5FYLE

Crystal structure at 3.7 a resolution of fully glycosylated hiv-1 clade a bg505 sosip.664 prefusion env trimer in complex with broadly neutralizing antibodies pgt122 and 35o22
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
213
structure length
213
Chain Sequence
b'SVLTQSASVSGSLGQSVTISCTGPNSVCCSHKSISWYQWPPGRAPTLIIYEDNERAPGISPRFSGYKSYWSAYLTISDLRPEDETTYYCCSYTHNSGCVFGTGTKVSVLGQSKANPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BG505 GP120 ENV ECTODOMAIN
publication title Trimeric HIV-1-Env Structures Define Glycan Shields from Clades A, B and G
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 31
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2016-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fylE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fylE02
3O2WL 1N64H 3O6ML 1ETZB 2R1XB 4L3AA 4P3DB 4YBLC 5TGBB 4YNYB 3F7VA 3MLSL 5CJQL 3RRQA 4FZEH 4U7MA 4UILL 4P46B 4MAUL 4DZ8B 3VXQA 2YC1A 1YEEL 1XCQB 3U0WL 1DEEA 1HKLH 1OQXA 3MLTA 5GGSY 5D7LE 1LE5B 1UCBL 4XAWL 4JM2C 3KR3H 5EFIA 4XZUA 3GSOB 3FRUB 3ARDC 4CN1A 2PN5A 1TZHA 2D31B 2C9AA 4CDHA 3RGVD 2Y9RT 2XZAL 3P9MB 5L9DL 3WFCH 5EDXA 1BD2B 3C5ZA 4GH7B 5ILTL 5J4MA 2WNGA 4S1SL 2L7JA 1OAZL 2FD6H 5E8NA 3BPCB 4NQVB 5DK0B 3EHBC 3U4EA 4ODHH 3IYLW 1NJ9B 5C0IB 5DHYA 2XOTA 2Q7YB 5I19L 2VR9A 3V6ZB 4NKOA 1MHEB 4O5LL 2IH3B 4AZ8A 2ITDB 4PLKC 2KQMA 1XF4B 2BSTA 1TZIA 3AAZB 1A6VH 5DO2D 2AEPH 3RWJB 3U36A 2PTVA 5HYIA 3LKOB 1DBJH 1NGZA 1IVLA 5B22A 5IB3A 1W72H 5F7WC 4U6VH 3TV3H 3WS3A 4E0RA 1EFXA 1IGJB 3VRJA 2VMFA 3N1GC 3T77B 4FQJH 2WMPA 1ZHBB 4FZ8L 5JORA 5EUKB 4OGAD 3I50H 5J11C 4KROB 3SDYH 1L6ZA 5EUOE 1NANI 4GG8B 1A6AA 3W9DB 4DWHA 4YXLH 5E8DH 1LP9F 2R2HB 2F54A 1H3GA 5INCA 4NHCL 1FQ9C 1KXTB 1DQMH 4Y1AE 3T4YB 3QIBD 2QSVA 1D5MA 4U1GB 3QXVA 4RRPA 2J3SA 4YWGH 2N7BA 2R15A 5JW4R 4G5ZL 5C92A 4JG1H 4MB4A 4D0CA 4EN3C 3T0XA 4DW2L 1KPUB 4PJXE 4JO4L 4NQXA 5ADOH 4ODBD 12E8L 1V7MH 3SJVE 2ADGB 2OM5A 3MFFB 3HMXL 4MNGA 3ZSSA 4EUPB 4HIEA 3S3SA 1EX0A 2M1KA 3VH8G 5A2IH 3ULVC 1EEQA 2GY5A 5F6IC 1OD9A 1SJHA 3DX6B 5GIRA 3CZFA 4M43L 4L9LC 5TDPA 1NC4D 3LKPB 3GKWL 5DMIL 3L7EA 1FNLA 5F7EH 5I8EB 4Q9QH 1HSAA 2CDEA 4YK4C 3EOAB 3RFZC 2A77H 4HJ0C 1XGPB 4FP8L 4Z7WB 2WUCL 3E8UL 3UTTD 3UCRA 3RU8L 3DPBA 2IBGA 3QG7H 5I1HL 3QUXB 4RFOH 3BRDA 4LIQH 2VQTA 4HGKC 1OAKH 1ZLWK 2YPVH 2VLMD 1JYVA 1PKQB 4M1DH 2AV7A 3HUJE 5ESQA 3C08H 2FWOB 2I9TA 1HZHH 4KJPD 4E41E 2DIBA 1A6WL 1MCSA 3NPSB 1X6NA 2NY3D 4MJIE 3O4OB 2A6IB 3RI5K 3VXPB 2GTWA 3B3IB 4JPVH 3ARFC 1AXSA 3JTSA 5TDNB 4JR9L 4MXQD 3MSPA 1XH3A 3MLYL 4M93B 4XVUC 2P5WB 1IAIM 4MNQB 2E6JA 2R56L 3BH9A 3QJFA 4TUOA 4X98B 4G8GD 5CCKL 3WIIH 3FQTB 3W39A 4NWUH 3MRJB 3VMNA 4PJ9B 1R3IL 3RWFB 1TQCC 1MUJB 4W6YB 3HE7C 2AQ2A 2DM4A 1OGAA 1KTRL 5JA8B 2Y1VA 4FQLH 3VFGL 1XGQA 5D93C 5GJTL 2IPKB 4K94L 4HPOL 2P8MB 3SDXF 4DZBA 2JB6A 4KXZH 2FIKA 2H6PA 4Y4FC 3QEGL 5KZCD 3OB0H 1YMMB 1CF8H 3DV6A 1JJUA 3G6JA 4G8IA 1IAMA 1FSKC 4XRCB 4H0GA 5DJZA 5HVGB 1O0VA 3O6FD 2GJZA 2IAMA 5DFVD 4F8QA 1JWSB 3G9AB 2D7NA 4HC1H 3RNKA 4LVOB 5F7FA 4OCMC 3REWA 3OZ9H 4CVXA 2B7DT 4OD2B 1GL4B 5KJRL 3HAEA 1OVZA 4TQEH 1JGUL 5JOEA 3WXWL 4OCRL 1FYTA 3KXFD 4LLUB 3LEVH 4QOKB 1HN1A 3PL6A 3S88L 4EQ3A 5AZ2L 4OKDA 3E2HC 2EYSB 1E4WH 4H8WH 4NNYB 4X7TB 4MDJA 1R5WA 2PTTB 4JE4B 2AK4E 1MLBB 4NZJA 2P5EE 2O5XL 3ZKMD 3S36X 4JVWA 1A4KB 3K8LA 4DKFH 3MGOA 3QXDA 5CEZL 4L4VD 1QO3A 4M61A 5H94A 3SGEH 4Z7VB 1RU9H 2FB4L 2A6DB 3T0EA 4G6KH 5C0AA 4HT1H 4HKXA 2IC2A 3P4NB 4KAQL 1QA9A 5CJOL 1U8KA 1JYWA 3CXHJ 1KJ2L 3SE8H 3QUZC 1BFVH 3DVGB 4QWWD 3VXTA 4GBXD 5J6HA 4JFHE 4K7PX 1Q38A 1IAOA 5EPMB 3SGDH 3MA9L 3I3BA 4PJ5B 5D7JC 4OM0L 1AC0A 4F9PA 5KVFH 2FJHA 2WBJB 4LAJH 4XVTH 4YDIH 5DJXB 1CTNA 1FNEB 4F15B 4LKCB 1I7TA 4XVSL 3C09B 1RFDH 1X5GA 3WMSA 4Q58C 4QF1B 1D7FA 4RGNC 4J3TA 3BP5B 3C6SA 3LIZL 1JZ6A 1HIML 2BNRA 3AS0A 3HAEH 3MV9D 4LHUB 1R5VA 3OR6A 3HE6A 1ITCA 1KJ2B 2MQ0A 5I6XC 3QDJD 2C4FU 1ACYH 4FQ2H 1EHXA 5I1GL 3D18A 4NUJB 1OP5K 1KCRL 3BISA 1N4XH 1WC7B 1DUZB 1Y18A 1RJLB 4PJBA 2Z8RA 1F3DH 5EOQH 1T22B 3VFSA 4F7CA 1JRHH 5F7KC 3CSPA 2ITCB 1EEYA 4LCWE 5BZDA 4JQXA 2MCPH 2NY1B 2GJ6B 5T1KA 4XC3H 4M9PA 1QBBA 3ARBD 2DQEL 4JHAL 1T5XB 4NQEE 3RWCB 1F4YL 1QLRA 3QCTL 3CVIH 4PREA 4WEBL 3U48A 5DTFB 1X7QA 4JREB 4NQUA 1EJOH 3MRRB 2BNQE 3U7WL 2NW3B 4JVPA 2A1WL 3O8XB 2VH5H 3KS0H 4Q97A 1MI5D 1SY6A 3GIVA 4H8WC 1X6LA 2AJZB 4G8EB 3EFDH 1NFDE 5IK3A 3DX7B 4ZXBC 2FHFA 4XMPH 3WJJC 1IAII 2VC2H 2IPUK 1S7XA 4YHMH 4F7TA 2WIIB 3D85B 3UTZA 3K2UH 1RUKL 1DFBL 3DSFH 5DS8B 2YOCA 1JF6A 5E2TH 3M45A 5DI8A 3T08A 5B39G 3V8CA 1BLNA 1KN2L 4OLWH 4F3FB 3IGAA 3UTSD 1A5FH 4LU5L 4BZ1L 1A9BA 4IHOA 3GM8A 4I2XE 3FFCA 3MUGB 1YYLL 1IEBB 4JRWA 2JIXB 3LMJL 4G43B 3GJEA 2UY7A 5FUCC 3P30H 3O41B 5FCUH 2DLGA 4I48B 3EGSB 4QO1A 4W70A 3GB7A 4WI3A 1FAIH 3BESR 1C12B 1AIFA 1FL3B 4M6NH 5IHZA 3DYMA 3BUTA 3LS5L 3T09A 4KK9D 1P4IL 1H3WM 2D7PA 1UM6H 4UINL 2NZ9C 4NZTH 1TJGH 4ODVL 4JPKH 4LHJB 5F9WB 5JHDD 2C3GA 4PTUB 3EUUA 1F00I 5IMOB 5IGXH 1A3LH 5ANMA 3ROOB 1QYGL 5EU6D 3L5WA 4OI8A 1SY6H 4K2UL 5KSBE 4EJ1C 3FT2A 1I1AC 2IQAA 3JWDH 3BRFA 4TSBH 4U6YA 3SDAD 1BHGA 5DLML 4TPRL 5BO1L 