5FZ0A

Crystal structure of the catalytic domain of human jarid1b in complex with 2,5-dichloro-n-(pyridin-3-yl)thiophene-3-carboxamide (n08137b) (ligand modelled based on pandda event map, sgc - diamond i04-1 fragment screening)
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
462
structure length
453
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with N11213A
rcsb
source organism Homo sapiens
molecule tags Oxidoreuctase
total genus 143
structure length 453
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fz0A01
5FZLA 5FYYA 5FZ1A 4AI9A 3N9NA 3PUSA 5F2WA 4XDOA 4LIUA 4CCJA 2YBKA 3ZLIA 5IVJA 5FY8A 3KV4A 5FZIA 4BXFA 4CUGA 4GJYA 5FZGA 5FJKA 5ANQA 5F39A 3AVSA 5KR7A 3DXUA 5FZ0A 2P5BA 3K2OA 3PUQA 5FZ7A 5FPLA 2OX0A 3N9PA 3N9MA 3N9LA 5FY7A 5FPVA 2Q8DA 5FZOA 1VRBA 5FYBA 4D6SA 4QXHA 3PTRB 5A7QA 2PXJA 2YPDA 2XXZA 5A7OA 2GP5A 5FP8A 3AL5A 3N9QA 2WWJA 2YBSA 2XDVA 4CCNA 2YU1A 5FZ6A 3KV5A 5CEHA 4CCLA 2XMLA 4QU1A 5F2SA 3U78A 5IVFA 5FPAA 5FZAA 4EYUA 3NJYA 4Y33A 5IVCA 3KVBA 3KV9A 5LW9A 5FUPA 5F32A 5FYVA 5FYMA 5A3PA 3N9OA 4UF0A 5FPBA 4Y3OA 4IGOA 4GD4A 5IVBA 5FYIA 5FUNA 5FZHA 2OQ7A 4QXCA 4D6RA 5A80A 5A3TA 5FP4A 2OT7A 3U4SA 5FYTA 3PURA 5FXVA 3AVRA 5FZMA 5A3WA 4D6QA 2OQ6A 3PU8A 5FXWA 5FP7A 5FY4A 5FZCA 2W2IA 5FPUA 5FZ3A 4BISA 5FP3A 5FXZA 5IVEA 4QX7A 4QX8A 3ZPOA 5A1FA 5FZKA 5IVYA 5FZ9A 2YU2A 5A7WA 5LY2A 4EZ4A 4CCMA 5F3GA 5FYHA 4EZHA 4QWNA 5E6HA 2Q8CA 5FZ8A 5FP9A 4UF0B 5FZEA 5FYSA 4C8DA 4TN7A 4BU2A 3KV6A 3OPWA 4LITA 4LIVA 3RVHA 4V2WA 5A7NA 4ASKA 3UYJA 5FZFA 4DIQA 3OPTA 4URAA 5FZOB 5FZ4A 5A7SA 4CCKA 4V2VA 5FY5A 5A7PA 4QXBA 5FZDA 4Y4RA 2Q8EA 4GAZA 5F5IA 5FYCA 5LY1A 3PDQA 3PUAA 5A3NA 4AAPA 5FV3A 5IW0A 4CCOA 5F3CA 4HONA 5FXXA 4CSWA 5IWFA 3K3OA 4NUBA 5A7WB 4E4HA 2XUEA 4LXLA 4XDPA 5ISLA 4IGPA 5FWJA 5F37A 4IGQA 5F5AA 2YBPA 5FWEA 5FZBA 3LDBA 3PU3A 5IVVA 4DO0A 5FY1A 5FYUA 3LD8A 3AL6A 2WWUA 3DXTA 3K3NA 5A1LA 5FBJA 2OS2A 5FYZA 4HOOA 5K4LA 5F5CA 5LWBA 2GP3A 5FJHA 5F3IA 5FY9A 5FY0A 3KVAA 2VD7A 5F3EA 4GJZA
chains in the Genus database with same CATH superfamily
5E89A 2HWD3 4NHYA 3BTXA 1L3JA 2AUYA 5ABJC 1KGYA 4Q4V3 3CO2A 3VBFC 3ZLIA 2XBO2 1GICA 3RYPA 3VHRA 1O6UA 1NX9A 4LKFA 4UXAA 1PZ8A 5LATA 1F5FA 2DF7A 2ZBJA 4R9BA 1JU3A 3HEIA 1IQAA 1DGWA 1Q56A 4FOQA 5FJKA 3H8RA 1C8M3 1S0JA 2RE9A 4N53A 3I2IA 2OZJA 2W92A 1PK6A 3BOPA 3W5NA 3EBRA 3H0OA 2WUHA 3I59A 4OHZA 1LCLA 3AKQA 3HNMA 3PVEA 4QPGC 4UAPA 3M1HA 2WINB 2ZGTA 3ZFEC 2WYFA 4N8MA 2PHFA 4HBNA 2Z5WA 3LB9A 1QY4A 2RMU1 2VO5A 2XQXA 2K46A 4G9SB 5B4NA 3NVCA 3RZJA 2GZWA 3SITA 2HEWF 1CGPA 3J8F2 3ZR6A 4KGQA 1JYWA 4RR3A 4QGMA 3O1RA 1JUHA 1ULPA 1XBFA 5F2SA 1SLIA 4CU7A 3N7MA 4B4QA 1HJGA 1UOFA 5L19A 4W50A 3N7KA 2ARCA 4M3CE 1NA1A 3KV9A 3WNNA 4I3GA 5F32A 2C1FA 2D93A 2GU9A 2PA7A 1S0BA 4JDMA 2VZPA 4LO6B 5CFCB 5FO7B 3KHCA 2RDSA 4AQ6A 5T5JA 2OQ7A 3FFQA 3ON7A 2ZEZA 2BBAA 1QOOA 3FZ3A 4AI3A 1PM7A 1SZBA 3PURA 2OKXA 1LHNA 1JODA 5A3WA 4FFGA 5C9AB 1C57A 1DLLA 3AJZA 3ZN4A 1O3RA 2G9ZA 5FZCA 3MGUA 2RS12 2IC1A 2W5FA 5ERLA 2XQRA 2VZTA 2RS31 1CJDA 2RVAA 3WCSA 4QX8A 3AXEA 2QDRA 4UFLA 4EZ4A 3MF6A 4CDWA 1ENXA 1OH4A 3PTYA 1XE7A 4XHBA 4QKNA 1WCQA 1ODMA 3POGA 3GALA 1VMHA 2NPIA 1SCSA 1POV0 4A2UA 4BWOA 1QJFA 5C9AC 1OC1A 1UYXA 4B7EA 3N36A 5FZFA 2VM9A 4XXAA 4CCDA 3WNLA 5A7SA 2WFF2 1QXPA 1W6OB 1B35A 2VMHA 1OOPB 4FAHA 1UIJA 3I2GA 1LESA 1N3PA 3LA3A 4CCOA 1ZBA3 2E32A 1KS5A 1GUIA 2O8OA 5DG2A 5GKAC 4UW4A 2GC0A 1R083 3MFAA 1N1YA 1VBE2 2BDRA 2DYCA 2JG8A 2XUEA 3SNMA 4B3NA 4JGZB 4LBNA 2Q5TA 4MHRA 5BNOA 3J9SA 4PI2A 2WZEA 4AFCA 3PU3A 2YC4A 1JYCA 5EJZB 3O0VA 3VBOC 3DPRB 1V00A 2EXJA 3IDAA 4CUCA 1VALA 5GZFA 4LT5A 3DXTA 5C33A 2B5HA 3AMQA 2KR2A 5EHDA 1TEIA 4BQYA 5A33B 2DURA 1CR7A 1OOPC 2VW1A 1W0OA 2C4XA 1FOD3 3ILNA 2BW8A 3ZSJA 3RNSA 4A44A 4TTGA 3CJIC 1O91A 3USUA 3WLUA 2YB7A 1ENSA 4GA9A 2P3IA 1IZ3A 3UKVA 4NAOA 3P6BA 4JGZC 3JBG3 1MZEA 4D8MA 1HXS2 4HKLA 2Y0IA 2CGOA 2VZQA 3CF6E 5DN2A 3ZSMA 1GMMA 4LIUA 1WLDA 1CAUB 1ULCA 1CAXB 4A7YA 3KV4A 1XOYA 4FFHA 3B69A 2NN8A 1TMF2 1ZX5A 3BIEA 1EPWA 4RS5A 1NCQA 3A7QA 2ORXA 4YZ3A 3RRDA 4BLIA 3LDRA 2A7AA 1PGL2 3FLTA 2GAUA 5A7QA 1YEWA 1GFF2 3N7JA 4LO7A 3KWVA 3WVJA 4F7ZA 2DVDA 1JOPA 4XURA 5FPXA 3KCYA 4Y5TA 1S2BA 3SCFA 1TME2 4R4XA 1LGNA 4XQWA 