5FZ0A

Crystal structure of the catalytic domain of human jarid1b in complex with 2,5-dichloro-n-(pyridin-3-yl)thiophene-3-carboxamide (n08137b) (ligand modelled based on pandda event map, sgc - diamond i04-1 fragment screening)
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
462
structure length
453
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with N11213A
rcsb
source organism Homo sapiens
molecule tags Oxidoreuctase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
total genus 143
structure length 453
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fz0A01
5FZ3A 5A3WA 5K4LA 5F5IA 5FZIA 4D6SA 3DXTA 5FP8A 5FPBA 3U4SA 5IVCA 5F3IA 2W2IA 2OQ7A 1VRBA 3PU3A 2XUEA 5FZMA 3LD8A 5FZEA 4IGOA 5FWEA 5FYYA 3AVSA 3KVBA 4CCJA 3NJYA 3K2OA 3PURA 5F3EA 5FYZA 5LY2A 2P5BA 5FY0A 2YBKA 4BU2A 4HOOA 4ASKA 4GJZA 5FXWA 2Q8DA 3AL6A 4HONA 5FPVA 5LY1A 4QWNA 5A3NA 5FXXA 4GD4A 2YBSA 3N9LA 5FZCA 3KV4A 5FY9A 5F5AA 4BXFA 3PUAA 5A7SA 5ANQA 5LW9A 4LIVA 2YPDA 5A7QA 3N9QA 2OQ6A 4UF0A 5F32A 2XDVA 4V2VA 2WWJA 4QX8A 5FZOB 2OX0A 4QXHA 3KV5A 3PDQA 4CCLA 5FZ0A 5FZ7A 5FYBA 2Q8CA 4EZHA 2XMLA 3OPTA 5IVFA 2GP3A 3PUQA 2YBPA 2YU1A 4XDOA 5FPAA 5FPLA 5A80A 5A1LA 5A7NA 2OT7A 3N9OA 5FXVA 2OS2A 5E6HA 5A1FA 4CCOA 4URAA 5FBJA 4V2WA 5FYTA 4CCMA 5FPUA 5FP4A 5FZLA 4AAPA 5FYUA 3OPWA 3K3OA 5FUPA 5FZBA 3AL5A 2WWUA 4XDPA 3ZPOA 5A7PA 5CEHA 4DIQA 4Y3OA 3UYJA 5FZ6A 5A7WA 5FZHA 4C8DA 4QU1A 5FYSA 5F39A 5A7OA 5FYMA 2GP5A 2XXZA 5IW0A 5F3CA 5IVBA 5FZ8A 5IVEA 4BISA 5FXZA 5A3PA 5F3GA 5IVJA 5FY8A 4CUGA 4QX7A 5IVYA 3RVHA 4E4HA 5FY5A 5FZDA 5F2WA 5FYHA 5A3TA 5FZGA 4GJYA 4IGQA 4CCKA 5FP3A 4EZ4A 3N9PA 5F5CA 3PU8A 3KVAA 5FJHA 3LDBA 3U78A 5FYIA 4CCNA 3K3NA 4CSWA 4Y4RA 4Y33A 2Q8EA 4TN7A 4UF0B 5F2SA 5FYCA 5FJKA 5FY4A 3AVRA 3PUSA 3KV6A 5FZKA 3ZLIA 3N9NA 2YU2A 5FZOA 5FZ9A 4GAZA 5LWBA 3KV9A 5IVVA 4DO0A 2PXJA 2VD7A 5KR7A 5FZ1A 3N9MA 5FP9A 4NUBA 5FZFA 5FZAA 5FY1A 4QXCA 5F37A 4LXLA 5FUNA 5ISLA 5FP7A 4IGPA 5FYVA 4QXBA 5FY7A 5FV3A 4AI9A 4LIUA 5A7WB 4D6QA 3PTRB 4LITA 4D6RA 5FZ4A 4EYUA 5FWJA 3DXUA 5IWFA
chains in the Genus database with same CATH superfamily
4OMCA 4OZXA 5CKQA 1OKOA 1LNSA 3LDKA 5FMBA 4RD7A 2OQ7A 3LPFA 5A6ZA 2MEV2 1O5UA 1UYXA 4PBOA 5FYYA 1O4YA 4UXAA 4AHWA 1X9TA 4JGZB 2IFWA 4QPWA 4K7JA 5FY0A 1OLMA 3NVCA 4DFSA 1VBE2 5DUVA 5FMOS 3ENRA 5FK8A 4A3ZA 5JSOA 1LCLA 2JWPA 4HONA 5FPVA 1CD3G 3JB4C 4XEZA 3BYWA 4W6XA 2A71A 2A73B 2W91A 5EJ1B 2RS33 5L7OA 2HEVF 5C5TA 1W8HA 4AEDC 1GANA 2QNKA 3WEZA 5JOWA 4GMP3 2FZ1A 1AR63 1QXJA 1X82A 3BCWA 4MXVA 1IS5A 4PCRA 2VVEA 5J37A 4XTMA 3BVCA 4MUVA 1CZSA 1JUIA 4NHXA 4XIOA 4KG8A 4ZS2A 4C91A 5FZ7A 1OC1A 1ENRA 3CJIC 5GLUA 4DY5A 1C28A 1WKYA 3URFA 4QHZA 2HWF3 3RDIA 3WP6A 3ZFGA 5CKMA 1MEC3 2CTVA 2RS11 1X9PA 3H3ZA 1W05A 4UW6A 1FT9A 3WNPA 3ZDVA 2OS2A 3DV8A 2Y34A 3CMGA 1OVPA 4CCOA 1OI6A 4V2WA 1UXZA 2R061 1UOJA 2XJRA 3AKTA 1YO8A 1T6BX 2DCJA 2CWMA 4JDMA 1CAWB 5FZLA 1SBDA 2YY1A 2R16A 4H7MA 1D4VB 2AEYA 3FC0A 2WYSA 3ZSKA 3H1WA 1ASJ3 2G4IA 3GBWA 3HOBA 4ITCA 5LA9A 3J8F1 5F39A 3FLRA 3J26N 4S2FA 3RQ0A 2VQUA 1AL21 2DVDA 3WUCA 5AC91 3T0AA 4QX7A 4E4HA 5CFDC 1K5MB 2ADEA 3KSCA 3PUHA 3GHNA 2QZ3A 5EYYA 2YDEA 4DNYA 2I07B 5JXIA 4YM2A 3IWZA 4JRAA 4FVVA 3W59A 1MS4A 1N1SA 2DURA 4P9LA 1AX2A 1AJOA 2W92A 1W6MB 4BQ5A 4HN0A 1GUIA 2Z2SB 1WZXA 4NIAA 2C1FA 2XLGA 5FYCA 1QOSA 2ET1A 3BOWA 4BHPA 1RIRA 1SLBA 1MS5A 1UWWA 1UYPA 1Y7BA 1V00A 2ZPXA 3KCXA 2WZEA 4FXGB 2JENA 4BA6A 2DUOA 3ZXFA 4Q4X1 5J09A 2YU2A 2ZKLA 1XB9A 5FDBA 5DPNA 1W6NA 3JD72 4QQPA 2QFEA 3ACIA 3HN1A 5JMOA 4DQAA 4ATFA 4FFIA 5FP9A 5GLZA 3BPSA 5CG9A 5CZKA 2DDUA 2GC1A 4AEMA 2JDNA 1NXD1 2R062 4PF5A 2PN5A 1AXKA 2Q5TA 5DUXA 1UY3A 5FP7A 1C5HA 3I3MA 2ET7A 4A2UA 2JDHA 1SEFA 2RR12 1YNAA 2J1TA 1AR83 1JW6A 4QT6A 3X29B 4HVQA 2QQPA 1K5JA 2BVVA 2JX9A 2VAUA 3GALA 3I8TA 4NAMA 3WDUA 4F7ZA 2ORXA 3THCA 3BALA 1W6QB 5KHHA 1ZZCA 1AR61 2XHKA 1H4GA 2JE9A 3LEIA 2WO1A 3OSDA 5ANNA 2PHWA 5FBZA 3PIJA 2C9AA 2HYKA 2WIIB 2XUMA 2BV4A 3AP7A 2C0ZA 3LD8A 3NNMA 3LA7A 4A3XA 3P5BA 3MF9A 1RVF1 4UFJA 5CKNA 3PMEA 5FYZA 3I2GA 1ZBE1 4EQVA 5CFCB 1R083 4LBQA 5BXXA 4CU8A 1S0IA 1FPN1 2VQ0A 3KQRA 5JIAA 2C24A 5FLJA 4OHZA 1DIWA 4JGYB 1KFUL 1VBC1 1RITA 2ARAA 3BODA 4QWNA 5H9RA 5E16A 1FI2A 4AI2A 2Y8KA 3KB5A 1R093 5BV6A 3S7IA 4LIVA 4OI4A 1RTVA 4TYSA 5A7QA 5DMYA 1A78A 3WQ1A 4BIFA 1UNBA 4Q29A 4CDWB 4FPLA 4BB3A 3VBRA 3T2QA 3S5AA 4FPFA 2JDKA 2OX0A 3HNBM 3R05A 2CV6A 5BNPA 2D7FA 2JG9C 3LOBA 4UAPA 3T3YA 4Q26A 1SFYA 1VAVA 2BU9A 2R073 3VBOA 5I93A 2ARBA 4CUAA 4B4RA 5FPLA 2R49A 2GNBA 2OT7A 1TE1B 5F1RA 1OD3A 5FXVA 4JGZC 4MGIE 2JDYA 4BJ0A 3JCIA 2LM3A 4PIXA 1UF2C 1WD4A 1I3HA 2YC0A 4YW2A 5FYTA 2VQAA 3VBUB 3VD7A 1MZEA 3WW2A 1QOTA 4XAEA 1VAMA 2TUNA 3NV3A 4XDPA 1GLHA 5A6QA 4IV1A 2WWSA 5A7PA 1VMFA 1FMD2 3B3QE 1PZ9A 3ASIA 4JDOA 4AVAA 1WD3A 1W6QA 2IC1A 4Y1UA 5FZ6A 4P9IA 2P4EA 2WNEA 5GLTA 1IZ3A 1RUD3 4N7IA 3SH5A 1C4RA 4ES9A 3C7EA 5BNQA 4QU2A 1EY2A 4E2QA 2OUHA 1XQNA 1DCSA 3E97A 1W2OA 2VCCA 5GM0A 1KJLA 2O0OA 2WO2A 4WVWA 1I9RA 4X8PA 1VBE3 4XJ9A 1UPIA 3O0WA 5J1XA 2HWB3 2EIBA 5A3UA 3KVAA 4L8QA 3WHTA 5BNOB 3M1HA 4HANA 4Y4RA 2DUPA 2WT2A 2RS53 4XURA 3A0KA 3DPRB 1JYWA 4J25A 4NWVA 1CGPA 4WM7A 3ST7A 4XQDA 2UWCA 1RJ7A 5A33A 4CA9A 4YVSB 4FFGA 4KU7A 2FDKA 3BIWE 3ALQA 3IDCB 1VLNA 3KV9A 1VBC2 5EFUA 1W04A 4FTSA 4IE0A 3Q8AA 4QQ2A 4CYDA 3T4HB 4Y24A 4Y4YA 1K42A 1C57A 1GNYA 5DXDA 1O4TA 1RUF2 4HVOA 3KCYA 4LTAA 4SLIA 1ND2A 1QWRA 5LBEA 1JYXA 3BIEA 1WLCA 1F31A 1L7LA 1AX1A 5ISLA 4YW4A 3WCRA 4CU6A 4DY3A 2JKBA 3AFGA 1FV2A 1YQ2A 3HQUA 4WBBA 2H0BA 4LHKA 1HXS2 2ZGSA 4OCTA 5GZDA 2ZAAA 2C9KA 3W9AA 4UW4A 1VRH3 1YJLA 4XF4A 2ZMNA 1QHDA 2DU1A 4XOGA 1QJU2 1G9DA 1HN1A 1DFQA 1S1AA 4N90A 4KH9A 4BCUA 1VBA3 4FOQA 4C1WA 4F3JA 3RZHA 3WG3A 4RFRB 3THDA 1UXXX 1LAJA 1VBE1 2XJPA 3MV01 5FCCA 1O4ZA 2DBNA 3K4ZA 5KR7A 5G04L 5JI7A 4FCAA 2V4VA 4GJZA 1W8FA 4Y22A 4I3PA 5IFPA 1HB3A 2PHXA 2WYFA 4CP1A 1UOGA 2ZHKA 2RMU3 1US3A 1WLWA 1QXPA 3B69A 2H0VA 1AYM3 1OH4A 2FCVA 3FMGA 4UFKA 1BYHA 1XYOA 3IAQA 4Z07A 4JZRA 4AFDA 2A6ZA 3ETQA 1R1A1 1W2TA 1W90A 2EXIA 2RJLA 4QX8A 2UY9A 3GCXA 5AFEA 4KWUA 5A3LA 4CEWC 5FYBA 3AKQA 1TME2 4AK3A 5ACA2 4EZHA 3H8OA 5I8TA 1LB2A 1PGW2 3ORJA 4A7YA 1PNFA 2UURA 4FPOB 1R092 4E4SA 1NY71 3N9OA 1UW8A 3L9JT 3WF3A 4M3CA 2BWCA 4B7KA 4IEPA 3N35A 1PM7A 4BQ3A 4HVRA 5E6HA 1MACA 4XCAA 2WKKA 3I59A 1K5MC 2PTMA 4YW7A 2XKOA 3J8F2 3HQXA 1QH6A 5FMOL 1X7NA 4XMAA 4XZPA 4IE7A 2WL1A 3BTAA 2CDPA 3DL3A 1GP6A 4LLFA 3VL9A 4C8DA 5FOBB 3GXUA 4XACA 4IESA 5IJRA 4ET7A 1W3XA 2B45X 3MW2A 5IW0A 5FUIA 5FZ8A 1HB2A 3VBFC 3VV1A 2VUAA 4HK8A 1V6LA 3KHBA 3NRUA 3C3VA 2VNVA 3VDBA 2HWB1 1PVC1 3EBRA 2VZVA 4WM8A 4XFGA 2P3JA 4ZKTB 5EYXA 2KA3A 2CYFA 1S2KA 1MS9A 2GC0A 2W08A 3N7LA 1WW5A 3IT8A 5FZGA 1W06A 4K1ZA 3WG1A 1JHNA 3POGA 4R9CA 4Y1YA 4IV3C 3NWKA 1YXWA 1HRI2 3GNEA 4CDUA 1YLLA 3TEZA 2HJIA 3AMQA 3DECA 3AP6A 1RUE2 4QQLA 2Q0AA 1OA2A 5BNNC 1GFF2 1OD5A 2A6WA 5KXDA 1KJRA 4HMZA 4CDQC 1Q5OA 3H3UA 4META 4RGAA 3UGHA 3H9AA 4M4PA 2BEOA 1ND3A 5FZ1A 4HKOA 1YUDA 3H1MA 1CESA 3CO2A 1LODA 3MUZ1 2WNUC 1ODMA 5JR2A 4K20A 4J1XA 3ZFEC 1XNBA 4BOWA 4ISQA 4R9BA 2NN8A 1K3IA 3NKGA 2Y0IA 4DB5A 5A6XA 4EN9B 3HVDA 1R1A3 2Q1FA 3EMRA 1WCQA 1WLTA 5LK5A 2GN7A 3VBHA 3M8LA 4Y5SA 1ULEA 1GP4A 4YGEA 4JDNA 3DPRC 1ULGA 5HCFA 1QJY2 4WZFA 3WNNA 5HCAA 2RMU1 3MW3A 5FREA 1KQRA 1E57A 1OLRA 5GLWA 4XIKA 4MG2A 5SV5A 2NYYA 1XOYA 5T52A 5BNOC 5ACA3 1GSLA 3CU7A 2VO5A 4LOTA 1S0DA 3WCSA 2LROA 1ZZBA 1KITA 2A1XA 1T2XA 2AZ5A 4CDQA 1ZRCA 3OTFA 2P5BA 4QB2A 2ZMKA 5KHJA 1MQTC 1JZ4A 4DINB 3WQ7A 1C1LA 4ASMB 2QUOA 1UZWA 2ZHMA 3O1OA 2PHRA 4IDZA 1WMFA 4KGGA 4E9KA 3IZOA 3H42B 1ASJ2 5KC5A 2CGNA 4N9HA 5D8AB 5LY1A 1GZ9A 4YW6A 4CEWA 3M3OA 2MHFA 3IKWA 1WCKA 3PUAA 5FK7A 3GDBA 1DGWX 4IXLA 2VMIA 2GZWA 1YC61 5DAWA 1QJEA 2RDSA 2I74A 2VE1A 2HKXA 3AM2A 3BN6A 4KQ7A 4V1PA 4ZY9A 5IK4A 4FTBA 2J1EA 5HXMA 4V2VA 4AVBA 3BTYA 1PNGA 3KF3A 1F9KA 4HN1A 3VD9A 4DRRA 5J7MA 3RMYA 1GZWA 1OUXA 2PAKA 2B5HA 4GWIA 2YROA 1DGRA 3OPTA 2KXLA 3ZYRA 5I0DA 1XU2A 4ZU5A 3VKMA 3OGJA 4XFAA 3JUUA 2VCBA 2WT1A 4COZA 5A1LA 4W65A 1BQPA 1YFYA 2F6BA 4M01A 1OQDA 4H3WA 3V56A 3S57A 5FPUA 3RZGA 4W50A 3VBFA 4AHZA 3ECQA 3LSDA 3IM0A 2WWUA 5CYYA 5I0RA 3BI3A 1ZRIA 4QDSA 4CXWA 1N1TA 3I2OA 1L3JA 1NZCA 4K8FA 2P17A 2CAVA 3OPZA 3DUIA 2KR2A 4IV3B 3G6JB 4IV3A 2Y64A 3PVNA 3FUOA 4D7SA 2FHRA 2VXRA 2Z79A 2RDNA 4XMIA 5CFCA 1BMV2 1UMZA 4Q0UA 3MBWA 4JAAA 4PJYA 3I2FA 2PQQA 1W8UA 1JXNA 3IPVB 3LB9A 4JHZA 2HWB2 1UU5A 1K12A 5FJHA 3HQRA 4Q4Y3 1I5ZA 1B35C 3LWCA 2EVXA 3KT7A 5DAQA 1AL23 4P5HA 1GOFA 2HWD2 1BBT1 1OFSA 2ERFA 1SLTA 1DGLA 2WNUA 3P6BA 5FY4A 1XRUA 3VBSB 3MZHA 2D6KA 3INAA 1Q43A 2WN2A 2BNOA 1SG3A 5FZOA 5IHRA 2Y26A 2WO7A 1FOD2 3NV1A 5C7GA 3VBUA 3LE0A 3DPRA 2VVDA 1VP6A 1ZM1A 3MEPA 3FHAA 4QXCA 5A33B 4D7YA 1EAH2 5CFDA 5FY7A 4AI9A 5CB7A 4XHBA 3MO4A 3PTRB 3U4XA 2IVJA 5LBFA 5AVPA 5JAXA 1AR73 2R072 3DGTA 5FZIA 5C9AC 2UWAA 3JBG1 1F5FA 3N36A 5KXBA 3DEMA 2VMFA 5IVCA 2OA2A 3MIDA 4ISRA 4XJ8A 5A70A 1RGSA 3I2KA 1J83A 1UOBA 4AI0A 4XHXA 1T6GC 5T5OA 4AQTA 4C90A 3WNXA 2ZBJA 4A6OA 5F3EA 4Z2AA 1SDWA 1DZRA 4YLZA 1AZDA 1ULDA 2A5ZA 1XXNA 1ZZ7A 4JVAA 4XFHA 4JGYA 4ARYA 2GDFA 3AZXA 4FOWA 5JXJA 5IFTA 4YG6A 5H9PA 4ORFA 3BU0A 4ARXA 2XPJA 1O8SA 4P9XA 5FY9A 4RGGA 5A6YA 1CJDA 4DUWA 2JB8A 4RHV2 3P3PA 4AF9A 2VW1A 1DLCA 3LOIA 