5FYLE

Crystal structure at 3.7 a resolution of fully glycosylated hiv-1 clade a bg505 sosip.664 prefusion env trimer in complex with broadly neutralizing antibodies pgt122 and 35o22
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
213
structure length
213
Chain Sequence
SVLTQSASVSGSLGQSVTISCTGPNSVCCSHKSISWYQWPPGRAPTLIIYEDNERAPGISPRFSGYKSYWSAYLTISDLRPEDETTYYCCSYTHNSGCVFGTGTKVSVLGQSKANPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords BG505 GP120 ENV ECTODOMAIN
publication title Trimeric HIV-1-Env Structures Define Glycan Shields from Clades A, B and G
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 31
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2016-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fylE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fylE02
2DQHH 1QR1B 1MFAL 4UI2A 3RI5K 3EJYC 1DANU 5I0ZA 1FORH 1OP3K 3L3DA 4F15C 4U1JA 2EDOA 1AR1C 2FSEA 1QBAA 3OKDA 3PDDA 1K8DA 1MWAL 2NR6C 3GKZA 3R8BB 3MTRA 2BHYA 3MRJB 5EU6D 4BM7A 4WI7A 3QIBA 4JFHD 3BPOC 1ZGLP 3MJGX 1P6AB 5ID1B 3B9KC 4LLDA 1XGPA 2NTSP 1BP3B 2DIJA 1OP5H 5DD5L 4JPVL 1GOGA 4OFDA 4RFOL 1ZHBA 4NCDA 5LGJB 2YD7A 1NCTA 4FZEL 4XCFH 3SE3A 3VFSB 4OZGF 1G9NH 5I1GL 1FZMA 3KNBB 4JB9L 3MOQA 4OV5A 5C0AD 3HUJB 5HPMA 1X5XA 3TVMD 1T4KA 4OCSL 1OP9A 5IWLA 5D70H 4ZOCA 4UT6L 2EYTA 2BVPB 4JPWL 4QLRA 3ZDXE 4UQ2A 5B39B 1Z9MA 3OR6A 1GGUA 2FNBA 4HKJB 1JPST 1PKOA 4U6VH 3VFNB 5I1IH 2FWOB 1DVFC 2ZNXA 3T4YB 1S9KC 2A6KB 2M2DA 3D9AL 3C60A 3DX8A 1TQCC 4UIKL 4KZEL 2X4PB 4M7KH 4LSQL 3OZ9H 2P43B 4NZTH 1NCWH 4UOW1 4O9HH 1MVFA 4Z7OE 1MIEH 1PDKA 3LEYL 4XAWL 4J1UB 5D2NC 3UTTB 3MX0A 4KTYA 1PEZA 5DJ0A 3VWJA 1JRHH 4DKFH 2AKRB 2E5EA 2LU7A 5ESQB 2ICWA 4PLJC 4RMWA 3QCTL 4HT1H 3IJHB 2CXKA 1N7MH 1R24A 4X83A 5KVDH 2BSTA 2H8PB 1UXSA 3ARUA 3GSOA 3ZYZA 5IKCB 4LCUA 2X5PA 2CRIA 2EIDA 1MJJB 1HINH 4NKDB 4YGAB 3WFEH 1RJLB 1TZGL 1Q94B 4O2CA 3TCLA 3ZKQD 4M7JL 3NZ8A 1MCWW 5FUCE 2G5RA 3K0WA 2O5YH 3DJ9A 4R7DB 1LWRA 2Q1EA 3MLWH 1XF2B 3MLTB 1EUUA 1FYTB 2ARJB 2P5EA 3LMJL 1P4IH 3EJZD 3PXHA 1D5ZA 3LQMA 2WBWB 4N0UE 5GS1B 3GSNH 2CUHA 3QG7H 1U8JA 3FRPA 3UYRL 3MRCB 3BAEH 1P4BL 3GHEH 1MCEA 2X9WA 4UNUA 4KUZL 4XC3H 4OZIB 1Q9OA 3UTZB 4YQXL 3IU3B 3V4VL 1FSKB 2D0FA 1KIRA 4R2GB 1CFVL 2IAMA 4RGOL 2C1PB 2BOCA 3O45A 4WFFD 3TZVB 4S1SH 1HCFX 3NN8B 3SE9H 1V3LA 4ERSL 2RIKA 1QLEH 4NQCA 1CXIA 3BW9B 2OTWB 5ALBH 3QQ9C 2JKXA 1PBYA 1MHHB 2AJSL 1RZJC 3TJHC 1J05A 3SCMB 1J12A 1C12A 1NC2A 4LLWB 5GGTH 4YX2L 5KVGL 1CD9B 4NM4H 3L95B 1D7FA 3NFSL 4PJDE 1L4IA 1LQSR 1IGCL 3EYQC 4FQLH 2VDQH 2OQJA 1OCWL 2P8MB 4OCWH 1C5BL 1NFDE 5IMKA 3CNKA 2ZPKL 4X6EB 3QXDB 2CKBH 3E6FA 3GSRB 4DN3L 3MOBH 1JVKA 1C16A 4Q0XH 3MRIA 3DTXB 1PSKL 5SV4A 1TNNA 3EZ8A 3VI4F 2YPKA 4M61A 1UC6A 1A3LH 3QUMH 1ZGLM 3HNVH 1ND0B 1IBGL 3MREA 3NFNB 1FL3A 3OF6D 5EU6A 3FZUC 4LCCA 2OCFD 4P99A 2ILLA 5TF0A 1CGUA 4OZFB 1CDCA 4HIJA 2CDFB 5IJKC 2ENSA 4P59L 4LSRL 3I85A 3BIKA 1OGAD 5I1AB 2EECA 2EDXA 2CKNA 5ADOH 1M7XA 1Z0MA 3SBWC 4NCC2 3K4DA 4OZHF 1S7QB 1B4JH 1IAKB 2FBJH 1TTGA 3C9NA 5EPMA 3LPFA 1OSPL 5C9JA 1K4CB 4Y4HD 2QADD 4BQBA 4JQIL 2DLTA 1NCCH 4XCCH 5D1ZB 1UT9A 1W8NA 4KMTH 5MEPB 1E4KC 1L0XA 3BQUB 5CJQH 4U1NB 1KBGH 1A3QA 4JZOB 1PFCA 1D9KB 4MA1C 2H32H 4RAVA 1M6OB 4GJTB 4IMKC 3A6BL 3F5WB 1GZPA 5JORB 4KFZC 4O4YL 4RBPH 4NQEE 3H9SA 4ZO7A 4WTZG 3S5LB 5FO8A 3TN0C 4LLUB 4N9GB 1P5VA 4KJWC 1OL0A 2X7LB 3CFJB 1JGLL 1YPZA 4KQ4H 4R7NB 1GRWA 1QLRA 1T2XA 3FQTB 5IHUL 1F00I 3B2UC 2G9HA 4HHAA 3L1OL 3MJ7B 3GI8H 3CVIH 5F1SA 3WD5H 1AXTH 4MNGE 5CSBA 3L3JA 5FO7B 3RGVA 1AJ7L 5I1LA 4ZYKA 4MZ2A 4JPKL 1JWSA 3VW3H 4LHUA 1MFEH 4F58L 3ARFB 1F4HA 2MCG1 1G7IB 3F6IA 1K85A 5KSBB 1NEUA 2WNGA 1AY1H 2ATPA 3U0WL 4HK3N 2OJZH 4JEGB 2PYEB 1SJEA 1BF8A 4ZFGL 4GKZA 3FHQA 1KIUA 4L4VD 1IQDB 5MEQB 3RWIB 8FABA 3DYOA 5T1KB 3UTOA 3U9PH 4X6DA 2WWKO 4YUEH 3Q3GB 5GGRB 3DOSA 3E6HB 4HDIB 2X4UB 1WBXB 1FN4A 4WTXA 1J0ZA 1CE1L 5EUOE 1BQHB 5SWQB 1WCBB 4P5KA 3QXTA 5AWNL 2HFGH 3KYAA 4CKVX 4OF5A 3CH1A 3G9VA 1A14H 4YK4C 1Z9OA 3JWDL 3BP7B 5FO9B 4JFEE 3G5YB 2DYPB 3FFCD 1D5MA 3STLA 5KANG 4ZUUA 3UMTA 4YHIB 5HGHA 5EU3B 4MNHB 3ORJA 1GH7A 1V7NL 5AAMA 5CEZE 3ZL4H 1FFOA 4GLRI 5KSAD 4YXKH 3SY0B 3CFEB 1B6UA 3IB4A 1T7VA 1IQWL 4O51A 1OWRM 2E7CA 1AGBA 1XF4A 5GHWL 4DQOL 1MFCH 5CSGA 1K5NB 4R26L 4PRIB 5EN2A 3RDTD 3P0YH 3BKJL 1YYMH 3JTSA 2WZPD 1GC1H 4UDTA 1I3RA 5E2JA 3T3PE 4WFGD 1MCOL 3QWOA 2ZUWA 4N1EA 3TFKC 3L5HA 3Q5TA 5C08B 4P2RD 5DFTA 3UTSD 4QHKJ 3BPNB 1EDQA 3O2DL 3FQNB 3TO4B 3ZKND 1WCQA 2NY2D 4GQ9L 4JFED 2OM5A 3MGOA 1YJDH 5BJTB 3MV7B 4ZPVA 5HDQH 4Z7QE 4YHML 4X5XB 2W0FB 1CD1B 3O4LE 2WBKA 5HPOA 3O2WH 1LO2H 3EYUH 1OGAA 4NBYB 4EIGB 4OTXH 3INUL 2BX5A 4ZDHB 1R3HA 1F6AA 3P77B 2AJYL 1PW3A 4R6UA 4RAUB 4LOUC 5FYLL 1IAMA 5C0RL 3LPWA 4OZGA 4ZS7H 2J6EL 3VRIB 4P2OB 4YIQB 3V6FB 3GEWB 2VSCA 3MLXH 2BSRA 1XGUA 2XY2A 3UPCA 5DD1H 4ELME 2XTJB 2R4RH 4RIRB 2Y7QA 1ONQB 2LV4A 2Z31C 2NY4B 5DRZB 5IW6B 4GH7B 2AJUH 3N85H 4I0PB 5GS0C 5DC4B 1RZIB 2VZVA 3U4EA 5EZJB 2R69H 4AYFA 4CMHC 1OOAA 3QQ3B 4G80B 4ZXBC 1DUYA 4NWTH 5F89A 1DBKH 3D6GA 5CILH 1WWBX 1NGWB 2I5YH 3MACH 5D7JB 2FATH 4ZD3H 3PL6C 1ZA6B 2F53A 2PO6A 1CN4A 3HR5B 