2CK2A 5IBTL 2NXZC 4S1QH 4J6RL 1SBSH 3NZ8A 3UPRA 1FNSH 2AI0H 4KKAC 1NAMA 1CFVH 5GS1A 5FGCE 1JPST 1YEKH 1MHCB 4K23H 5FKAB 3NMEA 4QXGH 4DOHB 3L3OB 4NRZB 3VWJA 4A2MA 4NNPH 2V5TA 4JO3H 3DYPA 4R4FH 4UNVA 2VXVL 1EGJA 2CIKB 4GW1A 3TN0D 4YHLH 1U8NB 3D0VA 5D6DA 4Y2DA 5TF0A 1FH5L 4QY8B 3J8F7 3LV3A 5HHXL 3D0LB 3W0WB 1NBQA 1HXMA 1Q9LA 3L3IA 4KKLD 3U0TA 3S4SB 1YN7B 4D94A 1V5JA 4PRBB 5J57B 3H9SE 3LKSB 1P9MC 3TIDA 4HS3B 2RB8A 1MRCH 1FORH 1YC7A 2Y07L 4DUXA 1H3VA 1NFDF 2ARJB 4P23D 4NKQB 5DZNA 2NY6C 3AM8A 1NUDA 3WIFA 2BY3A 3H3BC 4M7KL 3EYVB 5JO5B 2GCYA 5DSCA 1MFBH 1LO5B 3LB6D 2C1PB 1EUUA 3IKCB 2CXKA 2YUXA 4YIQA 4J4PA 4TNVF 3HB3D 4PJHA 5IMKB 3MRLB 3QEHA 5F3BB 2YSSB 2P8LA 1MEXL 5IF0B 3QI9B 2XWJA 5TDOB 5DJ0B 4GOSA 2OQJB 4WFGE 1B3JA 3BDYH 3RUGB 2HMID 2XA3A 4PGBA 4UV4L 4XC1L 5HPOA 4GAFB 4IEFB 5ID1A 5KW9H 5GS0D 2VDOL 2HAZA 5K33A 3TZVC 1IBGH 4M5ZH 2Y36H 4AENB 1JHTB 2QQKL 1XGRA 4L3EB 3MRCB 1F97A 2VZ1A 2BOCA 2IADB 3UZEA 3DHJA 3WFHA 2QQNH 2XXMB 1M6OB 3EJZD 5EU7E 2CK0H 3SBWA 1UXWA 1DBML 3DUUA 5KVGL 3MRQB 3CLFH 1MIEH 3QQ3B 5C07E 4V1DD 3LN5A 4QLRA 4OZHF 4TUKL 5HHOD 5DVNA 5EWIL 5FEBA 5DWUH 4ZQKA 3A67H 4BQ9A 1RZ7H 4F2MB 1LP9B 3TPUB 4FFZL 3QNXB 3VWKD 3JWDC 3QFJB 2E9WA 3QUML 3GBNL 1PKQE 2EE3A 4K7PY 1FDLH 3MGTB 5FM5M 2H26A 4WRLA 3KPRB 4YPGA 3PHOB 2CIIB 3QT2A 4Z7UE 4ZNEA 4K07A 3VFOA 2H41A 1A4JB 5TF1L 5F7DB 5BXFB 3QO1B 2P24B 4Z9KB 1Q9WB 3HI5L 2I24N 2P5WE 5F44A 5IG7A 4MS8C 3FONB 5DD1H 1V3MA 3V79C 4KI5F 3NGBB 5E8PA 4ZFGH 4JRYA 4GRLC 4X0KB 3CGTA 4PJGA 1DL7H 4FFWD 3FQUB 3VG9B 4YAQA 3CSGA 3QUMB 1I7RA 5IB4A 4BFGA 3X14A 2BC4B 2HFFA 4HCRH 2YWYA 2Y7QA 1HI6A 3KPSB 1I9JH 4XVJH 1I7UB 4GG6A 1MRDL 3FQWA 1YMME 5IVZA 3QNZB 1YEJL 4NN7B 1CIUA 1T0MA 1ZT7B 3LZFL 1AXTH 3KLAB 1P1ZA 1RV6X 1IGFL 4GRMA 5F9DC 5FO7B 4PP2B 3QIBA 4HWEH 2AK1L 3RAJL 5F9JB 5I71B 2OZ4H 3V4UL 4O4YL 4FQXD 8CGTA 1UGNA 4QGTA 3PV6A 4R4BB 4P2OA 1DANT 1QPXA 1RJCA 5ISZA 3JZ7A 4RISH 4EVNA 3CFBB 1U8HA 2I5YL 4IMLA 4PRAA 2NX5A 3GI9H 3OGOE 4IRJA 4LLQB 4NUGL 4KVCH 1F2XK 1S9XA 3C8DA 3MCKA 4PRPA 1GVIA 5AG9A 3LHPH 5GQBA 4P2RD 3ZTNL 1JPSL 3DXAB 5DYOA 1HH6B 1X9QA 4LNRB 3TBVB 5IMLA 1MAKA 3VI3E 1TJHL 2D9CA 1HHHA 1D5BB 4U1SB 3QHZL 3F12A 1YECL 4GSDL 1OAYH 5CZXD 5E00A 2ZCLL 5DJ6A 3W82A 3S34L 5I74C 2GSIA 2OR9L 4Y2DC 1T2XA 3FO1A 1S7SB 1TVDA 4S1RH 3NAAH 4ONHA 4R2GB 3WYRA 2G60H 3VFPB 1GGCL 3BEVB 4DTGL 5CMAA 1RMFL 1VESA 3BQUB 1LEGB 2JELL 1NDGA 5LWYL 4WI5A 4OCSL 5CIPB 5KOVC 4EXKA 1ED3A 3VXME 3OB8A 3PGFL 3GJFB 4KJQD 1UZ6E 4OAWB 3H0TB 4HH9A 1E4XI 3AM8C 2JK5A 4OGXH 3FZUC 3OR7B 3PDGA 4Y4HA 4XNYL 5TH2A 3BPNC 3DRQB 3U46A 3WHXA 1R24A 3VRIA 3TLRA 1KB9K 3CAFA 4H25A 5ENWA 5C8JB 3QXUA 2X4UB 4CJ0A 4ZDHB 3QFDA 3RX7A 4Z7UF 4P59H 2W60B 2X4PA 2FJGA 1T04A 1QVOA 2WQRA 5E2VL 5TE4L 4G8GA 3U2SA 1LK2B 4X6DE 4EUPG 3CDGB 1NMBL 1MJUH 4MMZC 1CXKA 3L7FB 3OHXA 4KTEH 4OV5B 3VWKC 1QBML 4XPGL 4DGIL 5GS2D 4UTAL 1JN6A 1NPUA 3FB7A 5I1LB 5MENB 3U9PH 1U9KA 4U1IA 3GSWB 3JBG7 5FYKD 2NY2D 4WUUD 2ARWA 1RIHL 5BZWA 4F7EB 2YZ1A 4LMQE 5E95B 5C0DB 5BS0B 1QG3A 4LL9A 5CP7A 1NC2B 1KPVB 5IEHB 2ATKA 1I85A 2PXYD 1KXQE 1W0WA 3H2WA 3O2DA 5MEPA 4TNVK 2EC9U 3AREB 5C08D 1J12A 2W07A 3DX8A 4ZTPL 1BQLH 2GI7A 5DHVA 3O4LB 2NPLX 4G9DB 2AJ3B 2VO5A 3ELAT 1X3DA 3JUZA 3RGVC 4C56E 1BGXH 1L7TL 3L3HB 2WQ8A 2E7LC 3NN8B 1CT8A 4IS6A 2AXFB 4HFWA 3V9FA 4MZ2A 3KG5A 1A6TB 1NAKH 4P4RA 4JRXA 5EIQA 1A1MA 3VXUB 3IFNL 1DQQB 5DO2C 5SX5H 4Y8AA 1WEJH 1QQDB 3RBGA 4OZIB 2ZUQB 3C6LD 4OCLC 4J1UB 1MHPH 1XT5A 4KUCF 4RZCB 5GRVK 3GMNB 4PRNB 2UYLB 2VABB 1YA5A 1BQHA 5T1LA 5D2LF 5EU3A 1DDHA 1NLDL 4OGAC 1WAAA 35C8L 3ZZ1A 2G5BA 2A74A 2QADB 4XCNB 1AJ7L 5DQJA 4XB8A 1YEDB 2B8OT 1L7IL 2X7LA 4N0UB 2VN4A 2GK0B 1TMCB 2I9LA 3MV01 4YHPA 3QIBC 5JNYB 4XGZA 3NIGE 1FIGH 1KIRA 1A7RH 2X4SB 4KZDH 1CLOL 4CVZB 4P2OC 1UWGL 1ND0B 5EN2A 3VGEA 4NZRH 4MJ6B 1N5AA 2DM3A 5ALCH 3QDJA 4X6DF 4ZSOA 5CKAA 1MJ8L 1HEZA 3BO8A 1KB5L 3R06B 5I1IH 5DR5H 1J0YA 4GKSA 4NOFA 5I1EL 1BD2D 2QLVB 3LN9A 4K9EH 4IOSD 1NBVH 5EU5A 5C09A 4PJDF 2DB8A 2OLDA 3QIUB 4GMSH 1S9VB 3H6JA 4HS6B 3ZO0A 2EYTA 5C9JA 3PDOB 1JTOA 4LPTA 3D39B 1MCLA 4KMLB 1A3QA 1LE9B 3O9WB 3WNPA 4R97C 1ZXQA 1F6AA 1MFEH 2X1WL 2NNAA 3VH8A 2IANA 3MACH 3O11B 3WNLA 1OAXH 2F5BL 3MV8A 1AD9B 4G6JL 4H0IA 1IFHL 4CBPA 3OMZA 4OUOA 1I8LA 2D0FA 2VSCA 4ALAH 1AP2A 4IMKA 4XMLH 4MLIA 3GMMA 5IV2B 3GMOA 3VFVA 2ZJSH 5DUPL 2B4CL 2DLFH 4OJFH 3Q6FB 4I0PB 1SEQL 3WHE1 3I9GL 5IMMB 1EHNA 4L29A 2JJTC 32C2A 1ZLSL 4YQXL 4KJPC 5DRXB 5KSVB 3BGAA 4JDZA 4LVHB 2NY3C 1AGFB 1IZJA 3NABL 4LHUG 4QRPB 4WHYH 4MA3A 4YE4H 3W5NA 3BP4B 4G6FB 4MXQC 3MNZB 4HBCH 3AMKA 3VI4E 1MCRA 1QSFA 4DKDC 1NCAL 3HCVA 4C58B 5M7QA 3GIZH 4KV5E 5E08L 4LSRL 5D5MF 2XQYG 3DUHA 5D70H 1MY7A 3JV6B 3IS1X 2X4OB 4NO2A 4D0BB 4M48H 1AY1L 1LO0H 2OL3H 4HV8B 3ZHDA 3UTSA 3PWVA 1JYXA 1OGTB 1U95A 4WU7B 5E2JA 4HQQL 1KJMB 4R96A 4G42B 5D7IB 3K0WA 3KVQA 4KKBD 3RUGE 1FN4B 3CVHL 3IXAA 3OKOA 4M6ML 1RZGB 3DRTB 4X7FC 2AJXH 1I85C 1W0VA 2HJKB 4MLSA 2YD5A 1RIVH 1EEZA 2OTUB 1GIGL 2MNUA 1D6VH 3O6FC 5DFVC 5J7CC 2PTUA 4D9RD 2IH1A 1AI1H 3OKNA 2D7TL 4S10A 4JO1H 5D7LA 5B3JF 1DJSA 3VG0H 5IIEA 3D3VD 1J0KA 1HCVA 4E5XB 3QUXD 2C26A 1YNLH 3L5XH 1HE7A 1HQ4B 1VFBA 