4Q4V1 3E6CC 1H9WA 4N53C 3NKTA 2CU5A 1RUOA 4PQQA 1GZTA 1RUI2 3T30A 1PO23 4GH4A 3V0BB 3FC0A 4QX0A 3RFRA 2GC1A 4AVBA 1W0PA 1C8M1 5FUPA 1VMJA 5IHRA 2R30A 2YZ4A 4UT5A 1GOFA 1W8OA 1PVC2 1Z7S1 2VOWA 1QJY3 4M3CB 4L9BA 5AC93 1VBA3 1W0NA 1BXHA 1W2OA 5FZHA 4SLIA 1V6IA 3ACHA 4LO5B 3TN93 1XSQA 3KCXA 2LTNA 1RUD3 3U14A 1GQGA 2DU1A 4HVOA 4WM7A 4FFIA 3C7EA 3B02A 5FY4A 3JZVA 1NA1C 1REFA 1UN1A 3MV11 1G9DA 4XXPA 5CKQA 2PYTA 3OBAA 4HANA 3S30A 1SG3A 2I45A 1HV1A 2QQVA 3DL3A 4LBQD 4AGVA 3WW3A 3PUHA 2UYAA 5FO9B 4RHV2 3APBA 4UF0B 4XACA 1DGRA 4I30A 1L7QA 2OUHA 4Q29A 1CIWA 1FNZA 2DTYA 1POV3 1GP6A 4OHVA 3MIFA 4AVAA 4UOJA 3PJYA 1XNBA 3SEPA 4C0BA 4AI2A 3O1MA 1RTVA 4FTEA 2ZA9A 2DUQA 3NNMA 3PJQA 5FPZA 4KWJA 2ZMKA 2QQWA 1OUSA 2BNNA 4DNYA 1AR61 2V09A 1K5JA 3LOIA 2CY6A 1OA4A 2R041 4K9SA 4QB2A 4YVWB 1J58A 4PLMA 3ZXKA 3W9AA 1K5MA 4N7UA 3AP9A 4IQPA 4LOSA 1GBGA 3INAA 3LEKA 5JSOA 5F37A 3H1MA 5FZBA 5LBCA 2WIIB 2GSYA 2YXSA 3P1IA 1COV3 1G8WA 3G7DA 4XILA 1UY4A 4WM8A 4WVMB 1VMFA 2RMU2 2XVGA 1R091 3U07A 1UD1A 1DG6A 2BBVA 4BMBA 4E4DX 2EIDA 2X5IA 3WNXA 3BTZA 4NMIA 1HV0A 3KCCA 4ZZ5A 3E6BA 2W39A 1QJX1 2QQKA 5FLHA 1ENRA 4QQ2A 4YVWC 5F7UA 1ZBA1 4AEDB 4LMFA 1IHMA 4CDXB 2OPKA 1QJEA 2KD7A 2W46A 1LOAA 2XGXA 3AYCA 2IXCA 2WA4A 4OLLA 5FZLA 3WZ1A 5DAPA 4IW3A 4XDOA 1ND3A 3IPVA 4QHZA 5T3NA 2YGMA 4DUWA 1RUC3 5I91A 1N47A 1I1EA 4CP9A 1D4VB 4BLJA 4AHXA 3FFZA 5GZGA 3IDBB 5F39A 4FXKB 4N9IA 5FPLA 2RS32 3O7OA 1BBT3 3AMHA 1ZZ8A 1ZRFA 2QQNA 3MO4A 1FOD1 1ULDA 4JCKA 2NM1A 3M3QA 2JD4A 5FZOA 2ZZQA 4AEDC 1XXNA 4XJ9A 3IIIA 4CDXC 2B9UA 3FBMA 4PF1A 3VZMA 2C9AA 2P6HA 2WS91 1HKDA 1OF4A 2A1XA 2GP5A 3KZ4C 3CLPA 3AZVA 5C7GA 3JBG1 1YQ5A 3GF6A 1GP5A 1WLWA 2HWF3 2WBKA 2XMLA 1AR73 4YPJA 3WHUA 1M06G 4RS5C 4JKLA 4FVVA 1KITA 3GZAA 1PX4A 1XNDA 1LOFC 4QDSA 3BALA 4AHYA 2AH2A 2R073 2NMOA 4X6QB 5I8YA 2BGPA 3ACFA 2EALA 4PCRA 1EP0A 2DBNA 2P3YA 1ST8A 3WINE 4BK4A 3BKZA 4LA2A 5JLVA 2VOVA 3ORJA 1RUG3 2VOKA 4LKDA 1JZ4A 1BVVA 4CDUA 1ZZBA 4BB3A 2FCVA 4W4ZA 3PLQA 5JR7B 2VPVA 4QM9A 5DABA 2EXHA 3AVRA 4XMIA 5HCFA 5CKMA 1KJRA 4UFMA 3RZHA 1A3KA 4FAGA 2LM3A 4NE9A 1VR3A 2WJSA 3VDDA 3AZWA 1A8DA 1BK1A 4EJRA 3ZPOA 3K77A 5LY1A 2YU2A 5HPOA 1PO21 3SCGA 2G19A 5F3GA 3WQ7A 5FYHA 4MVTA 1ZM1A 1XE8A 2A70A 2HWB2 4XFFA 2C0ZA 1ZYBA 3JQXA 1QJY1 2ID4A 5AC91 5KXEA 2YUEA 4AFMA 1JZ2A 1HN0A 3WCRA 4EN6B 1Y7BA 3WD5A 4XF9A 5JI7A 1RXGA 3MBWA 2BYVE 4IEZA 3TN91 1SPPB 2FDFA 4RN5A 1RUD1 2XJQA 1NLQA 4QXBA 2XH6A 4OHWA 5KHJA 1DQ0A 3BPSA 5F5IA 1ASJ3 4ZU4A 1EUUA 2PFWA 4CTEA 4ZS3A 3MIBA 1UXZA 3KB5A 2R7EB 5D8AA 4Z2AA 4L11A 2JKXA 5DPNA 1KDMA 4Y1YA 2C5DA 1JZ6A 4QX5A 4IETA 1ULGA 1SLTA 5KWRA 2QUOA 2IZWA 3Q8EA 4D94A 4MOAA 3O0WA 4TZDA 4UW3A 4K6BA 1UU6A 3BGAA 1AYN3 1POV1 3LE0A 4GMP1 5D2AA 2YROA 2Y33A 1LTEA 1U0AA 4EQVA 2WNUA 3EMRA 4Q4V2 1PGW1 4SBVA 5FYZA 4YM3A 2HJIA 3L2YA 3RJRA 2WKKA 2O1QA 1S1AA 3K51A 2BTVC 1C8M2 4QB1A 3QBQA 1I5ZA 3KGZA 3ZSKA 4I3PA 1D2QA 3IDCB 4MZUA 4GB33 2RM22 2ZX2A 4BK5A 1Z7S2 4ATEA 4AHZA 3N9NA 3LF7A 5I0RA 2ZMNA 1GSLA 2HYXA 4KU8A 2V5DA 4N43B 2B46X 4YG0A 2G4IA 5TSWA 4FPFA 1G86A 4I09A 1COV1 4BXFA 5LZ6A 1YIFA 5J37A 4NN0A 3AVSA 3FLPA 4JQRA 1CN1A 5A32A 3PUQA 4JGYA 1YJKA 3BPZA 4INDA 3RDIA 2ATFA 5IYYA 2WA3A 1DZTA 4XCAA 2Q8DA 3MZHA 2X53S 3ST7A 1J3QA 1W9FA 4ZXKA 5CFDA 5A7OA 3T3YA 1POQA 1MS8A 3OD4A 4IL7A 5L9VA 3F2ZA 2Q0AA 3O1UA 1GNHA 3CZJA 3ZFGA 1H1IA 1WBFA 3DYOA 4N43C 4YGCA 3N4MA 3E5UA 3I54A 4B29A 1QQP3 3KV5A 1AVBA 1Y9QA 3JB4C 5I0SA 4BQ2A 1W9SA 1RUC1 1CAVB 2XJRA 2ZGSA 2GN3A 2PHWA 5FPAA 4BM8A 5LEJA 4Y33A 2BNMA 3ZYPA 3ZIXA 5JZGB 4OUEA 3ZYIB 4OHYA 5FYVA 2VVEA 1NCRB 4CEYA 4CCCA 2ZEXA 5CG8A 1WWYA 1AR62 1SFNA 4EN0A 1WD3A 1WMFA 5IVBA 2N7GA 2R042 1S0DA 1UOGA 4J1XA 2PHLA 5DUUA 1MS1A 2VZVA 5IT6A 5C6CA 3D82A 1ND2B 1QKQA 1FV2A 4D69A 2WRAA 3ZYJB 2VNRA 2H6CA 4C90A 1MR5A 1YFUA 3MHZA 1R092 3EB7A 5FPUA 4TSVA 4MV2A 1AR71 5EWSA 4DY5A 3ATGA 2RR11 3DYPA 5FMOS 1BEV2 3D0JA 1QJX2 1Y4WA 1RXFA 3ZDVA 2A5ZA 3D5OA 5FTTC 2WZPP 4S2GA 4HFSA 1J59A 1A8MA 1ND2C 3VBRA 3CEWA 4BIFA 1SBEA 2ARXA 2D44A 1RUG1 4C1WA 4Y22B 4NIHA 1ENQA 3IT8A 3UV9A 4Y1XA 1XJAA 1W6MA 3POJA 3CJXA 5DUXA 5H9PA 4HETA 1DBNA 1XYPA 3FHQA 4IEOA 4YYOA 5BNQA 3T2TA 5I93A 1GQHA 4NIDA 2UY9A 3AMMA 1BKZA 2DUPA 3BOWA 2PHTA 4AXOA 2JENA 3MW2A 2QZ3A 5FXXA 