2E7AA 3N9QA 4JKLA 3LDRA 4UF0A 2FDJA 1BK0A 4PF1A 4AVSA 5KBFA 3USSA 4F83A 3O1SA 2AACA 4OHYA 5C9AA 1NLSA 2W1UA 2ZHNA 4Q4V1 1QQP1 4HLTA 1NA1A 3WY6A 1BBT3 2R1BA 1VBC3 2ID4A 1RB8G 3K75B 4AI3A 1COV1 5JPNB 1NZIA 3J7LA 1FPN3 3NW4A 3QBQA 4AW7A 2QQMA 3FHIB 5FFOC 1AR91 4M3CF 2WUHA 3I2DA 1Q8VA 2E63A 1DYOA 4MGZE 4QGMA 1HDKA 1RVF3 1TMF2 3ZOIA 2R32A 1OKQA 3JQWA 3QOPA 1TNRA 1YQ8A 2WR9A 1WLDA 3HEIA 4UFLA 1FATA 3OPWA 4YW5A 3SH4A 4S2GA 5I91A 2P1BA 2QQIA 3K46A 1DQ5A 4IEUA 4JQTA 2IUWA 1D2SA 4MADA 3NJZA 4CP9A 2VL4A 5B4XA 3OBAA 1DHKB 4IEQA 3W20A 1GU3A 1U5YA 1H2LA 3A21A 5GJ6A 2MNGA 1BZWA 2XJUA 4AQSA 1A3KA 4BISA 2WBKA 4Y22B 1L7RA 4AL9A 5FY8A 4DEVA 4AHXA 1RJ8A 1KEXA 2WLQA 1OF3A 5C4WA 5JZGA 3D3AA 1RUH2 1ZBA1 3MIHA 3OYWA 2BVBA 2YC2A 4LORA 4YWAA 2E32A 2W68A 1ST8A 3HBKA 3Q8EA 3PU8A 3ZFFA 4E27A 4RFT0 4H14A 4RR3C 4Y1ZA 3MGUA 3UK9A 1GQPA 4B29A 3IIIA 1ZA7A 4QDQA 3J7MA 2VZOA 1F5JA 2QQUA 3G7DA 4LKEA 5T50A 1AYN3 3KS7A 1O3QA 1CN1A 2BZDA 4A6SA 1J3PA 3WR0A 5L7OB 5JXHA 1BBT2 4DXRA 1LHWA 3B01A 1MZFA 1JZ7A 4KWLA 3K4DA 4R8HA 1BVP1 3NSTA 4M3CB 2X05A 3ZYFA 1PMHX 3B94A 3SEEA 2PAMA 1CJPA 3SEPA 4QX5A 5KHGA 2DVAA 1QJY1 3MW4A 5FV3A 2PHTA 4YRDA 1HQNA 4I30A 3IIAA 1N3OA 1RUH3 4YVWC 3N3HA 4K21A 5CISA 5A3MA 1SBEA 3NQHA 2DVGA 1KD7A 1TZOA 1V70A 1VRBA 2W9XA 1J58A 2DUQA 2QCSB 3FLTA 4K40A 5FZMA 1NLRA 2R063 1TMF1 5IVVA 5HCBA 1H8VA 2BOJA 3KVBA 4EN7B 1QDCA 3SCGA 1H2NA 1M4WA 1WA4A 3R0RA 5G05L 5EQUA 1MEC2 1AR72 1QDOA 4MV2A 3UT0A 5FKCA 4CDUB 1LENA 1RVF2 1SLAA 1TMF3 3CF6E 5I0UA 1POQA 1S2BA 1TG7A 1K5MA 3SH3A 3B5LB 1NA1C 1ODNA 2QVSB 3GZUC 3NJXA 3TN91 4GALA 5C8CA 5M0TA 1NCQB 3TRSB 1W9TA 2WC2A 4FOVA 4MX3A 3UGFA 4Y5Z0 3USUA 1VBD3 5F32A 1AR62 1JI6A 3SXWA 4RHV1 3AKRA 5DG2A 3GYDA 2WWJA 4R9AA 4IEVA 4QXHA 2E31A 3DKQA 2WZR3 2DCKA 4P9YA 3C8XA 4QPIA 4J6GA 1W0NA 4HSLA 2EXKA 3H8RA 1MVEA 1JTZX 4BQXA 4FQ4A 3FBMA 4XDOA 4LR4A 3K51A 1NG0A 4WM8C 2WINB 1I1EA 3RMXA 4YZ3A 2A3WA 3VUOA 5D1IA 1CIYA 1RUI2 3PJQA 5ABJA 2EAKA 3OEAA 1AUYA 3OB8A 3BKZA 1SACA 4URAA 2Y0OA 2CHHA 3O0VA 4O65A 1URXA 4UYBA 4QDRA 2WDBA 3U11A 4IE4A 1XE0A 2NMNA 4CDXC 3ZPOA 2W87A 4XF9A 4FFFA 5CEHA 1G9CA 4XETA 4IEYA 2Q4SA 1VBD1 3GJBA 4IE5A 1WW4A 4NRQA 5FYMA 3AMNA 1DG6A 2GP5A 4GB32 4I02A 4LNVA 5F3CA 4RGKA 3VN4A 4X6QB 4RL7A 1UZYA 3WW4A 2MEV1 2RS52 5DAPA 4QPIC 5DG1A 3ZIXA 2IXHA 1ZBE3 1GMMA 2B9UA 3ZFEA 4X6RB 2E7TA 2XWBB 1Y4WA 2ZOEB 5A3TA 1JMUB 1MS1A 1UX6A 1Z7S1 2P3KA 3ZFEB 1EV12 1W9YA 3KLSA 3QACA 3MI8A 3VD3A 4YG0A 1CAVA 1U12A 3DN7A 5BUVA 3V0BA 4FT8A 5ABJC 4QPGB 1GZWB 1TVGA 5E8AA 1W03A 1DU3D 2XVLA 4CPBD 2W1WA 1DZTA 1RUJ3 5A32B 2EXHA 1RMU2 5BNNB 4JTNA 4CDXA 1LGCA 1DBNA 2P34A 3KV6A 1AXZA 1OQ1A 3ZLIA 4FBFA 1GOGA 1I6XA 3T30A 4L99A 4Q5OA 5IVBA 1LR5A 4QAWA 3JQXA 5C5UA 2SLIA 1OOPA 1PO23 2AEZA 1S0EA 5IK5A 2PYTA 1D4M3 1H4HA 3DYOA 3MFCA 5GZCA 2W1SA 4QD2A 1QGLA 2BOIA 3KGLA 3W5NA 1E5SA 3VHNA 4COUA 4QX0A 1G9FA 4EYUA 4TTGA 3AYCA 1LTEA 5AC93 4AQ2A 1XC6A 1JU3A 1JU4A 3CNAA 5IWFA 3RYKA 3WW3A 4C0HA 3WDXA 2VUDA 4NRPA 1YFWA 3ROUA 4CCDA 4XJZA 2GNDA 5LRSA 4YVWB 1YFXA 4EJRA 2RS51 3RYPA 2VW2A 2BGCA 4LKFA 4HSJA 3UGGA 3WDYA 1J1TA 2NM1A 3D4KA 2CY6A 3MIFA 1PO12 4RQPC 1REDA 2B8MA 4PI2A 1F4HA 2YBKA 3LEGA 4AEDA 3VZOA 1G86A 1JUHA 5JCTA 1DLLA 5FO7B 5JOYA 3AJYA 3KT4A 5B4NA 1LGNA 1ND3C 1RMU1 4NPLA 5GZFA 3OD4A 4EN6B 4DZGA 4AXOA 4PQQA 1OF4A 1QF3A 4PDWB 1VMHA 4AE2A 2QQVA 4NPMA 5FLIA 2V4AA 2XGXA 3AP4A 4Z82A 3VBSA 3U1XA 2AYHA 4K1YA 4YNIA 1RXGA 2JIGA 4NJ4A 1FV3A 3LKJA 4BK4A 3ES4A 4BWOA 4MHRA 5LA0A 1LOFA 3HMYA 2RV9A 1YEWA 1MVQA 2D5HA 4B8EA 1OMIA 3RJ2X 3ZYJB 1ZYBA 1R64A 1FNYA 3B9IA 3SCHA 4O9EA 4I0WB 4Q4X2 4Y20B 1DQ2A 1PGW1 4LO8A 5JLVA 1BXHA 2ZACA 4FAGA 1I5PA 1TME1 5ACA1 5A1FA 2OVUA 1C8NA 3AMPA 2XBO2 4LOSA 2Z5WA 4ZU7A 2FZ2A 3E5XA 3LA3A 2QDNA 2VECA 4NR1A 3WUDA 2RS31 2DU0A 1UY1A 1RUJ1 4NAOA 1IGOA 3ZXAC 3VBSC 3MLJA 5H9QA 2W1QA 2JDZA 1C8M1 1S0FA 2HBUA 2ZX4A 3E5UA 4Q4Y1 1O91A 3ZXLA 2FDHA 3MLKA 2VMEA 3WX5A 3VDDA 4CUGA 3RVHA 2Y60A 1YJKA 3AP9A 4IEOA 4QX3A 5JPMB 1JZ6A 1KDKA 3UKVA 1Z7S3 1RL3A 2B39A 3I3EA 1S0BA 1X36A 1LHVA 2F4LA 2IWGB 2VOTA 2VU9A 3U10A 3ZSMA 4IGQA 3RPQA 1GBGA 2YUEA 2KD7A 3JU9A 5AVAA 3LDBA 1H30A 3WZ1A 3VBRB 3GBGA 5DUWA 2ZMLA 1O3SA 1CX1A 2OUJA 3H7YA 3RSJA 4UOJA 2Q8EA 3OUJA 3RFRA 4PLMA 4WZCA 3DKWA 3VHRA 2D6NA 4LHSA 2Q1MA 2GMEA 3HD8B 3N9NA 4Q4W1 1SZBA 2IVIB 2K9ZA 5LWBA 3JB8A 4CEYA 2DVFA 5C33A 3ZM8A 2PXJA 5CADA 2D98A 2ES3A 4DUVA 3I2HA 5DUUA 3N9MA 3ZFGB 5I8SA 2VUJA 4YFZA 1XBFA 2XOMA 4NHYA 1Z7S2 2DYCA 1A8DA 3I3DA 1OT5A 4FXKB 2RDQA 2CWSA 4HL0A 1FNZA 2PLV2 3RI8A 3KQ4B 4P00B 2D93A 2XJVA 4B3NA 5C3QA 4AZZA 2HWF2 3VZJA 1M06G 3DXUA 5FAXA 3Q9OA 5L36A 1QEXA 4XUNA 1CAXB 1LEMA 2X09A 3ZN6A 5F3IA 2W2IA 2ZEZA 1WW7A 1CAXA 3ZN6B 1X33A 3ZXGA 4ZS3A 4MLOA 5HI0A 4MGQA 4YZ2A 3H50A 5IAVA 5LY2A 2KM2A 1OPMA 3ETPA 1SPPA 3ELNA 5T5PA 3ZFFB 1NT0A 4OULA 3NJVA 4MOAA 4P08A 5GLVA 4NO4A 1Z0HA 4WM7B 1GOHA 4JKKA 2JG9A 4BXFA 1EP0A 1H9PA 3VGIA 1JOPA 3O1RA 2JG9B 1ZZ8A 2JDUA 2MPFA 1JZ3A 4IW3A 1EPZA 1Q8OA 4HPKA 2OQ6A 4H2AA 3ILFA 2B42B 4WVMA 1W8ZA 1NQDA 2XB6C 4UBHA 2VZQA 2XJTA 4IUGA 4LO4B 3KD4A 3ZSJA 2PMWB 1BJQA 1HJGA 3PJYA 1UKRA 3U14A 2PLV1 5IVFA 1HLCA 4MZUA 4QHOA 1V9U1 5A80A 1BEV1 3GZTB 4L11A 3V0AA 3OGGA 4LBQD 3WINE 4LBOA 4LBNA 4XPVA 3ZFGC 2BP6A 4LO6B 4Q4V3 1UIKA 2D3SA 5IUQA 5DZEA 3K3OA 1H6YA 1PVC2 2V5YA 5L9RA 3O12A 2NMOA 1IS6A 5KXCA 1STMA 4XYXA 2ZZJA 1PM4A 4QU1A 2LUWA 1GNZA 4ATEA 4Y26A 4FAHA 5GZGA 3I59B 4KG0A 1GQHA 4R52A 3WQ0A 5F9TA 2CGPA 1LJ7A 2QZ2A 3HR9A 3M3CA 2D6MA 5FY5A 5IYYA 1XE8A 4LK6A 2WAAA 5F2WA 1R1ZA 4XUTA 1SQ4A 5K7PA 2XONA 4NMIA 3BB6A 4Q2FA 1OLME 1UPSA 1EAH3 4OUMA 4EWEA 2VNOA 2LTNA 2Q30A 1H8TC 2V73A 2Y6GA 2D43A 4OMDA 4D7TA 1WGPA 4LHNA 4CCNA 1PIV1 3BU7A 3CIHA 1YIFA 3WG4A 5DQ0A 3MV11 2RS32 1J84A 5BYNA 2Y33A 3LFIA 2VBBA 1RUJ2 4HXCA 1OSGA 3OOXA 1J1LA 1PMJX 3PUSA 4BPZA 3WP5A 4N9IA 2R0HA 2CSGA 4KU8A 1EV11 1CVNA 1GQGA 2A6YA 3ACGA 3IBMA 4O7XA 3VKFC 3WD5A 3WG2A 4BXSV 1OXCA 4XZUG 2CNAA 1BLZA 3GCWA 2PHUA 1ZVFA 5FY1A 5LASA 2X29A 2JB4A 4E4ZA 2HH9A 4OHWA 2A6XA 4HT1T 5I0SA 1POV1 2XR4A 3AZVA 4IGPA 3OGRA 4QXKA 2R041 2ZEYA 4LITA 1UMIA 5DN2A 4D8MA 4QM8A 1KS5A 3SNMA 1AL22 3IB3A 3ITQA 2A3YA 2QKDA 4ZPIA 3HPNA 4D6SA 4INDA 5LB6A 3LA2A 3IDAA 3MLLA 3OCPA 4X8NA 4YZ4A 4AYUA 2IXKA 2VPVA 2XUEA 4FOYA 1H0BA 4MXWA 5C4WC 1TEIA 1G6NA 2G19A 3CZJA 2RM22 3M2MA 2PHLA 3S30A 1JYNA 1J3QA 3HT1A 3VZLA 1NCRA 2G1MA 2XQRA 2ZGMA 4EN0A 3WDWA 4ASLA 3E6CC 4LQRA 5H9SA 1RUD2 5L9BA 5CVRA 4FPHA 4FPEA 1GWMA 1AR82 3V65A 4AVCA 5A3NA 2JE7A 5C8CB 1W9SA 1Z78A 5FZCA 3MDPA 4LK7A 1HN0A 5T3NA 5LW9A 2O8OA 4BZ4A 5IAXA 5A32A 2YPDA 1W2NA 4RSUA 1D4M2 1FMD3 2WQ8A 3IDBB 1HV1A 3FX3A 2DFBA 4A42A 4XF3A 2D40A 4XUPA 1C5IA 4QKNA 3KV5A 2AREA 1HRI1 4NPRA 3LGRA 3PNAA 5D8AA 1MS0A 2X5IA 4AVVA 3I97A 2BBVA 4KBZA 3VBRC 5HV4A 2AENA 5C3OA 3PUQA 1LU2A 1YHFA 2E6VA 3FUQA 1JOJA 1QJU1 4LPLA 4URTA 5F5QA 5A7NA 3SMHA 2VG9A 4CUBA 3NNLA 4Y5TA 1RXFA 4XXPA 1AX0A 3WVJA 4DS0A 3D82A 1X8EA 2NZ9A 3AMHA 1U0AA 5EJZB 3RI9A 4A7KA 1GICA 3H8XA 1O3RA 3VL8A 5K9YA 4Q4Y2 1ZZ9A 2CL2A 3EJKA 3N7MA 3VDAA 5CAZA 5JUVA 1VB4A 3TNPB 4TSVA 1NX9A 3ZVXA 3PMSA 4DIQA 4CZSA 1ZA4A 5BPXA 1ZBE2 4CU9A 1AYM1 1AYN2 3DF0A 3QLQA 4ZZ5A 1CR7A 1RUG3 5C8CC 2XXZA 3TOJA 2ETEA 1H1MA 2VQTA 2ZGOA 3LIHA 2XBO1 2WJSA 4JHTA 3ZYGA 1ULCA 2ZAHA 1NCRB 1UKGA 4MHUA 4BM8A 3SC7X 3T08A 5LEKA 2DV9A 5FMDA 2XG3A 2GMPA 2LW8A 3WF1A 5F6KA 4LUKA 2JICA 3HAGA 3NNFA 4YM0A 2P6CA 2XBO3 4CVUA 4XQWA 1JZ5A 4BQ1A 2WT0A 1N1YA 2NQYA 2FBEA 1Y43B 1FMD1 4Q4X3 4CDXB 4NE9A 1ASJ1 1VJ2A 2ZHLA 4UBGA 1XNKA 4DXSA 1VRH1 3ILNA 4Y1VA 4YGDA 3K48A 3CZUA 1ND3B 2Z69A 3RZJA 4PDWC 3ZR5A 1XNCA 2VD7A 5K0UC 5DABA 2QQWA 3RGBA 1XJAA 3TBDA 3ON7A 1U5ZA 2J22A 1V0AA 2GH8A 1SDDB 3POYA 3ZXJA 2OKXA 4M3CE 4AGGA 4COYA 3SLIA 3RRDA 3T2TA 1PGL1 4DOUA 1NKGA 2BBAA 5FYVA 3O1TA 3AK0A 1GYKA 1W6NB 2R6QA 2BFUL 3BGAA 4D6RA 3W21A 3LEMA 1HRI3 3WF2A 5E89A 4XUQA 3S5QA 4GULA 3DYPA 5J98B 4CP0A 4DUXA 1O6UA 3VDDB 5EP9A 1UYZA 1PO13 1XYPA 4AAXA 1X8MA 1MQTA 4QGNA 3MICA 3EYPA 3EXUA 1LOFC 3KF5A 4XFBA 2WS93 3ZSEA 1W8NA 5LZ6A 3PURA 1VE0A 3R6SA 1ULOA 3S0MA 1RUOA 2VNGA 3VZMA 5IT6A 3AXDA 3NO8A 4PT6A 1RUF1 2JG8C 4ASKA 3O1MA 4FP3A 2A75A 3KGZA 4UFIA 4GD4A 2YBSA 1ZRRA 2WFF3 3ME2A 5ANQA 3NAPC 2V09A 3JBG3 3EHKA 4XXAA 5C3SA 3TEXA 2WZR1 3CEWA 2UYAA 4UFHA 1V6OA 4QPGC 4XE9A 3MIEA 1ZZ6A 3MIGA 3EQEA 3PDQA 5HBAA 2VMDA 2WFF1 1XSRA 3WNKA 5T5JA 2PHFA 2QQNA 2JECA 4OFGA 3R4SA 5EXOA 2R043 4Q0PA 1PGL2 1Q8QA 3TN93 3ZYHA 1UY2A 3H1YA 2F4PA 4LE4A 5JVVA 4GH4C 2VOVA 5FQ0B 5J96B 5FO9B 1A34A 2VCMA 5IK8A 4LLOA 2ZGUA 2HEYF 4P02B 5A1AA 3VB9A 1GWLA 2UY8A 3J9SA 4I0AA 4QX1A 4AAPA 1JH5A 1UD1A 3VZKA 1G8WA 4AFMA 1XU1A 1RUI1 1LHNA 4BQ2A 1C8M3 5J48A 3FN9A 1FAYA 3U75A 4XFCA 4MSVA 4XF0A 5A7WA 3WXPA 4I2OA 4AGVA 2J1RA 4YSFA 3J7HA 3FWEA 3C7GA 2OPWA 2GAUA 1GR3A 1WMXA 2JD4A 3NNJA 4PHZA 4AR2A 4FPKA 4Q0VA 4O9GA 1YQ5A 1N47A 3GJAA 2GALA 2Y38A 2E51A 1UZ0A 3KM5A 3ACFA 3BPZA 2GNMA 2VTXJ 3FZ3A 5EV7A 2VBPA 4GB31 3K4AA 4Q1RA 4GJYA 3ZN4A 1NQJA 3UJOA 3U78A 1DZQA 1E5HA 1SLCA 2DTWA 1OA3A 3J8F3 2R7EB 2RM23 3M70A 4CXYA 2DVBA 4OUSA 2RS12 4LEJA 2ZZQA 1QNYA 4L2NA 3DCQA 1XNDA 2GC3A 1Q56A 2N7GA 1NCQC 1RUH1 1S4CA 1ZBA2 3POBA 1IPKA 1KGYA 1NAEA 5FZKA 4GKYA 2WNVC 3OY8A 4NROA 5JIUA 4NIGA 3ZX7A 3VD5A 3GM8A 5EWSA 5DDJ2 3WF4A 1OLQA 1VR3A 2PAEA 1LOEA 4L92A 2JIJA 5CNAA 2RS13 