5D2NC 5K9JL 3H9ZA 1ORQA 4HKBB 4JAMB 4IOIB 4MX7B 5EU4A 1CD1A 3UPCA 1NCBH 2AJUL 3CVHB 2WWMD 3M1BB 3L95B 5AUMB 3IDJB 3WKNA 1NGWB 4K9EC 1LEKA 4XBGA 4JPWL 2ZWLT 4PUBL 4JY4A 6FABL 2FX8H 2DI9A 4BZ2L 4O2EA 2CLVA 4ZFZA 2V2XB 3QFJE 5J3HD 1NBZB 4WU5B 5I15H 3NA4A 3ZKMC 3V6OC 3RIFK 3WN5A 4C4KO 1YPZF 1NFIA 3U4BL 1KTDB 4NN6C 1ZEAL 2BSRA 15C8H 2GY7B 2N1KA 1CGUA 4MNQD 5EC1B 1OM3L 3BMVA 3O2VH 1HOCB 5GRVL 2GTZB 4PJ9D 4O9HH 5HGBA 1CLYL 3L1OH 6CGTA 1N8ZB 2XXCB 1NEZG 3I85A 5L6YL 1T7ZA 4QWWC 4GBXC 2VDLL 4K3DH 1TETL 1JGLL 4Y4KA 3LKQB 1FGNH 2APTA 2BOBB 3QJHA 4JFDE 1C5BL 1K3ZA 2QSCH 5FYKU 5DJCA 1PX4A 1H3XA 4KK6D 1H15B 3LQMA 2JCCF 1ZHKA 5SWSB 5EUOA 4NM8H 3PWLA 4Y1AA 1MIML 2X4RA 3JTTB 3TWCH 3B9EA 3NTCL 3OKDA 4YBLB 1BVKB 2FL5B 5KOMC 3JVGA 3VI4F 4PJXA 2CMRL 4U3HA 4KMTL 1T2JA 2ZOKB 4U3CA 2ATPB 4KV5F 5K9QG 1HKFA 3MLVH 4MGXA 1GAFL 2NXYD 5AEAA 3SJVA 3WLWD 4DAGL 5IB1B 4IRSB 3HNSH 4QOKD 1QP1A 2J4WL 4J7RA 4AJ0A 1FO0A 1NQBA 4L8DA 1UJ3B 3KPQA 3JV0A 4LSSH 3F8UB 1CZ8H 1S7TA 1WSST 2AXHA 3D1MC 4JB9L 3ROLA 2FR4B 1X4YA 3RA7H 2EH8L 2X1XR 5FO8A 4LRNL 1KCVL 4C57C 1JWUB 1XCTA 2H8PA 4R0LA 1YDPB 3OJDB 5HHNB 1CDYA 3ARBC 3J7HA 3S35L 4PGDB 4N8CL 1JNJA 5L2JB 1B9ZA 2ZCHH 1NFKA 3D48R 3GI8H 2VZUA 4NO3B 3TYFB 1A0QH 1QEWB 5C0EB 4G9FD 3PF2A 3SO5A 5JOFB 2FBOJ 2CH8A 3GBMH 2YD2A 4N0YH 3HUJA 4PJ5D 4ZUVA 1QFWH 4RMTA 2Y25A 1U58A 4E41A 1N7MH 3OPZH 3ORJA 3MRFB 4MD5B 4MJIA 5CILH 4BKLA 3CUPB 4PRID 4HX1A 2NLJB 3QIWA 3HZKA 4NBXB 2UZYB 4P5TD 5FUZL 3DECA 3OGCA 1I3RA 2BVYA 4HJJH 5IVXE 3ARSA 5JXED 4GAYA 2ADJA 3DV4A 2J8UF 5J11B 3UYOD 3GSXB 1N64L 4GUPB 4R26H 2P46B 4JANA 3ULVL 4WW1B 5HDBF 1CBVH 1AGEA 5CJ8A 1GH7A 4JDVB 4AEIL 4XP4L 4F57H 4FZEL 4OFIA 1FVCB 4RGOH 3RWGA 4OFVA 4Y5XB 2VWEE 1U8IA 1KBGH 1OD7A 5DUBB 5GS0H 5B39A 5AYQA 2PKDA 3ARXA 3RPKA 2AGJH 2NW2A 1ACZA 5HYJA 1R3LB 5MENE 2EIDA 1U8LB 1DQDL 2PR4H 1Q1JH 4Q2ZB 3VXSD 3KR3L 3M8OL 4I5BB 4O51A 1BZ7B 4XAKE 1RZ8B 4KK9C 4L8SA 1MRFL 3C60B 4Y5YA 5FA4B 1GZQB 4XH2A 1VERA 4JHZA 4UDTA 4BH8B 3ZE2E 5J1AA 2AW2A 5FKPB 3LRHA 4PBXA 2ERJC 3P4OB 4WEMB 4HWBA 1NCNA 1F3JA 1E6JL 2NTFB 3VFTA 3ZT7A 2PYFB 3IXTB 3NCEB 3IFLH 2VQ1B 5GGRB 2FLRT 5EULV 2XFXB 1JHKL 3IETA 1T89C 3O8XD 3OAYH 1E4KA 1OTTD 4JO2H 4E42A 3RNQB 1A6VL 2Y4SA 4HEPG 2AK4A 1F45A 1RUAL 1LNUB 1KF9B 3QEQB 5HSFA 4Z95H 1IKFH 4NGHH 2OBGA 4NBZB 1W72L 4M4PA 1UB5B 1QD0A 1TTFA 1HSBB 1MCPL 3SN6N 2OP4H 3PHQB 3D85D 4XNUH 5HHQA 1HHJA 4AH2A 4FA8A 1A7PL 5BCAA 5I30H 2O5ZH 4D9QE 1HHIB 1NH6A 4YLQT 4N8PA 4N8VB 4I3RL 5IM7B 3KYOB 3TN0C 3UC0H 1N5YL 3ARFB 4LLYA 4OZIE 1D5XB 1N0XH 3ARTA 4YXLL 1OSZA 3CH1A 2JIXD 4KKLC 1DQML 5DJDB 4DUWA 3CDYA 2DQGL 5JUEL 1WF5A 4U6HB 4YWGL 4J3OC 3HE7B 3U6RB 1S9WB 1KC5L 5CWSB 1G0XA 1MJJA 4P23C 5ADOL 1KLUA 1JV5B 3SHSA 2Y06L 4G6ML 3NACH 3LB6C 3I3DA 4HWBH 3TCLA 3ZE0E 4Y4FB 1YEGH 3KYNA 5HHME 3QH3A 1VSCA 3HB3C 4P9HH 4QRRB 1G7HA 1DP0A 4UB0H 3FKUS 4HIHA 3KPPB 2VISA 1TPXC 2FO4B 2BK8A 4P99A 4X9HA 4XNXL 4OUUA 4X5WB 2W38A 3FOMA 2HMIC 1SYVB 5IR1A 5KVMC 4JFZH 1I3VA 1J0IA 4OIBA 5EO9B 3BDBA 4EI5B 4Z0BH 5GS0C 2A77L 4LCUB 4OBRA 3QCVL 4WI4A 1DZBA 3ULUF 4LCWA 5ITFA 2G9HA 4ELKA 1A3RH 1NCCH 3QG7L 1DR9A 2C3HA 1QRKA 4RFOL 2HVJB 3FB6A 4PPTA 5FA3B 3H9HA 1HWGB 4H0HB 2YPVL 7FABH 1IAKB 3EJZC 3MA7B 4ZUSB 1LMKA 4NQEA 5DC9B 3OG6B 2VIRA 4DJMA 1P2CA 3ZE2F 4P5MA 2XN9E 1DVFB 1HHKB 1A7NH 1RULL 3QXAA 4FXKB 1E0OB 4X6FA 3OBAA 5LQBL 4WJ5A 3W0WD 1GYAA 2CUMA 2XRAH 1BM3H 1VEMA 1JF1B 4KJYA 5EA0H 2I07A 3WIIL 4NWUL 3S97C 1EAJA 2CRYA 5AWNH 1S7RB 1JK8A 1T21B 1QRNE 4BQBA 1J8KA 4FQLL 5D7JB 4S1DD 4QRPE 2BERA 2YUWA 4ZD3L 3MRMB 1MQKH 1V3LA 3G6AA 5GGSB 4PLNC 5D96C 5I1JH 1CE6B 4AT6B 5JZ7D 3CC5A 4OB5L 4L4TE 5EOCJ 5LCVH 4JFYB 2F53B 2QEJA 5MP6L 3ECBB 3LKNA 4C59B 5L8KB 2ZUUA 4I2XA 3T2NL 1CF8L 4AM0A 5GS2H 3IFPA 4D8PB 5H35A 1LDPL 2W0FB 2VE6A 5DA4A 4FFWC 4HUVB 2RCSH 4JZJA 2R1YA 2AEQL 4Y19B 2OCFD 4YGVB 5FYKH 3ZYZA 2XWTB 1NGXB 1WWAX 5I6XB 4NO5B 1UYWL 1W8OA 5DRNB 5TGBA 1GGIH 3RPIB 2AERT 2DWEB 3CFDA 2FX7H 5D7IE 1JZ2A 2DQDH 4P46A 4A2LA 4L3ED 5ICYB 3GGWA 4TQEL 4DZ8A 1CG9B 1VHPA 1KIUA 4UIMB 1JI1A 1FNGB 1JVKA 2KBGA 2AKRB 1J10A 1J1OH 3ZE0F 3FO0L 4TVSa 3UJTL 2IQ9H 3WD5H 3MPCA 2EDQA 4FQXC 1LE5A 3ILPA 5KSBA 2ZZUT 5FV2A 3SE3C 4PJCF 3VW3H 4R6UA 2E7MA 4ZODA 4DKFL 2D31A 3EO9H 3ZDXE 5FYLE 1IGYB 5IJKA 3TBTB 1RU9L 1Q9KB 4HT1L 1BD2A 2AXGB 5IHLB 2XZCH 4LDEB 3BPCA 3CSYA 1U93B 4GQ9H 1CFTB 1FZKB 4PGCB 4PLOB 3KPRD 5MHSE 5E1AA 5KVDH 5LGJB 2Q7YA 1BFVL 2DIAA 5CZXC 1MHEA 4FTVB 4JY6B 3BPOC 2ITDA 25C8H 1XF4A 1GC1H 4R7DA 5HYFA 2FBJH 5I76B 3A0OA 4RWYL 1VFAB 3LKOA 5D7KE 4UTBL 5JLZB 4XVTL 4HXBH 4CL7A 1WITA 1Y6NR 5CLWA 1G0DA 2UUDH 4IRZL 1GSMA 3H9SA 4HUXA 3T77A 1ZHBA 1KNOB 3FHAA 3AUVA 4KJQC 3ET9F 5EUKA 2VLJB 3KPSD 4QGYA 4NRYB 4JQVC 1SVZA 4MJ5B 4KKCD 1U6AL 4XXCA 4GG8A 4LKXB 3BZ4A 3W9DA 3DROB 3ZKSD 4PD4K 2R2HA 1KB9J 5I1CH 2R69H 5B8CC 3C5JB 5IBLD 3T4YA 4JZNB 1KENH 3RX8A 1X5KA 4P49A 4WV1C 3ZDZF 1OW0C 5DURB 2H2SD 3L3JB 3OKLB 3O2WH 4WO4B 1JRHL 3O6MH 4NIKB 4WW2C 1KPUA 1T1YB 4HLZH 2W9EH 3MLSH 4JKWA 5CJQH 1EDQA 3B2UD 4NFCA 3PGDB 4UILH 4MAUH 2Z9TA 3W9EA 2ADGA 5C6TL 1YPZB 3MREB 1IM9B 2YA0A 3MFFA 3QUYD 1ZSDB 4EUPA 4LSVL 4ZPTA 1FCCA 2NY2C 1ZLVK 1YEEH 5SX4I 