUA 4G2NA 2UDPA 4R1TA 3GLQA 3T4EA 4CR6A 1B14A 4PG4A 3T4XA 1YH3A 1XU7A 5JC8A 2PWZA 3SC4A 4UUPA 3ONEA 2ZB4A 4TKLA 3GNSA 3S2FA 5COAA 4FJ1A 4CM5A 4M55A 3NTQA 4H3VA 3ZNOA 4B4VA 1GAEO 4BGVA 3K9QO 3ZU3A 5F21A 4Z9FA 2IZZA 4BOYA 4OAQA 3ULKA 4ZJUA 4Q3EA 4PIVA 3HJAA 3MJSA 1CIVA 1YL5A 4CL8A 2BFAA 1NQAO 4GH5A 1PEDA 2Q1TA 1SB8A 4MOWA 1B7GO 1DFIA 4A03A 1SPXA 4OSOA 3EGOA 2HUNA 3H2ZA 5A5EA 1Y8RA 2FY8A 1JVBA 3PRJA 1C1DB 3I9LA 1JKFA 3GMSA 4HWKA 1G6KA 5T5QA 1E5LA 4I5GA 4BS9A 5JMWA 5TLSA 1X0VA 2E82A 2ET6A 2NM0A 5H81A 5L95A 4W9NA 3Q2IA 1ZO8A 4A10A 4A7PA 3JSAA 4BGEA 4CM7A 1F8FA 2YZ7A 3V1YA 4CMBA 1I2CA 2R2GA 1U4SA 4AJ4A 5C7LO 1GL3A 1I30A 2CDCA 3ITKA 3AI2A 4I9HA 4DMLA 1H6CA 1E7QA 3FNFA 3QLJA 4L8VA 2WDZA
chains in the Genus database with same CATH superfamily
1DO0A 1TJNA 3GP3A 4L3VA 3KS9A 5DI3B 4DC0A 1E3DA 2VKQA 3SPXA 3D1LA 5IAEA 4KX3A 4YPVA 3MGBA 3RBVA 5G1OA 3U44A 1TO2E 4OFZA 3RRZA 2Q49A 4WKPA 4JI4B 2SKCA 4OLBA 2O3RA 4CQNA 2E4WA 4HF7A 2B0JA 3L8HA 2VSQA 1Z06A 3BXXA 1PR2A 3ED5A 5DULA 1W25A 1Z0IA 2FN8A 1ZEJA 3BRSA 1NYTA 1O87A 4BP8A 1QIJA 2I78A 3M6VA 3LQYA 4OFWA 5EEGA 1G6HA 1GA4A 4EO9A 1EI9A 4QU5A 2IDMA 1HG0A 3TO5A 1Z0UA 3RANA 2J7KA 2BEVB 4QOJA 2VJPA 4DLYA 2QVGA 1VKRA 3QUSA 5FIUA 2JIZA 2J5RA 3AZPA 5EC8A 3HNRA 4LE1A 1CZKA 3ECSA 2P5YA 1FOEB 4FHCA 3FMVA 1CUXA 3H9JA 4YQEA 4ZI5A 1CE8A 1RBYA 3CRZA 4UHCA 2HN9A 4KN6A 1IY1A 1MJ5A 1RVDA 2BY4A 1EHCA 4W7SA 3HBAA 3EXEB 4AU1A 2C5EA 4FIDA 1KO4A 1GP2A 1YS2X 3M5WA 2NSJA 3M49A 3NDJA 4E21A 3NIDB 4GO1A 4RWEA 3SJCA 4DY4A 5AHWA 2VHEA 1L4GA 1Y7LA 4DPLA 3P27A 4IQGA 5E8RA 2O8BA 1KF0A 1A96A 2JLBA 3PV0A 1O94C 5B36A 3DW3X 2PLNA 3QYJA 1U0RA 4YIHA 1HSZA 1UDCA 2C03A 2ERCA 1ZVQA 2ID4A 4JMLA 4P7GA 2AOXA 3LV8A 3OOHA 4TS4A 5HK8A 1E32A 1DXYA 4GI1A 4ENQA 4QGSA 5A4FS 4F93B 3U80A 5JBIA 3NXSA 2C78A 4O4IF 1QCZA 1U2EA 3T1NA 3OZEA 3ZWWA 4XWOA 2JGEA 2WILA 1JQDA 1DL5A 3L04A 4KQIA 3V46A 4B7ZA 5A5VA 4I50F 1DFHA 2NO5A 3HZRA 4ZVOA 2WB2A 4AMVA 3M82A 4M83A 2JFUA 4TMFA 1CHDA 3LC7O 1QVWA 2NVWA 1OWMA 2D0PB 1XTUA 4IFIA 4AP9A 5F76A 6CHYA 1VPLA 1XZHA 4QQKA 1QV9A 3QXGA 4D6YA 1YBFA 4IDNA 3GNTA 4K03A 4PY2A 2WWIA 3VI4B 5CA1B 4L4SA 4AI6A 1F0YA 5IW8A 2TMKA 4KQ9A 5JCJD 3B2NA 1W5BA 3P4UA 4CMKA 1VTKA 2ZYUX 1PWHA 4LJ5A 1NKTA 3V4FA 3S1LA 4HGYA 3AOEC 4GDFA 2FN7A 3EVBA 1TIKA 3U2QA 1QFYA 1SXJB 2XZTA 1V5WA 3K8OE 1JG1A 2H1IA 1N1EA 1I7LA 2RG7A 3AFOA 3BD9A 4HQRA 4J1NA 1WBBA 3SX0A 1W5AA 3RC7A 5GVSA 2FZ4A 2WM2A 2HEGA 3L93A 1BMTA 4O3MA 5F3RA 1I8TA 3E9EA 4Q6BA 5KNCH 3OMLA 3I8SA 1GZ3A 