1DYPA 2XQXA 5APAA 1DQ1A 4CXXA 3EB7A 4LXLA 5CG8A 1ZREA 4N8MA 4XF1A 1GNHA 3LFMA 3I2IA 1WW6A 2LALA 1COV2 5HXVA 2VZRA 4D6QA 5C8WA 1YWKA 2BNMA 4GWNA 2BUKA 1LHUA 2W95A 3UKNA 3VBHB 4YM1A 5C3PA 4IQPA 3L2HA 4BK5A 5C71A 1C8M2 3WP4A 4LULA 1IPJA 2DWRA 3U4SA 3TEWA 2RM21 2Z4FA 4OI2A 3VDDC 4NIDA 3PU3A 4P9WA 2WSUA 2B4KA 3GZEA 2QTWB 3A7QA 5FWEA 5EPAA 4RYDA 2ADDA 3WP3A 1AR81 1V9U2 2EAAA 5BNOA 4BQWA 4NOTA 1QJU3 3H8UA 1RHI2 5ERLA 2JDPA 5FIXA 5K0UB 2FQPA 3ZXEA 3T09A 1WCUA 1IQAA 3TNQA 3B93A 4S2DA 1XSQA 2PLV3 3KV4A 4XJAA 4GWJA 3T1LA 5FR3A 2VC9A 4MGSA 3RZLA 4YPJA 4C0BA 2WLPA 1RUG1 2VM9A 1LOAA 4LT5A 1OHFA 3UNPA 2WFPA 5C9AB 1LECA 4U36A 3VBOC 1DF0A 3PUIA 4GZ9A 5E1RA 1N3PA 4JKMA 2YYOA 1FXZA 2LS6A 4OYUA 1JOBA 4QB1A 5A3OA 2VUCA 2Q8CA 1UU6A 5DDJ3 3WT3A 2P3IA 4E4DX 2FDIA 4OQ9A 2JXAA 2J1UA 2PHDA 3V64A 2ZGQA 2HWD1 5FPAA 1HKDA 2K2SA 3N7JA 4P9JA 1OBNA 3AJZA 1PX4A 3AZWA 4E2GA 4XC9A 1W6OA 1OH3A 2XVKA 4W6WA 3KMHA 4JRLA 2VULA 5FBJA 4HG6B 5CFDB 2YHJA 1CIWA 2ZGTA 4IV1B 3TAYA 3F2ZA 3H0OA 5JZGC 2X8KA 5I8YA 2QQOA 2XWJB 2DBIA 3O0XA 4AI1A 5FZHA 5JR7B 1DQ4A 2R0FA 1HRV1 2GSYA 2RR13 3WHUA 2NP0A 1W2UA 4MVTA 4Q1PA 5J3UA 5A3PA 5FXZA 3ZMNA 4RR3A 1PZ7A 4Z1VA 4KI5M 3U0ZA 2NPIA 1ENQA 2W0XA 3AKSA 1H8TB 1R081 4HK9A 5FZDA 1JZ2A 4JGYC 3E1F1 1O59A 4PBPA 2WA3A 2VZ1A 3I54A 2QQJA 3O5SA 1NCQA 1DGRN 1OQEA 1V6MA 2WS91 1YFUA 4LA3A 4UW3A 4HFSA 4CCKA 4CP2A 5CFCC 4CDQB 1HX6A 1W6PA 2O1QA 3PL0A 1XNTA 4OHXA 1ENSA 3HNYM 4XJWA 1OOPB 2CU5A 2WO3A 1WCDJ 3BOPA 4BQ4A 5KWRA 1RUD1 3ZN5A 4Q4W3 3O1UA 2BW8A 2XL9A 3VKNA 3ZDSA 3LF7A 4XFIA 4AHYA 1E5IA 3H3LA 3WF0A 2WNOA 4LO5B 4JCKA 4OLLA 4WVMB 3T0DA 3E5QA 1QNWA 3HWJA 4LBLA 4CCEA 1VPHA 4OUEA 1PVXA 5BNPC 3HNMA 3LPGA 4KL1A 2HEWF 4B4PA 5ABJB 2WSVA 1WBLA 1O3TA 2ZGPA 2IXIA 4S2HA 4XTPA 4TXWA 3BTZA 5FZFA 4MGYE 1POV3 3RNSA 1LOCA 2IXJA 1UY0A 3UKTA 3ZO0B 3OBZA 1MPXA 3P1IA 3CQOA 5DDJ1 1NXMA 2JEMA 4QXBA 3RYRA 1BCXA 1Q3EA 3Q8FA 1CPMA 1OFNA 4GWMA 4YVSC 2OYZA 5JMCA 5FWJA 3RZMA 2J42A 4Z8BA 4XCBA 2K46A 5FZ3A 3N4MA 5FPZA 1IS3A 4OHVA 4AWDA 3DXTA 2VJXA 4IV1C 1R082 1QU0A 5HCHA 5FZEA 2YXSA 4JV4A 5D8AC 4IGOA 1KS4A 3NJYA 4A44A 1ZNPA 4FO9A 2VZTA 3AZZA 3A4UA 1U5XA 3JD71 3POJA 1MR5A 4RR3B 2DCYA 3T0BA 4W4ZA 3S7EA 3IDEA 4AFBA 5JSPA 1LU1A 4OI0A 1MQTB 1IG3A 3I3QA 1BKZA 2Q8DA 1CQ9A 1DQ0A 1W0OA 1REEA 2YB7A 1RUE3 2QE3A 1VALA 2RDRA 2YFZA 3NMBA 1R1A2 1H1IA 2UU8A 1WA6X 2X10A 1W0PA 2FD8A 3A0NA 4NHLA 4XBLA 1AYN1 1AYM2 2XDVA 4UT5A 4LBJA 4FFHA 1IHMA 3WDVA 1ONAA 4PIYA 4Q8LA 4Z92B 1L7QA 2H6CA 2Y6HA 1OPOA 1RUC2 1PX3A 1QY4A 2BRTA 2ZS6B 3PVOA 4LO7A 4Q0SA 5L73A 5IATA 2VBDA 1NA1B 2ZX3A 2YBPA 2YU1A 3B7MA 1VBB2 1RMU3 2DCTA 2WABA 2VH9A 2ATFA 4K8RB 1PO21 3FJSA 3NKTA 3RG0A 2E33A 1YQ6A 5JOXA 5DZGA 4CCCA 3KZ4C 3VD4A 1Y9MA 3SITA 1VBA2 4YVWA 1SHWB 2QQLA 2I2SA 4QKDA 1W8TA 1PZ8A 3APBA 4I09A 3POIA 1UQXA 4E8CA 3O1VA 3D0SA 3IAPA 4JGZA 4ZXEA 1MS3A 1IG0A 2QJVA 5FMCA 3TB0A 3UV9A 3NV2A 4AEDB 3M3EA 4KGQA 3VZNA 2VY0A 1YIPA 3D8CA 4L97A 3AKPA 1FPN2 4P14A 2JDMA 4XFFA 1W8OA 1CONA 2EICA 1GZCA 5K8SA 1BEV2 2XL7A 4OI1A 5FP3A 4YZ1A 1BEV3 4OQ8A 1RC6A 2RE9A 5FLHA 2ZEWA 4QQHA 3HJRA 1J3RA 3WNOA 4CSWA 4D94A 2FDFA 1SPPB 1S0CA 1DP0A 5BNNA 4KMQA 1UU4A 4RHV3 4TWTA 5FJKA 5KXEA 1LOBA 2VOWA 4BH9A 3AVRA 5GKAC 4KWKA 2AUYA 4AG4A 2ZX0A 4XABA 2WRAA 5EZWA 1SCRA 5FZ9A 3WOGA 1TME3 4I3GA 5CU1A 2Y6KA 3AYAA 4YVSA 3CLPA 4RS5C 1P8JA 2AGSA 1W6MA 1AF9A 3FHQA 3OF1A 5F8PA 4ZU4A 4CDWA 2CAUA 2VZUA 2ZX1A 3JZVA 4JX0A 4N53C 3L2YA 4WM7C 1W9FA 5FZAA 1MZ5A 1AJKA 3UL2A 1UX7A 3D0JA 5F37A 5FUNA 5KC6A 3OEBA 5JI9A 1ND2B 1JYCA 1XYNA 4HBNA 1EV13 1DGWA 2CDOA 3ZPYA 1JS9A 2HWF1 2BPA2 1ULFA 3I7DA 3SISA 3AZYA 3ZYPA 5A7WB 2A6VA 1EUUA 5FZ4A 1HQLA 3KT1A 2QBXA 2P6HA 5DAXA 4PIZA 2R042 2OZJA 3THTA 4M0HA 2JD9A 5E88A 4RQPA 2HYXA 1JYIA 1R091 2XLAA 4EV0A 3E6BA 3PLQA 1CZTA 2G9ZA 2BTVC 3D6EA 3T2OA 2HBTA 3LSEA 4IEWA 1VAKA 1RUF3 3EO6A 4G9SB 4COVA 1EPWA 1CAUA 1RHI1 4NRMA 1PVC3 4WM8B 4EWDA 1OURA 3GHMA 4A41A 4BU2A 3WNMA 4HOOA 5I0TA 5F7UA 4CTEA 5JDBA 4PDWA 5BNPB 3P3NA 3LIGA 4LA2A 1FYUA 5T55A 4ES8A 3CL1A 3VKOA 2YGLA 1QJZA 2G9FA 2ARCA 2J1SA 2IXCA 4HZFA 3RWKX 5FO8B 3V0AB 5K0UA 1NE4A 5LBCA 5FOJB 2EXJA 4D0QA 3MPBA 4FPJA 4M4RA 5GALA 3TWIA 2ZGLA 2ORZA 2Q8OA 2BJSA 2BGOA 1H2MA 1HJFA 4BQYA 2GP3A 4M00A 1W2AX 3WNLA 3O1PA 1ZBA3 3ACHA 4Q4W2 3MYXA 4I0BA 4GA9A 3OGVA 3VBFB 2GMMA 4NIIA 1POV0 1D2QA 2OPKA 4OZOA 3KHCA 3OJBA 2XKPA 4FQZA 1MZ6A 3HN3A 5JZGB 1S2EA 1VBA1 5L19A 2F17A 4C1XA 1O7FA 1UYYA 2O14A 5FKBA 4QHBA 3C7HA 2I45A 2HWC1 2VXJA 3UETA 4B4QA 5C3RA 4QKFA 3I49A 5LEJA 3NAPA 4YYOA 5LRRA 2ENRA 5F3GA 1QKQA 4PQ9A 3T4VA 1UIJA 4LE3A 5FYHA 4N43C 1CAUB 1V6IA 1AR93 1APNA 2RJKA 3VHPA 1HB4A 3NV4A 4YZ5A 1Y9GA 5D2AA 4H7LA 3N9PA 5F5CA 4YW1A 4ZHNA 2ARXA 2OIIA 3JD73 4LMFA 4RA0A 4CEWB 5BY5A 5FYIA 2VCAA 2XJQA 3LQCA 2NLRA 4K9SA 4GH4A 1SFPA 1EUTA 1QXRA 3JBG2 4M0NA 4P9GA 4BYYA 4TN7A 4HKLA 4DEQA 1SLLA 2JKXA 2JE8A 3CKHA 1PK6A 4AVTA 2VNRA 4QPYA 4GQ7A 3ZKYA 3HIFA 4LKSA 4QGLA 5LBBA 3VBUC 1NY72 3D5OA 3BUCA 1DYKA 3W58A 4YW3A 4B1MA 4FPGA 4D69A 3CHXA 4N7UA 4Q27A 2BYVE 3WQBA 1PIV2 1V6KA 2QDRA 3BTXA 1IPSA 1A6CA 1E5RA 4N43B 3E6DA 2ZTNA 4N53B 4LBKA 1IS4A 4N43A 3VKLA 2WZPP 5JXGA 1WMDA 3QD6A 2BWAA 4LIUA 1CAWA 2WFF2 3LEKA 4E8DA 1RUG2 4D3WA 1AR92 4FP2A 4XUOA 4QB6A 1HB1A 1O8PA 2VTFA 5K4LA 2YMZA 1V6JA 4O61A 4NHKA 3GGLA 1C1FA 5FPBA 1JYVA 1UY4A 4BDVB 4BMBA 2W5FA 3SCFA 4K3UA 3VBHC 1N3QA 3J4UH 3NAPB 5GZEA 2VMHA 3AXEA 2FDGA 1IKQA 1BK1A 1CZVA 2X53S 3K2OA 3LCPA 4I01A 4WV8A 2WZ8A 4KWJA 3ABZA 1TQ5A 3U37A 5KHIA 3ILRA 2R1DA 2V72A 5JOZA 5FXXA 3SKJE 4A45A 1UL9A 4EROA 3N9LA 1HIXA 1COV3 1S55A 2Q1ZB 2WNVB 5FTTC 2GH2A 5A7SA 1B35A 3WSOA 2AH2A 2AR6A 2WNVA 3Q8BA 3RWNA 4MO3M 3POWA 5FRAA 1AHSA 1IKPA 2J1VA 2J7MA 4QX2A 3PHMA 2SBAA 1C3HA 4QQOA 1B09A 3AYEA 1A8MA 5FZOB 3T2PA 4CRQA 4CU7A 3CBNA 4IERA 4CEYC 2PFWA 1KDMA 3M4FA 5HV0A 3VDCA 2FCTA 2IXLA 1XPWA 3B02A 5SV8A 4A7ZA 5C6CA 3NNGA 2HWE1 4NHMA 4XVHA 3QH6A 2DTYA 4QM9A 4BIOA 4XQ4A 2QQKA 3M3QA 1HW5A 3WV6A 2W47A 1W99A 4EE2A 2YPJA 3S6PA 2D3PA 2G9GA 3B00A 4SBVA 1CPNA 1UAIA 4QPIB 5EIYB 3C7OA 1SLIA 4F8AA 5FP4A 1D7PM 1DQ6A 2PELA 2ZABA 4GIQA 2D6PA 3U07A 3M7AA 1F35A 3I4IA 4CP9B 3TEYA 2BQPA 1G7YA 1Q8SA 3MIBA 3UYJA 1PO11 2EALA 1OUSA 2J1AA 1NUKA 1WCSA 4FPYA 2VOXA 4YFWA 1EAH1 2TEPA 2ILMA 3SKVA 1ACCA 1D0GA 1H8TA 2Y6LA 1OA4A 4Y1XA 4DPNA 5IVJA 2BGPA 4FI9A 2XHNA 3RZZA 3ZFFC 1KFXL 2YFUA 1MS8A 2ZJCA 3MUY1 4BE3A 1RINA 4W8JA 1LRHA 4CUCA 2VW0A 2EIDA 2B7YA 1PK6C 3POFA 1W6PB 1QJX2 4ZONA 4YARA 2JJ6A 4KNCA 2HWE3 1LULA 2VTXA 3K3NA 1JZ8A 4NWWA 2GNTA 2VVFA 4YM3A 4YGBA 2FMDA 1YI7A 3T1MA 4ZZ8A 3FL7A 4Z2WA 3B9CA 2X5IB 4UF0B 5F2SA 1FOD3 1N1VA 2HWC2 4TLGA 1S0JA 4LBMA 2C6SA 3POEA 2Y6FA 4Q8KA 1NE6A 1Y9QA 2L9LA 2RJ2A 2HWE2 1HXS3 4G4FA 3AYDA 1D4M1 4E2SA 1PHMA 1VMJA 1V9U3 5FPXA 4NVPA 5AFBA 2ZGKA 3FFZA 2WQ4A 2EA7A 4XJUA 4RN5A 1JHJA 3OBRA 1D0HA 2PQSA 3GZAA 1VIWB 1WMEA 1YI9A 3MFAA 2YGMA 4LKDA 4R4ZA 4XBQA 3AP5A 4Y20A 5J36A 4MGKE 1GZTA 2P3YA 1REFA 4NN0A 5F6LB 1KXGA 2W94A 5A3WA 3TN92 1KRIA 4AFAA 2PA7A 2XJSA 2C5DA 1SMVA 2EIGA 2OXBA 3ZYBA 3QCWA 1BMV1 4B1LA 4MYEA 1DDLA 2A3XA 2ZEXA 3AFKA 1LEDA 4PI0A 4IEXA 1PMIA 2WQZC 3N7KA 1V6NA 4AOCA 5T54A 3MF6A 3RS6A 1CAVB 2DFCA 5EHDA 2D6LX 3V0BB 1QJY3 2VZSA 5L9VA 4AGRA 4GB33 3ATGA 2GC2A 2C26A 4LBQB 4P5YA 2ZX2A 3KWVA 3IMNA 3LZZA 5FXWA 2ZKNA 1ULPA 5CIRA 2GU9A 3VLBB 5LA1A 5IK7A 1HRV2 4J1WA 2K0GA 1W39A 3F95A 1VBB3 1JODA 1QOOA 3AC0A 4EWAA 1QMJA 1FOD1 3OUIA 1H1AA 1VBD2 2W3JA 1EYBA 3AX4A 2O8QA 1LGBA 1RUI3 1F8VA 4GMP1 4CCLA 5FZ0A 4UI9L 4XW3A 1ENXA 1QH7A 4TLFA 2P2KA 1QIQA 2RHPA 1CX4A 1UO9A 2WAOA 2XH6A 2XMLA 3A23A 3OGSA 3R4UA 5CBLA 5LCWL 1YRZA 4B7EA 2Z42A 3OY8B 2OZ6A 2WZR2 2H6BA 3OUHA 2D5FA 4K6BA 2Y6JA 3AB0A 4RQPB 2UWBA 1RUC3 4HKWA 2ZA9A 3LAGA 3ZXKA 4OVEA 5FUPA 5FZBA 4FPCA 3CJXA 1UZVA 3ZR6A 4BMEA 4UFMA 4Y3OA 4AEKA 1LESA 2B46X 2RVAA 1UOFA 5FYSA 3THPA 1W9WA 1SCSA 3FE5A 1IOAA 4BLIA 4A4AA 3PVEA 1RUNA 3I3BA 3VHOA 4FSJA 2D97A 3MPPG 5DAVA 2YV8A 4IL7A 4YG3A 3TYJA 4COWA 4G3YC 2WNUB 3OD0A 3RJRA 3A22A 4EZ4A 1X50A 3ZIWA 5JSRA 4GMP0 2CGOA 3ZMOA 1YYNA 2ZGRA 2WS92 1SBFA 1YQCA 1GWKA 5LATA 2BDRA 4Q4V2 2GN3A 5JWPA 4QKBA 3PIGA 1XE7A 4W6YA 1LKNA 4L9BA 3PVBB 5CA6A 2IFRA 5KHKA 1JBCA 4ZXKA 1HQWA 2B9VA 1OOPC 1RUC1 3IPVA 4XILA 1AR71 1O5LA 2OW4A 2X5IC 4JTOA 4WVVA 4GAZA 4L0PA 1OVSA 5LA2A 1FX5A 2E53A 1ALYA 1PIV3 4H55A 4HETA 4PLOA 4PLNA 5LK7B 2ZGNA 2P37A 1QJX1 5C70A 1PK6B 4AFCA 4BLJA 2W52A 1QJFA 3QH7A 4GXLA 3SQOA 2RR11 5F5IA 1W6OB 2FMYA 1UN1A 3UJQA 5FP8A 1VBB1 3DYMA 3JXSA 1WWYA 1W3VA 2W46A 3ZYIB 2VR4A 2D6OX 3ES1A 4UWDA 1VB2A 3AVSA 2VGDA 1NOVA 1RYYA 3GF6A 4CCJA 3J7NA 1H2KA 2E7QA 4DRVA 1GKBA 4JC1A 2A70A 4R9DA 2RG4A 5DZFA 4U2AA 2TNFA 1ZX5A 3WW1A 1J59A 4HPKB 4YGCA 1ND2C 1XNAA 1VRH2 4GH4B 3MHZA 3O14A 1K45A 3UESA 4DMIA 4AQ6A 3AL6A 1NCRC 4RS5A 3CDZB 1Y3TA 4IEZA 5HPOA 1BVVA 4XAAA 3PTYA 4RS5B 5F5AA 1JYTA 1SFNA 2IZWA 3VBOB 4FTEA 3OYWB 4CEYB 5EJ3A 1H6XA 3GBFA 2VOKA 4CDWC 4N53A 5D21A 3ZKUA 4AI8A 2A7AA 4TZDA 1RUE1 3ACLA 1HV0A 1B35B 1QQP2 3RZKA 5AC92 2VZ3A 1UCXA 2RMU2 4CDUC 4XBNA 3FFQA 1HXS1 3WLUA 3FBYA 1MEC1 1S0GA 2C4XA 1LOGA 1IQDC 1H9WA 4R4XA 2BERA 2YC4A 3CJIA 3HBZA 4CCMA 2ZCWA 5TSWA 3O7OA 5FYUA 4CPBA 3CJIB 1GV9A 1PGSA 3OG2A 3AL5A 1US2A 2VMGA 3H7JA 1W28A 1ZRDA 1NLQA 3KCCA 2D44A 3R4DB 1GP5A 2JDAA 4LHLA 3C2UA 2E9QA 2DCZA 5A7OA 4JQRA 2WA4A 2BFUS 4UW5A 2EF6A 5IVEA 4ONUA 1YCIA 2JG8B 5IVYA 3AMMA 1G9AA 1ZRFA 1RHI3 2JG8A 1PO22 3C7FA 2XLFA 2FCUA 4LJHA 3POSA 4DXTA 2UYBA 4MGTA 1QJX3 2V5DA 4DXZA 1UZZA 3SHRA 1UMHA 1F15A 2D3RA 1CWPA 1F2NA 1BHGA 1Q8PA 1G9BA 2R30A 2HLEA 4GKXA 4Y33A 5T5LA 4LUMA 5C4WB 1LHOA 1AVBA 4Q0QA 2HWC3 2E26A 2TBVA 3NL1A 4QPGA 4XDQA 1W8WA 1JN2P 3FLPA 4QMAA 3M3IA 2ZXQA 2BNNA 2YG0A 4KBBA 1NYWA 3IMMA 3K77A 3USUB 4AEJA 2DF7A 3WDTA 4DO0A 3IN9A 3Q8CA 3I2JA 1WUVA 2EIEA 2HWD3 4NUBA 4EN8B 2WN3A 1AL0G 5B2GB 2W39A 2AC1A 2VZPA 1AXYA 2YZ4A 4WVZA 4IETA 1WBFA 1TNFA 2MEV3 5FQ0A 2LRPA 4IE6A 4MXWB 3ZXDA 3OBTA 3W5MA 5L7OC 4NIHA 3HT2A 3ZSLA 2R071 2VMCA 2XVGA 4MH0E 1HRV3 1U5IA 1F4AA 1QQP3 4CE8A