4CSWA 4I01A 1S0IA 1FOD2 1QXRA 5ISLA 4IGPA 4ES9A 1V6NA 1UZ0A 1YQ2A 1CQ9A 2SLIA 4LHKA 5J7MA 5IVVA 1MQTA 2WS92 4CU6A 1EPZA 1JW6A 3OG2A 3SH5A 1EV12 2VMFA 4AVSA 4KH9A 3CZUA 1OFNA 1K42A 3GCWA 2FMYA 2D6KA 2VE1A 4COYA 2RJ2A 4IEXA 5F9TA 4HPKB 1GU3A 2F4PA 4KL1A 1Z0HA 4QX3A 1QU0A 1DQ2A 1FYUA 1F4AA 4OHXA 3O14A 2J1VA 2WC2A 1UZWA 3AP7A 4LLOA 3OPZA 1H4GA 5EYYA 4XIKA 2VUAA 4GWJA 3PUIA 2ZOEB 2HH9A 1S0EA 4ZZ8A 3ZPYA 1ULEA 5IVJA 2DCKA 4AR2A 1W6QB 5BNNB 3V56A 2BQPA 4H2AA 1CONA 2WR9A 4I0WB 2ZX3A 3ZXDA 2P5BA 2R0HA 1WW5A 4A6OA 1HQWA 2OX0A 1OLME 2VNVA 4FPLA 1UMIA 1CIYA 4D3WA 5DZFA 1OMIA 5JIUA 4ZU5A 5HCHA 2IVIB 1N3QA 1FPN1 1GLHA 1PO22 4MGKE 3IAPA 4QXHA 5FYBA 2FBEA 1MEC3 4NWVA 1D7PM 4YG6A 1QWRA 3TNQA 1K45A 1IS6A 4AHWA 4GB31 3MIDA 3KQRA 5AC92 3C7GA 3IKWA 5BNNC 1IG0A 1VE0A 5SV8A 3U78A 3I2FA 2CWSA 3DUIA 1UKRA 2JG9A 4K3UA 4QT6A 2ZZJA 3ZIWA 4QQOA 5L36A 4P14A 3TN92 2WSUA 3EYPA 2A3YA 3T1MA 1RMU2 2XHKA 2D5HA 3WOGA 2Y6HA 4K21A 5T5OA 5GLTA 4DXSA 3U75A 3C2UA 3BU7A 3S7IA 1H30A 5JSRA 4J25A 4HVQA 2JDAA 3GBFA 1LKNA 1GR3A 2VMDA 4BXSV 1RJ7A 1QOSA 2C6SA 2JIGA 4PHZA 1QQP1 1LODA 5FMBA 3T08A 2WQZC 5GLZA 4YM2A 4KWLA 3AX4A 4G4FA 1AZDA 1OA3A 1OD5A 5FDBA 3VZKA 2WO3A 3HOBA 1W3XA 2D7FA 5CVRA 4C8DA 1RHI2 2ZGOA 3KV6A 2Y60A 1S55A 2DWRA 3RVHA 1T6GC 4P9JA 5ACA1 1NYWA 1AR83 2B4KA 3H3ZA 2RS51 5EYXA 4HZFA 1I9RA 5BNPA 3VUOA 3I4IA 2HYKA 3MFCA 2BVVA 3I97A 1FT9A 1COV2 2BOJA 1F8VA 5FYCA 2J42A 1IG3A 3PDQA 5LA2A 1HRV3 4OVEA 1W04A 1ZREA 1BCXA 4LOTA 3AM2A 3JCIA 1DZRA 3T0AA 4PIZA 4AFDA 3BU0A 4BPZA 1DDLA 5K8SA 2TUNA 1F15A 1MS3A 3WEZA 1OA2A 1SQ4A 5FWEA 3LIHA 2A6WA 4ZU7A 3J26N 4H3WA 3FX3A 3ETQA 1W03A 1X8EA 3LFIA 1DQ6A 4Q8KA 2WT0A 5CFCA 1QJU3 1V70A 1EYBA 4LK6A 1GYKA 1BHGA 5EJ1B 4D0QA 1N3OA 5AFBA 2PHUA 1RUC2 1YI7A 4V1PA 2J1EA 2ZAHA 1APNA 3ZN5A 3DGTA 3LAGA 4PLNA 2QQMA 5FY0A 4PLOA 5C3QA 5KXDA 1RUH3 4HXCA 4N7IA 3AYDA 4DXRA 1R1A3 1US3A 4FTSA 5FZ1A 3NJXA 1WKYA 2Z42A 5HV0A 3MYXA 1FI2A 4CP1A 3IAQA 1RVF3 1CPNA 3K46A 4A3XA 4ET7A 5FZGA 5ABJB 1ALYA 1OQ1A 2ZGMA 3VBFB 2B45X 3DXUA 1E57A 1W2UA 1PMHX 2BPA2 4Z82A 3JD73 3R6SA 2JWPA 2QDNA 1GZWB 1AR72 3GZEA 3WDVA 3WP6A 1US2A 2RR12 4H14A 1IS5A 4DZGA 3AKPA 1KQRA 1N1TA 2XXZA 4JTOA 4MXWA 3ACIA 1UY0A 4XBQA 3J7HA 4Q4W3 1OPOA 3ECQA 4RGGA 1F9KA 1FMD1 5IAXA 4QPGB 3VDBA 2DU0A 3WG1A 4RQPC 1W6PA 5HCBA 3ZFEB 2P3KA 5EQUA 5FRAA 4JKKA 4BE3A 1CZVA 3LCPA 4DEQA 1D4M3 3DPRA 4LBKA 5FYMA 4RFT0 4HK8A 3WF4A 4COVA 5CBLA 3ZN6B 1OUXA 3ZYBA 4HKWA 3ZYFA 2JDYA 1KD7A 2FDJA 2F17A 1G9CA 3K48A 4XBLA 1TE1B 1U12A 3LGRA 1MEC1 1OKOA 1MS5A 1S2EA 2OT7A 3PIJA 2WO1A 2IFWA 4LBOA 3WNOA 1ZZ7A 1SLBA 2JE8A 4Q5OA 3SH4A 3OEBA 2PLV3 3U1XA 5FZ3A 2ZX0A 3UNPA 5FP3A 3HT2A 1JZ5A 2D43A 3WDYA 3SKVA 2WDBA 3RYRA 2GMPA 3D6EA 1OFSA 1YJLA 3NV4A 5ANNA 1J3RA 2QKDA 3D3AA 5L9BA 2ZJCA 2VMCA 1PZ9A 4XPVA 4UBGA 2MEV2 1A78A 1LENA 4BCUA 2ILMA 2W9XA 2WYSA 2ZXQA 4QKBA 3VDCA 4XHXA 4Z2WA 2FCUA 3KF5A 4LUMA 5J09A 4CU9A 2E26A 3BN6A 2RV9A 4A42A 4QDRA 1UWWA 3R4SA 1ACCA 1PMIA 4NPLA 1C1FA 5FAXA 4A45A 5IFPA 4COZA 1CAWA 5T5PA 3VBSB 3ZXGA 1C5HA 3BUCA 1UX7A 3AK0A 3GHMA 4AVVA 4QDQA 3SISA 4E4ZA 3ENRA 3MIEA 5LEKA 2FZ2A 1AL23 5LBEA 4NPMA 1I6XA 3CQOA 4AL9A 4YARA 1FPN2 5DDJ1 3B3QE 4XFHA 4E9KA 2HLEA 3KLSA 3POSA 2H0BA 2WNVA 4FSJA 5A1LA 1WBLA 4M4PA 4QQHA 4ZONA 1DGRN 1GNZA 2GC3A 3FWEA 4LHSA 3NKGA 4WZFA 1YHFA 3VB9A 3VBOB 1OQDA 4CDQB 3SKJE 4XF4A 4XDQA 2ZHMA 1V9U3 2D6PA 2R1BA 2XUMA 2X10A 1RUF3 3VBSC 1HRI1 1GWKA 4QHBA 1WW4A 2IXJA 4IEUA 4CEWC 1W8FA 4GJZA 5K0UB 2JE7A 3M7AA 2WZ8A 3AYAA 3CJIB 4FCAA 3THTA 3VKMA 1Z78A 4CCJA 5J48A 2AENA 4OFGA 4R4ZA 5C8CB 2A6ZA 3BB6A 3DYMA 4CUGA 5FKBA 4B1MA 3CU7A 4QU2A 4CDQC 1FATA 2OZ6A 4GKXA 3S5AA 4Q4Y3 4A7KA 3O1OA 1QJU1 1R1ZA 2HWE2 1H8TB 1QQP2 3VN4A 1EUTA 2DVGA 2VVFA 1PNFA 3N9LA 4QX1A 1SMVA 2ZABA 3UK9A 1RJ8A 4KWKA 1WGPA 1SFYA 2XKOA 1VP6A 1ZBE3 3HBZA 5CIRA 4W8JA 1RUH1 4YRDA 5C3PA 5K0UC 5K7PA 4AFBA 5DAVA 4FP2A 4DPNA 1NE6A 5IK4A 3ITQA 1RUJ3 3AKSA 1R1A1 2WWSA 1AR93 3MIGA 5CYYA 5C8CC 1S2KA 2CGNA 1QEXA 4JHTA 3SC7X 4R9CA 1ZVFA 5ACA2 2RS52 3WW4A 1DFQA 3DECA 3WP5A 4IXLA 5IVCA 1MVQA 1H8TC 4RYDA 3Q8CA 4WVMA 4N53B 2XVLA 2FQPA 5LBFA 2IFRA 1A6CA 2XJSA 5APAA 1JI6A 2BEOA 5EJ3A 1KXGA 4R8HA 5HBAA 1VJ2A 2V4VA 3K75B 3FHIB 1STMA 3I3EA 3IM0A 2JDZA 5LCWL 5FQ0A 2HWC3 