1PGQA 3EEIA 1C80A 4H6WA 5LOVF 4GZ3A 1SZCA 1MW8X 1U9YA 3OSZA 2J9ZB 2JRLA 1FC0A 3BULA 2O6HA 2QRHA 3KFVA 3Q7IA 4MRSA 1NVKA 2V7UA 2VHJA 1G8HA 4FOOA 2CF5A 3S2GA 1TCVA 2OA0A 3A1SA 3W5UA 4PPQA 4BAUA 3LWBA 3FOZA 3IQIX 2K6GA 4I5IA 8GPBA 1Y1KE 5J4YA 2X40A 5AVSA 3ZLBA 1UANA 1YR7A 2NSYA 1QK5A 3MVEA 4EMBA 3J7TA 4IQ0A 1G21A 1V5FA 4LYGA 3EXEA 1GPJA 1G55A 2XKAA 4EY6A 5EHXA 4R9RA 2XB8A 5JS8A 2O5VA 2PA0A 3P26A 4RXTA 2OD2A 3A1FA 5FFFA 1TGYA 1TM7E 3AM5A 1JTEA 1H0RA 5H4GA 5CCEA 2QMEA 4HLDA 1LSUA 3A1UA 3K0HA 2J30A 1C29B 4R2IA 2FEAA 3KJEA 4TSFA 3RR2A 3KSDO 4QUGA 1DC5A 1A7UA 3N6XA 2NSLA 4CKXA 4QASA 3RV3A 4DUPA 2NXWA 1ZIOA 3D6NB 8MHTA 3SE0A 3B1KA 1WMFA 2XT9A 4N1AA 4W9NC 3CNNA 3R76A 4AY5A 2J85A 1KOJA 4IDOA 1E3WB 1FRQA 1ZL2A 1NW5A 3KZKA 1QGDA 3I6QA 3F46A 5REQB 3MS4A 5K3OA 3F8TA 5BWCA 2UV8A 5KUTA 3AY7A 1NUUA 5IN4A 5JH7A 4OHPA 4HNQA 3ZIDA 2HU7A 1Z8NA 3CEPB 1JAXA 2OECA 2V9ZA 3TM4A 4BLWA 1JFSA 4TZTA 4DDWA 4DDUA 1PTKA 2H59A 2ZWOA 3IAUA 3DOUA 1YVEI 5JSZA 1Z29A 1LRLA 5DSTA 1Y3BE 5EIBC 1R5NA 3E9ZA 3RJTA 3B7GA 2A1UB 3H86A 4UBLA 1G1AA 4JBIA 4GRIA 2YMQA 1J8VA 3DQQA 3IVRA 4X91A 4CV0A 3BIOA 1VE6A 3GFBA 3P0FA 1P62B 3WV5A 1GXSB 1JRLA 3MUEA 2EBFX 2F9MA 2BOVA 4HXGA 4YLGA 3RSCA 2AE2A 3Q5EA 1DELA 1ZZGA 4PAOA 1E3JA 1EG7A 2QVBA 2O48X 4RVGA 2J32A 3GQBA 2XZDA 4JQZA 1Y9EA 2W43A 3AHIA 3I52A 2QP4A 3JS5A 3LDFA 3UQYS 5JISA 1JB1A 3MHTA 3L7AA 3QE3A 4I1YA 3ZDEA 4K9OA 4EDFA 4PTLA 2BE9A 4C06A 1X1TA 1CVIA 3C4QA 1ADJA 4TTQA 5BN4B 2QTCA 3AF1A 1R88A 2AF3C 2DPHA 1S9HA 3H2SA 2CLCX 2VUIB 4BTLA 4TYWA 1GCOA 2OT3B 3KR1A 2UYCA 1E4EA 3AFHA 3D81A 2IYVA 3RW9A 4NCHA 5AIAA 1ZK2A 5BMOA 2I62A 3DFUA 3PHJA 3H2IA 1BE6A 1PZGA 4N49A 4TLLB 1QLJA 1T9GR 1W0KA 3G68A 3R3YA 3VPSA 2OBLA 3EWSA 5DPMA 1I36A 2I6QA 3OIFA 4KP7A 5I9MA 1JR3A 5KHAA 3SKYA 2W0SA 1M34E 3KOXA 4UPEA 3KZMA 3SN6A 4ESOA 4CTMA 3PPVA 4WFKA 1DTWB 4DRZA 3DPIA 2J48A 3CB4A 1SU8A 1XZPA 2WWXA 3GB9A 2PXAA 1QHNA 3JQ9C 3MILA 3FWNA 1H5UA 3HJGA 4PZCA 4Y1FA 3TGPA 1PLJA 2ZQ5A 1TF7A 3H0CA 4ZDKA 4RYLA 1C4XA 3T5BA 1K92A 2RI0A 4KREA 2OMEA 1WBJB 3IT2A 4WOKA 2B20A 5TF0A 5JCOC 1DLJA 3GMIA 2CYCA 1Z7YA 1PBNA 5K2OA 1U94A 4KKXB 7AT1A 5K8LA 3LPLA 1BVYF 5KBYA 2DUNA 2ZBRA 3I9FA 3WGGA 3ZWYA 2OKGA 2X5JO 5DIFA 3JPYA 5L3VA 2ANBA 2W2PA 3HA3A 1E0JA 4BXOB 2R0QC 2JI8A 4CN9A 2YWBA 3H0EA 2P0EA 5FLEX 1U7DA 3R6LA 1U98A 3ZGVA 2HJRA 2R1TA 1ONBA 1GTG1 5IFLA 2X8WA 4CG1A 4I55A 3CX8A 5JVDA 2OHXA 1ZM9A 3ESZA 3TKLA 2ODEA 1ZICA 5FL3A 3I2JA 1JHUA 4BLRA 5DN6D 4XFDA 4K5QA 3O82A 4TROA 4IVNA 5EHNA 4BU1A 