4M7ZB 2X4RB 3GMMA 1RQ5A 2MJWA 1QRND 4XNQB 4GAGH 4L29A 5FHBL 1G7PB 2GUOA 4L9LA 5DMGC 1Z3GL 2BNQB 3DUUB 2EDNA 2DIAA 5C6PB 3F7RA 1B2WH 4LKXB 4MD0B 4WU7A 5ELIA 1QACA 3JVGC 4DZBB 4J6RH 4RGND 2C3GA 3BKCL 1J0IA 5I1JL 1N6QL 3ZDYE 5BRZA 4TNVF 4Z6AT 5EU5B 3PNWB 3MBEA 1CLOL 1K2DB 4GOSA 4IRSC 4U1SB 1IGTA 1Z9SA 4GSDH 2YPLD 3MV9E 4KROD 5A2FA 2W1NA 4E0RA 1DUZA 5JZ7C 3TBYA 1AP2B 2PW2A 4Z5RA 4KJYB 5E5UB 1RD6A 4JKMA 4OZFH 1CDGA 2EDQA 3R1GH 1ULVA 2YEZA 4RSVA 4MJ6B 3OPZH 3M17A 3OKEB 4RRPA 5C07E 1F3RB 1H8NA 2QBWA 1I7TA 1WUNT 2VXUH 4YFLF 3SJVB 1P84J 1YEFH 4L4VA 4PY8I 2D0GA 5I66B 4NQVB 2P46B 3EDKA 1MRCL 3AXLB 4KRPC 2WP3O 4G43B 2EYRA 4JFXB 1MAKA 1ZHKB 5J0BA 3ARXA 2BY2A 1JGUL 4PP1C 5HI5D 4B7LA 4FFVC 2HKHH 2MPAL 3FO2A 1T20B 5KVMC 3HRZB 4N8CL 1UZ8B 1I7UA 4TN9A 3QRGH 4H20H 4NZDA 1FGNH 3GB7A 1U3ZA 3PHOA 1RULL 2H2SC 4NZUH 4M48L 4QWWC 4P46A 1MRDL 5GGSY 2XQYK 4HSQA 4NRYA 1DDHA 4FFYL 2O61B 3V6OA 4ORGB 2BNRB 4NN6C 2XN9B 1MWAB 2ZCHL 2PR4H 1Q8MA 4ONOA 1AE6L 1G7MA 3UYPA 3HZVA 3EO1B 2BC4A 1PQZB 4LDEB 5C07D 4U6YA 5KSAA 4JY5H 1J0JA 3HUJF 4PJGF 4XWGH 5DURB 3SPVA 3BN9D 5I1EH 4HLZG 5M95B 1KTLA 4HIIA 1KXQE 1RZ7L 4JJHA 3HMXH 3NA9H 5EBMB 5DMJB 2X4QB 3ARBD 4Y0GA 5FYJE 3CLEH 4K94C 3MA7A 5K59E 2ADJB 1Q0XH 5C6TH 4OFKA 3H7LA 5CCKL 4JN1H 5F44A 5ICXA 3EDFA 4EN3C 4OIIH 3CZJA 4P9HH 4IIQA 4E5XB 3BH9B 3C09B 4HK0A 4NNXA 1J0HA 3UTSA 4P2RA 1EHXA 3UBXB 2B0SL 4RRPG 1EGJH 1IFHL 5TDOB 3S34H 5I1KH 1QBBA 2IQAA 3S35L 1T1YB 1MUJB 2D03H 4I4WB 5ALCH 2ICCA 5FUZH 3DVIA 1G7QA 3JWOL 4ODSH 4L8CA 4EDXB 4GO6B 3RL2B 4Z77A 4YNYA 4P2QB 1MREH 3IXAB 4EXPX 4ZO6A 1X5IA 5HHVL 4WV1C 1OAKH 2XPGB 4MDJA 1S8DB 2DBJA 4N90D 1MHPH 3HC4H 4GMSL 3MLYL 1IGFH 1BZ7B 4OZHA 4R4NC 1Q9KB 1T04A 1RURL 4N8VB 5IESL 5TH2A 2DQTL 3VGHA 1ZV5A 2CIIB 5F1IA 3MODL 4X4XA 1S5IL 5A16B 5I16B 4OCNC 3O11B 5EO1B 1BVLB 1LP9B 3V52H 5DT1L 1TJIL 3SKJL 3TBSB 4CJ0A 4Y16D 1LDPH 1KT2A 3MRQA 1S9XA 2VC2H 3G5VB 4NN5B 4NJ9L 3WNKA 1SEQL 2A0LC 4C56B 3K80A 4MXVE 4NQDA 2DDQH 1CK0H 4K9EL 1JPTL 2ESVD 4MJ5B 4X5WA 1PZ5B 4XH2A 3WJLA 1U8NB 4WWID 2DQDH 1FGVH 5EZIH 1UACH 5L8LB 4NKIL 1QRNA 2NW2B 2QHRH 5IMLA 4NZRL 4NJAL 3X13B 2WLYA 1TQBC 3LRHA 1S7XB 4JREC 5I76A 4LSUL 4MHHI 1LO5B 1RK1B 2DQFA 4I2XA 3WYRA 4XPTH 1ED3A 4HKZA 4FQXC 1WTGT 4WI9A 1JUFB 4TTGA 3RIFK 3SDXB 4LSSH 1J11A 3MOAH 2IAND 4FN0A 2Q8BL 3FT2A 1QLFA 5TFSH 5L9DH 1JZ7A 4LFHD 4JO4H 5CUSH 4YWGL 1KLGA 1HIMH 1GPOH 5JOFA 5DLMH 4OB5H 3E1F1 3V4UL 1BVZA 5I1CL 5ILTL 3D18A 3ZTNH 5E0QA 3LKOB 5F9OH 3ROOB 1H0DB 1OGTA 5K9OA 2JELL 1A7PH 4NFBA 2HVKA 3KXFD 3L5XH 3O6FD 1UB6B 3QFDA 1PY4A 3MNWA 5BV7L 3BDBA 4M1DL 2HT3C 5GISL 1SM3H 5DK2B 3OJDB 2A6IB 4OLYH 5CD3A 3EYSL 5CIPA 5C0CB 2V7NA 5EORH 2NY3D 5I75B 4XPFH 5JW4N 2NX5D 4P4KA 2N7BA 2YA1A 1UWXH 3IFPA 4OM0L 4QRRE 4AT6A 4QY8B 1HHKB 1F11A 5TQ0H 3EYOA 3W9EB 3VXSB 1C7SA 4GRWE 1MEXL 1TDQA 3AY4A 2AV7B 2HRPL 3QPXL 1SBSH 5DC0A 3LEXB 1FFNB 1YMHB 1EFXB 2MKWA 4HGWA 3DSFL 1NEZG 2XNAA 3GSNA 2DQIL 1EPFA 3MBXL 1RK0B 3U46A 3LKSA 4RMRA 5FXCH 4A6YL 2WWMC 3ARBA 4L5FL 5F96L 3SEPA 2Z91B 4YPGA 4DAGH 4FQHA 4QXUH 2RBLA 4WI3A 1QFUL 3QNZA 4XVJL 5ACLA 5I30H 5T3XH 3BFOA 1FP5A 3HNTH 5GPRA 5IBLC 1QA9A 5C71A 2F54D 4J3XA 2UWEE 1KJ2B 1LE5A 3MRFB 2OL3L 3GUTA 1KB9J 1JWUB 4OT1L 3C5ZC 2AJZB 4H1LB 2A74B 4YDVB 3PGDB 4QRUB 5EO9B 1FH5H 4U3CA 1CFQA 5GGTA 2VH5H 3JV0A 5T3ZH 5H8DA 4RMVA 1X6LA 2Z8SA 1T0NB 1I1AC 1C1EL 1XCQB 5L6YH 1CDJA 2NY6D 1NLDL 3BYYA 1CR9L 4KI5E 2VN7A 4QCIA 2RCSL 3GSQB 3BJLA 2MTPA 1F5WA 4XBGA 4G8IA 3QG6B 4OF6A 1INEH 1LO4L 2X2YA 3V6BR 4D0CB 1MNUL 2HT2C 5CEZL 1YQ2A 3SDCD 5JR1L 1F2QA 5DZLA 1BFTA 3HZKB 5KSUA 4IMLB 4LCIL 3O3EB 2VLKE 4Y1AA 3QEQE 2NW3A 3HAEB 1OM3H 1UG9A 2X42A 1Y18A 4E42B 3QUMA 3S4SA 1ACYL 2VR9A 4Y16A 4YHZL 3JTTB 5FECB 3UPRA 3L3HB 3FB7A 4XP9H 2H26A 4JHBA 2BVQA 3QUZD 1UJ3C 4CMMB 3I02A 4Q2ZA 3HI1A 1N8ZA 1EEUA 3GJEB 3Q6GL 5SX4H 5L2KA 4MGXA 4UUJB 1DP0A 5DQDL 4W81A 1NGPL 1QPPA 2J2ZA 3MROB 3NZHH 3TPKA 3QIUC 4JLRA 2JIXA 4KTDH 3FQWA 3SDDD 5DMIL 2AERT 4YHPA 4NHUB 4UINL 2XV6B 3MV8E 1GIGH 1Q0YH 3QNYA 1NBVH 2MQ0A 1LK2B 3BO8A 3VWKA 4JKKA 3CC5A 4HWBL 4U1HA 4GKSB 1IZKA 3P4LA 2H41A 1XR8B 5E2TL 5LAXB 4KAQH 2H6PA 4XP5H 1IAIL 2SEBA 2IANA 4BZ2H 5IFAH 4XBPA 2CLRA 3D39B 5GGSA 4Y4KD 2CMRL 1X5HA 5J6HA 1UKSA 1NC4B 2H32A 5IV2B 4YHNA 3ULVF 4X7FC 3PGFH 1DLHB 4PB0L 4YBQD 4OCYH 5H35A 3ME0A 4M6MH 4ETQB 2E7MA 2GIYA 4E9LA 4U7KA 1OT2A 4M43L 1MJ8H 3KXFA 3O6FA 1A1MB 3RTQD 4TULL 3NAAL 1I9JH 1BD2A 1RUAL 3F6LA 4P2YA 4OQ1A 2VITB 4HXBH 4XCNA 4UTBL 4Y5VC 1T21B 1N5YH 3MV8D 1NAKL 1RUKL 1NUNB 4BSVA 5JPNB 1LO3H 1CG9A 4CN6A 1MY7A 4KKAD 4GXVL 5E08L 3K46A 4KV5E 3UROR 1UH2A 2CLZB 1F45A 3O3BB 4I8DA 4DN4L 4NO2A 2HJFA 5ID1A 4GBXA 4OAWA 4EBQL 1WC7B 4AEHH 4NIKB 2P5WE 5MENE 2WIIB 5CBEB 3EDDA 2ZCKH 3C6LB 5KJRL 4HWNA 1P4LA 12E8H 2JK5A 1IM9A 1XCTB 3HUJA 3KYNA 4PJGA 3EFFB 2YHGA 5LGHH 4JKLA 1IT9H 2P5EE 4U7MA 3CH8A 4JQVC 3H2WA 4YFEA 3R0MA 5KG9B 4TRPL 2IH3A 4H26A 3QUKB 4LFHG 4YXHL 1I85A 4HBQA 3BKYL 1AD0A 3T4YA 1R3IL 1PLGH 1E4XI 1J0YA 1E0OB 1U8IA 2YPVL 2F54A 1FRGH 2A1WL 3DURB 2FB4H 5CLTA 4EI5D 1FHGA 3F7PC 3RVXC 3JUZA 4K8RL 5EC1A 1JZ4A 1FFPB 1RHFA 4XXDB 2GQHA 4MB4A 1N5AA 4QRTA 5AG8A 3WKML 1CLCA 3O41B 