3D0SA 5JDBA 2X8KA 2UYBA 1W8TA 4AEJA 5FXWA 2YV8A 4Q4W1 5FP7A 1AF9A 1QH6A 2ZGKA 4RR3B 2HWD1 2RDNA 4PI0A 3ZSLA 1OPMA 5IVEA 2XR4A 3SMHA 5FZKA 1NA1B 4FPOB 4IV1A 1ZZ6A 1Y9GA 2D5FA 2Q8CA 2BRTA 1PK6C 3I2KA 1JYNA 2AYHA 1YQCA 3NMBA 1O5LA 3KD4A 3VHOA 2BV4A 4CZSA 1JYTA 3IDEA 4AG4A 4FP3A 4OZOA 2WAOA 1VAMA 1JYIA 3AZZA 3K4DA 3ZKUA 3U11A 1RYYA 3OPTA 1AL0G 4URAA 5BUVA 4CYDA 1RUE3 5FY5A 1C5IA 4RR3C 4GIQA 5DAXA 2Y0OA 3LQCA 4GAZA 5IFTA 3OB8A 4XF1A 1Q3EA 2ARAA 1EAH3 5F3CA 1NAEA 5DAQA 1W8NA 1OT5A 4UWDA 4Y5Z0 2Y64A 5H9QA 3TEWA 4YVSA 4AQSA 3GXUA 4XMAA 4XJ8A 1VRH2 4CCEA 1O8PA 3E5QA 3Q9OA 2WQ8A 3A0NA 2E51A 4P08A 3HT1A 3PVBB 5D1IA 4AVTA 2A75A 1OD3A 3LD8A 5LBBA 4C1XA 3T1LA 2P3JA 3ILRA 2ZX4A 2YC2A 2D6MA 4OMCA 3OGVA 1FMD2 3WDXA 4YFZA 3VZJA 1TNRA 1KRIA 4NRMA 1IS3A 1B35B 2YFUA 4I2OA 5FY9A 4L99A 4FTBA 2OIIA 2RHPA 4L92A 2CAVA 2BGOA 3TBDA 2ZEYA 2VTXA 5F3EA 4Q0VA 2VR4A 2NP0A 3RYKA 4CDWC 1SDWA 5FYYA 4Q0QA 4DMIA 3EHKA 3UGHA 3WF0A 1OI6A 5CISA 3T2OA 2CHHA 1UL9A 4YG3A 4C0HA 4A4AA 4CU8A 5A6QA 5J98B 2XLGA 3A4UA 3J4UH 1VBB3 1B35C 1LAJA 4IESA 1JXNA 3GNEA 1JBCA 2FDIA 3RZZA 5JI9A 1V9U1 2KA3A 3FLRA 1RUF1 1VRBA 2AC1A 3S5QA 1Q8PA 4XFBA 5M0TA 1LGCA 1F35A 2QFEA 2JG8C 5LK5A 3ETPA 3SCHA 3VD7A 2YBSA 3OBZA 5BNOC 2GNMA 4OUMA 3VBUA 2Q1ZB 2BUKA 4HSLA 5I8SA 2HEVF 1LU2A 1R081 4ZXEA 1IOAA 1UY3A 3GBWA 1LHUA 2IUWA 1ULOA 2VQUA 2IXLA 2PTMA 3KVBA 3SXWA 2VG9A 4WZCA 5C8WA 4MADA 4KNCA 1PHMA 1W3VA 2FHRA 2J1SA 4RS5B 4URTA 4Y3OA 1NCQB 1GWMA 3ZYGA 4PDWA 4CXYA 1PIV3 4YSFA 1QMJA 5JVVA 4QXCA 5IJRA 5A80A 2R063 3QCWA 4ZPIA 5JXJA 2QTWB 5DDJ2 5A70A 1LEMA 2VZOA 5EIYB 1UO9A 1RUJ1 1AR91 5C4WA 2EICA 3D8CA 3VD4A 5FMCA 1YQ8A 5EPAA 2FCTA 4LBQB 2W47A 3BTYA 2VZSA 2FMDA 5C5UA 4GH4B 3KHBA 4P00B 1NCQC 3UL2A 1WZXA 3C8XA 5D21A 1HRI2 3WV6A 3NNJA 4AF9A 2O8QA 4QMAA 5L7OA 1O3SA 1MZFA 4Y4YA 4I02A 2QCSB 1HQLA 1ZZ9A 2ETEA 4MGYE 5A7NA 1RIRA 5BXXA 1FXZA 2XL9A 5FBZA 5BYNA 3LOBA 3QLQA 3N7LA 1PNGA 2Q4SA 5FZDA 3ZFFA 4XUNA 3PUAA 3WDTA 5J3UA 3HN3A 4BQWA 1G7YA 2VQTA 4GH4C 5FLIA 1QJU2 2IXIA 5EXOA 1OLRA 1AJOA 1P8JA 1CAVA 4M3CF 3LA7A 4U36A 4QQPA 4UI9L 5JMCA 1DZQA 3OOXA 5JZGA 3I2OA 1Y9MA 1RUH2 5F1RA 4ASLA 2E33A 2V73A 3RMYA 1NCRA 3M3CA 3S0MA 3MDPA 3VZOA 2VECA 5KHGA 4FOVA 5FLJA 3H9AA 1VBA1 2OS2A 2YPJA 3POYA 4WM7C 1RGSA 4XUQA 1LJ7A 1ZNPA 3HQUA 5EFUA 5LA0A 3RI8A 5I8TA 3BCWA 4R52A 4OZXA 3LSEA 4Y1ZA 4HK9A 1WW6A 4A7ZA 2WABA 1K5MB 1YFXA 2AGSA 2JDHA 2QBXA 4AZZA 3NRUA 1C3HA 3WF3A 2QQPA 4AI1A 4WM8B 4GJYA 4Q4W2 1O3QA 2D6OX 1KFXL 1WW7A 3UGFA 2C24A 3J8F3 3WQ1A 1D0GA 2HWD2 2X5IB 4Y22A 5KHIA 2C9KA 4W65A 1CX4A 5FPVA 1N1VA 4COWA 2BJSA 2CAUA 1OVPA 4K1ZA 5DZGA 3KQ4B 5IATA 4HKOA 4XYXA 5JXIA 1JS9A 1QH7A 1UIKA 1IQDC 3FJSA 1K5MC 2CL2A 1MS4A 3KF3A 4QPIA 3M3OA 3N9QA 4YW5A 3T09A 5CEHA 1ND3B 1OLQA 4WM8C 3IPVB 1WCDJ 4JVAA 5F8PA 1NXMA 1YC61 2AEZA 2VNOA 4XC9A 1AX2A 4CP9B 3OJBA 2XOMA 4K1YA 4MX3A 5FZAA 4EYUA 1OQEA 4O65A 1OHFA 5JAXA 2DFCA 3GM8A 2X5IC 3UKTA 4RGKA 4CPBA 4XVHA 2RS13 1HB1A 4F83A 3JB8A 1AXYA 4YGEA 3VBHA 1ZZCA 1U5XA 3J7LA 4YGDA 1LB2A 3FHAA 1UMHA 3DF0A 4ZHNA 5BY5A 4D7YA 2OYZA 4HPKA 1FNYA 3C7HA 4FOWA 4NPRA 1NXD1 1JYXA 5KC5A 1GOHA 3CIHA 4D6QA 1X9PA 3PU8A 1ND3C 3OCPA 3FUOA 2Q8OA 1ODNA 1AUYA 1C28A 3WQBA 2XKPA 4CE8A 3KT1A 3RS6A 2A6VA 2VCCA 2Z4FA 5A3UA 5A1FA 1REDA 2BWCA 2BZDA 5A7WA 1SCRA 5LY2A 2WFF3 1QGLA 4I0BA 5JMOA 1W6QA 3UKNA 4XJUA 4JHZA 2MHFA 5FZ8A 2W87A 2VUCA 2YHJA 3BTAA 4PBOA 1SBDA 2YY1A 4TN7A 4XJWA 1XU1A 3GHNA 4V2WA 4MH0E 1H2LA 1BBT1 3JQWA 1VBE3 4YZ2A 2RDQA 2GALA 4CDUB 3L2HA 3B00A 1XNTA 2R061 4MGTA 3QD6A 4EWAA 3OYWB 4LLFA 4XUTA 3GYDA 3EJKA 3M70A 2ZGRA 4IEVA 4XJAA 5H9RA 2RJLA 5C3OA 5DXDA 2YMZA 1SLLA 1DYKA 4XTPA 5DZEA 2LS6A 4CUBA 4FQ4A 1G9FA 2YGLA 5CAZA 3KS7A 3OEAA 2HWF1 4W6WA 1W99A 1H1AA 4XDPA 4XF0A 1V9U2 3T2QA 1A34A 1RUF2 4GULA 2WSVA 2R071 4CDUC 1CVNA 3H42B 1GQPA 1ZBA2 2BERA 2TEPA 3AL6A 1VBD3 4G3YC 1Q8SA 3E6DA 1WA6X 4XFAA 1JMUB 2O0OA 3UT0A 1R082 3J7MA 4ZKTB 3HQXA 3I2DA 3K4ZA 5I0DA 4XE9A 5LWBA 3V0AA 3S57A 4GALA 3VDDC 2EXIA 3JU9A 5DMYA 4L8QA 1JN2P 1IGOA 1O4YA 4IV3A 3NAPA 5I0UA 2NQYA 2VMEA 5D8AB 4MSVA 4NOTA 3VD3A 3EXUA 2K0GA 2P6CA 3UETA 4AI9A 5IK7A 2YBKA 3FBYA 5C3SA 3ZXFA 1SLAA 2VCMA 1NLRA 4DB5A 1UYZA 5ANQA 2ZTNA 1RUJ2 3THDA 2JEMA 1AR92 3MIHA 4QGLA 4DY3A 1TME3 