1GHFL 3ULSB 4HXAL 4P2QB 1A7QL 3DX6A 4V2BA 3IU4L 3DXAD 2ZG1A 1I1AB 2PXYC 3DBXB 5ERWA 3V0AC 3LKPA 5CZKA 1CDUA 2ZUWA 1RZIA 5I8EA 2GFBB 1DBBL 1I9RL 1XGPA 4JCLA 5C07A 5HGHB 2X44D 2XZAH 1NKRA 2YPKB 3KYKL 5L9DH 4QRSB 4GW5B 2OSLB 3BN9D 1OAZH 5AD0B 3HMXA 5AG8A 4XMPL 1T83A 4BSWB 1PKQA 3M17B 3SKNA 2DYPD 5I19H 2YA2A 3ZDXF 2OR7A 3HG1B 4OZGE 3PABB 4OFYD 5I1DB 5E2TL 1IGTB 1M7DB 1XF3B 3BN3B 4JKKA 4Y8DC 4UIKH 5DMYA 4JHWL 2N4IA 3LSOB 2VTFA 2ESVB 2A6IA 5BRZB 4POUB 1T20B 3LH2L 5IKCB 1BF8A 5TDNA 2DQHL 4GRWB 4WTWA 2P5WA 5EO1B 2GITB 3C6LC 1GC1C 4J8RB 4X98A 5FHBH 1TTUA 3SKUD 3UDWC 3MRJA 2NY6B 3RWFA 4AEHL 4FZ8H 5T3XL 1FAIL 1CWVA 4TUJB 4EUPH 3UAJD 4M6NL 1SYSB 1G9NC 3CX5K 5GGQH 4M3JA 2IPKA 5SWZB 5CGYD 4C55A 2P8MA 1UM6L 5IW6A 1WV7T 1TJGL 5TFSH 1ZE3C 3QNYA 1YMMA 2FGWL 4LK4A 4LPCA 5BS0D 1PEWA 3OJ2C 5IGXL 4LHQB 4G5ZH 3ALXA 4XRCA 1X5ZA 5L88L 1Q0YH 1F11A 1IC4L 3K74B 4DW2H 4JO4H 2B39A 5EBLA 4NCC2 5EZJB 3JWDL 4TSBL 12E8H 2RFXB 4YFDB 2Y6SD 4XPBH 1JWSA 2XKNA 3JV4B 3O4LD 4S1QL 4BQ8A 3GMLB 4OD2A 1MCHA 2MFNA 2P7TB 4B5EA 4N90E 1B6UA 3OF6D 4U1JA 1IGIL 4LLUA 4M43H 5ESVB 5E70A 4NBYB 5EOTB 2EYSA 3GKWH 4NNYA 4UT9L 4N9GA 4NNPL 2XYCA 4X7TA 3P77B 2PTTA 4JO3L 1EV2E 1T2QL 2D7QA 4FP8H 2WUCH 1NCTA 4JM2F 5GGUB 3VXUD 5FF6A 4HKZB 3RU8H 3VXRD 5I1HH 1REIA 1P84K 2M2DA 4RWHA 3NCYS 5JPMA 4Z7VA 5ECJE 1Y0LB 2A6DA 4NQSB 2ICWI 3B8YA 1ONQB 5C0RH 3UJIH 4XCFH 4I18C 4PJFB 3MJ7A 3P4NA 3UP1A 1AO7B 3WLBB 2YHGA 4L1HA 4TNWF 4HWUA 4K3EH 3VXMA 3DVGA 3T8XB 1A6WH 2ZUXA 1ZWIA 4L8BB 5EPMA 2Z31B 4KROC 4EDXB 1CE1L 2QADD 4JGMA 2R2CA 1E6OL 4JR9H 4Y16B 4C4KT 4OZGF 3LEYH 2WBJA 2R56H 5F9AC 4E9LA 4JCMA 4KPHL 5BOZG 1DQTA 2BSSB 1FNEA 3BX7C 2C3XA 4LKCA 2FZ3B 1R3IH 4KUZL 3LN4A 3S3PA 3BDYL 4QF1A 3WDJA 2X2YA 1T0PB 5KW9L 3VFGH 4LHUA 5C0BE 3VFMA 4K94H 4M5ZL 4HPOH 2Y36L 1KJ2A 2XTLA 4HIIB 1C16B 4RMVA 5HYQB 1Q72L 3QEGH 1CL7L 2OYPA 3GBLA 5H37H 1E28A 2P5ED 4I0KA 5D1ZD 1WC7A 1DUZA 5J8OA 4U1MB 4OIIH 1XIWB 2P4AB 1AQDB 1CFQA 2NY5C 1AC6A 4KKBC 3T1WA 4MDIA 1I8MB 2VKXA 3UPAA 4AQ1B 3QIUD 1T22A 5EIIB 5E6IB 1MVFA 3WS6C 4WWKA 4DN3L 2ITCA 4GS7C 3O9WD 5DQ9B 2X6MA 4URTB 5GS3A 2GJ6A 3WFZA 2IGFL 4HWZB 3PWJB 5KJRH 3RWIB 1JGUH 1Z0MA 1R3JA 4OCRH 3TO4A 3QUXC 1DE4B 4HIJA 2J88L 2EE2A 3N0PB 1T5XA 3RWCA 3HC0B 2X89D 3H9YA 4HPYH 3BAEH 1VB9A 2BHYA 1JMZA 4P48A 3GEWB 4HS8L 3E1F1 3SE9L 2A73A 3MRRA 3T3ME 2WWMC 1DQJB 2EIZB 2NW3A 4F7PB 1MLCA 5CEZH 2D9QB 5J3HC 2AJZA 4G8EA 1KJ3L 4ODXB 2FB4H 3Q5OA 3WUZA 1G7JA 2WINB 3DX7A 4X4ZA 4QXTB 1YZZA 2GAZB 4G6FD 3RDTD 4KAQH 5CJOH 2HFEB 3MZGB 1DL7L 2YD7A 1MCEA 1JZ7A 5GZOD 4KRMB 4HW6A 2WIIA 4PJ9C 1UG9A 1SJEB 4NKMA 2KH2B 3BPNB 1LEIB 1X4XA 1F90H 3MA9H 1JGDB 4JFPA 1EMTH 4OM0H 2F53E 4JFFB 4PRHE 3HMWH 4KK6C 2X10A 1B0WA 4RGNE 4G43A 4XVSH 1EHLH 4GLRH 4XP6L 1YEHL 1NEZA 3DIFA 4Y19E 2UWEB 1TVHA 2UV3A 2XY2A 2MCG1 1G9ML 3VWKB 3LIZH 2OZ4L 2WLYA 3EGSA 4BH7B 3O3BA 4Z18A 4M6OL 3LEXB 2DD8L 1FL3A 1MVUB 4N5ED 2DM2A 4RISL 3VD9A 1CYGA 3MC0A 3MBEB 3DOSA 4ZFFB 4IDLA 3QDGB 4LVOC 5I1GH 2BNQD 2H2PD 3OXSB 1KCRH 4GXUM 3FQNA 4KVCL 1WFNA 3K1KC 2NXYC 1B88A 2ICWJ 4YBHA 3WLWC 1WBYB 2X41A 5C0GB 5CBEB 1J8HB 1MSPA 2MPAL 2IPTL 2NMSA 4YFEA 2PW2B 5K9QI 1OAYL 4MQ7A 1VADB 2CD0A 4NQCB 4KRNA 2D0HA 2E7CA 3AU1B 2DQEH 2LV4A 3NIDE 3SEPA 2JJWA 4X6CB 1I8IA 3RQ3A 5DMKA 3QCTH 4WEBH 5KN5B 2YPLB 1ZLWH 1FZOB 3MV7E 3I02A 2RHEA 3GO1L 3L3OA 3U7WH 4NT6B 1A1OB 1Y6MR 1MCWW 1XF5B 3VE0A 1U91A 3S36L 5IWLC 4IJ3B 3CPLB 5C0CD 3I75B 4OLYH 2VL4A 2CIKA 1CQYA 1N26A 4MNHB 3X3GL 1U8NA 5CUSL 5GISL 1DUYB 2HG5B 5C2BH 4QY8A 3PJSB 1UENA 1QLFB 4PGJA 3D0LA 2ZCKL 4C54A 1SJXA 4CVUA 4FG6D 2RJMA 5SWSD 4W4OA 4PRBA 3AY4C 3SDDD 2DQTH 1YY9D 4CGTA 4F15C 1H3PL 3TBWB 2BVEA 3LKSA 3C09C 4K7PL 4P5TC 3TJHD 1RUKH 1DFBH 4HS3A 2CKBH 4NZDA 3RJQB 4MAYA 1T6VN 3O3DB 2V7HB 2X09A 3EYQD 2ARJA 4KTEL 2Q86B 1KN2H 1RJZB 5IROA 5BJTB 1V3JA 4LRIC 1BX2A 1OTUD 4PJCB 4LU5H 1R3KB 3EYVA 5FUCE 1LO5A 4ZUUB 4JFOB 3FO9B 5GRUH 2UZXB 3IKCA 3LAFA 1YYLH 3BIKA 4K8RL 1R6VA 4EQ2A 1GPOL 3PQYB 3ARGB 1QFOA 5IMKA 3MRLA 2YSSA 4IRSD 1P7QD 5IF0A 3L9RB 3QI9A 3HZYB 5D1QD 4DUVA 1MWAH 2ZP0T 2BNUB 5F8RC 5IW1A 3RUGA 2X5PA 1T80A 5D1XB 2HTLD 3LS5H 1KG0B 1BQLL 2JF1A 4AENA 4UINH 4AL8L 3PWPB 2R8SL 1J0HA 1Y6KR 1XGTB 4KI5D 4XNQA 1EUTA 1MF2L 3MRCA 1UXSB 4EI6B 1QYGH 1CCZA 1BGXL 1M6OA 1BFOA 3IVKB 4PJEB 2G2RB 4K2UH 3KPTA 5M95B 1B2WH 3GHBL 4R90H 1M7IB 1UZ8B 2UZIL 3MRQA 4R97B 3SKMB 3QQ3A 4TPRH 5BO1H 3AXLB 4X6BB 2Z91A 5IBTH 3O8XC 1AE6H 1R5IB 4KDWA 1OTTC 5C0AE 4F2MA 3UTTB 2E27H 2GUOB 2SEBB 3SE4A 3TPUA 5IP4A 1WEJL 1N0LA 1YEFH 2HT3D 4KDTC 4RFNB 3QFJA 2K9UA 3OL2A 3STBA 3MJ8B 5H2BB 3HG1E 3X3FL 3MR9A 5A3ID 1MHPL 3DMMD 2R23B 4RBPK 1FBIL 1WBXB 1G6RL 3V6FB 2A6KA 3EO0B 3U9UA 5HYSB 5ICZA 1FH5H 1V7NH 5BRZE 1A4JA 1U8PB 2NY3B 4QHKI 3OKKB 3QO1A 4GKNA 5HHXH 3TA3B 2P24A 4J3SA 4GRWE 1Q9WA 1SM3H 5ICXB 2FECL 2Z93A 1MAML 3RIAF 1BAFH 1EBAA 2JJSC 2IALB 5JMRA 1NBYB 2V5YA 3FQUA 1FIGL 1KJVA 4HUNB 3SGKC 4PGZA 3QUMA 4DCQB 3P3YA 2BC4A 4M7KH 4MCZB 3WKMH 1WBZA 1TITA 5INDB 5SWZE 3X17A 4NC1C 2MKLC 4CNIA 1G6RB 3QNZA 5L2KE 5KZCB 2P8PB 4K3JH 1DANU 1ZT7A 5I1IL 3KLAA 1J86A 1QSEB 5F9WC 5CD5D 3U0PA 3TVMA 5DGRA 5GGVL 2BDNH 4K9EL 1A47A 4NPYB 5FO7A 