4NQCE 3ZMRA 3FAXA 4GW1B 4PTUB 1KYOJ 3HLAB 3W2DH 1MHCB 1NBZB 2IADA 2AKRA 4M1CC 1JJUA 2FO4B 1KGCE 1MFNA 2JB6B 2P5WD 3QIWD 4ACPA 2J8UE 2OTUA 4KGJA 3DX6B 2QV2A 3I2CH 3QRFM 4PGCB 4LRNL 3E0GA 3BMVA 1ADQL 3IJHA 5E1HB 4OLUH 1QSVA 1KEML 5C0BE 1ACZA 1BLNB 2NMSA 1IEHA 5SV3A 3D48R 1U3HD 1QO3B 4I18A 4GKOA 5EOCL 3SDAC 5KN5B 1Q94A 4CU6A 3AAZA 4JRYE 4BELD 3BGMB 2EZ0C 2FJHA 5FYJL 3U0TB 4U1IB 4XC1L 4NKMB 3F8UB 1OP5K 2O26U 3NOIA 1RUML 3PIQB 4R7DA 2YBRB 3O9WC 3SO3C 3P0VL 3GMNA 2VDKL 1X6NA 4G6KH 4F8QA 5IM7A 4D9RD 1FYTA 4C59B 4XP4L 3QUZA 4PJBF 2NTFA 3EGSB 4G9FD 1QQDB 4EUPA 5KVFH 3S98A 2AJ3B 4F9LA 4QO1A 5D1QC 4JN2A 2IPKA 5IQ9B 3MRGA 3GSVB 1J1OH 1EA9C 4WHTA 3MCLH 2P4AB 5I6XC 3TYFA 3IU3A 1DBJH 1AFVH 3I6KA 3MLZH 3WIFB 5E2VH 1BFVL 5MHSD 3SDDA 4IEFB 4B0MM 5C0BD 1AGCB 4RQQA 4WWKA 4F7CA 3OGOE 1Z6JT 5E7BA 1QEWB 4WO4B 1HSBA 1J5OH 2FX8L 3BEVA 3Q1SH 4HS8H 3GIZH 4JRYD 3WFBL 1Q72L 3OKMB 1F3DH 3W0WB 4OFVA 1KENH 2Q76B 6FABL 1KPVB 4OD3H 4WRLA 1QNZL 4PS4H 3O6MH 2VLRE 4WHCA 5DEFA 4OI7A 3DROA 3IDIA 5DRXB 3L95A 1ZT1A 4ENED 1T6VN 2R2HA 1FCCA 3GMQA 4DCQA 4XNYL 1YEJL 4L1DA 2P8MA 1YY9C 3MUGA 5SWSE 2R23A 35C8H 5DEZA 3RTQA 5I71C 3UEZA 5AZEH 3U9UB 4FXKA 3L3IA 1AO7D 3I6GA 4LVOC 5H37H 3H9SE 1C08A 3RWCB 1ZHLB 4FP8L 1I1YB 2K7PA 1BMGA 2DICA 4LCWD 3HAEH 1GYAA 2R2EB 1I3UA 2ATKA 4NC2B 4I3SL 4M00A 4N0UB 1HHGB 4FHBD 1LNUA 2WUBH 3M1BA 1E6OL 3MRPA 4AMKL 3ZE2E 1KNOA 2VLRD 3VE0B 4YK4B 1MIML 5CZXD 3SKNB 3N50A 1FDLL 4WENB 4UTAL 4FQCL 4LSTH 5TPWH 1WWCA 4MHHG 4CVXB 2M8XA 4JM2B 4MA3B 1BM3L 2Q20A 4HCRH 4LDLB 4N5ED 2EXWD 4U1KA 4ESKA 3AU1B 4NQSB 4M93C 1FL5B 1JZ3A 4PGDB 2GFBA 2ZG1A 4Y2OA 2HTKC 1KJVA 1QFWM 4KRMB 1K4CA 1SYSB 4HGMA 4ZTPL 5IUSA 1I8MA 2EDLA 1T03L 4KTEL 5HHOD 5E8DL 4XI5D 2H3NA 5MEPA 5HI4C 3CDCA 4U1NA 3TH2T 1P84K 4HQQL 1VEMA 2VAAB 3FOLB 4BQ6A 4H0HB 4MZ3A 5E70A 1KEGH 1M6OA 3GIVA 2X9XA 2PNDA 2E6QA 4MWFA 4G7VH 4PRPA 3P4MA 4KI1A 5JW5B 5IFJA 3EZJB 3JWDC 4HJGA 4TUKH 3QIWA 4JFYA 2OR9H 4IRJD 4RNRA 1MF2H 3HMXA 4F3FB 2JB5L 4WFHE 4R7NA 3PV7A 3LKNB 5I17B 1T3FA 1UA6H 3EAKA 3O2VH 3VFWB 4DZ8B 3EDEA 1CBVH 3G6AB 3GGWA 1QSEB 3C8KA 3VH8A 3NIDE 4F7PA 2YC1A 1NDMB 3L3KB 3LQAL 4O58L 3TT1H 2BP3A 1F42A 5FAAA 3UTQA 1EGJA 4K2UH 3FO9A 2ZSWB 4BH7A 3P9WB 1B88A 3BWUC 2EKSA 4U1LB 2D7NA 2X44D 4UT7H 2MCPL 2G5BB 2ZUVA 5MI0C 3OR7B 5E1AB 3BP5A 1G9MH 4QRPA 1MQKH 4ZFFB 4ZXBB 2HG5B 3HPJB 3BRDA 4G9FA 3VFMB 3L3GA 4QHNB 5CJ8A 5FM5O 5GGVH 4AIOA 4MAYD 3GHBL 4JO2H 5DHVB 5ISZE 2IEPA 3WFDH 3ZKXC 2DQEH 2A9MH 5JQ6H 1P7QA 5A3ID 1INQB 4X4MA 4X80L 3VFGL 3U7AA 3G08A 4UIMB 5F9JB 3GM0A 2VLLB 3IFNH 3FT4B 4R90L 1HHIB 4G42A 4NYLB 4JVWA 5ESAA 5IIEB 1RPQA 2NYYC 1Y6KR 3QBTB 1XIWD 4TPRH 1N0LA 1FNGB 1AGFA 1ZANL 4NQEB 1JHKL 2X4NA 3QCVH 2BZDA 3K3QA 4RBPK 4UT9H 3VG0H 2FH8A 5CJXA 4DVBA 5JXEC 3D0LA 3TVMC 3ZHKA 5HYJB 2GJZA 5CEYA 3VXRB 1KCUL 1DANT 4YLQT 3NCFB 4Y5YA 5JUEH 4OJFL 4JRXB 2F53E 4ZS6D 4PRIA 5KVEH 4JFFD 2FL5B 3ZE1F 3CFKA 3BGFB 1Q38A 4PY7A 2A9NL 4A6YB 5J7CC 3GMLA 4LCWA 3FKUS 5FCUH 1T1ZA 4PJ5A 2GTWB 3VD9A 2ADFL 2UYLA 3KR3L 3DMMC 4HX1A 4YAQB 1DN0A 3RU8H 1HN1A 1X4ZA 3Q6FB 4PG9B 4JO1H 3CMOL 3BRGC 4M8QB 1JHLL 1CF8H 2R2CA 1ZGLA 1X5GA 1CLYL 2EDHA 1OF2A 4PP2B 4JM4L 4NN6B 5BOZG 3P77A 1R5IB 4W4NA 1XGQA 5EIIA 1VGKB 4P2OA 4MSWB 1KC5L 1FE8H 2YWZA 3VRIA 3DYPA 4Z76B 1LILA 3HTLX 4HFWB 5I8OL 1FNHA 1WISA 1Z2KA 5JHDE 5HHQA 2HMIC 2BMKB 2KKQA 4JCLA 1CFTA 4X6BA 3CXDL 4GG8B 4OCXL 4NNYA 4ZNEA 3FRUB 5TDPA 2FGWH 3S7GA 5DSCB 1A6WL 3IAPA 5TQ2H 1S9WB 4FA8A 5ESVB 5E56A 5DRZA 3FO1A 4M6OH 5HHOA 4I0PA 1J9CT 3OJ2C 4L8SC 3PWVB 4AEEA 3DECA 3N1GC 4W6WB 1LD9A 4V1DE 1I7ZA 1W0YT 5L2JB 2APXA 4Y4FA 4P23B 2CR3A 4GRLD 3SKMB 4EQ3A 5FYJU 3D3VE 4HGKC 5B8CB 3ULUD 3SOBH 1YN7B 1YUHB 1K8IB 3UP1A 1IGML 4QHLB 3VD4A 2IQ9L 4GAFB 1WAAF 2EXYD 5J1AB 2HJKB 4GG6B 4K3JH 4M6NH 2F15A 1FZJB 2A73B 3NCBB 1LHZA 3GSUB 4DZBA 1SJXA 2F5AL 1I1FA 2Z0BA 4HD9A 5DJ8A 4PJXB 2YN5A 4HZLB 1AHWB 5FUCC 1B6DA 2OMBA 1IL1A 3REWB 1EEZA 1QBLL 2EDJA 3MNZA 2AABL 1JN6A 1GCFA 4KHTH 2AK4E 4X9FA 4ZSOE 4DOHE 1RJZA 4AL8H 3LKRA 5TDNB 4AY0A 4PJ8C 4BK4A 3HE6D 5FA4A 5LXGH 4FQJH 3T3MF 4HUKB 1JGEB 4DW2H 1F3DJ 3KPOA 1NGQL 2J8OA 3QA3B 4E41B 3P30H 3D3VD 1CDYA 3VXQA 3FHAA 4KU1A 4MDIB 4X6FB 5F7YC 3VI4E 4XP1H 2D7TH 1PYWA 4PJBA 2OYPA 2QL1A 1FLRL 1GGYA 5DD0L 5B22A 3K7UA 3AXLA 3JWOC 3PF2A 1M1SA 3RNKB 5TF1H 3KLDA 4X7SL 1S7RB 3GM8A 5D8JH 4UV4H 1HSAB 1RUPH 1T22B 2YN3A 1KB9K 3BOVA 2OR7A 3TBVB 1WZKA 3WS3A 3ULVH 1TPXC 1XT5A 3QI9B 2EICA 1DJSA 4JFDB 3OKLB 4RFNB 3SE8H 2XA8L 1VGEL 5C7XL 1J8HE 5D1XC 2B7DT 1KLUB 2B2XL 2R0WH 2VNCA 4LIQH 2AK4D 2ZG2A 1IC4L 2X41A 2BVEA 1XIWA 4M8VA 3RWHA 3DX7A 2AS5M 1Z0NA 3PDOA 5IMMB 4MNQE 1KCLA 1U93A 4XBEL 1MCNA 1CU4L 1E27A 2DB8A 3KPLA 1U92A 5ADPH 4NHCL 4OGXH 3L6FB 5ICZB 1UWEH 4PR5A 1MCKA 2JCCB 4KK5C 3ZKMC 2PW1B 4Y4HC 4DFIA 4AEFA 4JZJC 3TBTA 3T0AA 4HK3J 3PJSB 4NQDE 3WBDA 1DBBL 4D3CL 5LVEA 1UWGL 1JV5A 3MV9B 1HHHA 2WBJD 5E8EA 1C5DA 2DM4A 5IQ7L 4HUUA 3G04B 4MQ7A 4G9DA 1ZAGA 3RZCA 1KXTB 3WFCH 4XMPH 5EOQL 2R8SH 3IDYB 3P9LA 3UBXA 4I2XE 1J8HD 4HH9A 3WN5C 5C0EA 2FJFA 4IDJH 1X4XA 3NCYS 1BZ9A 4JANA 4MX7B 4XX1G 4Y2DD 1KIQA 1AR1D 4GAYA 4PYHA 2AK1L 3JWNC 5GS0H 1VADB 3MLUH 2NR6D 2PTTB 