1T29A 1FSPA 2H52A 4JI5B 2GM5A 4HYYA 5DH9A 5C53B 1L4UA 4KR6A 4M89A 8OHMA 1WNFA 1MO4A 4MA5A 2VTBA 1G8AA 1RJ9B 2MYNA 1U7HA 3FPHA 4S1TA 4B1FA 1Q2UA 3F5FA 4BNXA 4DJDC 2NW6A 2ZWMA 5EZYB 5J40A 1W36D 4RZ3A 1HDGO 2V7BA 3CLVA 5LBIA 4TT3D 3RSGA 4P0PB 3M6UA 4KQFA 5E6SB 2Z2KA 3PEYA 3VKHA 2PKQO 3JZDA 4UEJA 4EW3A 1A1SA 2JEZA 1RR6A 4PFKA 3G8CA 1HPLA 2WYUA 3AI1A 4E6EA 3SYTA 5J2TF 3TMKA 4TN5A 4XDHA 2JAHA 1CUIA 1ODTC 3V8BA 3GV0A 5JYBA 1SKBA 3QTTA 3UIEA 2WWHA 3KKMA 1SK9A 3DP9A 4TQ9A 2QKYA 3KKQA 3WHPA 2HMWA 2REXB 1YZQA 1DQYA 2XSZA 3IILA 3M2TA 2AG6A 3GFQA 3RFFA 1COZA 5JO9A 5MFPA 5GOZA 4DC1A 3GYGA 2GOYA 2NSHA 5AVVA 1T3GA 4FSHA 3BBLA 4XQ0A 3W2HA 5AVRA 3FPCA 1SG6A 3L1VA 5FFNA 1QFJA 1WABA 3C39A 1F6WA 2AOTB 2R1ZA 3BMCA 1A5TA 1RCTE 2X5OA 2QV0A 4Q1AA 3IDAA 3KAQA 5ELMA 2PIAA 3STHA 1YA4A 5DP2A 5EJ2A 3ZE1B 4ZCSA 4AT1A 1GWNA 3PCXA 4HYQA 3GX1A 5K6TA 1HT0A 4ZFNA 1XZQA 3VR6H 1NP6A 2HRCA 1BTOA 3ESCA 3GFSA 3HXKA 4DNFA 5GTDA 3K6JA 1A4IA 5HOEA 1LTQA 1C41A 1UZMA 2H92A 4PSKA 3IIEA 3JV7A 2B4AA 4EF5A 3HVHA 2GPJA 4TLCA 2CV1A 4TYQA 2D5CA 2I6TA 3SBOA 4YRZA 4Y0VA 4ZODA 5KAPA 4ARSA 1X2EA 3UGKA 1ORWA 4IDAA 2O52A 4NV1A 4FFLA 5DYNA 1JFVA 1GR0A 3ZZTA 4E2WA 5BQXA 3P71T 3KLBA 4CCYB 1K2VN 3DOFA 1QE3A 3GRYA 2WJPA 2JVIA 2D2VA 4M1WA 1JHYA 4CLOB 5A4JA 3FYTA 3RG2A 2NO1A 4KTTE 2VUTA 4O5AA 3W4IA 4YQYA 1TEXA 3SZLA 3AHHA 2H2HA 3LS2A 1NZJA 3VPGA 3VNVA 1I13A 1HK7A 4D92A 1N5MA 1OLXA 1RC1A 5DW0A 1XVAA 1KA9H 1LPAB 2PBZA 2AFHB 1DEXA 2VJCA 3HKBB 2G76A 5CBPB 3VAYA 4TRMA 1YQXA 1SCJA 5DP1A 1XRSB 4G0UA 4XJXA 3MQ2A 2FK8A 4MO9A 2WZDA 5BPHA 1D6JA 1O4WA 5ISMA 4N18A 1OXTA 1DFGA 2HTEA 3N1UA 5CM2Z 4PX9A 1E92A 3AUUA 4R3NA 1XMIA 4HYTA 4PC3A 1M1YE 1M1YB 2AMYA 1A50B 5EKTA 3Q8WA 2W4MA 3RFXA 2WD7B 5KJ1A 1GFWA 3VVBA 3EG9B 4BQQA 3P96A 2VRBA 3HCAA 3BRWA 5C7YA 3AQ4A 3FOEC 1QE0A 1F6BA 1SOVA 1KQPA 5A1JA 2AR7A 5H5JA 2WUVA 3OUUA 4CKBB 2NVUA 4I4TB 4XGIA 1JEYA 4IEEA 1VLQA 4JBHA 1K6JA 2Q4OA 2ZYTX 4IR7A 3GLHA 3TX6A 4FI3F 2DTEA 3A11A 3M1IA 3ELBA 3OZGA 1WRBA 3MQ4A 3ID6C 2Z2ZA 5KDDA 5AYVA 3AHJA 9LDBA 4U6QA 5LU9A 2BEUA 3ZTWA 2VK1A 3CW8X 1T8SA 3R3ZA 1YK0A 1B6SA 1FSFA 2GRJA 3TMAA 1QYWA 3U60B 5DNAA 5BNWA 5JAOA 2JDIA 1O6BA 4MLPA 2DERA 1I4OA 2BH2A 3OPYB 3E9YA 3PNPA 3GLIE 2JB9A 3M9WA 3HR4A 5BQFA 3KJFA 4DA9A 4XB1A 4MQMA 5BSMA 5LB2A 2H1OA 1FYWA 1EQUA 3NBAA 3RVDA 3TRFA 1QCYA 2PWPA 3TB4A 1U8UA 5I7VA 4EK9A 3H5WA 4IXMA 3IAS1 4JH0A 2K2QB 4TX1A 4AY6A 1DOAA 3R7WA 1NBOA 1SMKA 2VTVA 3HCFA 1RHJA 1TYEB 2I87A 3H5IA 1U7ZA 3OG9A 1PQUA 4V39A 1IPFA 1ZH2A 