3P3NA 5FZ7A 3U0ZA 3JBG2 3VL8A 2CV6A 2LUWA 2WNUB 1HB2A 2ZKNA 2DFBA 1XNKA 4LKEA 1RUI3 1DYPA 1CESA 4OI4A 2A73B 5D8AC 2DVBA 3MPBA 3ZMNA 1ASJ1 2F4LA 1Q8VA 4L2NA 1PVC3 2IXKA 2WWJA 3TEZA 2XJVA 3T0DA 2XDVA 3I3BA 3OUJA 4KQ7A 5EZWA 5A1AA 1J1LA 4LULA 4CCLA 1FV3A 2VTXJ 4IEWA 1PM4A 4BYYA 2PMWB 3RSJA 1S0CA 1GZCA 3VD9A 1GOGA 2R32A 4N9HA 1VBC3 2WNUC 5AVPA 3VKLA 5LW9A 5T50A 3PVOA 4JGYB 1YLLA 2UWAA 5G05L 4ARYA 5K9YA 1IPKA 1AYN1 2P1BA 4IGOA 2P37A 2XL7A 5JIAA 4QX2A 3PHMA 2EAKA 4KU7A 2W91A 5FUNA 3IZOA 3U4XA 4MGSA 1XQNA 5E8AA 5CFDB 3OGGA 1D2SA 2PHRA 4LR4A 4RHV3 4TYSA 4RD7A 3HMYA 3ZFGB 3SEEA 1UCXA 3KMHA 3NW4A 2R6QA 4XFIA 1H2MA 2UY8A 3HWJA 3OF1A 4NVPA 1QJY2 4OULA 4QPWA 1VBA2 4BQ5A 4JRAA 1F4HA 4QX7A 3WG4A 5JWPA 2VW2A 2ZAAA 4H7MA 4JGYC 3OSDA 1L7RA 3NNGA 3WNPA 4LEJA 1RUD2 1BK0A 2IWGB 5FP9A 5ABJA 1YIPA 3VBFA 3UESA 1H6YA 1TG7A 4LITA 4LIVA 1YFWA 2HBTA 5CFDC 5FR3A 1OURA 2Y6KA 3GJAA 4JDNA 3ZFGC 2G9FA 4DIQA 2JDUA 4CXXA 4YW4A 2PAEA 4NRQA 4AFAA 5B4XA 4Y20B 2WFPA 2Q8EA 2JE9A 1XPWA 2V4AA 1PVXA 3POWA 4Q2FA 2YDEA 1DQ4A 2QVSB 2CTVA 4PBPA 5GJ6A 1XB9A 1ZRIA 4IE4A 4META 3ZFEA 2ZGQA 1CPMA 5JR2A 4MGZE 4BQXA 2QQLA 4CEYC 5A3OA 2XWJB 1O8SA 1PGW2 1F2NA 2XONA 3OTFA 1J3PA 4ZS2A 5JXGA 2DCYA 4AEKA 4YLZA 2W1UA 2R1DA 3TRSB 2A6YA 4HMZA 3Q8AA 1DYOA 1GANA 2JX9A 2AREA 3VBRB 5CKNA 1Q8OA 3A22A 1VBE1 4RGAA 1CZSA 1UXXX 1NE4A 3E5XA 3ILFA 3WF2A 1YNAA 2PAMA 3LIGA 3VD5A 4GZ9A 2P34A 2JDMA 3W5MA 2ZHKA 5FOBB 2G1MA 2JKBA 1QNWA 4E4SA 2D3PA 1GKBA 4XBNA 1SFPA 4P9LA 3SLIA 1LU1A 1G9AA 4AWDA 3PUSA 2QQIA 4OUSA 5F2WA 1LOEA 3POEA 1IS4A 1GZ9A 2CDOA 2MPFA 2E6VA 2IVJA 1VB2A 1W2NA 1I3HA 3WY6A 1K12A 4DINB 3VBRC 2FDKA 4DRVA 1Y3TA 2ZGPA 4X8PA 2FDGA 3LFMA 5KR7A 3K2OA 1VBD1 3MUY1 4KBZA 4RSUA 1DQ1A 3IMMA 4EN7B 4EN8B 3CDZB 3VKNA 3QOPA 3DKWA 2W68A 1ZRDA 5IK8A 3T0BA 1W8WA 4ITCA 4FOYA 4UFJA 3H1YA 4F3JA 2ZCWA 3RMXA 2YPDA 4OI0A 5C9AA 5FMDA 5C70A 4LUKA 3HD8B 3UJQA 4KI5M 4COUA 1UX6A 2VTFA 1MQTC 2ZHLA 1BBT2 4E8CA 3HBKA 2ORZA 2UWBA 2VXJA 1UPIA 3WW1A 1LOBA 1NG0A 4AOCA 5E16A 4JQTA 1W6NB 3HVDA 4RQPB 1UYPA 1QOTA 1VAVA 4W6YA 1GP4A 4BQ3A 4MO3M 1VPHA 4FPHA 2HWF2 1L7LA 1LOCA 2VC9A 1RUI1 5A3LA 1BYHA 3Q8FA 3ZM8A 1HN1A 3VLBB 1W6OA 2HWB3 2OQ6A 3MUZ1 5EV7A 1DU3D 1OOPA 2R072 4HLTA 1PVC1 2GH2A 2XLFA 5DUVA 3VZNA 2RDRA 2A3XA 2C26A 1XYOA 4YM1A 3LA2A 2PQQA 3CJIA 2JG9B 2Y6JA 3B9CA 1MZ5A 1U5IA 2BVBA 1RUG2 3HPNA 4JGZA 2EAAA 4LHNA 2CGPA 1JTZX 1VBC1 2O14A 1ZRRA 1V6LA 1RC6A 2JDPA 3CBNA 1NT0A 1UF2C 5FZEA 1NQJA 2VMIA 2BFUS 5CNAA 4OI2A 1H6XA 2VULA 3W58A 2PAKA 1UYYA 3ZR5A 4XW3A 4DEVA 3F95A 5A33A 3UYJA 1JZ8A 2J22A 2A71A 4B1LA 5B2GB 1UZVA 3SH3A 3UJOA 4HN0A 4RHV1 3NNFA 2JG9C 4KWUA 4R9AA 1UZZA 5IW0A 3E1F1 4EWDA 3VHPA 3HAGA 4XEZA 2J1AA 3NNLA 4YW6A 3ES1A 3LEMA 2VNGA 2DBIA 3LEGA 2OW4A 5AVAA 3RZKA 1CAUA 1CAXA 1WMXA 2YBPA 2XVKA 1I5PA 3DN7A 5T54A 2AR6A 1W39A 5FYUA 1T2XA 2DCJA 1ASJ2 3BIWE 3DCQA 4GQ7A 2XLAA 2RM23 4QXKA 1Z7S3 3WG3A 3OUHA 2DCTA 4LJHA 4OI1A 2KM2A 5BNPB 3RPQA 3OY8B 4Q0SA 4HOOA 5K4LA 2A6XA 3P3PA 3RZLA 1J84A 3POIA 4GMP0 3DKQA 4UW5A 4AEMA 4O9EA 1S0GA 3IMNA 3NJYA 4X8NA 3KGLA 4LBJA 3VGIA 1AYN2 2CSGA 3GBGA 5KC6A 1REEA 4IEYA 4PF5A 4LE4A 2HBUA 1MZ6A 4CEWB 1Y43B 1DCSA 2GNDA 3U10A 4M00A 5T5LA 4NIAA 3RQ0A 1V6MA 3V0BA 5F6KA 3NO8A 4QGNA 1FAYA 1UU4A 2B42B 3A23A 5BNPC 4FPJA 3UGGA 4O61A 4NIIA 1TZOA 4FPGA 4Y24A 4GB32 2HKXA 3RJ2X 2PHDA 1AR81 1KS4A 4M3CA 3N9MA 4NHMA 4BHPA 3GCXA 5FY7A 4FI9A 3O1TA 4D6SA 4XQ4A 3PTRB 4YZ1A 3GJBA 5DAWA 1MPXA 1HW5A 2K2SA 3AL5A 1QHDA 1HRV1 3O1VA 1AR63 2LROA 2R043 3MV01 2BWAA 2VBDA 1DQ5A 1LNSA 1X7NA 1DF0A 1YQ6A 4AGRA 1SEFA 2B8MA 3HNYM 1LECA 2H0VA 3WR0A 5CFCC 4S2HA 4KG0A 4ISRA 4LK7A 1WA4A 4JZRA 1X9TA 2QZ2A 1DGWX 4UF0A 2VOTA 4Y1UA 1R093 2GDFA 5FPBA 4GKYA 2TNFA 4YW7A 4LO4B 4XETA 5FYIA 4DXTA 4ES8A 2VY0A 4IE7A 3H8OA 1LHOA 2PELA 1VLNA 2J1RA 1E5SA 2RG4A 2VCAA 3PMSA 4XZUG 5SV5A 5FP4A 4D6RA 4YZ5A 1BEV3 5JXHA 1NZCA 1QJX3 1KEXA 4MXWB 5FZMA 5HV4A 4FT8A 4YW2A 1C1LA 2VH9A 3WG2A 2W2IA 1LRHA 2ZEWA 1DIWA 4AYUA 2D6LX 1W6PB 4XIOA 2FDHA 4YW3A 2YC0A 4YVWA 4NJ4A 4BISA 4NHXA 3W20A 5IVYA 5JPMB 1XU2A 4IEQA 5A6ZA 2DDUA 3VHNA 1RVF1 4QB6A 4QWNA 4K8FA 4LA3A 4AQTA 3BYWA 5GLWA 1PZ7A 1CX1A 5FOJB 2VBBA 4LPLA 3AZYA 3HIFA 1UY1A 3O12A 5GZEA 3JD71 4MGIE 4UW6A 1PK6B 1WCKA 2W94A 5L73A 