4IS6A 3NACH 4P2QA 3J8F7 1CGSL 5AZ2L 1GL4B 5ICYB 1J86A 1KCSL 2HFFA 3T1FB 1ZVSB 3B9KD 5HBBA 4X6CE 3BSZL 4M5ZL 5KW9H 2ITDA 4FFZL 5DXWA 1T89C 4L9DA 2F8XC 4QGYA 3KPRB 1VFAA 5C09A 3QH3A 4EOWL 2R1XA 2OSLA 1JHTB 4Z7VB 1ZVHA 3GRWH 3ARPA 4UU9B 1HWHB 4LSPL 4PV8B 5DJCA 5TE6H 2YD4A 4Z78A 3VFPB 5DRWA 3RX8A 5C1MB 1PY9A 4YGVB 3BPCB 5BV7C 2HWZH 5HHMD 1YMMD 1FL6A 1JNHA 1LGVA 4I3RL 2R0KH 1CICA 5HHPB 1DVFD 4OLVL 2Q6WA 3MGTA 1BEYH 4XHJD 4LU5L 3UDWA 3F12B 5DRNA 2I25N 3U0PB 3P4OB 3TIDA 4C56A 2EDYA 1BWWA 2XWJB 1RJYA 2HFEA 4HKXA 1E4XL 3PGCA 4J3UA 3DRQB 5I1HH 2IG2H 3K2UL 3BUTA 2VLJB 3V2AR 3X13A 2C4FU 1UVQB 3QDJA 1RVFL 1B0RA 2ZUUA 3IDJA 1RK1A 1I1AB 2EE3A 4HMCA 3RPIB 5E8OA 3LS4H 3H7BB 3KLAA 5MEOA 4PLJD 3S37X 4ZNCD 3MR9B 1MJ7L 4PRAB 4YFLI 4YXLL 5FB8B 4NRZA 5F9WC 3UAJC 5DUPH 1NMAL 43C9B 2WSKA 1NKRA 4MMZC 5D2LB 3C6SB 3U2SB 4BQ9A 1D5XB 1NL0L 2BVTA 3U83A 4S1DD 3MNVB 1TVDA 3QDME 4XP6L 1KJMA 3CCHB 3U82B 3FONA 4L4TE 4PJCA 3ZHLA 4TOYL 5JIHA 4BFEA 3QHZL 5F7EH 3WHE0 5D71H 3BEWB 3MZGB 1AGEA 3KPSD 4Q9QL 4IRZL 2HAZA 4PJ9B 4L3EA 1B9ZA 2G2RA 4GKNA 3OB8A 1U8QB 3KPNA 1QSFA 1N64H 4AIZA 4LAQL 2PYFA 5DEGA 3RDTC 5HHNA 3DPBA 3ARDB 4LK4A 4WI2A 2BY3A 4Z7UB 1DQDL 2HVJB 2A6DB 1NCDH 1D5IH 4P3CH 4MB5A 2WLZA 1HE7A 5F70A 2AXGA 3ZKNC 3PWJB 4K94H 2Z8WC 5JW3H 1DQTA 4O2EB 1QFWH 2VTFA 3KPMB 4G6FD 1KYOK 3VJ6A 1HHKA 4APQB 1HYSD 4L4TD 4PUBH 4Y1AE 5FFLA 5FHAH 3QQ9D 3G6JF 4HH8A 4WDIA 4OUUA 3MRNA 2AV7A 2YZ1A 5EO0A 4R8WL 1FNEA 4PJFB 4MA7L 2YWYA 3SE4A 1MCRA 3OXRA 3P73B 5FA3A 1OTUD 4UILH 2DM2A 5E5MB 1KPUA 1WZMA 1HEZA 4TVPH 1NGXB 5C3TA 1M7DB 1NCAL 4FQQB 5JNYB 1T5XB 1GHFL 5BS0D 1A9EA 1FZOB 3VXMD 1GOFA 5L2KE 5FYKH 5L88H 1X7QB 4P3DB 5CGYD 3O4OC 5FF6B 5J3HD 2P24A 4MXQD 2ZUQB 3ZTJG 2EYSB 2X4SA 2GW5A 3RVWC 4WEBL 1V05A 4RDQF 1MAML 3RY6C 3FTGB 1ETZA 4OLWL 3AUVA 2CK2A 2LFGA 1NUGA 1RZGB 4ODUB 5E00B 1S3KL 3FZUD 1HZHL 2ADIA 1XCQA 2R4SH 1EO5A 4OD1H 2X9YA 4YR6B 1Q9WA 1BIIB 3B9KA 3IDGB 3VGDA 1OB1A 5KZCD 4MA8L 3T0EB 2KBGA 1NCNA 4WW2C 2F58L 4JAMA 4H5SB 2E9IA 1UWXK 3GNML 4QXGH 4U0QB 1FYHB 5CS7A 2J4WL 1DQLL 5FDWB 4WUUB 4KROC 1A2YB 1MPAL 4XCEB 2EDKA 5MERB 2FX9L 5E6IC 1BD2E 4BFGA 1HWGB 2W9EL 1OAXL 1D5BB 1YMMA 4E42A 1ZEAL 3DI2B 1A6PA 3UC0H 3EOBA 1E28A 1WZ1L 5DJZB 2AXHA 1PG7H 3OX8B 1XR9B 1ZK9A 3RY4A 3RWFB 3B5GA 3HI6H 5C2BH 4QXTB 2ED7A 2YK1L 5HI5C 4HCRA 3K8LA 5HDBE 3VFRA 5D2NA 2ICEA 4PLKD 1U8OA 1YQVH 2LTQC 1IGIH 2R0ZL 3ARED 4BQCA 3QYCA 5DJDA 3UTPE 1IM3A 3L5WB 3D25B 4MD4B 3TN0D 1WAAA 4KJWD 1MLBB 1YEIH 3KPQB 3MO1A 3WE6A 3MCKB 2XI9A 5A40E 5C86A 5IVXB 4MS8C 5DO2D 2QQKH 1XGTB 2DN7A 3HUJE 1TJGL 1U8HA 4MJIB 2HRLA 3CMGA 4DUXA 2OJEB 3C8HA 2B1HL 3RL1A 4RZCB 5DD3H 4BK5A 5KS9F 3MYJA 5C0FB 5IROC 5B38A 3VRLF 3QFJB 4N0FA 2X4OA 1BOYA 3KPSA 1DLHA 4TUOA 5EZOH 4ZTOH 1T2JA 5F7DB 5GRJH 2CXGA 3O9WB 3SO3B 32C2A 3TV3H 2KL6A 3GMOB 4XZUA 2FZ3A 2IH1B 1WIPA 1LEIA 3O0RL 2FLRT 1T21A 3BDYL 2GSGA 5JMOC 3NIGE 3SGJC 1CL7I 2HYMA 1IGYA 4M7LH 3L3DB 1DFBH 1A0QL 4U1JB 2IGFL 3K8MA 5JPNA 2FSEB 4MMXC 3OKDB 2N4IA 4Z7NF 5GGQL 1K8DB 1DQML 1VSCA 5JOPD 5CHNA 1TZHA 3KYMA 3HZYA 3SGKC 2E8YA 3F58H 3WHE1 3QEGH 3ZT5A 3BPLC 3LH2H 3QIBB 3KYKL 4LLDB 1XGPB 5DWUL 1ZHBB 4Y89A 5I8KH 3FCTA 4LLYA 4KC3B 7CGTA 1FZMB 4NGHL 3HPLB 1C5CL 3O8XC 4OV5B 2IMMA 4RWYH 5HPMB 2VISA 1BGXH 4F57L 1T4KB 3VXNA 5FEBA 4YHLL 1FYTE 4MXWH 2EYTB 3UTTD 4Z0BL 4UQ2B 3OR6B 1P6FA 2E9BA 2OXHA 4DUWA 5BS0A 3O6LH 3VXMA 2L7UA 4LGSB 1F4YL 4P5MA 4OSUL 3C60B 3DX8B 4OZIE 2B4CL 1H3GA 3MRHA 1RFDL 3TFKD 2DF3A 3K74B 1RZ8A 2Z92A 2XT1B 1A6UH 3TYGH 4Y19A 5DJ0B 3VWJB 2QQQA 1IC7H 1MHCA 3U4BL 4OIBA 4PJEF 4HUNB 2ICWB 4HWEL 1I8LC 3DX6A 1WFOA 3LN5A 5IJKA 4Z0XA 2DQHL 3NPSC 1R24B 5JDJA 3E2HB 3HRPA 4X7DC 4QOKB 5T1LD 1FORL 1UXSB 3SBWA 3GSOB 4LCUB 4PJXF 5L8KB 4LOUD 3TA3D 5BZWA 5TE4H 3RGHA 5BXFA 3VGFA 5F72S 3ALXA 4O2CB 3TCLB 3RRQA 2EDDA 5DD5H 1A6VH 1ORQA 3NZ8B 1EX0A 4R2GD 4ALAH 3S3SA 1IILE 5I1GH 1ZT4A 2B1AH 2DKUA 2EE9A 3HC0A 4PB9H 1VFUA 3TZVD 5TJWK 4XCFL 1G0XA 4OCSH 1G9NL 1E4KA 2R29L 2YRPA 3B9EA 3MV01 4NPYA 2P5EB 1CVRA 3U6RA 4JPWH 2F19H 3WIHH 1D5ZB 4NO0D 3T77A 2YD5A 3IFOA 2XQBH 4IMKA 1RY7B 4UIKH 1Q9OB 4KZEH 2NY3C 3AB0C 5GJSH 1QD0A 1KIRB 3IYLW 5I1IL 4PIRF 2BHZA 2BOCB 2NNAA 2RR3A 3QAZB 3TN0A 3V4PL 5DMGD 3UJTH 2H9GA 3LOWA 1PJ9A 2FIRT 4M7KL 3OZ9L 3HA0A 4NZTL 4ZOAA 3EYVA 1JP5A 1NCWL 3TM6A 4NQCB 4O9HL 2Q3ZA 4OLXH 2YD8A 5DI8A 2GCYA 1MIEL 5IBTL 2DL9A 4GS7C 5LJYH 1J05B 1PG7X 4DK6A 1C12B 1NC2B 2FLBT 1JRHL 4DKFL 3VCLA 3BD5A 2X1QA 1N7ML 5KVDL 2EC8A 3H3PH 2OQJB 3W39A 5HY9A 4M7JH 2VO5A 4FOMA 5IMKB 4JZNA 1HINL 4OKDA 3OGCA 3E6FB 2HJLA 3MC0A 3A6CH 4FFVD 2YPKB 4M61B 1DSFH 2FCBA 2R2EA 5KTEL 3MLWL 2V5TA 4DEPC 3MJ8A 4IJ3B 3MREB 1FL3B 1DBMH 5EU6B 4LCCB 2NY6C 1P4IL 4KUZH 4HIJB 4QWWD 3KHQA 5I19L 5HYEA 4DTGH 3GSNL 3BIKB 5D1ZD 4XGZA 1S7VA 3GHEL 5D6CB 4HW6A 2V9TA 4NRXA 3G6JA 1B0WA 5EUKA 4P57A 3SDCC 4NQXA 3TT3H 1TTUA 1OARH 5IEKA 5KSBE 1D9KD 1EBPA 5AD0B 3C9NB 5FM5M 4PGEA 4Z7VF 5EPMB 3TVMB 1A4KA 4QRPE 2PYEE 5IOPA 1ZLSH 1QLEL 1U36A 4LVNC 3L7FA 3B9VA 3QUXC 5DGQA 1R3LA 3R06A 4M3KB 1JMXA 4KY1H 5SWZD 2BSED 4X4ME 4NM4L 5A1AA 2BY1A 3VGBA 1EAPA 2DRUA 3LCYA 1CLZH 4QRSB 3FOLA 5FKAA 1AQKH 1R6VA 1C5BH 4RAVB 