1E1MA 4ZCMA 3UBTA 3TRHA 5A6VA 1UFVA 3ZLJA 2Y1FA 4OIMA 4WX2B 2C31A 2H5IA 2IKQA 2GTHA 3KZCA 3STUA 1PSWA 2JAPA 3GDFA 3KR9A 5EJ9A 2JGMA 2ZDHA 3BE8A 4BP9A 2WIGA 1N7IA 3X1YA 4YYEA 5FTLA 4NFLA 5JQGA 2BUBA 3IIIA 4Y2GA 5KYWB 2OL4A 2Y27A 3QPUA 4MDFA 1KDPA 4C7OA 1H4VB 1NM5A 2GCEA 3AETA 3B1JA 4PIPA 4RVFA 2HA2A 4PZPA 4IUCS 3RASA 3VO8A 3W6UA 4B8ZA 4MS4A 1TPYA 1OI4A 1R8YA 1WB4A 2HCRA 2GEUA 3ZDDA 4XTRA 2YQ4A 5JBNA 1OIWA 2XXJA 1QHXA 1EZZA 5LD2C 2D7CA 4AB1A 3KXDA 4IF6A 2I2FA 1KS2A 3B3FA 1GRQA 1UXIA 1IWOA 2Q4TA 3ZW9A 3O83A 4BO5A 1HYEA 1XDSA 3C6XA 1GKKA 3GROA 4DCSA 2A0FA 3GWGA 4TWZA 2D4AA 3Q1KA 1NUHA 4JU9A 4OQQA 1QHGA 4QOSA 5KNLA 4MWDA 4B6RA 1U0LA 3O8NA 1DC4A 2J08A 1T4BA 1QP8A 1AK2A 3M0EA 4M76B 5J1TB 3I9V6 1U0OC 5UKDA 1ESCA 3FVWA 4XR4A 2QLJA 4RKQA 3N0WA 4E32A 1A7KA 3JD3A 4JIGA 1YIOA 2A57A 2XUHA 4AF6A 3K31A 1J07A 1CFJA 1DKQA 1UK7A 3SXUB 1XEXB 4BEBA 2R751 3AVVA 1BEEA 2RHCA 1SCUB 3CPSA 1KFCB 3ZR4B 2NSDA 3Q9LA 4PEVA 2NLOA 2RB4A 3UUGA 4UHDA 3V9AA 1U5AA 2RHDA 3GP5A 3MUFA 4YASA 2ZJ7A 3KXKA 3UUEA 2W6JD 4F2WA 4AYXA 1COWA 3FROA 2ZTVA 4O2AB 1W29A 5CGQB 4OATA 2ATXA 3WJAA 3KEFA 5BXYA 1CDOA 2HWWA 4TLAA 5K3SA 1RRCA 3EXHA 4GLJA 4WBNF 1C8BA 5ALNA 4RDXA 1C4OA 1M2VB 4ZDIA 1SCNE 3AB8A 3G7NA 5MDHA 1HLDA 3MWEB 1TW2A 3NWEA 2XT6A 5L4LA 1P29A 4EJSC 3HFSA 4OM8A 1A9XB 3DW1X 5C7IO 4HDKB 1Y63A 3WO0A 1K06A 4AJLA 3I9JA 3ZD9A 1JHQA 4YCJA 2OHHA 5T64A 1IOVA 3UATA 2IQIA 4WIAA 3ILHA 3THYB 3ANNA 2IU3A 5AKEA 1U04A 1HY3A 1LSOA 1WDLA 3HNPA 3KWLA 4JBGA 1KK0A 3EVEA 3WIUA 5BSWA 5JVDF 3FUUA 4N3CA 2WFLB 5ES3A 3VZDA 1U0GA 1ZHFA 3A1WA 3K73O 4XIJA 4P33A 2NN3C 4KQEA 4LPSA 3W6NA 3EH2A 1QLHA 4A8PA 5CDYA 5MFZA 1TM3E 7ADHA 3AYXB 2OCLA 3R6WA 1ADFA 4WA8A 1C7ZA 2Q1SA 3CNQS 4XAQA 3OWHA 4YJ3A 1TAGA 4OB8A 1IQPA 3G49A 4MCAA 1UDWA 1JJIA 3WYFA 4KPGA 2V45A 5ERXA 3L6EA 1EXMA 3JQBC 1C3OB 3PQFA 5B58T 4FYJA 3FIJA 4I36A 4A2PA 1GGFA 2NUPA 3LC2O 4ZQEA 3EF1A 2QF7A 2Y67A 3V5NA 1LRJA 3B70A 3OESA 5E6RA 3E7PA 4A6DA 3AI3A 1DI0A 1QR2A 1XF1A 1WY5A 1R6XA 3GBPA 4FYKA 1IZZA 3RTCA 1DT5A 2FG7C 3CH4B 4ALLA 1N1MA 1ZMXA 2YXEA 3G2IA 4K9LA 5B7PA 4MGHA 3BSYA 3CH7A 1O57A 3JALB 1SVIA 3E7XA 3FTCA 3I30X 4N65A 4OK3A 3RODA 4CYMA 3M5CA 3VR6A 3LLUA 2V0GA 5KSOA 1DUSA 1Z4PX 4U9HS 2JFPA 4ETNA 3L1KA 9ABPA 2D13A 2MTBA 2E48A 3TQHA 1ORDA 3EVGA 4QVIA 1SA0A 4LV5B 3KHUA 4WJKB 2YICA 2EEPA 2HHCA 2JGRA 3FGPA 5JD4A 2PWAA 4RULA 5AXAA 1TT7A 1P1IA 4TV9B 4MHSA 1N3LA 1YZUA 4LCEA 5K01A 1L1EA 2NAFA 1WNTA 3GLHE 4MVJP 4XPZA 4MQFA 2Q2OA 2ZKIA 1T1IA 1WL8A 1NQ5A 1V3QE 