1A21A 3GHEL 4W4NA 2VSDA 5F9JA 9CGTA 4XC1H 2V2TB 3A6BH 4GMSL 3DX9B 3O6FB 4HZLB 3QWQB 1L4IA 1UJTA 3N1FC 1T7WA 4MA1B 2QQKH 3CFBA 4C83A 4X7CC 1IC5L 3PWNB 4LLQA 4ZAKA 5D2NB 4RDQG 3SDCA 2EYRB 2F8VA 3LY6A 5F88B 4N68A 3VJ6B 1T03H 1Q94A 2ZJSL 3QA3B 4OJFL 1DBMH 3WL9B 2AV1B 5KVGH 3TBVA 1HH6A 4LNRA 1JHLL 5SWQB 4FFVD 1ZLUK 1I9IL 1D5BA 1FPTL 3FB5A 1FVDB 2WIMA 5CZVH 4FFZH 3VFWB 1S7SA 1BWWA 1J1PH 2A83B 3QUMH 2H9GB 4LSQL 3GBNH 4O2CA 3VFPA 3PGCB 2DMKA 1H5BA 2ZSVA 1AO7E 5CKGA 3BQUA 1LEGA 3DJ9A 4X7DC 4A6YL 3GIZL 1EZVX 4MD0B 3GJFA 3FCTB 5IJVA 4GBXB 2BMKB 4OAWA 5D70L 4PR5B 3MLXH 5IVXA 3OR7A 4U0RC 1LO0L 2OL3L 4S1DC 2WZPD 3GSUB 4EOWH 4FFYH 4BSVA 1FNAA 4F7MB 5C8JA 2NY4B 4G7YL 5JZ7C 4ZDHA 4QRRD 4OLUL 2V2WA 2EDNA 4N5UA 4H5SB 3NFSH 3MOQA 3QDMB 3EYFB 5EO0A 1LK2A 3D2UD 5HHPB 3CDGA 2Q7NA 1F13A 4OV5A 3MV9B 4UZGA 1D6VL 3H7BB 4TVPL 4A6YB 2L4OA 3QWOA 1AGCA 4EI5D 1RAMA 1MRDH 4P9ML 3HNVH 5I1LA 5MENA 4JO1L 4YUEL 1QSZA 1YEJH 4GKOA 1U8JB 3GSWA 3LZFH 4Y7MA 2D03L 2OL3B 5DEGB 1IGFH 4GFTB 2OMNA 2Q76B 4F7EA 4KUCD 1HWHB 2AK1H 3RAJH 2XA8L 3UJJL 3MXWL 1NC2A 3V4UH 4O4YH 4N0CD 1KV3A 3QWRD 5IEHA 4PJBF 2Z35A 1NCBL 3TIEB 3QAZB 5IW3A 3AREA 4JFED 5GRZA 2I5YH 1DVFD 4QHKJ 2VLKE 2FX8L 3HC3L 3OKMB 1DBAH 1XZ0B 1R3HB 4NUGH 4QRTB 5CIPH 3F7PC 4G9DA 1AKJD 1F02I 3IU3B 1G9EA 1A22B 2E7BA 1LVEA 3ZTNH 3CXHK 4X4ME 1IL1B 3L3HA 3NN8A 2BHUA 5JPNA 5LXGL 4Z77B 4O9HL 2AXFA 4HKJB 1F4WL 3STLB 2H3NB 2ZCLH 3S34H 1S7QB 5HHVL 1MI5B 7CGTA 2Y72A 4K3DL 1MCNA 1BP3B 2GSGB 3WIHH 5HVFB 3O6LH 1FL6B 3KPOA 4DTGH 1QQDA 1RMFH 5FM5O 1AD0A 1UT9A 4TULL 3RX5A 2YA1A 4X9BA 2JELH 3EAKA 3ESVF 4OZIA 2C7UB 4OCSH 5KSAD 3K2MC 5DUMH 3S37X 4PV8B 2DL2A 3VG9C 4PRNA 2UYLA 3S5LB 3MCG1 1QR1A 2VABA 4ISVB 5BW7C 4XNYH 4JFFE 4DVBB 2O26U 4D0DA 2XKUA 1LWRA 4ENED 2FJFB 5IB5B 4XCNA 4Z5RB 3MLVL 4KKCC 4NN7C 4APQD 1N3NB 1IQDA 1YEDA 4JGJA 2AEIT 1I75A 5CJXC 5I0DA 4PD4J 2UWEE 4B0MM 3EDKA 4N0UA 5E2VH 4KHTL 5HDOA 5TE4H 2GK0A 5IBLC 2WV3A 1NMBH 5I71C 3MX0A 4XWGL 3KJ4B 2H2SC 4DGIH 4UTAH 1EERB 3AROA 3RA7L 4CVZA 1ND0A 2DDQL 2PNDA 3FN3A 1FAKT 1T66D 4U2YA 3O81A 3VDBA 4MJ6A 3B2UC 1EVTC 3Q1SL 5E03A 3QUYC 5JHDB 2AJYL 2DF3A 3SY0B 2APFA 4NFBA 3T65B 4ERSL 1VACB 5E6ZA 4G3YH 4R8WL 4XWOD 5EU6B 2ZCHL 4HJGB 3MOBL 2YRLA 1QSVA 2I26N 3GI8L 4GXUN 1A9EA 2EZ0D 1KIQB 1FG9C 3TNNA 2H32A 4HMCA 1A0QL 5I1KL 3IJSB 4U6TA 4NDMA 3SDAB 5GPRA 3D39A 4PJ8B 4ZTPH 3X13B 2MOVA 5HI5D 4MA7H 4PJAB 4QHMB 4AMKL 4FN0A 4N0YL 4HK3N 1Z2KA 2Y23A 4LEOB 5FECB 3O11A 2BCKB 3B9KD 4PG9B 1CLCA 2XN9A 4I4WA 1AD9A 1OT1A 4CDGC 3OPZL 2MTPA 5IVOA 3DVIA 1FZJB 5E24E 1L7TH 3BN9C 5C0JB 4F33A 1KB5A 1TCMA 4I0PA 1WIOA 5IB2B 1BQSA 3FJTA 1G7IB 5IMMA 2QV2A 3TN0B 5E7BA 5DJAB 5KSVA 4QRPA 1AQKL 1FC2D 4H1LH 2YD1A 1I1CA 1WK0A 1D5IL 4MJ2A 4L4TA 1JBJA 1ZKAA 2W9DL 5KG9B 1QFUL 1DEEB 3TT1L 4K7FA 1B0RB 5KS9B 4WO4D 4WHTB 5L8JB 1NLDH 2PR4L 1NGPL 4DGVL 3JV6A 2X4OA 4D0BA 2DIJA 2W65B 3UAJC 3UBXG 3PP4L 2W59A 5EFIB 2E5EA 4PG2A 3CX5J 4KJWD 4X6EA 1LDSA 1HINH 5CGYC 1L7IH 3DI2B 1H8OA 3O3EA 3MRGB 4HUMB 5D7IA 4HSQA 1UFUA 5D7SL 1FN4A 4PJHF 1RZGA 2K3TA 3DRTA 2R0KL 2HJKA 1KGCD 1CLOH 3U4EB 2DMCA 5F89B 4CUCA 1H3TA 1BECA 5I8OH 1GGBL 4NKOB 4JO2L 2Y6SC 1JTPA 1MJ8H 2ENYA 1XR9B 4Q6IA 3QQ9D 1F4HA 1TZIB 3F5WB 1JFQL 2LAGB 3U36B 3NCBB 5F72S 2V5RA 5I1EH 1N6QH 4MQSB 2QSTA 3X12B 2IF7A 4NGHL 1JPTL 2E6QA 4HKBA 4JAMA 4IOIA 3RL1B 4MX7A 1EFXB 4LSDA 1BEYH 4KGJA 4V1DB 3L95A 3IDXL 5HHOB 5AUMA 3IDJA 1KACB 1NGWA 4QRQA 1ZANL 3KHQA 3BRGC 4WUKL 4IDJL 1PD6A 5T5NF 5JORB 4BJLA 5EBMA 3QCUH 2F5BH 4HMDA 4G6JH 2ESVD 1EZVY 1T3FA 2VLME 1ZMYA 3CFEA 5DUPH 2B4CH 5EC1A 4IIQA 2OTWB 1XEDA 1D5MB 3BGFC 1SEQH 4YH6A 3CNKA 5F7MC 1IE5A 1WVZA 3I9GH 2A9NH 4YHOL 1O7SA 5DK2B 4LCCC 1P6AB 4U33A 4YQXH 4JPIB 4P4KD 3ZHKA 1RZJL 3FMGL 5D96B 2APWA 3GUTA 3NACL 3T0BA 5LGHH 2BOBA 3NABH 4LF3A 2QADC 1YEGL 2LQRA 5EBWB 4G8GE 4MNGB 1H15A 1AFVL 5BOPA 4H20L 2EXWD 1HK6A 5JQ6H 5E08H 3MRDA 5JOPD 1YYML 2FGZA 3D9AH 4LSRH 2VAAA 4KRLB 4O02L 4QRUB 3B2VL 1RK1A 4PJGF 5TDPB 1AY1H 4XTRD 2QKIB 5T3XD 2HH0L 1KEGH 2ATPA 1A3RL 3TO2B 4GG6F 1NCCL 3CVHH 4WHDA 5IB1A 3RVUD 5D1ZC 1H8NA 4IOFD 5IQ9B 1C1EL 4FQXB 1GIGH 3QIUC 3Q3GB 4JM2A 2GT9B 2FR4A 2D7TH 5SV3A 1YN6A 3O9WC 1NCDL 4Z7NE 4XP9H 1GRWA 3KXFE 3ZKXB 1JWUA 3BVNA 2GTWB 1GGTA 1YDPA 5K9JH 5HHNA 1BM3L 4U1KA 1AXSB 5KVEL 4JGUA 4QCIB 3EDDA 3QJFB 4NO3A 4J2XA 1QEWA 5C0EA 4JKPL 4QHUB 5GSVB 3FB8B 3V6OE 2WP3T 4JPWH 4PUBH 4MXVE 5JOFA 4BZ2H 4L4VE 4OZGA 2Z31D 3QO0B 43CAB 1RK0A 1RVFL 5I1JL 4LVHC 3U4BH 4YZFF 4KKNA 2FIRT 4Y16D 2JB6B 3BKML 4NYLA 5LCVL 2FIKB 1XR8B 3BOVA 3K4ZA 4HLJA 4MD5A 4PJ7B 3DV6B 2HVKB 2HKHL 3G6JB 4G8IB 1I1RA 3RDTC 2BVUA 2XG5A 5DJZB 5IVNA 1J87A 3OKEB 5GZOC 4HHAA 1QKZL 5CD3A 5L6YH 3L3GA 3EIFA 2VDLH 1TETH 3UZQA 2YK1H 4WW1A 2ICEB 3C8KA 3RNKB 4JDVA 5DMJB 4U3XA 3BZEB 1PY9A 3REWB 4CVXB 2B1AH 1FVCA 4XHJD 1TJIL 1CTOA 4YEFA 5FOBA 1XIWD 4WV1B 3GDBA 3PL6B 4MCYB 1MIMH 3MV9E 3KPLA 4EN3A 1J1OL 5E6ID 3NTCH 3BUYA 3T04D 3QDJE 3WD5L 2QTEA 4MDJB 1U8LA 4JN2B 2EEDA 3VGFA 3BKYL 4KMTH 4N5EC 1BZ7A 1RZ8A 2NYYD 1CXLA 1D3CA 1UA6L 3BE1L 2BVPB 4NJAH 1U92B 3JV5A 3C60A 5FA4A 2H2PC 4DAGH 3MGOB 4BH8A 5H94B 5FKPA 1VGKB 3P4OA 1WZMA 4XNZB 2BVOB 4LVNC 4L9LA 