chains in the Genus database with same CATH topology
5FZ3A 5A3WA 5K4LA 5F5IA 5FZIA 4D6SA 3DXTA 5FP8A 5FPBA 3U4SA 5IVCA 5F3IA 2W2IA 2OQ7A 1VRBA 3PU3A 2XUEA 5FZMA 3LD8A 5FZEA 4IGOA 5FWEA 5FYYA 3AVSA 3KVBA 4CCJA 3NJYA 3K2OA 3PURA 5F3EA 5FYZA 5LY2A 2P5BA 5FY0A 2YBKA 4BU2A 4HOOA 4ASKA 4GJZA 5FXWA 2Q8DA 3AL6A 4HONA 5FPVA 5LY1A 4QWNA 5A3NA 5FXXA 4GD4A 2YBSA 3N9LA 5FZCA 3KV4A 5FY9A 5F5AA 4BXFA 3PUAA 5A7SA 5ANQA 5LW9A 4LIVA 2YPDA 5A7QA 3N9QA 2OQ6A 4UF0A 5F32A 2XDVA 4V2VA 2WWJA 4QX8A 5FZOB 2OX0A 4QXHA 3KV5A 3PDQA 4CCLA 5FZ0A 5FZ7A 5FYBA 2Q8CA 4EZHA 2XMLA 3OPTA 5IVFA 2GP3A 3PUQA 2YBPA 2YU1A 4XDOA 5FPAA 5FPLA 5A80A 5A1LA 5A7NA 2OT7A 3N9OA 5FXVA 2OS2A 5E6HA 5A1FA 4CCOA 4URAA 5FBJA 4V2WA 5FYTA 4CCMA 5FPUA 5FP4A 5FZLA 4AAPA 5FYUA 3OPWA 3K3OA 5FUPA 5FZBA 3AL5A 2WWUA 4XDPA 3ZPOA 5A7PA 5CEHA 4DIQA 4Y3OA 3UYJA 5FZ6A 5A7WA 5FZHA 4C8DA 4QU1A 5FYSA 5F39A 5A7OA 5FYMA 2GP5A 2XXZA 5IW0A 5F3CA 5IVBA 5FZ8A 5IVEA 4BISA 5FXZA 5A3PA 5F3GA 5IVJA 5FY8A 4CUGA 4QX7A 5IVYA 3RVHA 4E4HA 5FY5A 5FZDA 5F2WA 5FYHA 5A3TA 5FZGA 4GJYA 4IGQA 4CCKA 5FP3A 4EZ4A 3N9PA 5F5CA 3PU8A 3KVAA 5FJHA 3LDBA 3U78A 5FYIA 4CCNA 3K3NA 4CSWA 4Y4RA 4Y33A 2Q8EA 4TN7A 4UF0B 5F2SA 5FYCA 5FJKA 5FY4A 3AVRA 3PUSA 3KV6A 5FZKA 3ZLIA 3N9NA 2YU2A 5FZOA 5FZ9A 4GAZA 5LWBA 3KV9A 5IVVA 4DO0A 2PXJA 2VD7A 5KR7A 5FZ1A 3N9MA 5FP9A 4NUBA 5FZFA 5FZAA 5FY1A 4QXCA 5F37A 4LXLA 5FUNA 5ISLA 5FP7A 4IGPA 5FYVA 4QXBA 5FY7A 5FV3A 4AI9A 4LIUA 5A7WB 4D6QA 3PTRB 4LITA 4D6RA 5FZ4A 4EYUA 5FWJA 3DXUA 5IWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZ3 A;  5A3W A;  5K4L A;  5F5I A;  5FZI A;  4D6S A;  3DXT A;  5FP8 A;  5FPB A;  3U4S A;  5IVC A;  5F3I A;  2W2I A;  2OQ7 A;  1VRB A;  3PU3 A;  2XUE A;  5FZM A;  3LD8 A;  5FZE A;  4IGO A;  5FWE A;  5FYY A;  3AVS A;  3KVB A;  4CCJ A;  3NJY A;  3K2O A;  3PUR A;  5F3E A;  5FYZ A;  5LY2 A;  2P5B A;  5FY0 A;  2YBK A;  4BU2 A;  4HOO A;  4ASK A;  4GJZ A;  5FXW A;  2Q8D A;  3AL6 A;  4HON A;  5FPV A;  5LY1 A;  4QWN A;  5A3N A;  5FXX A;  4GD4 A;  2YBS A;  3N9L A;  5FZC A;  3KV4 A;  5FY9 A;  5F5A A;  4BXF A;  3PUA A;  5A7S A;  5ANQ A;  5LW9 A;  4LIV A;  2YPD A;  5A7Q A;  3N9Q A;  2OQ6 A;  4UF0 A;  5F32 A;  2XDV A;  4V2V A;  2WWJ A;  4QX8 A;  5FZO B;  2OX0 A;  4QXH A;  3KV5 A;  3PDQ A;  4CCL A;  5FZ0 A;  5FZ7 A;  5FYB A;  2Q8C A;  4EZH A;  2XML A;  3OPT A;  5IVF A;  2GP3 A;  3PUQ A;  2YBP A;  2YU1 A;  4XDO A;  5FPA A;  5FPL A;  5A80 A;  5A1L A;  5A7N A;  2OT7 A;  3N9O A;  5FXV A;  2OS2 A;  5E6H A;  5A1F A;  4CCO A;  4URA A;  5FBJ A;  4V2W A;  5FYT A;  4CCM A;  5FPU A;  5FP4 A;  5FZL A;  4AAP A;  5FYU A;  3OPW A;  3K3O A;  5FUP A;  5FZB A;  3AL5 A;  2WWU A;  4XDP A;  3ZPO A;  5A7P A;  5CEH A;  4DIQ A;  4Y3O A;  3UYJ A;  5FZ6 A;  5A7W A;  5FZH A;  4C8D A;  4QU1 A;  5FYS A;  5F39 A;  5A7O A;  5FYM A;  2GP5 A;  2XXZ A;  5IW0 A;  5F3C A;  5IVB A;  5FZ8 A;  5IVE A;  4BIS A;  5FXZ A;  5A3P A;  5F3G A;  5IVJ A;  5FY8 A;  4CUG A;  4QX7 A;  5IVY A;  3RVH A;  4E4H A;  5FY5 A;  5FZD A;  5F2W A;  5FYH A;  5A3T A;  5FZG A;  4GJY A;  4IGQ A;  4CCK A;  5FP3 A;  4EZ4 A;  3N9P A;  5F5C A;  3PU8 A;  3KVA A;  5FJH A;  3LDB A;  3U78 A;  5FYI A;  4CCN A;  3K3N A;  4CSW A;  4Y4R A;  4Y33 A;  2Q8E A;  4TN7 A;  4UF0 B;  5F2S A;  5FYC A;  5FJK A;  5FY4 A;  3AVR A;  3PUS A;  3KV6 A;  5FZK A;  3ZLI A;  3N9N A;  2YU2 A;  5FZO A;  5FZ9 A;  4GAZ A;  5LWB A;  3KV9 A;  5IVV A;  4DO0 A;  2PXJ A;  2VD7 A;  5KR7 A;  5FZ1 A;  3N9M A;  5FP9 A;  4NUB A;  5FZF A;  5FZA A;  5FY1 A;  4QXC A;  5F37 A;  4LXL A;  5FUN A;  5ISL A;  5FP7 A;  4IGP A;  5FYV A;  4QXB A;  5FY7 A;  5FV3 A;  4AI9 A;  4LIU A;  5A7W B;  4D6Q A;  3PTR B;  4LIT A;  4D6R A;  5FZ4 A;  4EYU A;  5FWJ A;  3DXU A;  5IWF A; 
#chains in the Genus database with same CATH topology
 4OMC A;  4OZX A;  5CKQ A;  1OKO A;  1LNS A;  3LDK A;  5FMB A;  4RD7 A;  2OQ7 A;  3LPF A;  5A6Z A;  2MEV 2;  1O5U A;  1UYX A;  4PBO A;  5FYY A;  1O4Y A;  4UXA A;  4AHW A;  1X9T A;  4JGZ B;  2IFW A;  4QPW A;  4K7J A;  5FY0 A;  1OLM A;  3NVC A;  4DFS A;  1VBE 2;  5DUV A;  5FMO S;  3ENR A;  5FK8 A;  4A3Z A;  5JSO A;  1LCL A;  2JWP A;  4HON A;  5FPV A;  1CD3 G;  3JB4 C;  4XEZ A;  3BYW A;  4W6X A;  2A71 A;  2A73 B;  2W91 A;  5EJ1 B;  2RS3 3;  5L7O A;  2HEV F;  5C5T A;  1W8H A;  4AED C;  1GAN A;  2QNK A;  3WEZ A;  5JOW A;  4GMP 3;  2FZ1 A;  1AR6 3;  1QXJ A;  1X82 A;  3BCW A;  4MXV A;  1IS5 A;  4PCR A;  2VVE A;  5J37 A;  4XTM A;  3BVC A;  4MUV A;  1CZS A;  1JUI A;  4NHX A;  4XIO A;  4KG8 A;  4ZS2 A;  4C91 A;  5FZ7 A;  1OC1 A;  1ENR A;  3CJI C;  5GLU A;  4DY5 A;  1C28 A;  1WKY A;  3URF A;  4QHZ A;  2HWF 3;  3RDI A;  3WP6 A;  3ZFG A;  5CKM A;  1MEC 3;  2CTV A;  2RS1 1;  1X9P A;  3H3Z A;  1W05 A;  4UW6 A;  1FT9 A;  3WNP A;  3ZDV A;  2OS2 A;  3DV8 A;  2Y34 A;  3CMG A;  1OVP A;  4CCO A;  1OI6 A;  4V2W A;  1UXZ A;  2R06 1;  1UOJ A;  2XJR A;  3AKT A;  1YO8 A;  1T6B X;  2DCJ A;  2CWM A;  4JDM A;  1CAW B;  5FZL A;  1SBD A;  2YY1 A;  2R16 A;  4H7M A;  1D4V B;  2AEY A;  3FC0 A;  2WYS A;  3ZSK A;  3H1W A;  1ASJ 3;  2G4I A;  3GBW A;  3HOB A;  4ITC A;  5LA9 A;  3J8F 1;  5F39 A;  3FLR A;  3J26 N;  4S2F A;  3RQ0 A;  2VQU A;  1AL2 1;  2DVD A;  3WUC A;  5AC9 1;  3T0A A;  4QX7 A;  4E4H A;  5CFD C;  1K5M B;  2ADE A;  3KSC A;  3PUH A;  3GHN A;  2QZ3 A;  5EYY A;  2YDE A;  4DNY A;  2I07 B;  5JXI A;  4YM2 A;  3IWZ A;  4JRA A;  4FVV A;  3W59 A;  1MS4 A;  1N1S A;  2DUR A;  4P9L A;  1AX2 A;  1AJO A;  2W92 A;  1W6M B;  4BQ5 A;  4HN0 A;  1GUI A;  2Z2S B;  1WZX A;  4NIA A;  2C1F A;  2XLG A;  5FYC A;  1QOS A;  2ET1 A;  3BOW A;  4BHP A;  1RIR A;  1SLB A;  1MS5 A;  1UWW A;  1UYP A;  1Y7B A;  1V00 A;  2ZPX A;  3KCX A;  2WZE A;  4FXG B;  2JEN A;  4BA6 A;  2DUO A;  3ZXF A;  4Q4X 1;  5J09 A;  2YU2 A;  2ZKL A;  1XB9 A;  5FDB A;  5DPN A;  1W6N A;  3JD7 2;  4QQP A;  2QFE A;  3ACI A;  3HN1 A;  5JMO A;  4DQA A;  4ATF A;  4FFI A;  5FP9 A;  5GLZ A;  3BPS A;  5CG9 A;  5CZK A;  2DDU A;  2GC1 A;  4AEM A;  2JDN A;  1NXD 1;  2R06 2;  4PF5 A;  2PN5 A;  1AXK A;  2Q5T A;  5DUX A;  1UY3 A;  5FP7 A;  1C5H A;  3I3M A;  2ET7 A;  4A2U A;  2JDH A;  1SEF A;  2RR1 2;  1YNA A;  2J1T A;  1AR8 3;  1JW6 A;  4QT6 A;  3X29 B;  4HVQ A;  2QQP A;  1K5J A;  2BVV A;  2JX9 A;  2VAU A;  3GAL A;  3I8T A;  4NAM A;  3WDU A;  4F7Z A;  2ORX A;  3THC A;  3BAL A;  1W6Q B;  5KHH A;  1ZZC A;  1AR6 1;  2XHK A;  1H4G A;  2JE9 A;  3LEI A;  2WO1 A;  3OSD A;  5ANN A;  2PHW A;  5FBZ A;  3PIJ A;  2C9A A;  2HYK A;  2WII B;  2XUM A;  2BV4 A;  3AP7 A;  2C0Z A;  3LD8 A;  3NNM A;  3LA7 A;  4A3X A;  3P5B A;  3MF9 A;  1RVF 1;  4UFJ A;  5CKN A;  3PME A;  5FYZ A;  3I2G A;  1ZBE 1;  4EQV A;  5CFC B;  1R08 3;  4LBQ A;  5BXX A;  4CU8 A;  1S0I A;  1FPN 1;  2VQ0 A;  3KQR A;  5JIA A;  2C24 A;  5FLJ A;  4OHZ A;  1DIW A;  4JGY B;  1KFU L;  1VBC 1;  1RIT A;  2ARA A;  3BOD A;  4QWN A;  5H9R A;  5E16 A;  1FI2 A;  4AI2 A;  2Y8K A;  3KB5 A;  1R09 3;  5BV6 A;  3S7I A;  4LIV A;  4OI4 A;  1RTV A;  4TYS A;  5A7Q A;  5DMY A;  1A78 A;  3WQ1 A;  4BIF A;  1UNB A;  4Q29 A;  4CDW B;  4FPL A;  4BB3 A;  3VBR A;  3T2Q A;  3S5A A;  4FPF A;  2JDK A;  2OX0 A;  3HNB M;  3R05 A;  2CV6 A;  5BNP A;  2D7F A;  2JG9 C;  3LOB A;  4UAP A;  3T3Y A;  4Q26 A;  1SFY A;  1VAV A;  2BU9 A;  2R07 3;  3VBO A;  5I93 A;  2ARB A;  4CUA A;  4B4R A;  5FPL A;  2R49 A;  2GNB A;  2OT7 A;  1TE1 B;  5F1R A;  1OD3 A;  5FXV A;  4JGZ C;  4MGI E;  2JDY A;  4BJ0 A;  3JCI A;  2LM3 A;  4PIX A;  1UF2 C;  1WD4 A;  1I3H A;  2YC0 A;  4YW2 A;  5FYT A;  2VQA A;  3VBU B;  3VD7 A;  1MZE A;  3WW2 A;  1QOT A;  4XAE A;  1VAM A;  2TUN A;  3NV3 A;  4XDP A;  1GLH A;  5A6Q A;  4IV1 A;  2WWS A;  5A7P A;  1VMF A;  1FMD 2;  3B3Q E;  1PZ9 A;  3ASI A;  4JDO A;  4AVA A;  1WD3 A;  1W6Q A;  2IC1 A;  4Y1U A;  5FZ6 A;  4P9I A;  2P4E A;  2WNE A;  5GLT A;  1IZ3 A;  1RUD 3;  4N7I A;  3SH5 A;  1C4R A;  4ES9 A;  3C7E A;  5BNQ A;  4QU2 A;  1EY2 A;  4E2Q A;  2OUH A;  1XQN A;  1DCS A;  3E97 A;  1W2O A;  2VCC A;  5GM0 A;  1KJL A;  2O0O A;  2WO2 A;  4WVW A;  1I9R A;  4X8P A;  1VBE 3;  4XJ9 A;  1UPI A;  3O0W A;  5J1X A;  2HWB 3;  2EIB A;  5A3U A;  3KVA A;  4L8Q A;  3WHT A;  5BNO B;  3M1H A;  4HAN A;  4Y4R A;  2DUP A;  2WT2 A;  2RS5 3;  4XUR A;  3A0K A;  3DPR B;  1JYW A;  4J25 A;  4NWV A;  1CGP A;  4WM7 A;  3ST7 A;  4XQD A;  2UWC A;  1RJ7 A;  5A33 A;  4CA9 A;  4YVS B;  4FFG A;  4KU7 A;  2FDK A;  3BIW E;  3ALQ A;  3IDC B;  1VLN A;  3KV9 A;  1VBC 2;  5EFU A;  1W04 A;  4FTS A;  4IE0 A;  3Q8A A;  4QQ2 