4JR1A 2KI5A 2GXQA 2GZMA 4K8RB 3HLTA 1S2OA 1V8BA 1EE1A 2OBFA 2XKBA 4WESA 5ESWA 4HNUA 1JILA 2HPAA 3ESRA 3AVYA 2BMEA 4PZYA 2C7BA 3DO6A 2V7TA 3WGZA 1UQRA 4R1MA 3W6ZA 3V8MA 2DY0A 1TTPB 1YQTA 2GAFA 4I6GA 4JOQA 4L4ZA 3KYCB 5GV8A 3THSA 5BW5A 5I7OA 2VDJA 4DJAA 3DV0A 3QMVA 3EVFA 1KQOA 4LGYA 3L46A 1I14A 2NTYC 4GICA 1YBHA 4BNGA 1JSLA 2A59A 4P6VF 5IMSA 5DNEA 3PYLA 1Q16A 2BZ1A 3H8VA 3PFIA 1Q11A 4QFDA 4D8WA 3FNIA 2A58A 5K8UA 2QQFA 3GFOA 2AJLI 3M4NA 1WCWA 1Q21A 4NULA 2XZLA 3CR3C 2HA6A 2VP9A 3D6JA 1T2FA 3I3SR 5THQA 4PQYA 1E9FA 4FDAA 3N05A 2BDEA 1L9XA 1E3QA 2ZUFA 3R9KA 4GR5A 3THXB 4PW0A 1VKJA 3CJQA 3EVTA 3HU5A 4L0DA 4FC6A 1F7VA 3U40A 1CW2B 4BBPA 1PW7A 1RM5A 4HNHA 1Z82A 4W1PA 3DFFA 1PKEA 5IP5A 1OZHA 1BWQA 2GYUA 3W8FA 4CQLB 5FWXB 2ZSUA 4PLVA 1AKMA 4C78A 4BV3A 4D4GA 2LD4A 2PX0A 4G4JA 3HBLA 4R68A 1KU0A 3RVNA 1TW3A 1CIJA 2YRWA 1SVOA 1A2KC 1W2WB 2C94A 2ZQZA 5A1TA 4EY7A 1OQAA 2RC6A 5C8VA 3HUFA 4ZEOA 4LWOA 4C4ZA 3OSUA 3UFXA 3FCUB 2ZBVA 5MN4A 1FJGB 2GEJA 2W2VA 3ONWA 3T0GA 2WJZB 2NVOA 4GXQA 5E9AA 4HVCA 1M2KA 4E2ZA 4ZKDA 2QUHA 2ZYDA 1MORA 3CHYA 1DAFA 2YV5A 3ZHBA 2G5CA 2NTVA 3HY6A 4HAWA 4OI4A 5ERGB 1ESZA 3UPTA 2OO5C 2BBTA 5C5IA 1BGVA 3SJUA 1ZNYA 2GMWA 3SBDA 1CF2O 2J9YB 2GN1A 1QGUA 3ITNA 4WUTA 1E6EA 3E61A 4B4KA 4DM3A 4XH9B 2G9NA 4RDHA 1JDPA 4BLUA 3ZXUB 3ZU4A 5DIZA 3ZHQA 4NMLA 4DJEC 4ZI7F 4KQKA 2DUMA 1U3VA 1X3LA 1N34B 4U7JA 5GADl 2FU5C 1ZCAA 2GPWA 2I71A 2WK1A 2RCNA 3NIGB 1FNMA 2W2TA 4YREA 3U0BA 1VLZA 3PGXA 4IDPA 4KXXA 2HU2A 3JX9A 2GVNA 5EIEA 2JAUA 4K7JA 2QTVB 4P4SB 1Y1QA 4BO0A 1NDQA 4D9FA 2N42A 4LTMA 4BNZA 3ANMA 2H6EA 2X42A 4AKIA 4YRSA 4BAZA 5KX5A 3K1JA 1MH1A 3M9XA 4KNWA 4O4JB 2OPHA 2E4AA 3PGLA 3Q3VA 3T9AA 5LOVA 2HA4A 3ZWXA 2AIRA 1T35A 4CU5A 1PJSA 2FSSA 4IF4A 4NZNA 3CSUA 4PO1A 5IBRA 4RU1A 1KPGA 1PNQA 4Q7MB 1YGYA 2OENG 1VLJA 2ODWA 1QBKC 1I1OA 3PFNA 1UQTA 4OQFA 3SEAA 2CHQA 2ISSD 2V97A 5BN5B 4E6PA 3AUKA 3BMQA 1NF2A 3CZPA 3F6PA 4R01A 1USKA 5IABA 4B40A 2OK8A 4FFWA 4E0BA 3MPUA 1QAQA 1OBFO 1TQ8A 4HAVA 3VM6A 4KAFA 4S3MA 1KP3A 2VT6A 1SM4A 1UJBA 1WDWB 3TFQA 3VOAA 4CM8A 1JFTA 1L5QA 5HMLA 2PGIA 3KSRA 3LQ2A 2IEGA 1RAHA 4ZQGA 5EE3A 4KRXA 4U0KA 3HYTA 4ZAVA 1DLIA 4V2UA 5JE8A 5LJLA 4Q93A 3ABRB 3NUQA 4KKVA 4UC0A 1NNSA 2AXNA 1NR1A 3BVPA 3EY4A 3W8DA 1NF8A 2VWGA 1V45E 3CBGA 1YBVA 3PP8A 2D00A 3WS7A 2BFOA 1KETA 5ALUA 4O2LA 1YDWA 3ZOKA 3EGDA 3OEEA 1KXZA 5B6IA 4ZQHA 4MTLA 1XWFA 4QGHA 4E5MA 3U3RA 5ELXA 2OC4A 2R79A 5EQDA 4RJLA 1V1RA 3ZU6A 3ZU2A 5AM4A 2A3RA 4CTNA 2VYQA 1SBTA 2FFJA 1Y6ZA 1H2EA 