3CZFA 4KI5C 2QTEA 1MFBH 2DI9A 4FQLL 1GZPB 2VDQL 3EFDH 4OCWL 3W82A 1MVUA 1U8KA 1RIUH 3D85D 2UVEA 2NQCA 1EERB 3H9SB 4Y5XC 3SKOA 4ZG1A 5FO8B 3BHBA 2CKBL 4TVPD 1YPZB 9CGTA 5M7QA 3BD3A 3MOBL 1QLRB 2VSDA 2AXFA 5T1LA 4YC2C 1GAFH 5EU4A 4HHAB 4UV7L 3ULVE 2BCKA 2Z4QA 3QUML 5D7IF 5D2LF 3PQYD 3T04D 4R4ND 3UO1L 3HNVL 5B39G 5HVHB 1N59A 2Z9TA 3L3JB 4Y4KC 5CINH 4LSRH 1N26A 3RGVB 5HYSA 1PG7W 2NY1C 3NCJH 5I1LB 4PRIE 4ZYKB 4LHUB 4B7IA 1IC1A 3GBLA 3QJFA 4YBQC 1F8TL 4RWHA 2V2WA 1PKQA 3SQOL 2Z31A 1LK3H 5ADOL 2ATPB 5C08E 4Q9RH 3E8UL 4J3VA 3OR7A 2FBOJ 1B4JL 1OSPH 1SJEB 2BJMH 4M5YH 2OS7A 4GKZB 1VA9A 2FBJL 3GO1H 4R97B 4ZXBA 1V3MA 1F58L 8FABB 3ARYA 2NXZB 3VFMA 4QHNA 4NO0A 1NAMH 4X6DB 3PL6A 3VXUD 4RMTA 1FO0L 2V5SA 3MV7E 3HG1D 4OF3A 2B5IC 2GK2A 1FN4B 1AKJA 1NCCL 4XCCL 1TETL 1MCSA 4CBPA 1UZ6E 4KMTL 3GRWA 3GJFA 3ESVF 4P5KB 5CJQL 4G6AD 1KBGL 1HHIA 2W65A 3CH1B 4K23L 1S5HA 2FD6L 3JVGA 2WUCL 1D5MB 4FQXD 3STLB 4WHYG 4ZUUB 5HGHB 3I3EA 1XF5A 4ZNEE 4IRSA 3VXTB 3AMKA 5KS9A 1FFOB 4V2CB 3UBXI 2VABA 2VAJA 3L1OH 3CGTA 1NCUA 4KQ4L 3TO4D 2VDNH 4O51B 3VXRA 1YNLH 1AGBB 1XF4B 4YBLC 2J5LB 3GI8L 3CVIL 5EN2B 3N9GH 4JPKH 3MV7D 3FOMA 3JTSB 4JFQA 4UDTB 1I3RB 1ZLVH 2A6JA 3HC3H 3QWOB 3QQ4B 4EI5C 3SGDH 1KCVH 1T2QH 4KH2A 3VW3L 2ZOLA 1MFEL 3DO3A 3U0WH 5CEXA 2HLFC 1TMCB 2ITCA 4ZFGH 3GI9H 1OAUH 1AY1L 4YDKL 3B5HA 1CFNA 5D72H 4MD5A 2OJZL 3MGOB 5T5NF 4XNUH 5C9KA 5T3XE 2DM3A 2XTJD 5CWSA 4PG9A 4ZPVB 2DQGH 1VKXA 4KHXH 1T0MA 4K7FB 5D6DC 3QO1A 3U9PL 1XMWA 1A9BA 1OGAB 4KDTC 1R3HB 5AWNH 5F71A 4OZGB 4X7EC 1T1XA 2BDNH 1U3HC 1IGJA 4MSWA 4HBCH 4OI8A 3LRGA 2LU4A 4F37F 1OVZA 4HFWA 5BMFL 2BSRB 2HFGL 3SJVE 3BZFB 1XGUB 3MFFA 1H3VA 2AW2A 4NO3A 2KPNA 2ZUXA 3LDBC 5D7LD 1A14L 2CH8A 2Y7QB 4P5TC 2QADB 1AIFA 2VQTA 1S7SA 1UQSA 1OAYH 2BNQD 1EXUA 3U4EB 4EN3A 5IBLD 5SWZA 3ZL4L 1DUYB 1IQWH 4LSDA 5F89B 1GOHA 4YXKL 2ZKHH 4ODXA 3VXPA 4R26H 2R1YA 2PO6B 1T7YA 3C5ZD 5IB5A 1ZT7A 1UB5A 3GMMB 1W0WA 4OZFG 1I4FA 1MFCL 3QO0A 3K1KC 3N06B 5I0DA 2GUOB 1YYML 1GC1L 4L9LB 4PJEA 3BT2H 2XN9E 2OMNA 4S1RL 5L0QC 3O2DH 4KKBD 2ADGA 1FZJA 4GQ9H 4WV1A 3KPPA 4WU7B 1L6ZA 4GXUN 5FGSA 1P53A 4KK6D 1DEDA 4HMDA 1ZWIA 5IK3A 2I9LA 5BRZB 3PQYA 3WNMA 1K3IA 4YHMH 2HT2D 2J1KA 3MBEB 3RKPA 3QEUA 3VGAC 3OAUH 3LZFH 1YJDL 3INUH 2XYCA 3CPLA 4IBLT 1IGTB 5HDQL 4ENEC 3DX9A 1DUZB 3TBYB 2PW2B 4Z5RB 3UX9B 1LO2L 3EYUL 1OLZA 2YEZB 4U1MA 5DMYA 4OTXL 1DR9A 1BZQK 3FB8B 4TQEL 1I7TB 5DHXB 3PWPA 4ZS7L 3C2AL 1BFOA 4L4VB 2BFVH 1IKNC 4LPCA 2A83A 4WNQA 3MLXL 1S78D 1MCBA 4RMSA 4POZD 2BNRD 5DD1L 5GRWA 3IDNA 2R4RL 3S5LG 1ZMYA 3HG1A 1JGVL 2RFXA 2VYRE 3PHQA 4P2QE 4J4PD 3FO2B 3VGGA 2AJUL 3N85L 3IKCA 3QIUD 1I7UB 2XKUA 1M05A 1Y6NR 2R69L 3OKLA 3GB7B 4BFIA 3PHOB 1DBKL 2CGRH 4WI8A 4PRDA 3PV6B 5CILL 5C09E 2I5YL 3MACL 4P46B 2FATL 4ZD3L 5CZXC 3RWGA 5F9WB 4NRYB 1DDHB 1G7JA 4FQXA 1HKFA 4XMKL 1Z3GH 4MAUH 2EXWC 4MCZA 2D2OA 4GAGL 1G7MB 3HZVB 1LP9E 4OCLC 2BC4B 1J8KA 5DK0A 4U6YB 5KSAB 4NM8L 3U79A 3KJ6L 3SPVB 3CFIC 1IEBA 3BKCH 1KTLB 4HIIB 2IPUK 1G7LA 4K71C 3VDAA 3A67H 1U91A 4PJAF 5FGBC 1B2WL 1CLOH 1O7SA 2Q7NA 4KVCH 2DLGA 4J6RL 4C56E 3PJSA 4XI5C 4DOHB 4U7SA 2F74A 5JIKA 5ICXB 3H0TA 1X5JA 5DUMH 4IIQB 2X09A 4GSDL 3DXAA 4HK0B 4S11A 4NNXB 1NLBH 4P2RB 3MPCA 3RWJA 5DQ9A 1BQHG 1JMZA 4LEXL 3UTSB 3P40A 3F7VA 3R1GL 3QUYC 3MXVL 4XB7A 2VXTL 3OPZL 1WT5C 2NY2B 4G8GA 1RZFL 2VXUL 3I75A 3QDGD 4YDLC 1G7QB 4YDIH 1YEFL 4L8CB 5IHZA 2QSVA 2P1YA 3JZ7A 4Z77B 1JGUH 4IRJC 4YNYB 2VQUA 3SKUD 1A8JH 3N1QC 5D5MF 1ZTXL 3D87B 4Q58C 1RV6X 4MDJB 4K3DL 3SN6N 1RU9H 4OZHB 1RULH 1FVDA 1HOCA 5GSVA 3IRPX 1T04B 2WWKT 4YO0A 4ISVA 5CMAA 3QRGL 4H20L 1A7BA 2VIRA 1FGNL 5TH2B 5EBLA 4Z7VA 2PXYD 4NC0B 6CGTA 4FFYH 1IRAY 3X3FL 5D7LA 4QNPE 3THML 4X4XB 2ZCHH 3VFPA 1CZ8H 1LMKA 4FXGA 5I9QC 4X99A 5BVPL 3F65A 1M71B 4J23A 3WUWG 5DC9B 3QHFH 2PR4L 1KT2B 5C0CE 1HDMA 1LVEA 3MRQB 4R0LC 1RZ7H 4JY5L 1S9XB 4KDVA 5FK9A 3R4DA 5I1EL 3F12A 5HVWA 2ZWLT 3ES6A 4HPYL 4MAYC 3C5ZA 3RVXD 1XFPA 4JVUA 4NN7C 4X5WB 2LABA 3NA9L 4XH2B 1OAZH 3RX5A 3CLEL 2P7TA 4IOSD 5A3IC 1QRNB 4LQFH 5IMLB 3OHXA 1Q0XL 4F33B 4WFEE 3TH3T 3ARGC 1EEYA 4FFWC 5I76B 4JN1L 3VXSE 5DJAA 4OIIL 2B0SH 4P9HL 1I1AA 4I2XB 4XRCA 3S35H 4YHYB 5IEHA 1ED3B 5AUMA 2A38A 3PP4H 2PUQT 1NEZB 2FX7H 2VDLH 4N0CC 3JWOH 5DR5H 3S34L 4HKZB 5FB8A 5I1KL 4RGNB 5DGRA 5DJXA 1BREA 2D03L 5ALCL 5D7IA 5D2LA 5FUZL 3C6SA 3U2SA 3F7YA 1D5XA 4P2CG 3FT2B 2EEBA 2CJUH 4ODSL 4U33A 2UY7A 3SDAD 1T83C 5JOFB 4X7TA 4PRHA 4JE4B 1A7RL 4GMSH 2EZ0D 1WZLA 1OAKL 2NCMA 2Y5TA 1RURH 3ZHDA 4FQIH 4GW4A 4IHOA 4Q6IC 3HC4L 1T1WA 5K9OB 1OGTB 1OAQH 1IGFL 3T0BA 2HVKB 3MODH 3QFDB 3OB0K 4L3CA 3MNWB 4PRBA 1I1RA 1UJ3A 3GJFK 1S7TA 1TJIH 1KG0A 2ZUSA 1K6QH 1NPUA 5CD3B 2E27H 5CIPB 2V7NB 3MRKA 1EFXD 1R3JA 3WLBA 4O5LH 4KXZI 3LRSA 3QIUA 4P4KB 4WW1A 3RAJH 3IFPB 1JPTH 4AT6B 2VC2L 5HGGS 1F11B 4OFPA 5TE7H 2V7HB 3EYOB 3ULVL 3RUGF 15C8H 2DQDL 1FGVL 4P4RA 5EZIL 1UACL 2QHRL 4Z18A 4W4OC 3MRBB 3WIHA 1QP1A 4HGWB 3IGAA 5B4MC 1UEMA 1DEEA 1CGYA 2XNAB 5E8PA 3GSNB 3BRFA 3U46B 4XPTL 5L7XH 3LKSB 2R0LL 3ARBB 1SJHA 5GRVL 4FQHB 1F90L 4HLZH 3BKMH 4TSCH 3QNZB 3SQBA 5I8CA 1YY9D 4ZUWA 1FZOA 5E9DD 1RHHA 3MOAL 4MQXD 1FG2A 5L9DL 5TFSL 1QA9B 1PAMA 