A;  4CYD A;  3T4H B;  4Y24 A;  4Y4Y A;  1K42 A;  1C57 A;  1GNY A;  5DXD A;  1O4T A;  1RUF 2;  4HVO A;  3KCY A;  4LTA A;  4SLI A;  1ND2 A;  1QWR A;  5LBE A;  1JYX A;  3BIE A;  1WLC A;  1F31 A;  1L7L A;  1AX1 A;  5ISL A;  4YW4 A;  3WCR A;  4CU6 A;  4DY3 A;  2JKB A;  3AFG A;  1FV2 A;  1YQ2 A;  3HQU A;  4WBB A;  2H0B A;  4LHK A;  1HXS 2;  2ZGS A;  4OCT A;  5GZD A;  2ZAA A;  2C9K A;  3W9A A;  4UW4 A;  1VRH 3;  1YJL A;  4XF4 A;  2ZMN A;  1QHD A;  2DU1 A;  4XOG A;  1QJU 2;  1G9D A;  1HN1 A;  1DFQ A;  1S1A A;  4N90 A;  4KH9 A;  4BCU A;  1VBA 3;  4FOQ A;  4C1W A;  4F3J A;  3RZH A;  3WG3 A;  4RFR B;  3THD A;  1UXX X;  1LAJ A;  1VBE 1;  2XJP A;  3MV0 1;  5FCC A;  1O4Z A;  2DBN A;  3K4Z A;  5KR7 A;  5G04 L;  5JI7 A;  4FCA A;  2V4V A;  4GJZ A;  1W8F A;  4Y22 A;  4I3P A;  5IFP A;  1HB3 A;  2PHX A;  2WYF A;  4CP1 A;  1UOG A;  2ZHK A;  2RMU 3;  1US3 A;  1WLW A;  1QXP A;  3B69 A;  2H0V A;  1AYM 3;  1OH4 A;  2FCV A;  3FMG A;  4UFK A;  1BYH A;  1XYO A;  3IAQ A;  4Z07 A;  4JZR A;  4AFD A;  2A6Z A;  3ETQ A;  1R1A 1;  1W2T A;  1W90 A;  2EXI A;  2RJL A;  4QX8 A;  2UY9 A;  3GCX A;  5AFE A;  4KWU A;  5A3L A;  4CEW C;  5FYB A;  3AKQ A;  1TME 2;  4AK3 A;  5ACA 2;  4EZH A;  3H8O A;  5I8T A;  1LB2 A;  1PGW 2;  3ORJ A;  4A7Y A;  1PNF A;  2UUR A;  4FPO B;  1R09 2;  4E4S A;  1NY7 1;  3N9O A;  1UW8 A;  3L9J T;  3WF3 A;  4M3C A;  2BWC A;  4B7K A;  4IEP A;  3N35 A;  1PM7 A;  4BQ3 A;  4HVR A;  5E6H A;  1MAC A;  4XCA A;  2WKK A;  3I59 A;  1K5M C;  2PTM A;  4YW7 A;  2XKO A;  3J8F 2;  3HQX A;  1QH6 A;  5FMO L;  1X7N A;  4XMA A;  4XZP A;  4IE7 A;  2WL1 A;  3BTA A;  2CDP A;  3DL3 A;  1GP6 A;  4LLF A;  3VL9 A;  4C8D A;  5FOB B;  3GXU A;  4XAC A;  4IES A;  5IJR A;  4ET7 A;  1W3X A;  2B45 X;  3MW2 A;  5IW0 A;  5FUI A;  5FZ8 A;  1HB2 A;  3VBF C;  3VV1 A;  2VUA A;  4HK8 A;  1V6L A;  3KHB A;  3NRU A;  3C3V A;  2VNV A;  3VDB A;  2HWB 1;  1PVC 1;  3EBR A;  2VZV A;  4WM8 A;  4XFG A;  2P3J A;  4ZKT B;  5EYX A;  2KA3 A;  2CYF A;  1S2K A;  1MS9 A;  2GC0 A;  2W08 A;  3N7L A;  1WW5 A;  3IT8 A;  5FZG A;  1W06 A;  4K1Z A;  3WG1 A;  1JHN A;  3POG A;  4R9C A;  4Y1Y A;  4IV3 C;  3NWK A;  1YXW A;  1HRI 2;  3GNE A;  4CDU A;  1YLL A;  3TEZ A;  2HJI A;  3AMQ A;  3DEC A;  3AP6 A;  1RUE 2;  4QQL A;  2Q0A A;  1OA2 A;  5BNN C;  1GFF 2;  1OD5 A;  2A6W A;  5KXD A;  1KJR A;  4HMZ A;  4CDQ C;  1Q5O A;  3H3U A;  4MET A;  4RGA A;  3UGH A;  3H9A A;  4M4P A;  2BEO A;  1ND3 A;  5FZ1 A;  4HKO A;  1YUD A;  3H1M A;  1CES A;  3CO2 A;  1LOD A;  3MUZ 1;  2WNU C;  1ODM A;  5JR2 A;  4K20 A;  4J1X A;  3ZFE C;  1XNB A;  4BOW A;  4ISQ A;  4R9B A;  2NN8 A;  1K3I A;  3NKG A;  2Y0I A;  4DB5 A;  5A6X A;  4EN9 B;  3HVD A;  1R1A 3;  2Q1F A;  3EMR A;  1WCQ A;  1WLT A;  5LK5 A;  2GN7 A;  3VBH A;  3M8L A;  4Y5S A;  1ULE A;  1GP4 A;  4YGE A;  4JDN A;  3DPR C;  1ULG A;  5HCF A;  1QJY 2;  4WZF A;  3WNN A;  5HCA A;  2RMU 1;  3MW3 A;  5FRE A;  1KQR A;  1E57 A;  1OLR A;  5GLW A;  4XIK A;  4MG2 A;  5SV5 A;  2NYY A;  1XOY A;  5T52 A;  5BNO C;  5ACA 3;  1GSL A;  3CU7 A;  2VO5 A;  4LOT A;  1S0D A;  3WCS A;  2LRO A;  1ZZB A;  1KIT A;  2A1X A;  1T2X A;  2AZ5 A;  4CDQ A;  1ZRC A;  3OTF A;  2P5B A;  4QB2 A;  2ZMK A;  5KHJ A;  1MQT C;  1JZ4 A;  4DIN B;  3WQ7 A;  1C1L A;  4ASM B;  2QUO A;  1UZW A;  2ZHM A;  3O1O A;  2PHR A;  4IDZ A;  1WMF A;  4KGG A;  4E9K A;  3IZO A;  3H42 B;  1ASJ 2;  5KC5 A;  2CGN A;  4N9H A;  5D8A B;  5LY1 A;  1GZ9 A;  4YW6 A;  4CEW A;  3M3O A;  2MHF A;  3IKW A;  1WCK A;  3PUA A;  5FK7 A;  3GDB A;  1DGW X;  4IXL A;  2VMI A;  2GZW A;  1YC6 1;  5DAW A;  1QJE A;  2RDS A;  2I74 A;  2VE1 A;  2HKX A;  3AM2 A;  3BN6 A;  4KQ7 A;  4V1P A;  4ZY9 A;  5IK4 A;  4FTB A;  2J1E A;  5HXM A;  4V2V A;  4AVB A;  3BTY A;  1PNG A;  3KF3 A;  1F9K A;  4HN1 A;  3VD9 A;  4DRR A;  5J7M A;  3RMY A;  1GZW A;  1OUX A;  2PAK A;  2B5H A;  4GWI A;  2YRO A;  1DGR A;  3OPT A;  2KXL A;  3ZYR A;  5I0D A;  1XU2 A;  4ZU5 A;  3VKM A;  3OGJ A;  4XFA A;  3JUU A;  2VCB A;  2WT1 A;  4COZ A;  5A1L A;  4W65 A;  1BQP A;  1YFY A;  2F6B A;  4M01 A;  1OQD A;  4H3W A;  3V56 A;  3S57 A;  5FPU A;  3RZG A;  4W50 A;  3VBF A;  4AHZ A;  3ECQ A;  3LSD A;  3IM0 A;  2WWU A;  5CYY A;  5I0R A;  3BI3 A;  1ZRI A;  4QDS A;  4CXW A;  1N1T A;  3I2O A;  1L3J A;  1NZC A;  4K8F A;  2P17 A;  2CAV A;  3OPZ A;  3DUI A;  2KR2 A;  4IV3 B;  3G6J B;  4IV3 A;  2Y64 A;  3PVN A;  3FUO A;  4D7S A;  2FHR A;  2VXR A;  2Z79 A;  2RDN A;  4XMI A;  5CFC A;  1BMV 2;  1UMZ A;  4Q0U A;  3MBW A;  4JAA A;  4PJY A;  3I2F A;  2PQQ A;  1W8U A;  1JXN A;  3IPV B;  3LB9 A;  4JHZ A;  2HWB 2;  1UU5 A;  1K12 A;  5FJH A;  3HQR A;  4Q4Y 3;  1I5Z A;  1B35 C;  3LWC A;  2EVX A;  3KT7 A;  5DAQ A;  1AL2 3;  4P5H A;  1GOF A;  2HWD 2;  1BBT 1;  1OFS A;  2ERF A;  1SLT A;  1DGL A;  2WNU A;  3P6B A;  5FY4 A;  1XRU A;  3VBS B;  3MZH A;  2D6K A;  3INA A;  1Q43 A;  2WN2 A;  2BNO A;  1SG3 A;  5FZO A;  5IHR A;  2Y26 A;  2WO7 A;  1FOD 2;  3NV1 A;  5C7G A;  3VBU A;  3LE0 A;  3DPR A;  2VVD A;  1VP6 A;  1ZM1 A;  3MEP A;  3FHA A;  4QXC A;  5A33 B;  4D7Y A;  1EAH 2;  5CFD A;  5FY7 A;  4AI9 A;  5CB7 A;  4XHB A;  3MO4 A;  3PTR B;  3U4X A;  2IVJ A;  5LBF A;  5AVP A;  5JAX A;  1AR7 3;  2R07 2;  3DGT A;  5FZI A;  5C9A C;  2UWA A;  3JBG 1;  1F5F A;  3N36 A;  5KXB A;  3DEM A;  2VMF A;  5IVC A;  2OA2 A;  3MID A;  4ISR A;  4XJ8 A;  5A70 A;  1RGS A;  3I2K A;  1J83 A;  1UOB A;  4AI0 A;  4XHX A;  1T6G C;  5T5O A;  4AQT A;  4C90 A;  3WNX A;  2ZBJ A;  4A6O A;  5F3E A;  4Z2A A;  1SDW A;  1DZR A;  4YLZ A;  1AZD A;  1ULD A;  2A5Z A;  1XXN A;  1ZZ7 A;  4JVA A;  4XFH A;  4JGY A;  4ARY A;  2GDF A;  3AZX A;  4FOW A;  5JXJ A;  5IFT A;  4YG6 A;  5H9P A;  4ORF A;  3BU0 A;  4ARX A;  2XPJ A;  1O8S A;  4P9X A;  5FY9 A;  4RGG A;  5A6Y A;  1CJD A;  4DUW A;  2JB8 A;  4RHV 2;  3P3P A;  4AF9 A;  2VW1 A;  1DLC A;  3LOI A;  2E7A A;  3N9Q A;  4JKL A;  3LDR A;  4UF0 A;  2FDJ A;  1BK0 A;  4PF1 A;  4AVS A;  5KBF A;  3USS A;  4F83 A;  3O1S A;  2AAC A;  4OHY A;  5C9A A;  1NLS A;  2W1U A;  2ZHN A;  4Q4V 1;  1QQP 1;  4HLT A;  1NA1 A;  3WY6 A;  1BBT 3;  2R1B A;  1VBC 3;  2ID4 A;  1RB8 G;  3K75 B;  4AI3 A;  1COV 1;  5JPN B;  1NZI A;  3J7L A;  1FPN 3;  3NW4 A;  3QBQ A;  4AW7 A;  2QQM A;  3FHI B;  5FFO C;  1AR9 1;  4M3C F;  2WUH A;  3I2D A;  1Q8V A;  2E63 A;  1DYO A;  4MGZ E;  4QGM A;  1HDK A;  1RVF 3;  1TMF 2;  3ZOI A;  2R32 A;  1OKQ A;  3JQW A;  3QOP A;  1TNR A;  1YQ8 A;  2WR9 A;  1WLD A;  3HEI A;  4UFL A;  1FAT A;  3OPW A;  4YW5 A;  3SH4 A;  4S2G A;  5I91 A;  2P1B A;  2QQI A;  3K46 A;  1DQ5 A;  4IEU A;  4JQT A;  2IUW A;  1D2S A;  4MAD A;  3NJZ A;  4CP9 A;  2VL4 A;  5B4X A;  3OBA A;  1DHK B;  4IEQ A;  3W20 A;  1GU3 A;  1U5Y A;  1H2L A;  3A21 A;  5GJ6 A;  2MNG A;  1BZW A;  2XJU A;  4AQS A;  1A3K A;  4BIS A;  2WBK A;  4Y22 B;  1L7R A;  4AL9 A;  5FY8 A;  4DEV A;  4AHX A;  1RJ8 A;  1KEX A;  2WLQ A;  1OF3 A;  5C4W A;  5JZG A;  3D3A A;  1RUH 2;  1ZBA 1;  3MIH A;  3OYW A;  2BVB A;  2YC2 A;  4LOR A;  4YWA A;  2E32 A;  2W68 A;  1ST8 A;  3HBK A;  3Q8E A;  3PU8 A;  3ZFF A;  4E27 A;  4RFT 0;  4H14 A;  4RR3 C;  4Y1Z A;  3MGU A;  3UK9 A;  1GQP A;  4B29 A;  3III A;  1ZA7 A;  4QDQ A;  3J7M A;  2VZO A;  1F5J A;  2QQU A;  3G7D A;  4LKE A;  5T50 A;  1AYN 3;  3KS7 A;  1O3Q A;  1CN1 A;  2BZD A;  4A6S A;  1J3P A;  3WR0 A;  5L7O B;  5JXH A;  1BBT 2;  4DXR A;  1LHW A;  3B01 A;  1MZF A;  1JZ7 A;  4KWL A;  3K4D A;  4R8H A;  1BVP 1;  3NST A;  4M3C B;  2X05 A;  3ZYF A;  1PMH X;  3B94 A;  3SEE A;  2PAM A;  1CJP A;  3SEP A;  4QX5 A;  5KHG A;  2DVA A;  1QJY 1;  3MW4 A;  5FV3 A;  2PHT A;  4YRD A;  1HQN A;  4I30 A;  3IIA A;  1N3O A;  1RUH 3;  4YVW C;  3N3H A;  4K21 A;  5CIS A;  5A3M A;  1SBE A;  3NQH A;  2DVG A;  1KD7 A;  1TZO A;  1V70 A;  1VRB A;  2W9X A;  1J58 A;  2DUQ A;  2QCS B;  3FLT A;  4K40 A;  5FZM A;  1NLR A;  2R06 3;  1TMF 1;  5IVV A;  5HCB A;  1H8V A;  2BOJ A;  3KVB A;  4EN7 B;  1QDC A;  3SCG A;  1H2N A;  1M4W A;  1WA4 A;  3R0R A;  5G05 L;  5EQU A;  1MEC 2;  1AR7 2;  1QDO A;  4MV2 A;  3UT0 A;  5FKC A;  4CDU B;  1LEN A;  1RVF 2;  1SLA A;  1TMF 3;  3CF6 E;  5I0U A;  1POQ A;  1S2B A;  1TG7 A;  1K5M A;  3SH3 A;  3B5L B;  1NA1 C;  1ODN A;  2QVS B;  3GZU C;  3NJX A;  3TN9 1;  4GAL A;  5C8C A;  5M0T A;  1NCQ B;  3TRS B;  1W9T A;  2WC2 A;  4FOV A;  4MX3 A;  3UGF A;  4Y5Z 0;  3USU A;  1VBD 3;  5F32 A;  1AR6 2;  1JI6 A;  3SXW A;  4RHV 1;  3AKR A;  5DG2 A;  3GYD A;  2WWJ A;  4R9A A;  4IEV A;  4QXH A;  2E31 A;  3DKQ A;  2WZR 3;  2DCK A;  4P9Y A;  3C8X A;  4QPI A;  4J6G A;  1W0N A;  4HSL A;  2EXK A;  3H8R A;  1MVE A;  1JTZ X;  4BQX A;  4FQ4 A;  3FBM A;  4XDO A;  4LR4 A;  3K51 A;  1NG0 A;  4WM8 C;  2WIN B;  1I1E A;  3RMX A;  4YZ3 A;  2A3W A;  3VUO A;  5D1I A;  1CIY A;  1RUI 2;  3PJQ A;  5ABJ A;  2EAK A;  3OEA A;  1AUY A;  3OB8 A;  3BKZ A;  1SAC A;  4URA A;  2Y0O A;  2CHH A;  3O0V A;  4O65 A;  1URX A;  4UYB A;  4QDR A;  2WDB A;  3U11 A;  4IE4 A;  1XE0 A;  2NMN A;  4CDX C;  3ZPO A;  2W87 A;  4XF9 A;  4FFF A;  5CEH A;  1G9C A;  4XET A;  4IEY A;  2Q4S A;  1VBD 1;  3GJB A;  4IE5 A;  1WW4 A;  4NRQ A;  5FYM A;  3AMN A;  1DG6 A;  2GP5 A;  4GB3 2;  4I02 A;  