2LALA 2Q1FA 4EWEA 1BQPA 2B39A 3I59B 4Q4X3 2VQAA 3AFGA 2SBAA 1DLCA 2HWB1 4V2VA 4LBLA 5GLVA 2VL4A 4QPYA 2WS93 2P4EA 3H7JA 4U2AA 2XG3A 1EV13 3RI9A 1YFYA 2V72A 4AEDA 4CDXA 1VBD2 5HI0A 5HXVA 1F5JA 1NKGA 3K3OA 5F5QA 3MICA 2P2KA 4CXWA 3MI8A 3DPRC 2VGDA 4XUOA 3I2HA 3VV1A 4Q0PA 1IPJA 2JD9A 1UY2A 5KXBA 2ET7A 3OUIA 1OXCA 3M8LA 4DO0A 1D4M1 2VOXA 3N3HA 4H55A 1XE0A 4QHOA 3NQHA 2WWUA 2MNGA 3ES4A 4JX0A 4UFHA 1LOFA 4BZ4A 5KHHA 2VZRA 4AK3A 3LPFA 1NZIA 3ME2A 2W95A 3HR9A 3ZXEA 1YUDA 2WN2A 2VQ0A 2CNAA 5T55A 2QJVA 2VXRA 1LHVA 2ZPXA 3ROUA 4MXVA 4GMP3 3C7OA 1CAWB 3KVAA 3WSOA 4XZPA 5JOZA 2WNEA 1UU5A 2PLV1 3R05A 3ABZA 2Q30A 4Q26A 5JSPA 4LBQA 3I3MA 3VKFC 4UYBA 3S7EA 3O1PA 4N90A 4NRPA 2WLPA 3NV2A 4E2GA 4XTMA 4CDWB 4Z07A 2WNVB 4HL0A 2RJKA 5FZ0A 1OSGA 5IAVA 2RM21 4D7SA 1V6JA 1NY71 1YI9A 1NQDA 4PT6A 1S4CA 2EA7A 1VB4A 2YG0A 4GWMA 3GZUC 1O3TA 4WVWA 3AKRA 3ZX7A 1W8ZA 1RMU3 3WP4A 1VBC2 2D3SA 3RG0A 2ES3A 3SHRA 3GDBA 4RL7A 2I2SA 4AQ2A 4KMQA 4IE6A 4WV8A 3NJVA 1LEDA 4AI0A 1O4ZA 5C71A 1IKPA 2JG8B 2WNVC 1AL21 4FPEA 5BNOB 2BFUL 4H7LA 4PIYA 1KJLA 2BNOA 3H7YA 1MEC2 1X33A 3TEXA 3MF9A 4E2SA 2J7MA 2YFZA 3THPA 1E5IA 1PX3A 1UNBA 1X82A 1YO8A 5DUWA 4LQRA 2VW0A 3LDKA 2DVFA 1HQNA 2Z69A 1SPPA 5FYTA 4DQAA 3CMGA 1IKQA 3Q8BA 1UOJA 1RITA 3USUB 2AZ5A 3D4KA 3ASIA 1RHI3 4UFKA 1H0BA 2PN5A 1BLZA 3WNMA 1AXKA 5CADA 3L9JT 1H4HA 4ASMB 2XJUA 1W06A 5FKCA 2NLRA 2E7AA 4FXGB 3RGBA 2XHNA 1O7FA 4JAAA 3T2PA 1PGSA 3OD0A 1QDCA 3K4AA 5JOWA 1YWKA 2WZR3 4ONUA 3VL9A 1C4RA 1SBFA 4Q4Y1 4BU2A 4E2QA 4A6SA 3OBTA 4CP2A 3WT3A 1AX1A 4S2FA 3T4VA 3ZSEA 5FQ0B 3MLKA 2W1SA 4MHUA 4YFWA 1BEV1 5FZ4A 2W1QA 1ZA4A 1ZBE1 2WO7A 2GMMA 4Y4RA 2Y8KA 5LRRA 1AYM3 3BVCA 3S6PA 5FV3A 4AAPA 4HONA 4IE5A 2WQ4A 1QXJA 3AP4A 5LRSA 1JUIA 5C5TA 1CJPA 4B8EA 2JB4A 2Z79A 4NUBA 4DRRA 1AR82 4E4HA 2VBPA 1PO13 5A6YA 3M4FA 2P17A 4IV1B 2Y26A 1W90A 4DS0A 4N43A 2YYOA 4XUPA 3PNAA 5F5AA 1GNYA 1ULFA 2ADEA 2JECA 1HRV2 5BV6A 3FL7A 3AP5A 1LHWA 2I74A 5FBJA 3KSCA 2ZGNA 4DUXA 4LHLA 4Q4X1 4XFCA 3ZDSA 2HEYF 2D97A 1OVSA 2HWC1 2W1WA 3AB0A 4LNVA 2J1TA 2CYFA 3B5LB 3R4UA 5F3IA 3AKTA 1EV11 3KT7A 4WM7B 1Q5OA 3ZYRA 1WMDA 4Q1RA 4TLFA 4IV1C 3ZOIA 1HB4A 1IPSA 4XQDA 2JB8A 1JOBA 3H50A 4YVSB 2EXKA 2RR13 3AC0A 5GM0A 3T4HB 5FY8A 3RWNA 4OYUA 1BMV1 5DQ0A 5CZKA 3NWKA 4O7XA 2ZKLA 3M2MA 3WW2A 3ACLA 4M01A 2PHXA 1BVP1 1JOJA 1ZA7A 2XB6C 4J1WA 4P9YA 3WNKA 1R1A2 1QJZA 4DXZA 4BMEA 3P5BA 2XJTA 4EROA 4DFSA 2WLQA 2XBO3 2EIBA 4AW7A 1RUE1 4WVZA 3OYWA 4CRQA 1ND2A 1Q43A 1SACA 1RVF2 1S0FA 3N35A 2X29A 1BJQA 1EY2A 1MVEA 2QQOA 3AFKA 3NL1A 4M4RA 4CVUA 3WQ0A 4YVSC 4CA9A 2OXBA 4C91A 1EAH1 1U5ZA 2B7YA 3IN9A 4QAWA 4RA0A 3V65A 3WX5A 4BH9A 4CP0A 3POBA 3JD72 5J1XA 1HIXA 3AMNA 1UMZA 3MW4A 3ZVXA 3WHTA 3B9IA 2H6BA 3GZTB 3ZO0B 2AACA 2VMGA 4M0NA 2R0FA 4BOWA 2GH8A 5A6XA 1WLCA 4BQ1A 4B4RA 2W52A 3J7NA 3QACA 4XAEA 1RMU1 1SHWB 4HG6B 4MG2A 1M4WA 1OF3A 3ZMOA 2FZ1A 2Z2SB 2WNOA 1D4M2 2AEYA 2MEV3 3VBUB 4HSJA 2VAUA 4IEPA 1QNYA 4OCTA 2LW8A 3C7FA 3ACGA 1DP0A 4JRLA 2KXLA 2WAAA 3RWKX 1XC6A 4UFIA 2A3WA 2EF6A 4NO4A 3WDUA 4CCMA 2ZS6B 4A41A 1U5YA 4XABA 2BGCA 2CWMA 4IUGA 4L97A 3A21A 4PDWB 2JIJA 4BDVB 1VBB1 3MLLA 2PLV2 4OMDA 3HQRA 2XJPA 1H2NA 3W59A 3MEPA 4R9DA 3WDWA 4QKDA 5GZDA 1B09A 1HB3A 3AZXA 5FZOB 1FPN3 2VVDA 3I8TA 3BI3A 4CCKA 5A7PA 3VBUC 3O0XA 1JU4A 2ENRA 2OVUA 1RHI1 5A3MA 5A3NA 5C4WB 5BPXA 4Y5SA 3USSA 1ONAA 1NY72 5LA9A 4K20A 3H1WA 1DGLA 2OPWA 1G6NA 2ARBA 3PIGA 4LXLA 3JXSA 3BODA 2X05A 3I3DA 4UBHA 5FWJA 1GWLA 4PDWC 2UWCA 3THCA 4OQ8A 1MS0A 1UZYA 3LDBA 2WZR1 5BNNA 4AVCA 3IIAA 2EIEA 5L7OB 2W3JA 3K3NA 1V0AA 1W2AX 4F8AA 1R64A 1PIV1 2WT1A 5DG1A 4Z8BA 3ZXAC 2Y6FA 3EO6A 1O5UA 3H8UA 1H8VA 3KT4A 4IERA 4P9XA 4CPBD 1AL22 5C4WC 1RB8G 5F5CA 4NAMA 2XPJA 5FJHA 3ZFFB 1C8NA 1AYM1 1JH5A 1RINA 2V5YA 3CL1A 3TB0A 2E63A 2VD7A 1LOGA 2NYYA 3LSDA 3LWCA 1W9WA 3NV3A 4E8DA 2HWE3 2VZ3A 4NWWA 3HNBM 3VDDB 2OA2A 4WVVA 5JPNB 5CA6A 4YM0A 1PO11 1W28A 4TLGA 2WT2A 4KGGA 3VDAA 1JZ7A 4I0AA 5L7OC 1G9BA 4TXWA 5EP9A 1NLSA 2B9VA 2VZ1A 2Y34A 2D98A 3B93A 2D6NA 2ZGUA 4FPYA 4HVRA 1AXZA 1AX0A 4K8RB 4ZY9A 3TAYA 1Q8QA 3WXPA 2ERFA 3G6JB 5GZCA 4FQZA 5ACA3 1HXS3 3M3EA 4Q1PA 4IE0A 3VZLA 3N9PA 1W9TA 1T6BX 2RS53 3ZFFC 4LBMA 1DHKB 4AAXA 1RUNA 1CZTA 2UURA 4MYEA 1XNAA 1JHJA 1W8UA 2QNKA 3OGSA 