2AV1B 1A3RL 4JO4L 5CUSL 3DIFB 3CIQA 5ILTH 1HIML 1GPOL 4F2MA 2ERJB 1LE5B 5DLML 3CDYA 4GRLC 4OB5L 4Y5VA 3GUTB 4JJ5A 1ZSDA 4M03A 1WAAE 3ULUC 5FOBA 3ZTNL 1RJCA 4TSAH 1OPGL 4UDUA 1CFQB 1YYLL 1MI5D 2APFA 5F9OL 3QDGA 4G3YH 4M1DH 4Z9KB 1A7PL 1JF5A 1B4RA 2D4DA 1YPZF 1TNMA 1V8HA 4QCIB 1SM3L 3NCCB 3QP3A 1VFBA 4M4RA 5BW7C 2JJUA 4OLYL 4XBGB 4G8IB 2N1KA 5EORL 3WNLA 2CIKA 3T3ME 3ROLA 3ZDXF 4XPFL 2R56H 4GXUM 3HE7D 4PYGA 1AI1H 5KSUB 5T5FH 4G5ZL 3VDCA 4A2LA 2W60A 5FDWA 4ZOBA 2NW3B 2C1OA 3HE6C 4B53A 2DD8H 3QPXH 1Y18B 5TQ0L 4JQVA 1OLLA 3AS0A 1FIEA 3RIFF 3S4SB 3DSFH 5T1DL 4Y16B 2DQIH 1SBSL 3MBXH 3UPRB 4YJZL 3FB7B 4PJHA 2H26B 5HI4D 4Q7DA 1UCTA 2BVQB 4QTHA 5I73C 3I02B 3F7QA 4Q2ZB 3WUZA 3HI1B 1EO8L 1U95A 4DAGL 3D39D 4QXUL 3PE9A 3B6SA 4FTVA 4XVTH 1HHJA 2XXCB 3VA6A 4JLRB 5I30L 2JIXB 5T3XL 3FQWB 2OL3H 3HNTL 4YHPB 2DS4A 5ERWA 4MD4A 1NFIA 3KPQA 1W8OA 2CLVA 3QNYB 3VWKB 3BO8B 4N8VG 4MJ4A 2GJ6A 1URLA 1IVLA 1GGCH 3CC5B 4JPIA 4U1HB 5CD5C 4MJIA 3AC0A 3ELAT 1FH5L 3GBMH 4WU5A 3SGEI 2H6PB 2VUYA 3H9YA 1NLDH 2IANB 4XBPB 2BY0A 2CLRB 5GGSB 4AEIH 3SDAA 5J6HB 1IC5H 5C0FA 5L6YL 1VPOH 2H32B 5CP3H 3FN9A 4LEOA 3ZE0F 3JBG7 1R5WA 3OAYH 4XNXL 3O3AA 5H35B 2B4CC 5ANMB 2AJVH 3U30B 1CS6A 2NXYC 5ETUB 1INEL 3O9WA 3ARSA 1XH3A 1T0PB 2WBJC 3KXFB 3O6FB 2AJXH 4NDMA 4XVSH 3S35X 1QRKA 5DFVC 4Y19E 4XCNB 1ACYH 2EDRA 3I6LD 5D1QA 2ZSVA 5CJOH 3MJ9H 4KK9C 3A6OA 3C6LD 4BSVB 3MXWL 2D3VA 4Y2DC 1CG9B 4XP9L 5IBUB 1BJ1H 1MCPH 5FYLD 4NO2B 2HJFB 2NYYD 4GBXB 4OAWB 5GRUH 3VD5A 5DMIH 4D0BA 4GQPH 4UINH 2VR5A 3NZHL 1A7NH 2IBZX 2OK0H 4KTDL 4DUVA 1EVTC 3HPLA 1P4LB 1NAMA 1NFDF 2JK5B 1IM9B 2M1KA 3KYNB 4PJGB 3WIIH 5JXED 5E2TH 1KFAH 1Q0YL 1G9NC 2HA1A 5JOEA 5CP7A 1ZHNA 4CAGA 1S9YB 4PJAA 5E4EB 3TLRA 2GTZB 1I8IA 2V2TA 3DV4B 2IH3B 4H26B 4KAQL 1AXSA 1AD0B 4BZ2L 5IFAL 1U8IB 1WBZA 2F54B 4XHJC 3MUY1 3LKPA 3TPUA 2R39A 3EO9L 4FXLA 3PGFL 1HH9A 4HC1H 5EC1B 4OCYL 4C54A 4JY4A 3WHXA 2GITA 3IVKB 4QRTB 1N5AB 4YDJA 4UNTA 5E7FA 1A4JB 3A0OA 3MLSL 3DMMD 1HCVA 3GSWA 2D9CA 2IADB 1NAKH 3W0WE 2YXFA 2OTUB 3IFLH 4ZAKD 1J0KA 4LDOB 2IBZY 2NLJA 4HXBL 3IDMA 3ILPA 1X9QA 5D5MA 5DTFA 3WEXA 5J6GA 2KQMA 3I9GH 1BIHA 1X5AA 4QOKA 1WIUA 5CIPH 2CPCA 3BUYA 1QPXA 4I18B 4NP4H 4S1DC 1O0VA 5IB3A 2ZJSL 2O5XH 3H9HA 4ZFOB 4EBQH 1QTYT 3AAZB 2HMID 5F21B 4LP5A 1F6LL 5FDYA 2FJHB 2OI9C 5HYIA 3OG4B 4PGZA 3O3DA 3ET9F 1TZIB 1MJUH 2Y25A 4AEHL 5FOJA 3GMNB 4NOFA 3V0VA 4H1LG 3C5JA 2C4FT 5IM7B 4JGJA 1CQYA 3T0WA 5F1NA 3QUZB 2NTFB 12E8L 4EUPB 1WTLA 3T2NH 4GLRH 1CT8A 1HH6A 2W59A 5LGHL 1Q1JH 4JN2B 5FUOH 1IT9L 1QFPA 2IPKB 4HFUH 3TF7C 2Q86A 1R3IH 3G6DH 3MRGB 1N6VA 4WHTB 2YPVH 3TYFB 3BX7C 3I6KB 1NMCB 2IF7A 3AS3A 1JTOA 3SDDB 1LO0H 2HKFH 3MRMA 4RQQB 4WWKB 1MCCA 4F7CB 1FRGL 2FB4L 3CFDA 1ZA3A 1HSBB 1H5BC 5JIIA 2AEPH 3WKMH 3BEVB 1HYSC 3QJHA 3TBWA 5IW1A 4YC2B 3X12A 2X1PA 5IR1A 3HAEG 5F6HJ 5CJBA 4KKLD 3W2DL 5DEFB 1ADQH 3DROB 1HYRC 4WUKH 1OTUC 3IDIB 3UPAA 1C8PA 3I2CL 5DFWH 1ZT1B 4PJ8D 5DVNA 4GAJL 4U1GC 3LB6C 2R2HB 3GMQB 5ENWA 4DCQB 4KMLB 4OQTL 4OLUL 3GMRA 3MUGB 4UB0H 2R23B 4PJIA 5C0IA 3RTQB 4G8EA 2RHEA 3MLRH 3O2DA 4FXKB 5CJ5A 3L3IB 3I6GB 5CGYC 3VA2C 1JL8A 5EUOF 5J3HC 5J13C 4MXQC 4WTZA 2HT4D 4JM2D 2WINA 4DK3A 1C08B 4PJ7A 4LVHC 2M26A 5KOMC 2IFGA 3NH7L 4H8WC 4RCAA 2Q87A 1AH1A 4G6KL 5F7MC 2XACC 1SBBA 2ATKB 1QSEE 1LNUB 3M1BB 5CBAA 2HP4A 5KVFL 3MRPB 2UVFA 5D1XD 2J6EA 5HGDA 1KNOB 1JWMA 3D69A 3RUGA 1QFWI 3DVNA 5D6CA 3MCLL 3NFPA 1DBJL 3T0DA 3MLZL 3NVQA 3W5NA 5E2VL 4S1QH 1PKQE 4U1KB 5EA0H 5K9KB 5HJ3A 5AD0A 1CIDA 5C0AA 2GFBB 3TVMA 1KJVB 5HHXL 1Q72H 3KJ4C 4U2YA 3T3PF 4AIXA 4KK5D 3ZKMD 1KJ2L 1DLFH 3GIZL 4HS8L 1I8MB 3VD3A 1CDBA 1CFBA 1KENL 1ODAA 1KIPA 4OD3L 1YEEH 2H3NB 4RMUA 5D96C 3IETA 1JF6A 3O6ML 2E9JA 3IF1B 3RA7L 3V7AE 5E4IA 4HJJH 4QRSA 1QSED 2DOCA 3GIVB 2BRRH 2IBGA 1BJMA 2VDRH 4MWFB 3KLSA 4PRPB 3P4MB 4PLKC 5IFJB 4HJGB 2AQ2A 3DMMA 2EO1A 5DA0B 3WO4C 3AREC 1WFNA 3QIWB 4JFYB 4FP8H 4HF5H 4RNRB 4JY6A 1IAII 2EEAA 5E95B 4AM0A 1UM4H 4F37K 5DO2C 1T3FB 1JF1A 3B43A 3VRLE 5DD6B 4I3SH 4ELMF 3GGWB 4C55A 4WW2F 2UV3A 5HYJE 5EU7C 3C8KB 3VH8B 3VXRE 4D0DB 3FQXA 2RGSA 2E9WA 4F7PB 2YC1B 5D93B 1FDLH 4JRXE 4N68A 4FQCH 3UTQB 3S97C 5BQ7A 4POYA 3FO9B 4BH7B 1TFHA 2EKSB 4XXCC 2V17H 4TSBH 4LSTL 5TPWL 1HXMA 3QULA 4O02H 3V6ZA 4HCRL 5I74B 3BP5B 4QRPB 4L8SA 2FHCA 3ARTA 4G9FB 1I9EA 3L3GB 4F7MA 4MJ2A 3GKWH 2D7PA 1JZ6A 4LQ1A 1JPSH 2VDML 4NQED 4OI9A 1N6UA 1JNLL 2D7OA 4RGMB 3VRJA 1P7QB 2UZXB 1FAIH 2FEDC 3G08B 5J11C 5E03A 2IALA 1TLKA 4BZ1H 5HYJD 2XKNA 4B50A 4G42B 1MH5A 4X98A 3SHSA 5ESAB 4BKLA 1VACA 1W0VA 4JRXD 1KEGL 1AGFB 3UAJD 2X4NB 4OM1H 3VMNA 1BJ1J 2FYYA 3RWEA 3VG9B 2JB5H 1JTPA 3VXTA 4ZUVB 1DBAH 2BHUA 5IJVA 1N2RA 5A2LH 4DVBB 3D0LB 4W68A 2OR9L 2Y06H 1MF2L 4PJ8A 2C9AA 2GJZB 5CEYB 3L9RA 2G60H 3O2VL 1GGIH 4Y5YB 1CBVL 3EDJA 4RISL 4O58H 4LMQI 5CGTA 2LU3A 4CNIB 1EJOL 3CFKB 3GK8H 1AO7B 1XF3A 3QQ4A 3TT1L 4PY7B 5J4MA 3GMLB 5GXBB 2E6JA 4K2UL 4LCWB 2XG5A 5D7SL 4GG6E 4F80A 1T1ZB 1WBYA 4PJ5B 3ILQC 1BWMA 1FIGH 2UYLB 1G9ML 3MGAA 4HX1B 1MQKL 1DN0B 5HD8D 1ITBB 4W6YB 3OF6A 5K9QG 3GHBH 4PJXE 1EFQA 3G9AB 1H3WM 5D1XA 5CEZD 4FS0A 4K7FA 3EOAA 5LG1A 4LRIC 5GGVL 4EUPH 4K55A 1ZGLB 4JO2L 3SDYH 