4LNV A;  5F3C A;  4RGK A;  3VN4 A;  4X6Q B;  4RL7 A;  1UZY A;  3WW4 A;  2MEV 1;  2RS5 2;  5DAP A;  4QPI C;  5DG1 A;  3ZIX A;  2IXH A;  1ZBE 3;  1GMM A;  2B9U A;  3ZFE A;  4X6R B;  2E7T A;  2XWB B;  1Y4W A;  2ZOE B;  5A3T A;  1JMU B;  1MS1 A;  1UX6 A;  1Z7S 1;  2P3K A;  3ZFE B;  1EV1 2;  1W9Y A;  3KLS A;  3QAC A;  3MI8 A;  3VD3 A;  4YG0 A;  1CAV A;  1U12 A;  3DN7 A;  5BUV A;  3V0B A;  4FT8 A;  5ABJ C;  4QPG B;  1GZW B;  1TVG A;  5E8A A;  1W03 A;  1DU3 D;  2XVL A;  4CPB D;  2W1W A;  1DZT A;  1RUJ 3;  5A32 B;  2EXH A;  1RMU 2;  5BNN B;  4JTN A;  4CDX A;  1LGC A;  1DBN A;  2P34 A;  3KV6 A;  1AXZ A;  1OQ1 A;  3ZLI A;  4FBF A;  1GOG A;  1I6X A;  3T30 A;  4L99 A;  4Q5O A;  5IVB A;  1LR5 A;  4QAW A;  3JQX A;  5C5U A;  2SLI A;  1OOP A;  1PO2 3;  2AEZ A;  1S0E A;  5IK5 A;  2PYT A;  1D4M 3;  1H4H A;  3DYO A;  3MFC A;  5GZC A;  2W1S A;  4QD2 A;  1QGL A;  2BOI A;  3KGL A;  3W5N A;  1E5S A;  3VHN A;  4COU A;  4QX0 A;  1G9F A;  4EYU A;  4TTG A;  3AYC A;  1LTE A;  5AC9 3;  4AQ2 A;  1XC6 A;  1JU3 A;  1JU4 A;  3CNA A;  5IWF A;  3RYK A;  3WW3 A;  4C0H A;  3WDX A;  2VUD A;  4NRP A;  1YFW A;  3ROU A;  4CCD A;  4XJZ A;  2GND A;  5LRS A;  4YVW B;  1YFX A;  4EJR A;  2RS5 1;  3RYP A;  2VW2 A;  2BGC A;  4LKF A;  4HSJ A;  3UGG A;  3WDY A;  1J1T A;  2NM1 A;  3D4K A;  2CY6 A;  3MIF A;  1PO1 2;  4RQP C;  1RED A;  2B8M A;  4PI2 A;  1F4H A;  2YBK A;  3LEG A;  4AED A;  3VZO A;  1G86 A;  1JUH A;  5JCT A;  1DLL A;  5FO7 B;  5JOY A;  3AJY A;  3KT4 A;  5B4N A;  1LGN A;  1ND3 C;  1RMU 1;  4NPL A;  5GZF A;  3OD4 A;  4EN6 B;  4DZG A;  4AXO A;  4PQQ A;  1OF4 A;  1QF3 A;  4PDW B;  1VMH A;  4AE2 A;  2QQV A;  4NPM A;  5FLI A;  2V4A A;  2XGX A;  3AP4 A;  4Z82 A;  3VBS A;  3U1X A;  2AYH A;  4K1Y A;  4YNI A;  1RXG A;  2JIG A;  4NJ4 A;  1FV3 A;  3LKJ A;  4BK4 A;  3ES4 A;  4BWO A;  4MHR A;  5LA0 A;  1LOF A;  3HMY A;  2RV9 A;  1YEW A;  1MVQ A;  2D5H A;  4B8E A;  1OMI A;  3RJ2 X;  3ZYJ B;  1ZYB A;  1R64 A;  1FNY A;  3B9I A;  3SCH A;  4O9E A;  4I0W B;  4Q4X 2;  4Y20 B;  1DQ2 A;  1PGW 1;  4LO8 A;  5JLV A;  1BXH A;  2ZAC A;  4FAG A;  1I5P A;  1TME 1;  5ACA 1;  5A1F A;  2OVU A;  1C8N A;  3AMP A;  2XBO 2;  4LOS A;  2Z5W A;  4ZU7 A;  2FZ2 A;  3E5X A;  3LA3 A;  2QDN A;  2VEC A;  4NR1 A;  3WUD A;  2RS3 1;  2DU0 A;  1UY1 A;  1RUJ 1;  4NAO A;  1IGO A;  3ZXA C;  3VBS C;  3MLJ A;  5H9Q A;  2W1Q A;  2JDZ A;  1C8M 1;  1S0F A;  2HBU A;  2ZX4 A;  3E5U A;  4Q4Y 1;  1O91 A;  3ZXL A;  2FDH A;  3MLK A;  2VME A;  3WX5 A;  3VDD A;  4CUG A;  3RVH A;  2Y60 A;  1YJK A;  3AP9 A;  4IEO A;  4QX3 A;  5JPM B;  1JZ6 A;  1KDK A;  3UKV A;  1Z7S 3;  1RL3 A;  2B39 A;  3I3E A;  1S0B A;  1X36 A;  1LHV A;  2F4L A;  2IWG B;  2VOT A;  2VU9 A;  3U10 A;  3ZSM A;  4IGQ A;  3RPQ A;  1GBG A;  2YUE A;  2KD7 A;  3JU9 A;  5AVA A;  3LDB A;  1H30 A;  3WZ1 A;  3VBR B;  3GBG A;  5DUW A;  2ZML A;  1O3S A;  1CX1 A;  2OUJ A;  3H7Y A;  3RSJ A;  4UOJ A;  2Q8E A;  3OUJ A;  3RFR A;  4PLM A;  4WZC A;  3DKW A;  3VHR A;  2D6N A;  4LHS A;  2Q1M A;  2GME A;  3HD8 B;  3N9N A;  4Q4W 1;  1SZB A;  2IVI B;  2K9Z A;  5LWB A;  3JB8 A;  4CEY A;  2DVF A;  5C33 A;  3ZM8 A;  2PXJ A;  5CAD A;  2D98 A;  2ES3 A;  4DUV A;  3I2H A;  5DUU A;  3N9M A;  3ZFG B;  5I8S A;  2VUJ A;  4YFZ A;  1XBF A;  2XOM A;  4NHY A;  1Z7S 2;  2DYC A;  1A8D A;  3I3D A;  1OT5 A;  4FXK B;  2RDQ A;  2CWS A;  4HL0 A;  1FNZ A;  2PLV 2;  3RI8 A;  3KQ4 B;  4P00 B;  2D93 A;  2XJV A;  4B3N A;  5C3Q A;  4AZZ A;  2HWF 2;  3VZJ A;  1M06 G;  3DXU A;  5FAX A;  3Q9O A;  5L36 A;  1QEX A;  4XUN A;  1CAX B;  1LEM A;  2X09 A;  3ZN6 A;  5F3I A;  2W2I A;  2ZEZ A;  1WW7 A;  1CAX A;  3ZN6 B;  1X33 A;  3ZXG A;  4ZS3 A;  4MLO A;  5HI0 A;  4MGQ A;  4YZ2 A;  3H50 A;  5IAV A;  5LY2 A;  2KM2 A;  1OPM A;  3ETP A;  1SPP A;  3ELN A;  5T5P A;  3ZFF B;  1NT0 A;  4OUL A;  3NJV A;  4MOA A;  4P08 A;  5GLV A;  4NO4 A;  1Z0H A;  4WM7 B;  1GOH A;  4JKK A;  2JG9 A;  4BXF A;  1EP0 A;  1H9P A;  3VGI A;  1JOP A;  3O1R A;  2JG9 B;  1ZZ8 A;  2JDU A;  2MPF A;  1JZ3 A;  4IW3 A;  1EPZ A;  1Q8O A;  4HPK A;  2OQ6 A;  4H2A A;  3ILF A;  2B42 B;  4WVM A;  1W8Z A;  1NQD A;  2XB6 C;  4UBH A;  2VZQ A;  2XJT A;  4IUG A;  4LO4 B;  3KD4 A;  3ZSJ A;  2PMW B;  1BJQ A;  1HJG A;  3PJY A;  1UKR A;  3U14 A;  2PLV 1;  5IVF A;  1HLC A;  4MZU A;  4QHO A;  1V9U 1;  5A80 A;  1BEV 1;  3GZT B;  4L11 A;  3V0A A;  3OGG A;  4LBQ D;  3WIN E;  4LBO A;  4LBN A;  4XPV A;  3ZFG C;  2BP6 A;  4LO6 B;  4Q4V 3;  1UIK A;  2D3S A;  5IUQ A;  5DZE A;  3K3O A;  1H6Y A;  1PVC 2;  2V5Y A;  5L9R A;  3O12 A;  2NMO A;  1IS6 A;  5KXC A;  1STM A;  4XYX A;  2ZZJ A;  1PM4 A;  4QU1 A;  2LUW A;  1GNZ A;  4ATE A;  4Y26 A;  4FAH A;  5GZG A;  3I59 B;  4KG0 A;  1GQH A;  4R52 A;  3WQ0 A;  5F9T A;  2CGP A;  1LJ7 A;  2QZ2 A;  3HR9 A;  3M3C A;  2D6M A;  5FY5 A;  5IYY A;  1XE8 A;  4LK6 A;  2WAA A;  5F2W A;  1R1Z A;  4XUT A;  1SQ4 A;  5K7P A;  2XON A;  4NMI A;  3BB6 A;  4Q2F A;  1OLM E;  1UPS A;  1EAH 3;  4OUM A;  4EWE A;  2VNO A;  2LTN A;  2Q30 A;  1H8T C;  2V73 A;  2Y6G A;  2D43 A;  4OMD A;  4D7T A;  1WGP A;  4LHN A;  4CCN A;  1PIV 1;  3BU7 A;  3CIH A;  1YIF A;  3WG4 A;  5DQ0 A;  3MV1 1;  2RS3 2;  1J84 A;  5BYN A;  2Y33 A;  3LFI A;  2VBB A;  1RUJ 2;  4HXC A;  1OSG A;  3OOX A;  1J1L A;  1PMJ X;  3PUS A;  4BPZ A;  3WP5 A;  4N9I A;  2R0H A;  2CSG A;  4KU8 A;  1EV1 1;  1CVN A;  1GQG A;  2A6Y A;  3ACG A;  3IBM A;  4O7X A;  3VKF C;  3WD5 A;  3WG2 A;  4BXS V;  1OXC A;  4XZU G;  2CNA A;  1BLZ A;  3GCW A;  2PHU A;  1ZVF A;  5FY1 A;  5LAS A;  2X29 A;  2JB4 A;  4E4Z A;  2HH9 A;  4OHW A;  2A6X A;  4HT1 T;  5I0S A;  1POV 1;  2XR4 A;  3AZV A;  4IGP A;  3OGR A;  4QXK A;  2R04 1;  2ZEY A;  4LIT A;  1UMI A;  5DN2 A;  4D8M A;  4QM8 A;  1KS5 A;  3SNM A;  1AL2 2;  3IB3 A;  3ITQ A;  2A3Y A;  2QKD A;  4ZPI A;  3HPN A;  4D6S A;  4IND A;  5LB6 A;  3LA2 A;  3IDA A;  3MLL A;  3OCP A;  4X8N A;  4YZ4 A;  4AYU A;  2IXK A;  2VPV A;  2XUE A;  4FOY A;  1H0B A;  4MXW A;  5C4W C;  1TEI A;  1G6N A;  2G19 A;  3CZJ A;  2RM2 2;  3M2M A;  2PHL A;  3S30 A;  1JYN A;  1J3Q A;  3HT1 A;  3VZL A;  1NCR A;  2G1M A;  2XQR A;  2ZGM A;  4EN0 A;  3WDW A;  4ASL A;  3E6C C;  4LQR A;  5H9S A;  1RUD 2;  5L9B A;  5CVR A;  4FPH A;  4FPE A;  1GWM A;  1AR8 2;  3V65 A;  4AVC A;  5A3N A;  2JE7 A;  5C8C B;  1W9S A;  1Z78 A;  5FZC A;  3MDP A;  4LK7 A;  1HN0 A;  5T3N A;  5LW9 A;  2O8O A;  4BZ4 A;  5IAX A;  5A32 A;  2YPD A;  1W2N A;  4RSU A;  1D4M 2;  1FMD 3;  2WQ8 A;  3IDB B;  1HV1 A;  3FX3 A;  2DFB A;  4A42 A;  4XF3 A;  2D40 A;  4XUP A;  1C5I A;  4QKN A;  3KV5 A;  2ARE A;  1HRI 1;  4NPR A;  3LGR A;  3PNA A;  5D8A A;  1MS0 A;  2X5I A;  4AVV A;  3I97 A;  2BBV A;  4KBZ A;  3VBR C;  5HV4 A;  2AEN A;  5C3O A;  3PUQ A;  1LU2 A;  1YHF A;  2E6V A;  3FUQ A;  1JOJ A;  1QJU 1;  4LPL A;  4URT A;  5F5Q A;  5A7N A;  3SMH A;  2VG9 A;  4CUB A;  3NNL A;  4Y5T A;  1RXF A;  4XXP A;  1AX0 A;  3WVJ A;  4DS0 A;  3D82 A;  1X8E A;  2NZ9 A;  3AMH A;  1U0A A;  5EJZ B;  3RI9 A;  4A7K A;  1GIC A;  3H8X A;  1O3R A;  3VL8 A;  5K9Y A;  4Q4Y 2;  1ZZ9 A;  2CL2 A;  3EJK A;  3N7M A;  3VDA A;  5CAZ A;  5JUV A;  1VB4 A;  3TNP B;  4TSV A;  1NX9 A;  3ZVX A;  3PMS A;  4DIQ A;  4CZS A;  1ZA4 A;  5BPX A;  1ZBE 2;  4CU9 A;  1AYM 1;  1AYN 2;  3DF0 A;  3QLQ A;  4ZZ5 A;  1CR7 A;  1RUG 3;  5C8C C;  2XXZ A;  3TOJ A;  2ETE A;  1H1M A;  2VQT A;  2ZGO A;  3LIH A;  2XBO 1;  2WJS A;  4JHT A;  3ZYG A;  1ULC A;  2ZAH A;  1NCR B;  1UKG A;  4MHU A;  4BM8 A;  3SC7 X;  3T08 A;  5LEK A;  2DV9 A;  5FMD A;  2XG3 A;  2GMP A;  2LW8 A;  3WF1 A;  5F6K A;  4LUK A;  2JIC A;  3HAG A;  3NNF A;  4YM0 A;  2P6C A;  2XBO 3;  4CVU A;  4XQW A;  1JZ5 A;  4BQ1 A;  2WT0 A;  1N1Y A;  2NQY A;  2FBE A;  1Y43 B;  1FMD 1;  4Q4X 3;  4CDX B;  4NE9 A;  1ASJ 1;  1VJ2 A;  2ZHL A;  4UBG A;  1XNK A;  4DXS A;  1VRH 1;  3ILN A;  4Y1V A;  4YGD A;  3K48 A;  3CZU A;  1ND3 B;  2Z69 A;  3RZJ A;  4PDW C;  3ZR5 A;  1XNC A;  2VD7 A;  5K0U C;  5DAB A;  2QQW A;  3RGB A;  1XJA A;  3TBD A;  3ON7 A;  1U5Z A;  2J22 A;  1V0A A;  2GH8 A;  1SDD B;  3POY A;  3ZXJ A;  2OKX A;  4M3C E;  4AGG A;  4COY A;  3SLI A;  3RRD A;  3T2T A;  1PGL 1;  4DOU A;  1NKG A;  2BBA A;  5FYV A;  3O1T A;  3AK0 A;  1GYK A;  1W6N B;  2R6Q A;  2BFU L;  3BGA A;  4D6R A;  3W21 A;  3LEM A;  1HRI 3;  3WF2 A;  5E89 A;  4XUQ A;  3S5Q A;  4GUL A;  3DYP A;  5J98 B;  4CP0 A;  4DUX A;  1O6U A;  3VDD B;  5EP9 A;  1UYZ A;  1PO1 3;  1XYP A;  4AAX A;  1X8M A;  1MQT A;  4QGN A;  3MIC A;  3EYP A;  3EXU A;  1LOF C;  3KF5 A;  4XFB A;  2WS9 3;  3ZSE A;  1W8N A;  5LZ6 A;  3PUR A;  1VE0 A;  3R6S A;  1ULO A;  3S0M A;  1RUO A;  2VNG A;  3VZM A;  5IT6 A;  3AXD A;  3NO8 A;  4PT6 A;  1RUF 1;  2JG8 C;  4ASK A;  3O1M A;  4FP3 A;  2A75 A;  3KGZ A;  4UFI A;  4GD4 A;  2YBS A;  1ZRR A;  2WFF 3;  3ME2 A;  5ANQ A;  3NAP C;  2V09 A;  3JBG 3;  3EHK A;  4XXA A;  5C3S A;  3TEX A;  2WZR 1;  3CEW A;  2UYA A;  4UFH A;  1V6O A;  4QPG C;  4XE9 A;  3MIE A;  1ZZ6 A;  3MIG A;  3EQE A;  3PDQ A;  5HBA A;  2VMD A;  2WFF 1;  1XSR A;  3WNK A;  5T5J A;  2PHF A;  2QQN A;  2JEC A;  4OFG A;  3R4S A;  5EXO A;  2R04 3;  4Q0P A;  1PGL 2;  1Q8Q A;  3TN9 3;  3ZYH A;  1UY2 A;  