5L7YA 1IXZA 3DWIA 2DYKA 2EIXA 4TS9A 4V0SA 1SEPA 3RSLA 4E2FA 4P80A 4D81A 4HCJA 4JB3A 3ROKA 2XCQA 5AKXA 2XRZA 2BFDB 4WKNA 2OILA 4QGFA 2C3MA 4MJ3A 3VU9B 1OFGA 2XVMA 2CLOB 2UYYA 4EHDA 4B43A 3NHMA 3DE3X 1GGNA 1N2OA 5IARA 4JXZA 3KUUA 3LW7A 4QXQA 5ADHA 1WCXA 4KU4A 4D9HA 2QGZA 3PRHA 2EW1A 3OEED 4MDYA 2OZPA 2XBUA 1CT9A 4P86A 5KKNB 5JC1A 2YXBA 2QTLA 3C1UA 3R2JA 2P3SA 4HXYA 2QIOA 2CBZA 3HGQA 1KZ1A 1C30B 3GEBA 3E3OA 3KIPA 1XJ0A 1LX6A 4KN5A 4DIOA 3BGWA 4NBUA 5JQGB 1I4WA 2RI1A 3GZNA 2CUTA 1MZVA 4MICA 2ZWVA 1NNEA 2IS6A 2WOJA 4IDBA 3EIQA 1USIA 3DXYA 1XDBA 4LRYA 2C2ZA 2NWQA 3ILXA 1W8IA 1FY2A 5EP1A 2AHOA 1LD3A 4IIHA 2ORVA 2WT9A 4JMPA 2ESRA 5E1DA 4RVCA 5A3SA 2XUJA 4WDQA 4OOFA 4CMEC 5DE3A 4F12A 3UF0A 1VBNA 1WCIA 2FX5A 4MLZA 3FNRA 1WZUA 1KP2A 1CDZA 3U7FB 3GCWA 5LQJA 3QITA 4B46A 4JYAB 3CLSC 4MR8A 3CZRA 3R6DA 4BLPA 5JYCA 1EP9A 2J6CA 2F6RA 1T9AA 4L0QA 4KXNA 4RH3A 3F2VA 1IC6A 5ALIA 3OLCX 5EZ6B 2HDWA 2Y1XA 1VJ0A 1KSHA 5IFKA 3SE7A 2AR0A 2XOKD 3EG9A 3U4CA 2JFHA 5EXXA 2M6RA 2AZTA 2ZIZA 1E1RD 3L79A 4FFSA 4MRAA 5LQDA 4NFSA 1UT5A 2WSMA 2V7QA 3E3MA 1GZHB 2F3RA 3QY0A 3RQIA 1QOPB 1T91A 4NMHA 1RQPA 1S1CA 1VKOA 3V7NA 4OD0A 4B4OA 3HLYA 2VSYA 3BWYA 1Z7WA 2FPGA 1OU0A 2I8AA 4ARAA 2GJKA 3GJ6A 3RADC 3IODA 4QXAA 3WNDA 2QT9A 1NDHA 3E2IA 3RU7A 1MDFA 3D5TA 5ANRB 2D54A 3EGXB 4MVJD 4TXJA 1FIUA 5BXQC 4FR2A 3PGKA 2NU8A 4A36A 2OGWA 4UOZA 4HVLA 2Y66A 5AM1A 5A3JA 4Q9NA 5JCJA 1LCIA 2N75A 4M8NE 4KJZA 3TBHA 1I3OA 4P4GA 5H3HA 2I9PA 2JLAA 1A88A 3UMBA 3QVTA 3GMTA 1JYEA 1XZEA 1CJUC 4JXJA 4UXHA 4C4PA 1TZBA 3F6RA 2BFMA 4BEWA 4C43A 3V1NA 5IF3A 1KY4A 4EW2A 4MWEA 1ONPA 2RHTA 5I7AA 4OI0A 1T0JB 1DBPA 5IC4A 5K0BA 5TQ2B 3FPLA 4MYSA 4XOIA 4KUHA 5G0TA 3WIEA 2AN3A 2XLBA 3PZBA 4JUFA 3QE4A 3SIWA 2O8VA 2I99A 3EIFA 1CUYA 3IL2A 1O94D 5AK4A 2OQRA 1ZD3A 1O5OA 1MB4A 2DFKB 5G40A 2PX2A 3T99A 3IRVA 1FTNA 1V0JA 3LUCA 3ZDQA 2CL6X 3OCZA 2LTAA 4XZ3A 3OX2A 3VBCA 1NHWA 1NW6A 4YIKA 3ZE8A 2X8LA 3TSWA 3DQPA 1CQZA 1GNSA 2GEDA 5K0CA 5KC8A 1VLMA 2Z09A 1GRVA 4BNTA 4PFSA 4GNRA 1Y7TA 1X1QA 3F74A 4LZZA 5HZKA 3H5VA 1F0PA 1K0UA 3QLVA 4Z8YA 1KI7A 2ID9A 4EFMA 1EGMB 2K87A 4F9FA 1UZUA 1HT2E 1XCGB 3H11A 4J1SA 4EUKA 1RQGA 3A6GA 3WOHA 4DDMA 3T9BA 1A72A 2HRBA 3ZBQA 2KE5A 4LECA 1Z5UA 3N8GA 3AG5A 3TTTA 3U7IA 3UAZA 1SULA 4KEAA 4AO8A 4Z51A 1FB5A 4R8MA 4BMCA 2A0KA 4EA6A 1ISJA 1WUIS 2QW0X 3HJUA 3PGJA 4XGRA 4ZAGA 3RF7A 1S8OA 4CG2A 2C5GA 4E5UA 2OGUA 1HKHA 2OVBA 3WK6A 1K8XB 1PGPA 4TM7A 5JJ5A 4DR7B 3I62A 1MLDA 4RLQA 2WKSA 1GAXA 3PK0A 1XB2A 2O20A 