4M62H 3TCXA 1OF2B 3BESR 4FRWA 3WFDL 2DQEL 2A9ML 2W9LA 4FG6C 4XPHH 5AG9A 3TA3C 4R96A 3V0AC 1XGQB 2XWTA 5EIIB 3UXFA 4JFPA 5K59F 4P23D 4E41E 5GS1C 3BN3B 3IFNL 1WJ3A 1NFDA 5BZDA 5HHQB 1H3TA 2VUOA 2I07A 3BZFA 3QXAA 1CFTB 4X6BB 1JHKH 1FSKC 4K3EH 4NNYB 4R2GC 4Y4HA 5TDPB 4I77H 4JZJA 5KSVB 4KGLA 1P5UA 1QYGH 3TGXA 3TZVC 3FO1B 5HHOB 1TENA 1F4WH 1LD9B 1BVKA 2YSSA 1KCUH 5INDA 1I7ZB 3VG0L 2Y07H 2MHAA 3IDXH 4Y4FB 4OJFH 3V0WL 4JFDE 4RA3A 3SCMC 4OIAA 3KHOA 3O4LD 3WN5A 2VDOL 4ODHL 3RVWD 5JUEL 4K07A 4IOFD 5KVEL 5GQBA 1ZLVK 3RVTC 2GT9A 3LEVH 5LQBL 3KR3H 5FCUL 1CDHA 1I1FB 2YKLH 2JCCE 5DJ8B 1T89A 3CMOH 2X70A 1K9TA 1IL1B 1JHLH 1EEZB 3MNZB 3QDAA 1JI1A 3RU8L 1JN6B 2Y36H 4X0KB 4Y88A 4JO1L 1RJZB 1TJHH 2V5RA 3LKRB 4JM4H 3G5XA 5FA4B 4ZO8A 5EH1A 1CF8L 3FB5A 5E6ID 3KPOB 1H3PL 1OD9A 2AP2A 3ARWA 5EOTA 4MXVF 1D6EA 3QI9D 5HGBA 4NNPH 4S2SA 3FB8A 4JFDD 3VXQB 4D9LH 1H3UA 2APWA 3CXDH 4OCXH 1PYWB 1F3JA 2UZIH 3NABH 1A6WH 4PJBB 5IT2H 5DS8B 5HI3C 1OHQA 2BSSA 1MY5A 2W9DH 4HPOL 5EOCJ 4MAYB 2VLME 4LMQE 1JFQL 1A1OA 3LPGA 1OQOA 1W72B 2FGWL 3Q0HA 5TQ2L 4OGAD 5AYUH 1GGTA 4G7YH 1KN2L 3WS3B 4M6OL 5HYQA 4LCYB 3NCMA 2J88H 1BBJA 3MV11 2FDBP 2CK0H 4MNGA 4PGJA 4C83A 2E7HA 3KPRE 3PV6A 4MS8D 1S7UA 4RFEA 4Z7VE 5D1ZC 1EHLH 2W91A 1XIWB 3FFCA 3SOBL 3MV9D 3RWHB 3DX7B 5E99H 1CGTA 1IKFH 1I8KA 3BQUC 3PDOB 1U93B 2AEWA 3KWWA 2DBLH 2GKIA 1E27B 2WIMA 4UNVA 3KPLB 1U92B 3QSKB 1D9KC 1FC2D 4HUWA 1A02N 5JW4R 4PR5B 5J9PB 4K3JL 4ONGH 5INCA 1DN2A 4ZUTB 1S9VA 3DRTA 2EO9A 3TBTB 1HNFA 2A77H 2NY0B 4XCYA 3T8XA 2OL3A 3RDTA 1JV5B 5F7WC 1HHHB 4K8RD 5E8EB 1S7WA 4XTRD 1C5DB 4HUUB 4MQ7B 4G9DB 2VLJE 3RZCB 5EUOA 3V7AG 3S36L 3P9LB 4FQJL 1F97A 4P9HC 2GJJA 4DW2L 4HH9B 4X4YA 4NUJA 5C0EB 2FJFB 1J1XL 1BZ9B 4FNLL 4JANB 3EHBC 3P30L 4JFEA 3ZDZE 1FLRH 1KIQB 1F2XK 4GRWF 4GAYB 4XP1L 3ARFC 5CP3A 4X7SH 1XZ0A 2D7TL 2BNUB 4IS6B 5D2LE 4NUGH 4Z7WF 3VXOA 3VFVA 2CSPA 1TVBA 2QQNL 2HFFB 5TF1L 1Q9LA 4PRHE 4UV4L 3TO2A 1RUPL 4QEGA 3B9AA 2ITDB 1YEKL 2MFNA 4PY8J 5FYJD 1VFAB 3CSBA 2B2XH 5C09B 3QH3B 2R1XB 3O8XD 2OSLB 5J8OA 5DDHB 5IFHL 5HGAA 5DJCB 2IPTL 3H42L 4QTIL 3MJ9A 4Z78B 5DRWB 3D2UD 2UWEF 4Z7UE 2LAAA 1FL6B 1M71A 4YZFF 4ZOEA 4ONHA 1JNHB 4ZPTB 1CICB 1YA5A 1BAFH 1JZ2A 5I8EA 2Q6WB 4OGXL 1A21A 3MGTB 4JR9L 3WS6C 1TVHA 3GBNL 3PP3K 1E6JH 1WEJH 1UWEL 3R0NA 1FG9C 4LARL 5DRNB 3T65A 3TIDB 5CZVH 4D3CH 1RJYB 2HFEB 4HKXB 3PGCB 4KI5F 3O4LA 3JV5A 1B0GA 1CGXA 3RY6A 2QEJA 4F33A 2OP4L 3QDJB 1B0RB 2F5BL 3IDJB 3BJ91 3UCRA 4G6AC 2UUDH 4IM8A 4UBDD 3KDMA 5E8OB 4PJ9D 3MZTA 3KLAB 4PJFE 5MEOB 4HV8A 3WFCL 1NEZA 4XMPL 2R8SL 3LKQA 4BSWA 4NRZB 1V5JA 3ARDD 4ELMA 4IDJL 4WW2A 2KUTA 3UZQA 3N1FC 1X3DA 4NO5A 4OLZH 1KCSH 1KJMB 5GS0L 4AG4H 3FONB 3MLUL 2ZUTA 4PJCB 1A7QH 2YPLA 3BPNC 4HC1A 4Q74A 3HE6B 5I18L 4M5ZH 3TO4C 4XVUD 4FFZH 1AGEB 2YS4A 1YY8A 4WEUD 5E6IA 4L3EB 4U6TA 2G2RB 3DVGA 5ID0A 4GKNB 4XMLL 3KPNB 1QSFB 4AIZB 2DLEA 5DEGB 2PYFB 5KW9L 5HHNB 4HIEA 3B3IA 3JV4A 4ETYA 1YNTA 2LE9A 4NBZB 3STBA 3GRWL 1JNNH 2O5ZH 5TE6L 1MLCA 5JDSA 4EI6A 4I3RH 3N0PB 1OW0C 5C0ND 2E7LC 3DBXA 1ZS8B 1U8PA 2HWZL 3D0VA 3V9FA 2AXGB 3V5HA 2R0KL 3P11L 2Z35B 3T0EE 2XTJC 1BEYL 1Z5LA 3BP4A 1E4XH 3ZYOA 2V9QA 4WHDA 3VJ6B 4JDTL 2NY4C 2RB8A 1YN6A 3ZSSA 2EDEA 1A6ZA 3QCUH 2V7HA 4LASL 4WUUE 5I1HL 1X5ZA 2NY5L 5EFIA 3O81A 4WDIB 4OUUB 3MRNB 43CAA 5EO0B 3OKOA 4LNRA 1FNEB 4R4FH 3MRBA 1E4WL 5C07A 5D7JC 1MJ7H 3OXRB 5FA3B 4YXLH 5IROA 4M7ZC 3LS4L 1KLFA 1KPUB 1HEZB 1F02I 3BH8A 4OFYD 4MVBD 1A5FH 1FNSH 2YD1A 5DUPL 3DWTA 3TNMA 5J06A 1A9EB 4TOYH 2ICWI 3QHZH 4J2XA 1X44A 3FFDA 1J88A 2AV1A 3DIFA 1KELL 2P24B 3LIZH 5DF0A 4KV5F 4WEMB 2HN7A 3KYOA 3T0ED 4LAQH 5F7KC 2X4SB 1B90A 1INDL 4QRRD 2P8PA 1P2CA 3SGJA 5IVXE 4F15B 1ETZB 1N64L 2DMKA 1ADQA 2MQ3A 4MJIE 5F8QC 3SGKA 4WJ5A 2ADIB 4KKBC 1D5IL 3PG2A 3BPOB 3NBNA 4MB3A 1Q9WB 2WQRA 4P3CL 3B9KB 5JHLH 1OB1B 4KK6C 3QFJE 1UM6L 4OF0A 1W72H 3CK0H 3BZDA 3N1MC 3QB7C 4JAMB 3BWAB 4EDWH 1AXIB 2NY7H 4JFZH 5H2BA 3O8XA 4P0DA 3VGEA 3MRRA 1QFWL 1JI2A 1L0QA 5HDOA 4OGYH 4C58B 2DWDA 4R8WH 4PUBL 5HHMB 1YMMB 4XB8A 1DVFB 3EOBB 1E28B 3QUXD 1KF9B 1TTFA 1UYWL 4W70A 1TQCB 3MCG1 4NKOA 1S78C 1NCAH 4POZC 4RMQA 4B41A 2J8UF 3OKKB 2ESVA 4KI5D 4KDWA 2VWEE 2DTMH 3VFRB 4J4PC 4HUXA 2ICEB 5D2NB 4BQ8A 4CN1A 5C70A 1U8OB 4NC1E 3ARZA 3QFJD 4O2FA 3CSYA 5DJDB 5L88L 1IM3B 5ECJE 1FBIH 1RMFH 2G75A 3MO1B 1I8LA 3WE6B 2H2PD 1MAMH 2VQ1A 3KLHC 2OXGA 2VLKD 5B3JE 1XGYH 1U8HB 5FKPB 3QEQD 4F7EA 3RL1B 4PJAE 3C09C 3CU1A 3WSQL 2RQ8A 1TXKA 4P9MH 3MYJB 1A7OH 3CDFA 2NY1D 2AXJA 5B38B 2R4SL 4N0FB 3RZWA 2X4OB 4OD1L 3KPSB 4TUOB 5ANMA 5ETUA 1CXEA 4NBXB 4JDZA 1FLTX 1A6TA 2CUIA 32C2B 4HEPG 1V7MH 2VXQH 3ARQA 3WLWC 3OJMB 5HYFA 4YHKH 4UOW0 3QIBD 4QXGL 5EULV 4U05A 1GGBH 4XZUB 2FZ3B 4DGVL 1LEIB 2X6MA 3GSXB 2GSGB 3P3YA 3IJYA 1IGYB 4KVNL 2PCPA 1XGRB 5D5ME 2NX5A 4CADB 4K7PH 5GGUB 4QYOA 1YECH 5GZND 4QOKE 5CHNB 3RNQA 1PG7L 3T4AA 1TZHB 2ORBH 3HZYB 3KYMB 3UYOD 3NIFE 3IXTA 3TIEA 1AC0A 2EIEA 5LWYH 5HVGB 3U7YL 1NMBL 2K9UA 3P2TA 2R0ZH 5D9SB 1RZKL 4OZ4A 1QBML 3ULUH 3FCTB 3LHPH 1G7HA 3HI5H 4LLYB 1YQVL 4HS3A 4NN5C 1I3GH 1IGIL 1KPRA 2X4TA 4WTWA 3VI3E 3B8YA 4PGBB 3M07A 1BX2A 1TJGH 2PXYC 2VISB 5F7NC 3VXNB 2YUVA 5IVZB 