3H1Y A;  2F4P A;  4LE4 A;  5JVV A;  4GH4 C;  2VOV A;  5FQ0 B;  5J96 B;  5FO9 B;  1A34 A;  2VCM A;  5IK8 A;  4LLO A;  2ZGU A;  2HEY F;  4P02 B;  5A1A A;  3VB9 A;  1GWL A;  2UY8 A;  3J9S A;  4I0A A;  4QX1 A;  4AAP A;  1JH5 A;  1UD1 A;  3VZK A;  1G8W A;  4AFM A;  1XU1 A;  1RUI 1;  1LHN A;  4BQ2 A;  1C8M 3;  5J48 A;  3FN9 A;  1FAY A;  3U75 A;  4XFC A;  4MSV A;  4XF0 A;  5A7W A;  3WXP A;  4I2O A;  4AGV A;  2J1R A;  4YSF A;  3J7H A;  3FWE A;  3C7G A;  2OPW A;  2GAU A;  1GR3 A;  1WMX A;  2JD4 A;  3NNJ A;  4PHZ A;  4AR2 A;  4FPK A;  4Q0V A;  4O9G A;  1YQ5 A;  1N47 A;  3GJA A;  2GAL A;  2Y38 A;  2E51 A;  1UZ0 A;  3KM5 A;  3ACF A;  3BPZ A;  2GNM A;  2VTX J;  3FZ3 A;  5EV7 A;  2VBP A;  4GB3 1;  3K4A A;  4Q1R A;  4GJY A;  3ZN4 A;  1NQJ A;  3UJO A;  3U78 A;  1DZQ A;  1E5H A;  1SLC A;  2DTW A;  1OA3 A;  3J8F 3;  2R7E B;  2RM2 3;  3M70 A;  4CXY A;  2DVB A;  4OUS A;  2RS1 2;  4LEJ A;  2ZZQ A;  1QNY A;  4L2N A;  3DCQ A;  1XND A;  2GC3 A;  1Q56 A;  2N7G A;  1NCQ C;  1RUH 1;  1S4C A;  1ZBA 2;  3POB A;  1IPK A;  1KGY A;  1NAE A;  5FZK A;  4GKY A;  2WNV C;  3OY8 A;  4NRO A;  5JIU A;  4NIG A;  3ZX7 A;  3VD5 A;  3GM8 A;  5EWS A;  5DDJ 2;  3WF4 A;  1OLQ A;  1VR3 A;  2PAE A;  1LOE A;  4L92 A;  2JIJ A;  5CNA A;  2RS1 3;  1DYP A;  2XQX A;  5APA A;  1DQ1 A;  4CXX A;  3EB7 A;  4LXL A;  5CG8 A;  1ZRE A;  4N8M A;  4XF1 A;  1GNH A;  3LFM A;  3I2I A;  1WW6 A;  2LAL A;  1COV 2;  5HXV A;  2VZR A;  4D6Q A;  5C8W A;  1YWK A;  2BNM A;  4GWN A;  2BUK A;  1LHU A;  2W95 A;  3UKN A;  3VBH B;  4YM1 A;  5C3P A;  4IQP A;  3L2H A;  4BK5 A;  5C71 A;  1C8M 2;  3WP4 A;  4LUL A;  1IPJ A;  2DWR A;  3U4S A;  3TEW A;  2RM2 1;  2Z4F A;  4OI2 A;  3VDD C;  4NID A;  3PU3 A;  4P9W A;  2WSU A;  2B4K A;  3GZE A;  2QTW B;  3A7Q A;  5FWE A;  5EPA A;  4RYD A;  2ADD A;  3WP3 A;  1AR8 1;  1V9U 2;  2EAA A;  5BNO A;  4BQW A;  4NOT A;  1QJU 3;  3H8U A;  1RHI 2;  5ERL A;  2JDP A;  5FIX A;  5K0U B;  2FQP A;  3ZXE A;  3T09 A;  1WCU A;  1IQA A;  3TNQ A;  3B93 A;  4S2D A;  1XSQ A;  2PLV 3;  3KV4 A;  4XJA A;  4GWJ A;  3T1L A;  5FR3 A;  2VC9 A;  4MGS A;  3RZL A;  4YPJ A;  4C0B A;  2WLP A;  1RUG 1;  2VM9 A;  1LOA A;  4LT5 A;  1OHF A;  3UNP A;  2WFP A;  5C9A B;  1LEC A;  4U36 A;  3VBO C;  1DF0 A;  3PUI A;  4GZ9 A;  5E1R A;  1N3P A;  4JKM A;  2YYO A;  1FXZ A;  2LS6 A;  4OYU A;  1JOB A;  4QB1 A;  5A3O A;  2VUC A;  2Q8C A;  1UU6 A;  5DDJ 3;  3WT3 A;  2P3I A;  4E4D X;  2FDI A;  4OQ9 A;  2JXA A;  2J1U A;  2PHD A;  3V64 A;  2ZGQ A;  2HWD 1;  5FPA A;  1HKD A;  2K2S A;  3N7J A;  4P9J A;  1OBN A;  3AJZ A;  1PX4 A;  3AZW A;  4E2G A;  4XC9 A;  1W6O A;  1OH3 A;  2XVK A;  4W6W A;  3KMH A;  4JRL A;  2VUL A;  5FBJ A;  4HG6 B;  5CFD B;  2YHJ A;  1CIW A;  2ZGT A;  4IV1 B;  3TAY A;  3F2Z A;  3H0O A;  5JZG C;  2X8K A;  5I8Y A;  2QQO A;  2XWJ B;  2DBI A;  3O0X A;  4AI1 A;  5FZH A;  5JR7 B;  1DQ4 A;  2R0F A;  1HRV 1;  2GSY A;  2RR1 3;  3WHU A;  2NP0 A;  1W2U A;  4MVT A;  4Q1P A;  5J3U A;  5A3P A;  5FXZ A;  3ZMN A;  4RR3 A;  1PZ7 A;  4Z1V A;  4KI5 M;  3U0Z A;  2NPI A;  1ENQ A;  2W0X A;  3AKS A;  1H8T B;  1R08 1;  4HK9 A;  5FZD A;  1JZ2 A;  4JGY C;  3E1F 1;  1O59 A;  4PBP A;  2WA3 A;  2VZ1 A;  3I54 A;  2QQJ A;  3O5S A;  1NCQ A;  1DGR N;  1OQE A;  1V6M A;  2WS9 1;  1YFU A;  4LA3 A;  4UW3 A;  4HFS A;  4CCK A;  4CP2 A;  5CFC C;  4CDQ B;  1HX6 A;  1W6P A;  2O1Q A;  3PL0 A;  1XNT A;  4OHX A;  1ENS A;  3HNY M;  4XJW A;  1OOP B;  2CU5 A;  2WO3 A;  1WCD J;  3BOP A;  4BQ4 A;  5KWR A;  1RUD 1;  3ZN5 A;  4Q4W 3;  3O1U A;  2BW8 A;  2XL9 A;  3VKN A;  3ZDS A;  3LF7 A;  4XFI A;  4AHY A;  1E5I A;  3H3L A;  3WF0 A;  2WNO A;  4LO5 B;  4JCK A;  4OLL A;  4WVM B;  3T0D A;  3E5Q A;  1QNW A;  3HWJ A;  4LBL A;  4CCE A;  1VPH A;  4OUE A;  1PVX A;  5BNP C;  3HNM A;  3LPG A;  4KL1 A;  2HEW F;  4B4P A;  5ABJ B;  2WSV A;  1WBL A;  1O3T A;  2ZGP A;  2IXI A;  4S2H A;  4XTP A;  4TXW A;  3BTZ A;  5FZF A;  4MGY E;  1POV 3;  3RNS A;  1LOC A;  2IXJ A;  1UY0 A;  3UKT A;  3ZO0 B;  3OBZ A;  1MPX A;  3P1I A;  3CQO A;  5DDJ 1;  1NXM A;  2JEM A;  4QXB A;  3RYR A;  1BCX A;  1Q3E A;  3Q8F A;  1CPM A;  1OFN A;  4GWM A;  4YVS C;  2OYZ A;  5JMC A;  5FWJ A;  3RZM A;  2J42 A;  4Z8B A;  4XCB A;  2K46 A;  5FZ3 A;  3N4M A;  5FPZ A;  1IS3 A;  4OHV A;  4AWD A;  3DXT A;  2VJX A;  4IV1 C;  1R08 2;  1QU0 A;  5HCH A;  5FZE A;  2YXS A;  4JV4 A;  5D8A C;  4IGO A;  1KS4 A;  3NJY A;  4A44 A;  1ZNP A;  4FO9 A;  2VZT A;  3AZZ A;  3A4U A;  1U5X A;  3JD7 1;  3POJ A;  1MR5 A;  4RR3 B;  2DCY A;  3T0B A;  4W4Z A;  3S7E A;  3IDE A;  4AFB A;  5JSP A;  1LU1 A;  4OI0 A;  1MQT B;  1IG3 A;  3I3Q A;  1BKZ A;  2Q8D A;  1CQ9 A;  1DQ0 A;  1W0O A;  1REE A;  2YB7 A;  1RUE 3;  2QE3 A;  1VAL A;  2RDR A;  2YFZ A;  3NMB A;  1R1A 2;  1H1I A;  2UU8 A;  1WA6 X;  2X10 A;  1W0P A;  2FD8 A;  3A0N A;  4NHL A;  4XBL A;  1AYN 1;  1AYM 2;  2XDV A;  4UT5 A;  4LBJ A;  4FFH A;  1IHM A;  3WDV A;  1ONA A;  4PIY A;  4Q8L A;  4Z92 B;  1L7Q A;  2H6C A;  2Y6H A;  1OPO A;  1RUC 2;  1PX3 A;  1QY4 A;  2BRT A;  2ZS6 B;  3PVO A;  4LO7 A;  4Q0S A;  5L73 A;  5IAT A;  2VBD A;  1NA1 B;  2ZX3 A;  2YBP A;  2YU1 A;  3B7M A;  1VBB 2;  1RMU 3;  2DCT A;  2WAB A;  2VH9 A;  2ATF A;  4K8R B;  1PO2 1;  3FJS A;  3NKT A;  3RG0 A;  2E33 A;  1YQ6 A;  5JOX A;  5DZG A;  4CCC A;  3KZ4 C;  3VD4 A;  1Y9M A;  3SIT A;  1VBA 2;  4YVW A;  1SHW B;  2QQL A;  2I2S A;  4QKD A;  1W8T A;  1PZ8 A;  3APB A;  4I09 A;  3POI A;  1UQX A;  4E8C A;  3O1V A;  3D0S A;  3IAP A;  4JGZ A;  4ZXE A;  1MS3 A;  1IG0 A;  2QJV A;  5FMC A;  3TB0 A;  3UV9 A;  3NV2 A;  4AED B;  3M3E A;  4KGQ A;  3VZN A;  2VY0 A;  1YIP A;  3D8C A;  4L97 A;  3AKP A;  1FPN 2;  4P14 A;  2JDM A;  4XFF A;  1W8O A;  1CON A;  2EIC A;  1GZC A;  5K8S A;  1BEV 2;  2XL7 A;  4OI1 A;  5FP3 A;  4YZ1 A;  1BEV 3;  4OQ8 A;  1RC6 A;  2RE9 A;  5FLH A;  2ZEW A;  4QQH A;  3HJR A;  1J3R A;  3WNO A;  4CSW A;  4D94 A;  2FDF A;  1SPP B;  1S0C A;  1DP0 A;  5BNN A;  4KMQ A;  1UU4 A;  4RHV 3;  4TWT A;  5FJK A;  5KXE A;  1LOB A;  2VOW A;  4BH9 A;  3AVR A;  5GKA C;  4KWK A;  2AUY A;  4AG4 A;  2ZX0 A;  4XAB A;  2WRA A;  5EZW A;  1SCR A;  5FZ9 A;  3WOG A;  1TME 3;  4I3G A;  5CU1 A;  2Y6K A;  3AYA A;  4YVS A;  3CLP A;  4RS5 C;  1P8J A;  2AGS A;  1W6M A;  1AF9 A;  3FHQ A;  3OF1 A;  5F8P A;  4ZU4 A;  4CDW A;  2CAU A;  2VZU A;  2ZX1 A;  3JZV A;  4JX0 A;  4N53 C;  3L2Y A;  4WM7 C;  1W9F A;  5FZA A;  1MZ5 A;  1AJK A;  3UL2 A;  1UX7 A;  3D0J A;  5F37 A;  5FUN A;  5KC6 A;  3OEB A;  5JI9 A;  1ND2 B;  1JYC A;  1XYN A;  4HBN A;  1EV1 3;  1DGW A;  2CDO A;  3ZPY A;  1JS9 A;  2HWF 1;  2BPA 2;  1ULF A;  3I7D A;  3SIS A;  3AZY A;  3ZYP A;  5A7W B;  2A6V A;  1EUU A;  5FZ4 A;  1HQL A;  3KT1 A;  2QBX A;  2P6H A;  5DAX A;  4PIZ A;  2R04 2;  2OZJ A;  3THT A;  4M0H A;  2JD9 A;  5E88 A;  4RQP A;  2HYX A;  1JYI A;  1R09 1;  2XLA A;  4EV0 A;  3E6B A;  3PLQ A;  1CZT A;  2G9Z A;  2BTV C;  3D6E A;  3T2O A;  2HBT A;  3LSE A;  4IEW A;  1VAK A;  1RUF 3;  3EO6 A;  4G9S B;  4COV A;  1EPW A;  1CAU A;  1RHI 1;  4NRM A;  1PVC 3;  4WM8 B;  4EWD A;  1OUR A;  3GHM A;  4A41 A;  4BU2 A;  3WNM A;  4HOO A;  5I0T A;  5F7U A;  4CTE A;  5JDB A;  4PDW A;  5BNP B;  3P3N A;  3LIG A;  4LA2 A;  1FYU A;  5T55 A;  4ES8 A;  3CL1 A;  3VKO A;  2YGL A;  1QJZ A;  2G9F A;  2ARC A;  2J1S A;  2IXC A;  4HZF A;  3RWK X;  5FO8 B;  3V0A B;  5K0U A;  1NE4 A;  5LBC A;  5FOJ B;  2EXJ A;  4D0Q A;  3MPB A;  4FPJ A;  4M4R A;  5GAL A;  3TWI A;  2ZGL A;  2ORZ A;  2Q8O A;  2BJS A;  2BGO A;  1H2M A;  1HJF A;  4BQY A;  2GP3 A;  4M00 A;  1W2A X;  3WNL A;  3O1P A;  1ZBA 3;  3ACH A;  4Q4W 2;  3MYX A;  4I0B A;  4GA9 A;  3OGV A;  3VBF B;  2GMM A;  4NII A;  1POV 0;  1D2Q A;  2OPK A;  4OZO A;  3KHC A;  3OJB A;  2XKP A;  4FQZ A;  1MZ6 A;  3HN3 A;  5JZG B;  1S2E A;  1VBA 1;  5L19 A;  2F17 A;  4C1X A;  1O7F A;  1UYY A;  2O14 A;  5FKB A;  4QHB A;  3C7H A;  2I45 A;  2HWC 1;  2VXJ A;  3UET A;  4B4Q A;  5C3R A;  4QKF A;  3I49 A;  5LEJ A;  3NAP A;  4YYO A;  5LRR A;  2ENR A;  5F3G A;  1QKQ A;  4PQ9 A;  3T4V A;  1UIJ A;  4LE3 A;  5FYH A;  4N43 C;  1CAU B;  1V6I A;  1AR9 3;  1APN A;  2RJK A;  3VHP A;  1HB4 A;  3NV4 A;  4YZ5 A;  1Y9G A;  5D2A A;  4H7L A;  3N9P A;  5F5C A;  4YW1 A;  4ZHN A;  2ARX A;  2OII A;  3JD7 3;  4LMF A;  4RA0 A;  4CEW B;  5BY5 A;  5FYI A;  2VCA A;  2XJQ A;  3LQC A;  2NLR A;  4K9S A;  4GH4 A;  1SFP A;  1EUT A;  1QXR A;  3JBG 2;  4M0N A;  4P9G A;  4BYY A;  4TN7 A;  4HKL A;  4DEQ A;  1SLL A;  2JKX A;  2JE8 A;  3CKH A;  1PK6 A;  4AVT A;  2VNR A;  4QPY A;  4GQ7 A;  3ZKY A;  3HIF A;  4LKS A;  4QGL A;  5LBB A;  3VBU C;  1NY7 2;  3D5O A;  3BUC A;  1DYK A;  3W58 A;  4YW3 A;  4B1M A;  4FPG A;  4D69 A;  3CHX A;  4N7U A;  4Q27 A;  2BYV E;  3WQB A;  1PIV 2;  1V6K A;  2QDR A;  3BTX A;  1IPS A;  1A6C A;  1E5R A;  4N43 B;  3E6D A;  2ZTN A;  4N53 B;  4LBK A;  1IS4 A;  4N43 A;  3VKL A;  2WZP P;  5JXG A;  1WMD A;  3QD6 A;  2BWA A;  4LIU A;  1CAW A;  2WFF 2;  3LEK A;  4E8D A;  1RUG 2;  4D3W A;  1AR9 2;  4FP2 A;  4XUO A;  4QB6 A;  1HB1 A;  1O8P A;  2VTF A;  5K4L A;  2YMZ A;  1V6J A;  4O61 A;  4NHK A;  3GGL A;  1C1F A;  5FPB A;  1JYV A;  1UY4 A;  4BDV B;  4BMB A;  