2DQIL 3RTQD 5BQ7B 1G7MB 4JB9H 2YXFA 1U8KB 2PYFA 2EH8H 2PYED 1EXUA 1ITBB 4LRNH 4PYHA 3VXTB 5J6HB 1KCVH 25C8L 5ELIA 1GOGA 4WEUD 1PZ5B 3WNMA 1MCFA 5D6CB 1LNUA 5HYSG 1VFMA 3RWEB 4KH2A 2VLRD 2EIEA 1WTGT 2XZZA 3QEQA 4LVEA 3RZCD 4AK1A 1LD9B 3S98A 1UB5A 4LFHD 4Z7NF 1G9NL 5GRXG 1G1YA 3ZDYE 3PHQA 5M94B 1PG7X 3LD8C 3QHFL 4J12A 4X7SH 1EO8L 1MI5E 1OLZA 4ZUTA 5E4EC 5HJ3B 3F58L 3ULUD 2EDEA 4UQ2A 3HE6B 5IM7A 3DO3A 2B1HL 2HA1A 3ARFA 1D5XA 1S7UB 3RWDA 1CDIA 3IDMA 1OTSD 3G5VB 2RR3A 5I1CL 4QHNB 4XP5H 4FG6C 4MXVF 4U1NB 5DJDA 5FUZH 1Y18B 2VDRL 4PJBB 3SDDC 1YY9C 1UB6A 1TQBB 3HE7A 3TJHC 3AB0C 3B6SB 3UTSE 1S9WA 1W72A 2NCMA 3LPFA 5CWSA 4F7CB 3EYQC 3ULVH 1X5LA 5BZDB 2V6HA 1OTUC 2DLIA 2W9EL 1JV5A 3MBED 4AEIH 4CRPA 4XP4H 3GRWL 5ADPL 3QDGD 4NKDB 5T1KB 1BOYA 4Y4FA 1WAAF 5C0BA 3S37H 4KU1A 1IAIL 4YC2C 1WZ1L 2J6EH 2GQHA 4LQFL 4XMKL 4IRSC 1BZQK 4PREB 1J8HD 5D1QC 5I66A 2FO4A 4XCCL 3V0WL 1UJ3C 3MLZL 1DQDH 3GSRA 1SYVA 3M8OH 4NNXB 2HTLC 3HS0A 1K4CB 2ENSA 5EO9A 4LLWB 1MRFH 5JHDE 4NQCD 1MFCL 5LJYH 2HN7A 5EU6E 2X70B 3MROA 4NO0A 5GGTH 4KI5C 5IK3B 3UX9B 5I1AA 4NRXB 4ELMB 2YPLD 1E6JH 1KCKA 4CADB 1I3UA 5FA3A 3E0GA 1UACH 3SQOL 1UADC 3MA7A 4ZUSA 1JHKH 4K55A 4PJAE 2KQNA 2ZNWA 4KWUA 3UTZB 4IBLT 5DI8B 4UIKL 2DOCA 1BLNB 1BQHG 1WT5C 4RSVA 1F8TL 1RUAH 3LQAC 1OY3B 1HHKA 4YX2L 4FXKA 4OGYL 3WUWG 2HT3C 4PY8I 1JUFB 1JF1A 4I18B 5ACLA 1D9KD 2VRAA 1MCPH 3E6HB 3OQ3B 3DVNA 3N1QC 2W1NA 1A7PH 5FHBL 5A3IC 2AXJA 2G75A 3DMMC 3QUZA 3PG2A 3V5KB 3D69B 5GJSL 4I3RH 1G84A 5IQ7L 4WHYG 5LG1A 1S7RA 1A7BA 4F37K 1T21A 3VA2C 4XNMB 1N5YH 3V2AR 2NY5L 1FNFA 1NAML 5D7JA 3RGHA 1UVQB 5GGQL 1F6LL 3ZDYF 1X5YA 3IS0X 1UH2A 3PQYD 5TFSL 1UH4A 5A43C 3ARGD 4RX4A 3RHWF 5JUEH 2DQGH 2F53A 3A6CL 1SQ2N 1IKNC 4PRHA 4FHBD 4Y5XC 5ANMB 4D8PA 1KC5H 1A1NA 1Q0YL 3L5WB 4QT5B 5T33L 1EGJL 5D1XD 5ALBH 2O61B 3I2CL 4X4YB 3FT2B 4Y19A 1ZAGA 3QEUA 4MQXD 5JQHC 1NGXA 2JJVA 2Y06H 4G6MH 4NO5A 3MLUL 4XPBL 4B50A 5DRNA 1OAUL 1X5XA 3PWPD 3RPIA 5CHNB 2DWEA 1PVHA 4WDIB 4WTZA 2HKFH 3C60C 1RD6A 5E6YA 2ZG2A 1NAMB 4EBQL 3QDHA 1CG9A 4J3UA 5CD5C 1FNGA 4K8RD 2AKRA 3GK8L 3P9LB 4KXZI 2QHRL 3KYAA 3NFPB 2EDLA 4XNXH 4GS7B 1JYNA 4ZFOA 3QCVH 5DD5L 4HGWB 3SCMD 2CRIA 4HD9A 4Y2OA 3D0VB 5GXBB 3D3VB 3LV3B 2KL6A 3CXDL 5SX5K 1IGYA 3OWEA 5DDHB 4NQDD 3L3IB 4HC1A 1QTYT 1Q9KA 2EDJA 3P0VL 3W2DL 5C0RL 5HHOE 4XCFL 3UJIL 3NCYP 5FDYA 1RHFA 1TZGH 1U93A 4HUWB 1CFTA 4PGCA 3MV7A 5E9DD 1T0NB 2OJZH 4FFVC 4K3EL 2FLBT 3ZLQC 4FTVA 3BYTA 3IFOB 3Q0HA 1RULH 3VFNA 4U4BA 3TA3D 2OJEB 5LQBH 1UC6A 5I76A 4ZXBA 4YIQB 4LCIL 1MJ7L 1VFAA 3LEYL 5JLZA 2VJXA 5FB8B 5DFTA 3WJJA 4XPAL 3F6LA 4OFKA 3PP3K 1U2HA 2XWJB 3QR2A 3H42L 3SGEI 1QNZH 5HGAA 4FQIL 4PGBB 1XGYH 2YBRA 5EC2B 5ID1B 2BFVL 4TYUA 5F7LB 4ZD3H 2VLJA 4NRYA 3WDIA 1RJYA 4MJ5A 4OB5H 4HAGA 5BVJB 5MP6H 2VLLA 4LKXA 2C4XA 3T2NH 3WNOA 1FFNB 4RMUA 3SGDI 1QSED 5HYJE 1LDPH 3BP6B 3C5JA 4OIIL 4Z78B 4M00A 1DSFH 4JZNA 5K59E 4F9LC 5EUOF 3GSVA 3RVTD 4XPTH 4NKIH 2AEQH 4OI9A 1UXWB 3WCYA 4M7LT 1BREA 2VXTL 1T1YA 1UYWH 3AS3A 4DK3A 5DT1L 3LN5B 3IRZA 3EYOB 3SKJH 5J1TC 4EI5C 3PGDA 5I8KL 4GXVL 3CU7A 4M7JH 2NXYB 3MREA 1IM9A 4PJXF 1ZSDA 1IQWL 4PY8J 3PE9A 3C9NB 5A16B 3THMH 4P2QA 1CVRA 3CK0L 3FO0H 3BAEL 4HPYL 3V8OA 3V4VL 4FQ1L 3UJTH 3MZTA 3MRKA 1I1AA 4N0CC 1MFNA 5I0ZA 3DBXA 1NDMB 1OP9A 4CMHB 4ZS7H 1I8KA 1U2CA 2GFBA 3GSNL 4X8JA 5HGGS 3VFOB 1DVFC 4UBDD 1FC1A 1JRHI 2VDNH 4YO0B 5HGHA 2WBKA 3HI1B 5LAXA 4P2RE 4QRSA 3TBYA 2XIDA 1C5DA 1ZHNB 4GW5A 3FL7A 2OSLA 5E94A 3DO7B 1NL0H 4JRYB 4YDVA 4AY0A 4G9FB 4BSWA 4YAQB 1JGEB 2PO6D 1I7RB 5IEKA 3CIQA 3HG1A 1AR1D 3PABA 3X14B 1BVLA 5C0FA 1F90L 3H3PH 1NEUA 1EMTL 3BD3A 4RWYH 1NCWL 4GG6B 2ESVA 3FQWB 3HUJF 3MNVB 4PJ7E 1IM3B 4UTBH 5BRZA 5IVZB 3GSNB 3HMWL 2NY4D 1RZKL 1T0MB 1T20A 2BXYA 3BGMB 4PRIB 4RIRB 5IBUB 5IKCA 3VGAB 4P5TB 1EHLL 1P1ZB 3EBAA 1P9MA 5K93A 5EO1A 2GITA 3QDMD 5KSAC 5D9SA 4J8RA 4NM4L 3OXRB 4IRZH 2LFGA 1MAJA 2OI9B 4TUJA 4YEEA 5ISZB 1CICD 1U8HB 1U6AH 4IMLB 4PRAB 1CIDA 2NX5B 5SWZA 3V95A 4ENEC 1FNHA 5CSZB 1Z6JT 4APQC 1KTKE 5C3TA 5L2KA 3MLWL 3TC9A 5IHUL 3HI6L 1RPQA 1E4XL 1T1ZB 3EOTL 5FM8A 4L1DA 1ZA6A 2VZ3A 3KHOA 5IMLB 3FN0H 1RIUL 3TZVA 5EZJA 3VXSB 3B5TA 5FYKE 4WUUE 3T3PE 2RFXA 3MRPB 5F93C 1T66C 5C6TH 2LTQB 5K59F 3ES6B 3JV4A 4LSVH 4TVPD 4TTDD 3FO1B 1S8DB 1S7WB 1GHFH 4ONHB 2XZQH 4HXAH 1T4KA 4NFDA 4QXUL 1A7QH 2P7TA 1UKTA 1WCBB 2LVEA 3IU4H 1CR9L 4RNRA 4XWOC 3V7AG 1NDGB 5C08E 1AR2A 5F71A 2EZ0C 4AIZB 1M7XA 2WAHA 4LSUL 1DBBH 1I9RH 1J88A 3BEWB 5HI5C 4OLYL 4GRWH 5GGUA 4JN1L 3KYKH 4OZ4A 1C5CH 4QYOB 5TH2B 4HKZA 3WHXB 5C2BL 3B9KC 2EDRA 1MCCA 4NQTA 1B4JL 2YWZA 1Y0LA 4NQSA 4KK5D 4YDKL 2DQTL 2FJGB 1T04B 4PJFA 4M1GH 1CLZH 1I4FB 2CKBL 1AO7A 3OHXB 1CXIA 1MREH 4JHWH 4JY5L 2B0SL 3T8XA 3FB7B 4L8BA 4PJIB 4MMXC 4NZUL 3TJEL 4U1IB 5GRUL 3LH2H 4HH8A 5EZOH 2DQHH 1PG7H 1IARB 4GRLA 5E5RB 4NN5C 2EDBA 1P69B 2BSSA 3QG6B 1DLHA 2FZ3A 4M1CD 1MWAL 4AEHH 5T3XH 4GAJL 1U41A 1V3KA 4YHNB 4N9OB 3C2AL 4I3SL 2VXQH 4WO4C 3TEUA 5MEPB 1A6UH 1F3DJ 2EE9A 4KTYA 4M7LL 2CKBB 2YZ8A 5DJ2B 2C3VA 4HIIA 4FMKA 1C16A 1FP5A 4RA3A 5DHVB 1MELA 5HYQA 4KJWC 4XBEH 2FGWH 2KKQA 2DQCH 2KPNA 4M8VA 1TNMA 1AQDA 1HDMA 5L88H 1IC4H 4M9OA 1I8MA 