5FGRA 4YFDB 3DV6A 2QQKL 4NWUH 1RUQL 3BZEA 4OFYA 1S9YA 1IAOA 2GTZA 3VWJD 1HQ4A 2D7MA 1R0AH 3DV4A 1EMTL 3VFUB 3EIFA 5BS0B 4XAKE 3VXMB 5E6YA 2ZOKA 4P5MB 4FABH 3WV0A 4Q6YA 3NTCH 3MRHB 5EWIL 3ULSA 1RZ8B 4LLMA 4QRRA 2I60L 3OAYK 4F9PC 3LVEA 2HLFD 2PTVA 1T5WA 2KZ1B 2Z92B 3I84A 5EZOL 3ZE2F 3BP6A 3IVKA 3BVNA 5GRXG 5GRJL 1FZKB 3WXVH 3LAFA 7FABL 1NSNL 4Y19B 3ZTJH 3TV3L 2HH0L 1A4JA 2VDPH 3BISA 3W9DA 2VZTA 2P8LA 4UOJA 5MEND 5E94A 3QZWG 4Z7WA 4OBRA 1QFHA 3LN5B 2LAGB 4Z0XB 1BOGA 1DQMH 4WGWB 3HMWH 4M7LL 1DFBL 2P5ED 3RIAF 3EW3B 5EG6C 3SDCA 1SHMA 5BZWB 1RIHH 5BXFB 4AH2A 5EC2A 3LS5L 1DTUA 3KYKH 3WFHA 5KAQG 4ZFOA 3F58L 1AQDA 1IJ9A 1ORQB 3QEGL 3LH2L 5I75C 1XEDA 2IAMD 2UWEA 4P5TD 3FB6B 3I3BA 1TZIA 1ZT4B 1HKLL 1MHEA 3HC0B 1NDGA 4JKPL 1WK0A 5I8KL 3QUXA 4HIXL 4YHLH 3GFUA 4QHMA 5D96B 4AZ8A 2AI0H 4NPYB 3U6RB 4NQCD 2DQJH 3PWNA 4RWYL 1BGXL 4LPVA 5GJTL 4MA1B 3T77B 4MXWL 1KGCD 3EYFA 5EU6E 3IFOB 5JW4Q 1CQKA 3LY6A 1P7KA 2XZAH 1RFDH 2DLFH 3O6LL 2VXVH 1F4XH 2NNAB 3JSSA 3P4NB 4OBSA 4Y5XA 3TN0B 5JW4M 2H9GB 3NIDF 4JO3L 3EYVB 2VLKA 4X8JA 3QEQA 4F7TA 5DI8B 1PD6A 2GCYB 1A6UL 3TYGL 4HWEH 5GZOD 2FR4A 4C4KT 5A2JH 4Y4KA 2Y9RT 3TWCL 4PLNC 1IC7L 3VCLB 1A64A 2D4FA 3STZA 1CGWA 4J3WA 2DWEA 4EEEA 3W39B 5HY9B 1ORSA 4GMTL 4MQXC 2Q8AH 1AGDA 5TE4L 4JZNB 5F9AC 4Z95H 3OGCB 2MWCA 1OT1A 2HJLB 4JQXC 2XKSA 1A6VL 4OFIA 5IF0A 1FNAA 3MV8A 5CKAA 4ALAL 4KQ3H 2R29H 1YPZE 1YC8A 3MUHL 2B1AL 4PB9L 5JXAL 5J11B 3MJ8B 4H25A 5EZLA 4KZDH 1EEQA 5IGXH 2F19L 3WIHL 3UJJH 4OD2A 3AGVA 5F6HI 4XGZB 1S7VB 2XQBL 1Y0LB 4ZFZA 4NRXB 3G6JB 5EUKB 3V4PH 4P57B 5GJSL 3HE7C 4NQXB 5IEKB 2GAZA 5E5RB 5K9KA 2Y6SC 4PGEB 5SWSD 4QT5A 3UJTL 1A4KB 2P45B 5IBTH 5IOPB 1U2HA 1YC7A 1UXWA 4OLXL 4K7PX 4LKCA 1JPGA 4QGTA 3H9SD 4X6DE 3L7FB 2FECI 3VFOA 3MA9H 1R3LB 2FJGA 3R06B 4X9BA 4JG0H 3UJIL 4MLSA 3IF1A 4EI5A 2R1WA 1EAPB 4WFFE 5FKAB 3ULUF 3CZFB 4CW1A 1OWWA 2C3WA 3QUYD 3H3PL 2XG4A 2PETA 3RGVD 1MVUB 1U8KB 2C7UA 1ZKAA 3FN0H 4QF1A 4FQ1L 5DVLA 3WL9A 4LHUD 4DJMA 3SKOB 2MSPA 2P5WA 2BVYA 3BHBB 5MENA 5D6DA 1QKZL 5KTEH 3A6CL 2AXFB 4KDTA 1FVEA 5T1LB 5EU4B 5DD6A 4ORZC 1DSFL 3ZE0E 2VXSH 2YOCA 2BCKB 2Z4QB 5DJ2A 3TA3B 4U2ZA 5FYKU 2CDGA 1NGZA 1U3HA 2VE6A 2NXZD 3I50L 4D0DA 4J7RA 4K7PY 1N59B 5I19H 2UZYB 5HYSB 1DBML 1VENA 4PJCF 3C8DA 3H3KA 3QJFB 5CAYB 4P5TA 4DTGL 2V2WB 4XPGH 1PKQB 2Z31B 4RAHA 4UAOC 1P9MC 5CLWA 3V5KA 1I9IL 3BZ4A 4JHWL 1U8LA 4BH8A 1NCBH 4CMHB 3TT3L 1RZJH 1OARL 3IU4H 1NGYB 4GUPB 2GI7A 4ODTH 4ONFL 4NO0B 1G9MC 2BOBB 3PL6B 1ZLSL 2V2XA 2J8UA 4MCYB 5T33H 1NBYA 3FO0L 1AKJB 4WFHD 3C6LC 1OGAE 3ARGD 4FFWD 3HNSH 5FGCB 1UJTA 5C0BA 3GJFB 3FQUA 1EK3A 1ZLUH 4KY1L 2W65B 4OZGE 1S5HB 1SEBA 2VZSA 1CLZL 5GS2D 3B2VH 3OAZH 4LL9A 1AQKL 1I7RA 4N0CD 4JRYA 1CXHA 2XY1A 1MFBL 5DUBA 4TUJA 5GIRA 3EFDL 1XF5B 3M45A 1RIUL 4H8WH 4IRSB 5JIPA 5KS9B 1WGOA 4ZUVA 1E4JA 5HDLA 2VABB 5IB1A 2QSCH 4UV7H 5FV2A 3K4AA 1KACB 5LCVH 2FEEL 1LE9A 3UO1H 3EJJX 3VFTA 3QNXA 1GAFL 3CVHH 3Q5YA 3FRPG 4HXAH 5ISZD 3FOMB 1AR2A 5F3HA 1JGDA 1F8TH 1IKNA 4JFQB 5CINL 4CNIA 4DGYH 2A6JB 3T08A 1AO7A 3NCJL 3SQOH 3CFCH 3EOTH 2DI8A 4KRPB 2XZQH 2ZOLB 2DIBA 3E8UH 4DGIL 4J8RA 5CEXB 2ITCB 4R4BA 5JTWA 1OQXA 1LK3L 1O5DT 1GZQA 1F58H 4Q9RL 1CFNB 4MD5B 1YEGL 4M5YL 2BJML 3IRZA 1EHAA 4HAGA 5CWSB 3GO1L 1FO0H 5BRZE 1G6RH 4JDVA 1WWAX 3CXHJ 4ZAKC 1VKXB 4G6JH 1T0MB 2VLRA 3MRLB 3QO1B 4OCMC 1NAML 1A9BB 1TETH 4HLJA 2QKIA 1FFRA 5F97E 2XQYG 3S88L 1LEKA 3DSNA 1T1XB 4K23H 1IGJB 5FIEA 1TCRB 2EH7L 2FD6H 5SWSA 5B4MD 3IJSA 2EDBA 2F53D 2PO6D 2WUCH 1FPTL 3ZYIA 3MFFB 4NO3B 4L4VE 3HCVA 3QR2A 5JA9A 5FGBA 4JHAH 2JJTC 1AIFB 1KB5H 3S37H 2EIZA 4LPXA 5JPMB 1S7SB 3LN4A 1UQSB 5KSVA 2J3SA 1SMOA 1EXUB 2EDTA 4WO4C 4EN3B 4DKEH 5SWZB 4ZUSA 4H0IA 2AEQL 5E2UH 4ODXB 5E8NA 4QHKI 3RX7A 3VXPB 2DQUL 5F88A 2R1YB 5BRZD 2VDNL 5IB5B 1ZT7B 1UB5B 3MBED 3ALPA 3QUYA 4U4BA 1W0WB 1YNLL 1WT5A 1I4FB 1D6VH 3QO0B 3D85B 5DVMA 3N9GL 3FFCE 4X6CF 2LVEA 4M1GH 3V6OE 3RWDA 4PJEB 4IRJA 3HC3L 3DUSA 3D5OF 2ADGB 5T1MA 1KCVL 1T2QL 4TYUA 4YDKH 4WV1B 3KPPB 2AGJH 1JRHI 4HS6A 5JHDD 3GI9L 1ZWIB 5IK3B 1OAUL 2B8OT 2I9LB 3PQYB 1CE6A 4KKLC 5D72L 3WFZA 2VZ3A 3QEUB 4XNUL 1EVUA 3D1MC 4X0KA 1YEDA 3CPLB 1DQJA 2DQGL 2ZCLL 4KHXL 4KWUA 3DX9B 2BXYA 3G5ZA 1G6VK 4V1DD 4WFGE 1ZLWH 5CSZB 4U1MB 3FT3A 3MRDA 3UTSE 4P2RE 5BMFH 3PWPB 2BDNL 4D8PB 1BFOB 4HBCL 4R0LA 3C5SA 4P46D 1RAMA 2A83B 2EDWA 5DYOA 4WNQB 5DS8A 1RIVH 2HT4C 4JM2C 4POUB 3VXUB 3IDNB 4MAYA 2OZ4H 3L7EA 4JFOA 3RKDC 4P3WA 1W72A 2RFXB 3HG1B 3PHQB 4X5LA 1PVHA 4RA0C 4EVNA 5F93C 3W11D 1YNKH 4PRNB 1OAYL 4HJ0D 1U0QA 3ARGA 4CVUA 1TQBB 4JREB 4CVWA 3IKCB 4N0YH 4LCYA 3ECBA 4I5BA 5F7LB 1M05B 5JLZA 4OZHE 4BFIB 5JA8B 2ZKHL 4PRDB 3E3QE 1A1NA 3HS0A 2YD2A 3FMGH 3RWGB 1G7JB 4FQXB 5CD5D 1N4XH 4LLQB 4LHUG 4NZJA 3P9MB 4S1RH 5I2IA 4MCZB 3WUWB 1YZZA 2MNUA 5DK0B 4YE4L 3BT2L 1T83A 4WHYH 5LBSH 1JYVA 1IEBB 2XFXA 2MMXA 1SMAA 3IT8D 1G7LB 5J9PA 1CGVA 1U91B 2Y4SA 4ZUTA 5GS3A 2NXYD 3BYTA 5JO5A 8CGTA 4Q6IA 3S96A 3QXWA 5ISZA 1II4E 2F74B 4JFFA 4DFHA 4K9EC 2JJWA 3H0TB 3WNOA 1QRNE 3OAUL 3O6KL 3LZFL 5DFVD 25C8H 4XPBH 3DXAB 2GYSA 3RWJB 4TQEH 5DQ9B 4L4JA 3F7VB 2ARWA 5ABDE 3C2AH 4KK9D 4G8GB 3EO0A 4HWUA 2IFFH 3I75B 4RGNE 2BFVL