4Y20A 4E27A 5LA1A 2DV9A 2G9GA 1TMF3 1UQXA 5FP8A 3X29B 3TEYA 3ZYHA 4Q4Y2 4CCNA 1ZRCA 2VZUA 2JDKA 5JZGC 1BZWA 3B7MA 5FO8B 4QU1A 3GGLA 3R4DB 5IVFA 1E5RA 1NCRC 2DTWA 4Q0UA 3WUCA 1URXA 4EV0A 1ZBE2 4YWAA 4P9WA 2WO2A 3ZKYA 3WP3A 2QQUA 3N9OA 5A3PA 1LULA 4PQ9A 1HLCA 4NHLA 1X50A 1VIWB 4JV4A 2EVXA 3TOJA 3ZXLA 1XYNA 3OGJA 4GD4A 2L9LA 4WBBA 3DEMA 4LTAA 2GNBA 2XBO1 5J96B 2VJXA 2QE3A 3TYJA 4K40A 1J1TA 2JXAA 4QKFA 1V6KA 4QPIB 4QM8A 3WF1A 2NMNA 4FFFA 2GMEA 3CNAA 5E1RA 1W9YA 3PL0A 3FMGA 4IDZA 5FXZA 3SQOA 3LZZA 4AI8A 5FZ9A 3OBRA 4Q4X2 1HJFA 2XWBB 4PJYA 2HWC2 4FPKA 4B4PA 4EZHA 2VCBA 4KBBA 5FREA 3U37A 2LRPA 5AFEA 3POFA 5J36A 3C3VA 1H9PA 3VBHB 3H8XA 5A32B 3J8F1 3AJYA 2K9ZA 4DUVA 2WN3A 4ISQA 4NROA 4QPIC 1H1MA 1NUKA 1RL3A 2Q1MA 4ASKA 2E7QA 1VRH3 1YCIA 2E9QA 4ORFA 4Y1VA 4OQ9A 2W08A 4ATFA 4HT1T 1NOVA 1BMV2 4YZ4A 1H2KA 4Z1VA 2MEV1 2VU9A 4BIOA 4P02B 1FMD3 1MACA 4P5YA 5IWFA 4QQLA 5LK7B 4MGQA 1O59A 5A7WB 1WCUA 2CDPA 5F6LB 4PIXA 5KBFA 3I2JA 3FUQA 4DOUA 5FFOC 2BOIA 3VBHC 4NIGA 1RUE2 4IGQA 1W05A 5FIXA 1W6NA 4M0HA 2J1UA 2ZMLA 4QD2A 4RQPA 3W21A 1SDDB 1CWPA 3EQEA 5H9SA 5E88A 3DV8A 4GWIA 4Q8LA 1YXWA 4LORA 3IWZA 2RS11 2PQSA 3VKOA 1EAH2 4AGGA 4CEYB 1WCSA 3URFA 5T52A 1KDKA 2FD8A 1TVGA 5G04L 1GZWA 3RZGA 1W8HA 5FUIA 3MLJA 1F31A 5LB6A 1E5HA 5CB7A 1OLMA 3AMPA 4FO9A 4YNIA 2RMU3 1AJKA 3WUDA 1MS9A 5JOXA 3LKJA 2E7TA 2IXHA 1JHNA 2VUDA 1WD4A 4QPGA 1O4TA 3V64A 1W2TA 2UU8A 1TNFA 1WUVA 2WFF1 1KFUL 3H3LA 3PVNA 5FZIA 4EN9B 1UAIA 4AE2A 4FPCA 4XF3A 3MPPG 4RFRB 2E31A 1X8MA 2WL1A 3HJRA 4JDOA 4L0PA 5HCAA 2D40A 3ZN6A 1UOBA 5CU1A 1W6MB 3V0AB 3E97A 4JC1A 2PXJA 4YW1A 4IV3B 4O9GA 3NAPB 2GN7A 4BA6A 2R49A 2D3RA 2HWE1 4ARXA 5FK7A 1WMEA 2YU1A 4S2DA 1VBB2 3PMEA 4MLOA 5FZ6A 3JUUA 2RS33 1QDOA 2W0XA 3CHXA 3MW3A 3NJZA 3NSTA 3H3UA 2JJ6A 4LKSA 5JOYA 1GV9A 1OBNA 5GLUA 4JKMA 1D0HA 1YRZA 5DDJ3 4B7KA 4D7TA 1MQTB 2X09A 3I3QA 1HX6A 1HXS1 1OH3A 1N1SA 2ZX1A 3A0KA 1AHSA 3R0RA 4K7JA 5KHKA 1K3IA 4IV3C 3OY8A 3NAPC 2DUOA 2ET1A 1XSRA 5A3TA 3OGRA 2E53A 1LGBA 3KM5A 5I0TA 5FXVA 4YGBA 3U4SA 1HDKA 1TMF1 1HRI3 2WZR2 2ZGLA 3I7DA 4P9IA 5HXMA 2Y6LA 2I07B 3VBSA 5L9RA 1LR5A 3O1SA 2GC2A 2OUJA 1PIV2 1J83A 4NHKA 1FX5A 3HN1A 5KXCA 1V6OA 4XOGA 4JTNA 4P9GA 4CEWA 1PGL1 4HN1A 5JCTA 2R062 4MUVA 3FN9A 2BP6A 5E6HA 3QH6A 1WLTA 2VUJA 1AYM2 3AP6A 3TNPB 1SLCA 1VAKA 1OKQA 2DVAA 3CKHA 3LPGA 5FYSA 4Z92B 2EIGA 4TWTA 2DCZA 3OPWA 1TME1 4FBFA 3RZMA 2R16A 1CD3G 1QF3A 2F6BA 1XRUA 1PO12 1X36A 4CUAA 1JZ3A 4CDQA 5GALA 3VBOA 2QQJA 1JYVA 5FK8A 2TBVA 2JDNA 1UKGA 3M3IA 2Y38A 3IBMA 4A3ZA 4KG8A 2GNTA 2JICA 3QH7A 3ALQA 5K0UA 4Y26A 4EE2A 5IUQA 2ZHNA 1TQ5A 1XNCA 4GXLA 5CG9A 1YYNA 1PMJX 3AXDA 4P5HA 2BU9A 2ZACA 1QIQA 5C8CA 5IK5A 5JUVA 5FCCA 4NR1A 5FY1A 4Q27A 4XFGA 3TWIA 3AYEA 3I49A 3IB3A 1H8TA 4XCBA 4GWNA 5C3RA 4J6GA 1VRH1 2Y6GA 3B01A 5LASA 3ZXJA 1UW8A 3NV1A 3O5SA 4LE3A 2GP3A 2NZ9A 4BJ0A 4XAAA 3LEIA 4W6XA 1UPSA 5FMOL 4BQ4A 3ELNA 3B94A 4X6RB 2ADDA 3FE5A 4LO8A 4XJZA
chains in the Genus database with same CATH topology
5FZLA 5FYYA 5FZ1A 4AI9A 3N9NA 3PUSA 5F2WA 4XDOA 4LIUA 4CCJA 2YBKA 3ZLIA 5IVJA 5FY8A 3KV4A 5FZIA 4BXFA 4CUGA 4GJYA 5FZGA 5FJKA 5ANQA 5F39A 3AVSA 5KR7A 3DXUA 5FZ0A 2P5BA 3K2OA 3PUQA 5FZ7A 5FPLA 2OX0A 3N9PA 3N9MA 3N9LA 5FY7A 5FPVA 2Q8DA 5FZOA 1VRBA 5FYBA 4D6SA 4QXHA 3PTRB 5A7QA 2PXJA 2YPDA 2XXZA 5A7OA 2GP5A 5FP8A 3AL5A 3N9QA 2WWJA 2YBSA 2XDVA 4CCNA 2YU1A 5FZ6A 3KV5A 5CEHA 4CCLA 2XMLA 4QU1A 5F2SA 3U78A 5IVFA 5FPAA 5FZAA 4EYUA 3NJYA 4Y33A 5IVCA 3KVBA 3KV9A 5LW9A 5FUPA 5F32A 5FYVA 5FYMA 5A3PA 3N9OA 4UF0A 5FPBA 4Y3OA 4IGOA 4GD4A 5IVBA 5FYIA 5FUNA 5FZHA 2OQ7A 4QXCA 4D6RA 5A80A 5A3TA 5FP4A 2OT7A 3U4SA 5FYTA 3PURA 5FXVA 3AVRA 5FZMA 5A3WA 4D6QA 2OQ6A 3PU8A 5FXWA 5FP7A 5FY4A 5FZCA 2W2IA 5FPUA 5FZ3A 4BISA 5FP3A 5FXZA 5IVEA 4QX7A 4QX8A 3ZPOA 5A1FA 5FZKA 5IVYA 5FZ9A 2YU2A 5A7WA 5LY2A 4EZ4A 4CCMA 5F3GA 5FYHA 4EZHA 4QWNA 5E6HA 2Q8CA 5FZ8A 5FP9A 4UF0B 5FZEA 5FYSA 4C8DA 4TN7A 4BU2A 3KV6A 3OPWA 4LITA 4LIVA 3RVHA 4V2WA 5A7NA 4ASKA 3UYJA 5FZFA 4DIQA 3OPTA 4URAA 5FZOB 5FZ4A 5A7SA 4CCKA 4V2VA 5FY5A 5A7PA 4QXBA 5FZDA 4Y4RA 2Q8EA 4GAZA 5F5IA 5FYCA 5LY1A 3PDQA 3PUAA 5A3NA 4AAPA 5FV3A 5IW0A 4CCOA 5F3CA 4HONA 5FXXA 4CSWA 5IWFA 3K3OA 4NUBA 5A7WB 4E4HA 2XUEA 4LXLA 4XDPA 5ISLA 4IGPA 