3SGJC 4P3CL 3UBXA 1B2WL 3UBXI 4R90L 4IS6B 5E6IA 1XF1A 1X5FA 4YBQD 4PJ8D 1MWAB 4P4RB 5T3ZD 5DQ9A 1MCJA 4JRXB 1AE6L 5FHAH 4CU7A 1A7OL 3NCJH 3WXVL 1NUGA 1F4AA 1BD2E 4TOYL 2E27L 3VD5A 3QQ9C 4HWZA 3PWJA 4ELME 1CDJA 3KS0J 4KDVA 2VLKA 1YEFL 1BZ9B 1CI5A 1Q0XL 1QOKA 1IGIH 1UKQA 5T5FL 5IFAH 1P7HL 1TLKA 3EO1B 4FXLA 3HC0A 4UT9H 1YUHA 2YKLH 4RAVB 2MWCA 4X4MA 1OB1B 1T2QH 4PYGA 1YJDH 2EIZA 5T1LB 1MFAL 1V7NL 4OQTL 4KQ3L 1T7VA 1JE6A 5TE7L 5DC4B 3D87B 5DK3A 1EBPA 2G5BB 2A74B 4Z76B 1SM3L 3OKYA 5DQJB 4ODXA 5FCSH 2WINA 4QXTA 1U8OA 1IGMH 2GAZA 4HG4K 1IEHA 1BAFL 1HXYB 2I9LB 2X4NB 4I13B 4R3SA 2HFEA 1CGTA 1W0YT 1HH9B 3VMOA 1NUFA 1PY4A 4RMQA 4U0RB 3WKML 1SJEA 1S5HA 2F19L 1LEIA 1NCUA 1CE1H 4JFQA 4RCAA 1JGDA 4P4KC 1JNHA 3MYJB 1N5AB 1E6OH 3P4MA 3OG4B 4JFFA 4JQIL 4ZSOB 4OLZL 3MRBA 4K3JL 3BO8B 3FT3A 4ONFL 4KPHH 3VXOA 1QACA 1LGVA 3UTPD 4GKSB 4KUZH 2BDNL 3C5ZD 5DZLA 2EXWC 1EJ6A 5C09B 5IFJB 2UWEA 5TPWL 3A6BL 3VWKA 1OF2A 1HNGA 2EYTB 2EDYA 5DD6B 3SKOA 3HRZA 1MVUA 2F8XC 1Q72H 2JLLA 4U7SA 2IANB 1BIIA 4EEEA 1CL7H 1QZ1A 3PXJA 4HCRA 2OXGA 3OXSA 1ZLVH 4WFEE 4CJ1A 3G04B 3BH8A 2JB5L 3BHBA 3IB4A 1T03L 2EO1A 3RVUC 4QNPE 3GMOB 3VFVB 4IOFC 4JLRA 3WE6B 5C0GA 4D9RE 1EFXD 5F6HI 3RZWA 4DN3H 1OCWL 4Z7WE 3P73B 3AGVA 2G5RA 2PW2A 1O7VA 3HZMB 2V9TA 4LPWA 5C6WH 2DN7A 5CZVL 2OZ4A 2IGFH 1I3GH 2DICA 4BSJA 5KSBF 3RGVA 1J1PL 2F54D 2J88H 4I77H 4X6CA 4MA3B 2E7LA 2FH8A 5C6PB 3HR5A 5KN5A 1FZOA 4Q9BA 1KULA 1QSFB 2Q1EA 3ULUH 1XGUB 4HS8H 3SE9H 5I73C 3TYGL 2JTDA 4YR6A 4NT6A 2E7HA 1A1OA 3FTGA 1M71A 3HZVA 3MLXL 3CPLA 3I75A 4NO2B 2R0WL 5K9KB 3CMGA 5DVMA 1KJ3H 1N2RB 1GJIA 2Z31C 2R39A 4XP1H 4EOWL 1DUYA 1S3KL 2HG5A 1PFCA 4FFYL 4MNQE 5KTEL 2Q8AL 1YJDC 4M8QA 4UU9B 4Y16C 4R96B 4BM7A 3T1FB 1G7PB 3NFSL 2CJUL 4DVRL 3TBWA 2P49B 3G5ZA 1IGCL 1W0VB 3VDAA 5HPMA 3O3DA 2V7HA 5BJTA 1EEZB 1FZMA 2EKSB 2Q86A 4FABL 4UT7L 1R3KA 1T5WB 2IH1B 1KLGA 3HNVL 4L5FH 4NJ9L 3OKNB 3Q5YA 3G9VA 4ZUUA 4JFOA 3STZA 1Z9LA 2ZUVA 4YJZL 1T7XA 3AS2A 3REVB 1OWRM 4MXWL 4XHJC 5DD3H 1G7QA 1UEYA 3EJYD 1YEHH 4XP6H 1VFBB 3L9RA 4PBWD 1XIWC 3BKCL 4HEME 3HZYA 4HLZG 3TP4A 1ORQB 1G9MH 3V6BR 4GW4B 2EC8A 4MD4B 2FHBA 3ZKND 5C3LD 2BNUA 4M6OH 2DD8H 5E6IC 2A6JB 3C87A 5IHBA 4W68A 3RY6C 2XPGB 1J18A 5C0ND 1OT2A 4PV9B 4XBGB 5CAYB 3LQZB 1DBAL 4O2EB 3QUYB 4QOKE 2D3VA 2AEWA 2NYYC 3ZYOA 5TQ2L 1XGTA 5B38B 5F7HA 1UWXK 3WN5B 1NFIB 1UXSA 4EI6A 1ADQH 1EO5A 3I6LD 1MNUL 2MPAH 4YHKL 2IPTH 4PJEA 3RTQC 1L0YA 1NC4A 1N59B 1M7IA 1UZ8A 2YD8A 1NGYB 3WEXB 3MXVH 1TNNA 3SKMA 3TFKD 3AXLA 3FRPA 4ZYKB 3SDXB 4X6BA 1OGAD 1C08A 4Z7VE 1R5IA 4QNPF 5FGBC 4QKXB 3IJHA 4Y4KB 3UTTA 3KWWA 2GUOA 3WIHL 2SEBA 3O6LL 4FQPA 3ABZA 4X4XB 5ACZB 1ZHKB 4G9FE 4GMTL 3WO3B 2CUHA 1WIPA 5DEFA 4DGYH 3RZCC 3GO1H 5DUML 3MJ8A 5H2BA 2R23A 1INDL 2DYPB 4LSPL 3S36H 2FEEI 1ULVA 3PWLB 2X4RB 1PLGL 2MHAB 4XXDB 3V5DB 2JJTA 1WBXA 1RHHB 4PJ5E 1HILB 3OKDB 2IAMD 3V6FA 3Q48A 3X3GH 3EO0A 2AQ3A 5HYSA 2YUZA 5CUSH 5GISH 3ULUC 1U8PA 3CDCA 3OKKA 4PJXB 4PRIE 2ZCKH 3H8NA 3FFDA 4FXGA 1OAQL 5CEZE 5ICXA 4LGSB 2FNBA 1OTSC 1EAPB 1RUQL 1H3PH 1BVZA 1FYTD 1SHMA 4K7PH 3PL6D 5F6HJ 1Z5LA 1FO0B 4UOJA 4ZO9A 1NBYA 3KPQB 1J05B 3DWTA 2R0ZH 1S7TB 3EW3B 3ROLB 3JSSA 5INDA 2V7NA 4XBPB 1DLFL 5I75B 5FO8B 1JGVL 1CVSC 4OV6F 3MBEC 3B9VA 4K8RH 5F21B 1GPOH 1RZFL 1RUML 2LABA 1TCRB 1XCTB 4R0LB 2P8PA 3DI3B 4BUGA 4LLMA 4TRPL 3T0ED 4G3YL 4NPYA 1HHGA 3BWAB 1P5VA 2GJ6E 3O6FA 2X9XA 3MODL 3QQ4B 4MA7L 1DBKH 3B43A 4AL8H 1G9MC 2R8SH 3HUJB 5B4MD 4G8FB 1CK0H 3GSQB 2IWGA 3IJYA 2EDOA 2R2BB 1MF2H 3K4DA 4PRDB 4ZUVB 4Q74A 2XWBB 1U58B 2J12B 5D2NA 3KXFA 2EYRA 5F88A 3BP7A 3VJ6A 4HX1B 3GHBH 3QA3A 1MPAL 1P4LB 2E9BA 2DBLH 1Z9OA 2UZIH 1G1CA 2AV1A 2FYYA 4YDJA 3W11D 3VU2A 5SWQA 2VYRE 2BY0A 3BMWA 3DV4B 4Q6YA 4LP5A 2BNRD 4IJ3C 1FVDA 3HE6D 1J7VR 2YEZA 5B3NA 3VXRB 3V6OA 1A2YB 3VXNA 5EOCL 3VI3F 1ZOXA 4L4VA 3TBSA 1LO2L 2X4QB 3WFBL 2A83A 2AJSL 1AXIB 2H9GA 3PGCA 3RWGB 3BGFB 5I2IB 3X3FH 1U8QA 3NZHL 1CGXA 4Z7VF 3PIQA 1FBIH 4DKEL 3RVWD 4LCCB 2QHLA 4YHIA 5A2FA 2N7AA 1G6RH 3BIAX 4OQ1A 1FLRL 4ZMAT 1A6ZB 3FCTA 4GBXA 4Y5VC 4DQOL 1LO3H 4PR5A 4LPXA 1JWMB 3WUWA 4AG4H 1ZT1A 2R4RL 3GMPB 4BFIB 5T1KD 3WJLC 1ZGLP 3GSUA 1HINL 1ZGLA 1UZ6F 1MAMH 1CDCA 4XH2B 4P3WA 3ARGC 5J1AB 5I9QB 2Q87A 1K8IB 1I7ZA 3FHQA 3N1MC 4H5SA 1M4KA 3EYFA 4H1LB 3V7MA 4NC1E 4M62L 4LNVA 3VFTB 1FIEA 1ZT4B 2DMBA 4MB5A 5D1XC 3MV9A 5I8OL 4MQXC 1LQSR 5H37G 1H0DB 4ZNCD 2B2XL 3C5SB 4LLVB 4E42B 2LVCA 1BBJB 2P5EB 2VL5B 5D1ZB 3ZYJA 2OL3A 1N6QL 5GGVH 2R1WB 3AC0A 4WVRA 2NY0D 1JTTA 2Q76A 3L6FB 3SQBA 3GHEH 4Z0XB 1KT2B 2YMXL 4K8RC 4Z7OE 3MMEA 1FJ1A 2R2EB 1FRGL 4CVWA 4UUJB 2XQBL 4B53A 1BEYL 4HDIB 1HHJB 4AH2B 5HHQB 3TIEA 3N1PC 3QZWB 2CLZB 3SCMC 4FQHB 3OKMA 3QCUL 1XZ0A 1IC5H 4G7VL 4N0RA 3ARBA 3FFCD 4CW1A 3R0MA 4DOHE 1VA9A 3IU3A 4RFNC 3CH1B 1MH5A 1LO4H 4OCXH 3K3QA 3CFIC 4KZEL 1IL1A 1JHLH 2CO6B 2XG4A 1I9IH 2A9NL 4Z77A 4HKJA 1FPTH 2DS4A 4GKZA 3STLA 2H3NA 2DLHA 3W0WE 4GQPH 2C5DC 1MI5A 5JDJA 1TXKA 5LGHL 3TCLB 3TA3C 1CU4L 3V5HB 2GSGA 4LSQH 1N6VA 3VFUB 2X4TB 3RDTB 4ODSL 2C7UA 2EDXA 5ESAB 4I3GA 5JQ6L 3VMPA 4A6YH 4ZO7A 3WFDH 4LBEB 3D9AL 4PV8A 3K4AA 3FOMB 5IR1B 4Z7QE 1X4ZA 3V52L 1KEGL 2FJFA 4LCWB 1WJ3A 3TH4T 