4D9MA 3JWJA 3ICCA 5TQJA 3LWDA 2V74B 1F4PA 3AIIA 5ER6A 4C14A 3DCIA 2A9FA 3SMQA 3NIFB 3V4LA 4FE7A 1GV1A 3IULA 2UXBB 5KWEA 1A0OA 5E6UA 3OFKA 4JLUA 1E5QA 1LBEA 2I9KA 5FBZA 3P9RA 3H9EO 3PVZA 2H48A 2VDMB 2SKDA 4QVKA 4HNAA 4D4JA 4R1SA 1C8KA 3KSMA 2LDBA 4E7OA 5EJAA 1N5RA 4ESEA 1JQBA 5A3RA 2OV6A 3GPDG 4DOMA 3K2EA 3O2NA 1K4KA 4I4NA 2H9AA 4CJXA 4PN3A 4FP9A 5JY6A 1NL3A 3QBEA 2WKQA 2I4IA 4EVRA 1NQWA 2XWSA 4MKZA 4K3UA 1C0PA 1OY1A 3X1ZA 5K6AC 4DBZA 1W36B 1O0BA 4O4HA 3KUCA 1KEZA 3AXTA 1NN5A 4UNNA 3V7YA 1YBAA 1TJYA 1P2VA 1OPXA 2X4GA 3NTOA 1XQXA 1A5AB 1AKRA 3B7PA 2CDAA 2AOUB 4R1PA 1AQNA 3I8XA 4L9RA 3ZDZB 1NNUA 1X8LA 2H4WA 4HWSA 1AD2A 5L45A 3JVDA 1E3LA 3OFVA 1ZU5A 1B0ZA 1VCHA 3GIDA 3KPYA 5JATA 4WINA 5LUAA 2AN1A 3KTFA 3L9XA 4IZOA 2VIIA 1LPOA 3ZTYA 2FJ0A 4OHKA 4DR4B 5D3QA 4J3JA 1WHTB 1BDJA 3NEJA 4KI0A 5ALJA 4YWHA 2VZ8A 3MSXA 4E51A 4KXQA 3CZ5A 2BMFA 2IUYA 3V3TA 4L4XA 5M04A 4PFQA 1Z2DA 3VSCA 4HUQA 4BEVA 1KGSA 1WG8A 1UJ6A 1NBHA 3DO8A 3IDFA 3V8NA 4BX2A 2XUFA 3MLAA 4HUQB 3VYWA 2Q5LA 2X9LA 2HNBA 5HDBB 2PVPA 5A0TA 5A7HA 2FPSA 1B41A 4CG3A 2PMWB 2F1HA 1M5RA 5LFAA 2H4XA 3MGCA 4TXMA 3LQKA 1GZDA 1A76A 1T6XA 2QUIA 1T3SA 4RXUA 2EQ5A 5K3DA 4KW7A 4E5NA 4HN4B 1C50A 1KC1A 4WI1A 2CFRA 1U8ZA 4NAVA 3RYIB 4Z4CA 3TPFA 1B23P 3C45A 1JR6A 4LY6A 5KYYA 1MVOA 2NT4A 3GT7A 5AKLA 1FTSA 1MW9X 2X8AA 3C41J 4M1OA 3RUDA 2NXJA 4KX5A 1N2XA 2Y68A 4RDCA 4XPIA 1RWPA 4REQB 1VL1A 1MX1A 4CL2A 2VQFB 1GT91 1YZFA 4JNCA 5HFJA 1WPQA 2XY4A 1AQYA 2FJUA 4DNPA 1NRIA 5LIRA 5BSGA 4ENSA 3T7DA 4MJ7A 3RS8A 2WT4A 1T9ZA 1XA0A 2R6R1 1IQUA 5EKUA 2HXSA 3PC6A 2EKPA 3F4BA 1F3LA 4IP0A 1Z26A 1AZTA 3VPXA 5KYXB 5BN4A 1L1RA 1XRNA 2GD6A 1D6SA 2VNSA 3CNBA 4C6SA 4DV2B 2DAPA 3OJLA 2MSNA 4YFVA 3X2SA 3EASA 2F7SA 1YVPA 3L7YA 4V0MA 3SYKA 4LXYA 4QULA 3IEPA 5D3MA 3ZHCA 4NFHA 5TMDA 1BCRB 3HWRA 4ZOBA 4ND5A 1A95A 1J0DA 2J0QA 1S2GA 3EF3A 3OWOA 3QYFA 3UZUA 4QZVA 2ZUCA 3SOPA 4CFYA 1Q1EA 1ZS9A 1M2NA 1W85A 2H4HA 2JGDA 3BXGA 1CJMA 1OYWA 2PKWA 3SR0A 1PQPA 4DABA 3W9YA 3EAFA 1TF5A 3CPHA 4FEEA 1LPSA 4LRUA 1AK9A 3TUIC 3W5IA 5G0WA 1XZFA 2OHFA 4H35A 3CCCA 3K0KA 1HKUA 3U37A 1JBQA 4ZYTA 3B3AA 3R7DA 2C59A 2ECFA 2P0AA 2QTRA 4G0ZA 4JCCA 4S2UA 3U4QB 2J09A 5KVCA 1XLVA 5CJ2A 3VZSA 5LKRA 1OJLA 1SC6A 4QPDA 2ZJOA 3OZVA 1J20A 1NW4A 2G1AA 1GADO 2PR7A 3OETA 4MINA 4KGZA 1G8KA 1ZC4A 2Q3EA 2QRJA 1EDDA 4MIKA 4BMZA 1OXBB 1XK7A 4ROSA 4FQ5A 4R71A 1UXOA 1AVTA 1XEFA 4KXWA 4QDJA 2GF2A 3CLSD 5FTNA 1L8OA 1OAAA 3NBMA 4IIFA 1YUMA 2P9CA 1C9JA 2V0CA 3FVVA 2P9HA 4C5AA 2X3UA 