2W5F A;  3SCF A;  4K3U A;  3VBH C;  1N3Q A;  3J4U H;  3NAP B;  5GZE A;  2VMH A;  3AXE A;  2FDG A;  1IKQ A;  1BK1 A;  1CZV A;  2X53 S;  3K2O A;  3LCP A;  4I01 A;  4WV8 A;  2WZ8 A;  4KWJ A;  3ABZ A;  1TQ5 A;  3U37 A;  5KHI A;  3ILR A;  2R1D A;  2V72 A;  5JOZ A;  5FXX A;  3SKJ E;  4A45 A;  1UL9 A;  4ERO A;  3N9L A;  1HIX A;  1COV 3;  1S55 A;  2Q1Z B;  2WNV B;  5FTT C;  2GH2 A;  5A7S A;  1B35 A;  3WSO A;  2AH2 A;  2AR6 A;  2WNV A;  3Q8B A;  3RWN A;  4MO3 M;  3POW A;  5FRA A;  1AHS A;  1IKP A;  2J1V A;  2J7M A;  4QX2 A;  3PHM A;  2SBA A;  1C3H A;  4QQO A;  1B09 A;  3AYE A;  1A8M A;  5FZO B;  3T2P A;  4CRQ A;  4CU7 A;  3CBN A;  4IER A;  4CEY C;  2PFW A;  1KDM A;  3M4F A;  5HV0 A;  3VDC A;  2FCT A;  2IXL A;  1XPW A;  3B02 A;  5SV8 A;  4A7Z A;  5C6C A;  3NNG A;  2HWE 1;  4NHM A;  4XVH A;  3QH6 A;  2DTY A;  4QM9 A;  4BIO A;  4XQ4 A;  2QQK A;  3M3Q A;  1HW5 A;  3WV6 A;  2W47 A;  1W99 A;  4EE2 A;  2YPJ A;  3S6P A;  2D3P A;  2G9G A;  3B00 A;  4SBV A;  1CPN A;  1UAI A;  4QPI B;  5EIY B;  3C7O A;  1SLI A;  4F8A A;  5FP4 A;  1D7P M;  1DQ6 A;  2PEL A;  2ZAB A;  4GIQ A;  2D6P A;  3U07 A;  3M7A A;  1F35 A;  3I4I A;  4CP9 B;  3TEY A;  2BQP A;  1G7Y A;  1Q8S A;  3MIB A;  3UYJ A;  1PO1 1;  2EAL A;  1OUS A;  2J1A A;  1NUK A;  1WCS A;  4FPY A;  2VOX A;  4YFW A;  1EAH 1;  2TEP A;  2ILM A;  3SKV A;  1ACC A;  1D0G A;  1H8T A;  2Y6L A;  1OA4 A;  4Y1X A;  4DPN A;  5IVJ A;  2BGP A;  4FI9 A;  2XHN A;  3RZZ A;  3ZFF C;  1KFX L;  2YFU A;  1MS8 A;  2ZJC A;  3MUY 1;  4BE3 A;  1RIN A;  4W8J A;  1LRH A;  4CUC A;  2VW0 A;  2EID A;  2B7Y A;  1PK6 C;  3POF A;  1W6P B;  1QJX 2;  4ZON A;  4YAR A;  2JJ6 A;  4KNC A;  2HWE 3;  1LUL A;  2VTX A;  3K3N A;  1JZ8 A;  4NWW A;  2GNT A;  2VVF A;  4YM3 A;  4YGB A;  2FMD A;  1YI7 A;  3T1M A;  4ZZ8 A;  3FL7 A;  4Z2W A;  3B9C A;  2X5I B;  4UF0 B;  5F2S A;  1FOD 3;  1N1V A;  2HWC 2;  4TLG A;  1S0J A;  4LBM A;  2C6S A;  3POE A;  2Y6F A;  4Q8K A;  1NE6 A;  1Y9Q A;  2L9L A;  2RJ2 A;  2HWE 2;  1HXS 3;  4G4F A;  3AYD A;  1D4M 1;  4E2S A;  1PHM A;  1VMJ A;  1V9U 3;  5FPX A;  4NVP A;  5AFB A;  2ZGK A;  3FFZ A;  2WQ4 A;  2EA7 A;  4XJU A;  4RN5 A;  1JHJ A;  3OBR A;  1D0H A;  2PQS A;  3GZA A;  1VIW B;  1WME A;  1YI9 A;  3MFA A;  2YGM A;  4LKD A;  4R4Z A;  4XBQ A;  3AP5 A;  4Y20 A;  5J36 A;  4MGK E;  1GZT A;  2P3Y A;  1REF A;  4NN0 A;  5F6L B;  1KXG A;  2W94 A;  5A3W A;  3TN9 2;  1KRI A;  4AFA A;  2PA7 A;  2XJS A;  2C5D A;  1SMV A;  2EIG A;  2OXB A;  3ZYB A;  3QCW A;  1BMV 1;  4B1L A;  4MYE A;  1DDL A;  2A3X A;  2ZEX A;  3AFK A;  1LED A;  4PI0 A;  4IEX A;  1PMI A;  2WQZ C;  3N7K A;  1V6N A;  4AOC A;  5T54 A;  3MF6 A;  3RS6 A;  1CAV B;  2DFC A;  5EHD A;  2D6L X;  3V0B B;  1QJY 3;  2VZS A;  5L9V A;  4AGR A;  4GB3 3;  3ATG A;  2GC2 A;  2C26 A;  4LBQ B;  4P5Y A;  2ZX2 A;  3KWV A;  3IMN A;  3LZZ A;  5FXW A;  2ZKN A;  1ULP A;  5CIR A;  2GU9 A;  3VLB B;  5LA1 A;  5IK7 A;  1HRV 2;  4J1W A;  2K0G A;  1W39 A;  3F95 A;  1VBB 3;  1JOD A;  1QOO A;  3AC0 A;  4EWA A;  1QMJ A;  1FOD 1;  3OUI A;  1H1A A;  1VBD 2;  2W3J A;  1EYB A;  3AX4 A;  2O8Q A;  1LGB A;  1RUI 3;  1F8V A;  4GMP 1;  4CCL A;  5FZ0 A;  4UI9 L;  4XW3 A;  1ENX A;  1QH7 A;  4TLF A;  2P2K A;  1QIQ A;  2RHP A;  1CX4 A;  1UO9 A;  2WAO A;  2XH6 A;  2XML A;  3A23 A;  3OGS A;  3R4U A;  5CBL A;  5LCW L;  1YRZ A;  4B7E A;  2Z42 A;  3OY8 B;  2OZ6 A;  2WZR 2;  2H6B A;  3OUH A;  2D5F A;  4K6B A;  2Y6J A;  3AB0 A;  4RQP B;  2UWB A;  1RUC 3;  4HKW A;  2ZA9 A;  3LAG A;  3ZXK A;  4OVE A;  5FUP A;  5FZB A;  4FPC A;  3CJX A;  1UZV A;  3ZR6 A;  4BME A;  4UFM A;  4Y3O A;  4AEK A;  1LES A;  2B46 X;  2RVA A;  1UOF A;  5FYS A;  3THP A;  1W9W A;  1SCS A;  3FE5 A;  1IOA A;  4BLI A;  4A4A A;  3PVE A;  1RUN A;  3I3B A;  3VHO A;  4FSJ A;  2D97 A;  3MPP G;  5DAV A;  2YV8 A;  4IL7 A;  4YG3 A;  3TYJ A;  4COW A;  4G3Y C;  2WNU B;  3OD0 A;  3RJR A;  3A22 A;  4EZ4 A;  1X50 A;  3ZIW A;  5JSR A;  4GMP 0;  2CGO A;  3ZMO A;  1YYN A;  2ZGR A;  2WS9 2;  1SBF A;  1YQC A;  1GWK A;  5LAT A;  2BDR A;  4Q4V 2;  2GN3 A;  5JWP A;  4QKB A;  3PIG A;  1XE7 A;  4W6Y A;  1LKN A;  4L9B A;  3PVB B;  5CA6 A;  2IFR A;  5KHK A;  1JBC A;  4ZXK A;  1HQW A;  2B9V A;  1OOP C;  1RUC 1;  3IPV A;  4XIL A;  1AR7 1;  1O5L A;  2OW4 A;  2X5I C;  4JTO A;  4WVV A;  4GAZ A;  4L0P A;  1OVS A;  5LA2 A;  1FX5 A;  2E53 A;  1ALY A;  1PIV 3;  4H55 A;  4HET A;  4PLO A;  4PLN A;  5LK7 B;  2ZGN A;  2P37 A;  1QJX 1;  5C70 A;  1PK6 B;  4AFC A;  4BLJ A;  2W52 A;  1QJF A;  3QH7 A;  4GXL A;  3SQO A;  2RR1 1;  5F5I A;  1W6O B;  2FMY A;  1UN1 A;  3UJQ A;  5FP8 A;  1VBB 1;  3DYM A;  3JXS A;  1WWY A;  1W3V A;  2W46 A;  3ZYI B;  2VR4 A;  2D6O X;  3ES1 A;  4UWD A;  1VB2 A;  3AVS A;  2VGD A;  1NOV A;  1RYY A;  3GF6 A;  4CCJ A;  3J7N A;  1H2K A;  2E7Q A;  4DRV A;  1GKB A;  4JC1 A;  2A70 A;  4R9D A;  2RG4 A;  5DZF A;  4U2A A;  2TNF A;  1ZX5 A;  3WW1 A;  1J59 A;  4HPK B;  4YGC A;  1ND2 C;  1XNA A;  1VRH 2;  4GH4 B;  3MHZ A;  3O14 A;  1K45 A;  3UES A;  4DMI A;  4AQ6 A;  3AL6 A;  1NCR C;  4RS5 A;  3CDZ B;  1Y3T A;  4IEZ A;  5HPO A;  1BVV A;  4XAA A;  3PTY A;  4RS5 B;  5F5A A;  1JYT A;  1SFN A;  2IZW A;  3VBO B;  4FTE A;  3OYW B;  4CEY B;  5EJ3 A;  1H6X A;  3GBF A;  2VOK A;  4CDW C;  4N53 A;  5D21 A;  3ZKU A;  4AI8 A;  2A7A A;  4TZD A;  1RUE 1;  3ACL A;  1HV0 A;  1B35 B;  1QQP 2;  3RZK A;  5AC9 2;  2VZ3 A;  1UCX A;  2RMU 2;  4CDU C;  4XBN A;  3FFQ A;  1HXS 1;  3WLU A;  3FBY A;  1MEC 1;  1S0G A;  2C4X A;  1LOG A;  1IQD C;  1H9W A;  4R4X A;  2BER A;  2YC4 A;  3CJI A;  3HBZ A;  4CCM A;  2ZCW A;  5TSW A;  3O7O A;  5FYU A;  4CPB A;  3CJI B;  1GV9 A;  1PGS A;  3OG2 A;  3AL5 A;  1US2 A;  2VMG A;  3H7J A;  1W28 A;  1ZRD A;  1NLQ A;  3KCC A;  2D44 A;  3R4D B;  1GP5 A;  2JDA A;  4LHL A;  3C2U A;  2E9Q A;  2DCZ A;  5A7O A;  4JQR A;  2WA4 A;  2BFU S;  4UW5 A;  2EF6 A;  5IVE A;  4ONU A;  1YCI A;  2JG8 B;  5IVY A;  3AMM A;  1G9A A;  1ZRF A;  1RHI 3;  2JG8 A;  1PO2 2;  3C7F A;  2XLF A;  2FCU A;  4LJH A;  3POS A;  4DXT A;  2UYB A;  4MGT A;  1QJX 3;  2V5D A;  4DXZ A;  1UZZ A;  3SHR A;  1UMH A;  1F15 A;  2D3R A;  1CWP A;  1F2N A;  1BHG A;  1Q8P A;  1G9B A;  2R30 A;  2HLE A;  4GKX A;  4Y33 A;  5T5L A;  4LUM A;  5C4W B;  1LHO A;  1AVB A;  4Q0Q A;  2HWC 3;  2E26 A;  2TBV A;  3NL1 A;  4QPG A;  4XDQ A;  1W8W A;  1JN2 P;  3FLP A;  4QMA A;  3M3I A;  2ZXQ A;  2BNN A;  2YG0 A;  4KBB A;  1NYW A;  3IMM A;  3K77 A;  3USU B;  4AEJ A;  2DF7 A;  3WDT A;  4DO0 A;  3IN9 A;  3Q8C A;  3I2J A;  1WUV A;  2EIE A;  2HWD 3;  4NUB A;  4EN8 B;  2WN3 A;  1AL0 G;  5B2G B;  2W39 A;  2AC1 A;  2VZP A;  1AXY A;  2YZ4 A;  4WVZ A;  4IET A;  1WBF A;  1TNF A;  2MEV 3;  5FQ0 A;  2LRP A;  4IE6 A;  4MXW B;  3ZXD A;  3OBT A;  3W5M A;  5L7O C;  4NIH A;  3HT2 A;  3ZSL A;  2R07 1;  2VMC A;  2XVG A;  4MH0 E;  1HRV 3;  1U5I A;  1F4A A;  1QQP 3;  4CE8 A; 
#chains in the Genus database with same CATH homology
 5FZ3 A;  5A3W A;  5K4L A;  5F5I A;  5FZI A;  4D6S A;  3DXT A;  5FP8 A;  5FPB A;  3U4S A;  5IVC A;  5F3I A;  2W2I A;  2OQ7 A;  1VRB A;  3PU3 A;  2XUE A;  5FZM A;  3LD8 A;  5FZE A;  4IGO A;  5FWE A;  5FYY A;  3AVS A;  3KVB A;  4CCJ A;  3NJY A;  3K2O A;  3PUR A;  5F3E A;  5FYZ A;  5LY2 A;  2P5B A;  5FY0 A;  2YBK A;  4BU2 A;  4HOO A;  4ASK A;  4GJZ A;  5FXW A;  2Q8D A;  3AL6 A;  4HON A;  5FPV A;  5LY1 A;  4QWN A;  5A3N A;  5FXX A;  4GD4 A;  2YBS A;  3N9L A;  5FZC A;  3KV4 A;  5FY9 A;  5F5A A;  4BXF A;  3PUA A;  5A7S A;  5ANQ A;  5LW9 A;  4LIV A;  2YPD A;  5A7Q A;  3N9Q A;  2OQ6 A;  4UF0 A;  5F32 A;  2XDV A;  4V2V A;  2WWJ A;  4QX8 A;  5FZO B;  2OX0 A;  4QXH A;  3KV5 A;  3PDQ A;  4CCL A;  5FZ0 A;  5FZ7 A;  5FYB A;  2Q8C A;  4EZH A;  2XML A;  3OPT A;  5IVF A;  2GP3 A;  3PUQ A;  2YBP A;  2YU1 A;  4XDO A;  5FPA A;  5FPL A;  5A80 A;  5A1L A;  5A7N A;  2OT7 A;  3N9O A;  5FXV A;  2OS2 A;  5E6H A;  5A1F A;  4CCO A;  4URA A;  5FBJ A;  4V2W A;  5FYT A;  4CCM A;  5FPU A;  5FP4 A;  5FZL A;  4AAP A;  5FYU A;  3OPW A;  3K3O A;  5FUP A;  5FZB A;  3AL5 A;  2WWU A;  4XDP A;  3ZPO A;  5A7P A;  5CEH A;  4DIQ A;  4Y3O A;  3UYJ A;  5FZ6 A;  5A7W A;  5FZH A;  4C8D A;  4QU1 A;  5FYS A;  5F39 A;  5A7O A;  5FYM A;  2GP5 A;  2XXZ A;  5IW0 A;  5F3C A;  5IVB A;  5FZ8 A;  5IVE A;  4BIS A;  5FXZ A;  5A3P A;  5F3G A;  5IVJ A;  5FY8 A;  4CUG A;  4QX7 A;  5IVY A;  3RVH A;  4E4H A;  5FY5 A;  5FZD A;  5F2W A;  5FYH A;  5A3T A;  5FZG A;  4GJY A;  4IGQ A;  4CCK A;  5FP3 A;  4EZ4 A;  3N9P A;  5F5C A;  3PU8 A;  3KVA A;  5FJH A;  3LDB A;  3U78 A;  5FYI A;  4CCN A;  3K3N A;  4CSW A;  4Y4R A;  4Y33 A;  2Q8E A;  4TN7 A;  4UF0 B;  5F2S A;  5FYC A;  5FJK A;  5FY4 A;  3AVR A;  3PUS A;  3KV6 A;  5FZK A;  3ZLI A;  3N9N A;  2YU2 A;  5FZO A;  5FZ9 A;  4GAZ A;  5LWB A;  3KV9 A;  5IVV A;  4DO0 A;  2PXJ A;  2VD7 A;  5KR7 A;  5FZ1 A;  3N9M A;  5FP9 A;  4NUB A;  5FZF A;  5FZA A;  5FY1 A;  4QXC A;  5F37 A;  4LXL A;  5FUN A;  5ISL A;  5FP7 A;  4IGP A;  5FYV A;  4QXB A;  5FY7 A;  5FV3 A;  4AI9 A;  4LIU A;  5A7W B;  4D6Q A;  3PTR B;  4LIT A;  4D6R A;  5FZ4 A;  4EYU A;  5FWJ A;  3DXU A;  5IWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...