4G7YH 4OLUH 2DJSA 4ODUB 1N3NA 4OF8A 2CRZA 3FB6B 3MO1A 3N50A 1KIPB 1QBAA 3WO4C 4QXWA 2HWZL 3RVTC 2OX5A 4NQEB 3VWJD 4TVPH 2XTJD 5KANG 3UTOA 4MSWB 1P2CB 4P9MH 2DKMA 4P57B 4L3EE 4FNLL 2NY7L 4YUEH 2YN5A 1ZS8B 5C71A 3NIGF 4MA1C 1Q8MA 2BNQB 3OAUL 4XP9L 1INQA 4Y2DD 1ES0B 2D03H 4KRPB 4X6FB 5JHDA 1FL5B 4LVNB 4YGAB 2XA8H 3UJJH 3MXWH 1VACA 4HIXL 4KJYB 5EU6A 1NFDB 2I07B 4HJGA 3WNNA 2CDFB 1IC1A 1KIQA 3ARWA 1T89A 3IJSA 1LP9E 1NMCB 3SDAA 2V9QA 4PTTA 3X13A 2YD9A 3HC3H 4PJAA 4QHMA 4UV7H 1VEOA 5HTSA 5LKNA 3I6KA 4Z7OF 3FQXB 4UBDC 2BCKA 3F62A 3G6AB 4J4PD 2Q20A 4ZPVB 5AYUL 3KPRE 1ERNA 1G7LA 1AGDA 4RBPH 3LD8B 5LXGH 5IB2A 1F4WH 1YEIL 5E4EB 4EDWL 1D5ZB 1G7IA 4JZJB 2PO6C 5DXWA 4MQTB 5C0CB 5HHVH 1AR1C 1B90A 3TN0A 2YK1L 3KPMB 5DJAA 1CFNB 3GMRA 4KY1L 3M07A 3CFDB 4TULH 3F7YB 2B1AL 1QLEH 3GGWB 2NY4C 3BW9B 3SDDB 1FGVH 1QFWI 3AB0B 4N0FA 4TTGA 5KG9A 4LGPB 3MBXL 4OZHB 3KPSE 4YDLC 1B0RA 5KS9A 3E3QC 4P23A 4JFXA 5FO9A 4W6XB 4WHTA 1YNTB 2W65A 3ILPB 2QQLL 5KSBB 2XICA 1CICC 1JCKA 1SEBB 2W0LA 4HF5L 4NJAL 1WGOA 4YC2B 2FSEB 2AABL 3C8HA 3BXNB 5E99L 3MRGA 1P7QB 4KHTH 2YS4A 4Z7QF 4WGWB 3ARPA 5D1QB 5T3ZH 4XWGH 3CSYB 4P2CG 3LQAL 4LSTL 5FGCB 3MFGB 4P5KB 5F89A 2OMBA 3DUSB 2DDQH 5E1AB 3OSKA 3QAZC 5J9PA 3RUGF 3KNBA 3T4AA 3Q1SH 3CFJA 1XR9A 4R7DB 3F5WA 2AJYH 5FYJD 3IDGA 4TTDC 3IT8D 4I9WE 4WENB 1EVUA 3NCFB 3FT4B 3HFMH 3DXAE 3MNWB 4R8WH 4ERSH 2HRPH 3X12A 3MOBH 1MCOL 3CJJA 4JRYD 3V0VB 3U30C 5DJYB 2VOTA 3S4SG 5I1KH 3RL1A 1IJ9A 2I60L 1ZA3A 3NPZB 1ZLUH 3O3AA 3SDXE 3PNWB 4X7SL 4V1DA 4AMKH 5HHOA 3H9SB 4HUXB 2BVQB 1X5HA 4DN4H 1A14L 2XQYK 4KQ4L 3EZJB 3BZ4B 2EO9A 2HLAB 3MUY1 1TENA 4XP5L 3DMMB 3RVXD 1HYSD 4KK5C 2OTWA 1HNFA 3TNMB 4WFHD 2EDWA 4ZUWA 5CLTA 1EA9C 5DK2A 5HYEA 2FX9L 4P2OD 5ISZD 4JPIA 4U1HB 1S7VB 4X99A 4ESKA 1IT9L 2NX5D 5CBAA 3W9EB 1AQKH 1BWMA 5F96L 4HK0B 5A2LH 4YHYB 3S37L 4IRJD 2CLRB 5EBWA 3X11A 1D5IH 4ZPTB 2J6EL 3I84A 2W9DH 2XI9A 1QFUH 4JKMA 4PRPD 3TT1H 5DQDL 4M1CC 5EORL 3ZT5A 4QRUA 5D72L 3KJ4C 2ZNXA 1NGPH 5ERWB 4DGVH 3EZ8A 3MRHB 3UEZA 3CU1A 4PB9L 3PP4H 1RZIB 4ODWA 4FMFA 2QKIA 5BS0E 5C07B 5TQ0H 1ZK9A 3ZSTA 3TO2A 5GGTL 3NCCB 3NFNB 5D7SH 4OKVB 1NGQL 2AAVA 3VDCA 1FV1B 1UACL 2R0KH 1AHWC 4ZS6D 5IQ9A 3CX2A 1BPVA 4FQXA 2LAAA 2PCPB 3SKNB 3Q3GA 1G6VK 3O4LE 4YBQC 1GGBH 1NANH 2GT9A 3SDAC 4PJ8C 4WNQB 3SE3A 2DKSA 1ZVSB 4Y4HD 1S9YA 1JFQH 2WM0A 4OCWL 4Z7UB 1KPRA 1JPTH 4U31A 4UOW0 4M3KB 3WSQH 4UQ3A 3L3KB 4P2RA 1YMHA 4QCIA 3KJ6L 1PG7W 5CINL 3RL2B 4BYHA 3IDXH 1ZANH 4WUKH 3VXUE 4IDJH 4QHUA 5GSVA 3FB8A 3VXRE 2F9BT 2ZUTA 2X40A 4QHLB 1K4DB 3QO0A 2IPUG 4LCYA 43CAA 2VNCA 5IW6B 3I3EA 4X9FA 4OD1L 3QNYB 1XR8A 4ZOCA 5IFHH 4PJ7A 2BHZA 5J13B 5CEXA 5I17B 3TT3L 2HVKA 4HG4J 4J3XA 4ORGA 4YHOH 3QRGH 1F11B 3KPNB 3OKEA 5ALBL 5EBLB 5E8OB 3OV6A 1RZJH 3FMGH 3H7LA 4W6WB 5MERA 4JQVA 5FK9B 2FATL 4JJ5B 1U3ZA 1RQ5A 2Z8VC 4N0UE 4UDUA 2ICEA 2XKNB 2DTML 2DLEA 5IVXF 1AFVH 2HKFL 4BFBD 5F1IA 4H20H 3BZEA 5B8CA 1F58H 1CFBA 2ORBL 2F8OA 3UYRL 1ZHLB 4PGEB 3LRGA 1YYMH 3HC4L 4U1JB 1OW0A 4WV1A 3C5ZC 3D2UB 4O02H 4MCYA 3B2VH 5B38G 1PYWB 2Y5TB 4WW2A 4XCEA 5EG6C 1E4JA 3T0VA 1KXVC 4N9GB 1P7KB 4JN2A 1QFPA 2D7MA 2HH0H 2Q8BL 1U36A 3HPLA 4JRXD 3EYSL 4O58L 2O5YL 3MLRL 5FF6B 4WUUA 2BVPA 1U92A 1BJ8A 3L3DB 4H88L 2P47B 5JPMB 5DZOA 4Y89A 1VGKA 3D39E 3IDNA 1MHHA 2ICWB 1C1EH 2BVOA 2DQFA 4OBSA 2PXYA 5BQ7A 1G7MA 2ADIA 1TZGL 5D2LB 3MJ7B 3OAZK 4OGZA 2OJZL 5C08A 4JFEB 1NCDH 5T1LD 3VXMB 1ZWIB 4U6XA 1OQOA 4EZMA 1L0XA 1AKJB 4J3WA 1PZ5A 5D6CA 5IESL 3RWEA 5KVEH 3JUYA 5ID0B 1Q9OB 2CDGB 3DNKA 3ETBF 5F70A 1LD9A 4WI6A 5MEOA 1QNZL 3LN4B 4JKPH 2RAMA 4JHBA 1XGYL 3IDYB 2FCBA 2ILLA 4X6DB 4RAUB 5HJ3A 1CFSB 3N9GL 3S9DB 2APBA 3VFMB 1RVFH 4JG0L 5CJ5A 2BRQA 3O3UN 3BKMH 3P40A 1S7UA 1A02N 5HY9B 4PJDB 4F58H 3G5VA 3C6LA 2HKHH 2A38A 3LKRB 4QHNA 1E28B 5KSAB 4U1NA 3L5IA 3UDWA 1CFQB 5C09D 3BYYA 1DSFL 4MDIB 4OZIF 5T1MB 5ETUB 1QKZH 3KDMB 4XPTL 4NKIL 5I16A 3B6SA 4TSAH 4H26B 2NZIA 4WWKB 1OP3K 1ETZA 2R1XA 4P3DA 4YNYA 3SKJL 1FFRA 2IAND 5HVWA 4NKDA 4APQB 1TJIH 3E6FB 4M7JL 5FYJU 3MV8D 4DEPC 1FFPB 1RZJC 1R3JB 4KK8D 3TO4B 3THML 1M05B 1XCQA 4HIJB 3EJYC 1MFDL 5FOJA 3ZKNC 4C56B 1PBYA 2ED7A 5CJBA 1UM5L 1BJ1J 2A73B 3BKYH 4ZS7L 5J6GB 3N85L 3CLEL 1BQUA 4NNXA 3KYMB 2VITB 1K4CA 3GSOA 3FRUA 5C0NC 3MRIB 1MLCB 1UA6H 3NH7L 3BE1H 4LLWA 2VDNL 3ZKXC 1X44A 2ZPKL 4MWFB 3P9MA 3GFUA 3P11L 2X70A 3CFCH 1FG2B 4UAOB 1G7JB 3GRWA 4NRXA 2DQIH 1NL0L 4ELMA 4OD3L 4CADA 5D5MB 4NQVA 5DK0A 1QSFD 2FEDD 3JXAA 2HYMA 5DJ8B 1NJ9A 5C2UB 5C0IA 1KCLA 3MJ9L 3V6ZA 2N56A 3ZL4H 2IH3A 4NKMB 3AAZA 3TFKC 3G6DH 3H3PL 2HJFB 3U4AA 3B9KB 4JFPB 3RWJA 3BPLB 1M1SA 3EYUH 1VKXB 2AJVH 1KTLB 2WK2A 1JUFA 5EZIH 1G9NH 4I18A 3U82B 4BZYA 3E6HA 1IGJA 3QHFH 5C0CE 1NEZB 3DIFB 1EO8H 1TVHB 4QEGA 4TSCH 3V5KA 3FO2B 3D69A 4AEFA 3F58H 3O3BB 3I6GB 4NSKB 2P45B 2IAMC 1KYOK 4H1LG 4XNMA 2B1HH 5SWSE 1GCFA 1UVQA 5D7LD 1X5AA 2DJUA 3T0WA 5FGRA 2GEEA 5C70A 4NN5B 2ZUYA 4M7ZC 3FQNB 1K5NB 5HD8D 2VDRH 3INUH 4OZHE 1JNLL 3LOWA 1JIBA 5FAAA 3PL6C 4QT5A 2O61A 5DRZB 3FN0L 4X4YA 3U1SL 1I1FB 2A0LD 3C2SA 3PWUB 3GRWH 5ADPH 4MQ7B 1A8JH 3UXFA 3BSZH 1WLHA 4XPHH 3ZT6A 3SPVB 4YXHL 3T0DA 4RMSA 5CHNA 2P44B 4WDIA 1IAIH 1WZ1H 3QZWG