5BUCA 3V4VB 4QELA 5KNCD 1JPNA 1XZCA 4GZ6A 2VZLA 5AJUA 1T0UA 3KTDA 1QZXA 4RM2A 4BP1A 2Q27A 2VAVA 4IMPA 2PFSA 3T7KA 3VHQA 1Y5MA 4B6QA 1HUQA 2WU0A 2I5PO 2D2XA 3JQPA 4JEMA 3VJLA 1MB0A 4R2JA 4CT4B 1Z63A 1IL0A 3ITDA 4PSVA 3UMMA 2FWRA 1POXA 4IINA 2J9XB 3UAVA 3NWPA 1ZUHA 2OG2A 1JMYA 3FBGA 3RUHA 2A5LA 4FVTA 1SXJD 2XBMA 2J5QA 5L3SA 4TRRA 1O6CA 3W9UA 2GA8A 4CV1A 2W22A 1ORVA 4C7XA 5LQRA 5EIXA 5EZ5A 4X92A 1IZ9A 2O7SA 1HXHA 2F4NA 1G66A 3IHWA 4OYHA 3ZV3A 4WN3A 3HH8A 4PZ0A 1QJ4A 3PL5A 1T10A 2GDZA 3TCNA 2QRNA 5HP4A 4Z86A 5LQSA 1HYGA 1FMJA 1LY1A 1Q0RA 1RNLA 1MO2A 2YCBA 3KOWA 4TSKA 4LBWA 4ARBA 5B7NA 4DEYA 5IEJA 4OJTA 1S0UA 3SHWA 1G0NA 2F2TA 3M33A 2VJMB 2RHWA 3RNOA 3D3QA 3ABQB 1PJTA 3M6AA 4XSVA 4B6SA 3THOA 2HJHA 3PT9A 4C7MA 5DTRA 3OUTA 3E9CA 4MR9B 4P82A 1A9PA 3ZGLA 2BF4A 4DAEA 2ZTHA 4Y2XA 4K0RA 4HGZA 4FEGA 4YI5A 1EFRD 1XTTA 5KINB 2YWRA 2OLJA 3L40A 4FXPA 1QYDA 1HZJA 2R5WA 2PAAA 3BFVA 4GP7A 4H7EA 2FEMA 4R1NA 5D1NA 3R75A 1EXDA 1CEEA 1E2FA 3NWOA 3FNBA 5H68A 3A06A 3JQ6A 3LK7A 2HFJA 3JYNA 1K97A 2FSGA 2R7AA 3RC1A 3WQQA 3R9WA 4MW4A 4N7JA 1QTNA 2B1RA 4HEQA 4RIFA 5GONF 2FXIA 1PO7A 3I0MA 1RYDA 1CSEE 4XFKA 5IUKC 3H1GA 4U9IS 1PJ2A 1EBFA 1VYHA 2DHRA 1X7GA 4GP6A 4NDNE 3DV9A 1UINA 4RABA 2IEZA 1EVQA 2EJVA 3T1QA 4AJPA 1ISFA 1QUFA 2FLVA 3ZW7A 1AKTA 4N12A 2V3WA 3U7QB 4NE9A 3HU1A 5J4HA 2GJ8A 3PBKA 1FJHA 3ELDA 1P0IA 3I9MA 2CWDA 5B4TA 4NH4A 2WIJA 5LLTA 3ADDA 2ZYHA 4J7CA 4TRNA 3GDWA 1ULBA 1CYDA 3W6PA 1ECGA 4B33A 1LNZA 5B30A 2JD1A 4K40A 1P5RA 3RQSA 3A7EA 3AFMA 1T1EA 1D03A 3MERA 3PD7A 4MCHA 2IPLA 3IBFA 1HDYA 1Y82A 4EB6A 5DNDA 1TMKA 1RFGE 4IXWA 3F6YA 3CG4A 3F7MA 3T54A 1B6RA 3HABA 5IBCA 1P5ZB 2VCYA 2E89A 1F06A 2KBEA 3FWPA 1KWKA 3ETLA 2VHTA 3TUZC 3O75A 2YIMA 1MO3A 1U63A 1QANA 1P4RA 1GOTA 3E22A 4ARIA 1PU2A 4WVFA 2Y9MB 1UJ2A 2SNIE 4MGEA 4PYQA 3DD1A 4F9GA 1KP9A 3IHKA 5BOSB 4CRWB 2WU8A 1UKAA 4MITA 4XYEA 5LP6F 1U0HC 2FFQA 3QIVA 3ETGA 4UM7A 4XSGA 1URPA 5FOQA 1ZYUA 3DEKA 4DLKA 1RRKA 2ZAIA 5BSUA 3EZLA 1QS0B 2K7ZA 3BERA 1RAGA 5BVHA 1EEHA 1E2LA 3R5FA 5KVSA 4YRDA 2YNMD 1Z39A 2AG0A 1X14A 2ZSAA 3DVQX 3NIWA 2YXNA 3VSAA 3VGPA 2N0SA 2BSXA 4K9NA 2GFIA 2FK7A 4KCGA 3LTNC 3RC8A 1BW9B 4ZT6A 1AUVA 2DPXA 1XDWA 1Z6YA 4LAFA 3HP1A 4PLCA 5IDXA 4MYUA 1CVRA 2FNAA 2XWJI 2GBIA 3GYBA 3B78A 3AUTA 4KDFA 3KQHA 3FCCA 1J90A 1QFSA 5DM2A 2I3AA 4ZEMA 1GPUA 3VNSA 4WBXC 2VKTA 2DPGA 4J4TA 5BN1A 3TOZA 1QIGA 5AJTA 3UPUA 1QDLB 4DIBA 1FFXB 4PXYA 4X65B 4MRVA 1P19A 1FMTA 2BGTA 4NAUA 1DGQA 3CT6A 4K28A 4JJAA 3TTYA 4NNPA 2C0CA