5FWJA 5F37A 4IGQA 5F5AA 2YBPA 5FWEA 5FZBA 3LDBA 3PU3A 5IVVA 4DO0A 5FY1A 5FYUA 3LD8A 3AL6A 2WWUA 3DXTA 3K3NA 5A1LA 5FBJA 2OS2A 5FYZA 4HOOA 5K4LA 5F5CA 5LWBA 2GP3A 5FJHA 5F3IA 5FY9A 5FY0A 3KVAA 2VD7A 5F3EA 4GJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZL A;  5FYY A;  5FZ1 A;  4AI9 A;  3N9N A;  3PUS A;  5F2W A;  4XDO A;  4LIU A;  4CCJ A;  2YBK A;  3ZLI A;  5IVJ A;  5FY8 A;  3KV4 A;  5FZI A;  4BXF A;  4CUG A;  4GJY A;  5FZG A;  5FJK A;  5ANQ A;  5F39 A;  3AVS A;  5KR7 A;  3DXU A;  5FZ0 A;  2P5B A;  3K2O A;  3PUQ A;  5FZ7 A;  5FPL A;  2OX0 A;  3N9P A;  3N9M A;  3N9L A;  5FY7 A;  5FPV A;  2Q8D A;  5FZO A;  1VRB A;  5FYB A;  4D6S A;  4QXH A;  3PTR B;  5A7Q A;  2PXJ A;  2YPD A;  2XXZ A;  5A7O A;  2GP5 A;  5FP8 A;  3AL5 A;  3N9Q A;  2WWJ A;  2YBS A;  2XDV A;  4CCN A;  2YU1 A;  5FZ6 A;  3KV5 A;  5CEH A;  4CCL A;  2XML A;  4QU1 A;  5F2S A;  3U78 A;  5IVF A;  5FPA A;  5FZA A;  4EYU A;  3NJY A;  4Y33 A;  5IVC A;  3KVB A;  3KV9 A;  5LW9 A;  5FUP A;  5F32 A;  5FYV A;  5FYM A;  5A3P A;  3N9O A;  4UF0 A;  5FPB A;  4Y3O A;  4IGO A;  4GD4 A;  5IVB A;  5FYI A;  5FUN A;  5FZH A;  2OQ7 A;  4QXC A;  4D6R A;  5A80 A;  5A3T A;  5FP4 A;  2OT7 A;  3U4S A;  5FYT A;  3PUR A;  5FXV A;  3AVR A;  5FZM A;  5A3W A;  4D6Q A;  2OQ6 A;  3PU8 A;  5FXW A;  5FP7 A;  5FY4 A;  5FZC A;  2W2I A;  5FPU A;  5FZ3 A;  4BIS A;  5FP3 A;  5FXZ A;  5IVE A;  4QX7 A;  4QX8 A;  3ZPO A;  5A1F A;  5FZK A;  5IVY A;  5FZ9 A;  2YU2 A;  5A7W A;  5LY2 A;  4EZ4 A;  4CCM A;  5F3G A;  5FYH A;  4EZH A;  4QWN A;  5E6H A;  2Q8C A;  5FZ8 A;  5FP9 A;  4UF0 B;  5FZE A;  5FYS A;  4C8D A;  4TN7 A;  4BU2 A;  3KV6 A;  3OPW A;  4LIT A;  4LIV A;  3RVH A;  4V2W A;  5A7N A;  4ASK A;  3UYJ A;  5FZF A;  4DIQ A;  3OPT A;  4URA A;  5FZO B;  5FZ4 A;  5A7S A;  4CCK A;  4V2V A;  5FY5 A;  5A7P A;  4QXB A;  5FZD A;  4Y4R A;  2Q8E A;  4GAZ A;  5F5I A;  5FYC A;  5LY1 A;  3PDQ A;  3PUA A;  5A3N A;  4AAP A;  5FV3 A;  5IW0 A;  4CCO A;  5F3C A;  4HON A;  5FXX A;  4CSW A;  5IWF A;  3K3O A;  4NUB A;  5A7W B;  4E4H A;  2XUE A;  4LXL A;  4XDP A;  5ISL A;  4IGP A;  5FWJ A;  5F37 A;  4IGQ A;  5F5A A;  2YBP A;  5FWE A;  5FZB A;  3LDB A;  3PU3 A;  5IVV A;  4DO0 A;  5FY1 A;  5FYU A;  3LD8 A;  3AL6 A;  2WWU A;  3DXT A;  3K3N A;  5A1L A;  5FBJ A;  2OS2 A;  5FYZ A;  4HOO A;  5K4L A;  5F5C A;  5LWB A;  2GP3 A;  5FJH A;  5F3I A;  5FY9 A;  5FY0 A;  3KVA A;  2VD7 A;  5F3E A;  4GJZ A; 
#chains in the Genus database with same CATH topology
 5E89 A;  2HWD 3;  4NHY A;  3BTX A;  1L3J A;  2AUY A;  5ABJ C;  1KGY A;  4Q4V 3;  3CO2 A;  3VBF C;  3ZLI A;  2XBO 2;  1GIC A;  3RYP A;  3VHR A;  1O6U A;  1NX9 A;  4LKF A;  4UXA A;  1PZ8 A;  5LAT A;  1F5F A;  2DF7 A;  2ZBJ A;  4R9B A;  1JU3 A;  3HEI A;  1IQA A;  1DGW A;  1Q56 A;  4FOQ A;  5FJK A;  3H8R A;  1C8M 3;  1S0J A;  2RE9 A;  4N53 A;  3I2I A;  2OZJ A;  2W92 A;  1PK6 A;  3BOP A;  3W5N A;  3EBR A;  3H0O A;  2WUH A;  3I59 A;  4OHZ A;  1LCL A;  3AKQ A;  3HNM A;  3PVE A;  4QPG C;  4UAP A;  3M1H A;  2WIN B;  2ZGT A;  3ZFE C;  2WYF A;  4N8M A;  2PHF A;  4HBN A;  2Z5W A;  3LB9 A;  1QY4 A;  2RMU 1;  2VO5 A;  2XQX A;  2K46 A;  4G9S B;  5B4N A;  3NVC A;  3RZJ A;  2GZW A;  3SIT A;  2HEW F;  1CGP A;  3J8F 2;  3ZR6 A;  4KGQ A;  1JYW A;  4RR3 A;  4QGM A;  3O1R A;  1JUH A;  1ULP A;  1XBF A;  5F2S A;  1SLI A;  4CU7 A;  3N7M A;  4B4Q A;  1HJG A;  1UOF A;  5L19 A;  4W50 A;  3N7K A;  2ARC A;  4M3C E;  1NA1 A;  3KV9 A;  3WNN A;  4I3G A;  5F32 A;  2C1F A;  2D93 A;  2GU9 A;  2PA7 A;  1S0B A;  4JDM A;  2VZP A;  4LO6 B;  5CFC B;  5FO7 B;  3KHC A;  2RDS A;  4AQ6 A;  5T5J A;  2OQ7 A;  3FFQ A;  3ON7 A;  2ZEZ A;  2BBA A;  1QOO A;  3FZ3 A;  4AI3 A;  1PM7 A;  1SZB A;  3PUR A;  2OKX A;  1LHN A;  1JOD A;  5A3W A;  4FFG A;  5C9A B;  1C57 A;  1DLL A;  3AJZ A;  3ZN4 A;  1O3R A;  2G9Z A;  5FZC A;  3MGU A;  2RS1 2;  2IC1 A;  2W5F A;  5ERL A;  2XQR A;  2VZT A;  2RS3 1;  1CJD A;  2RVA A;  3WCS A;  4QX8 A;  3AXE A;  2QDR A;  4UFL A;  4EZ4 A;  3MF6 A;  4CDW A;  1ENX A;  1OH4 A;  3PTY A;  1XE7 A;  4XHB A;  4QKN A;  1WCQ A;  1ODM A;  3POG A;  3GAL A;  1VMH A;  2NPI A;  1SCS A;  1POV 0;  4A2U A;  4BWO A;  1QJF A;  5C9A C;  1OC1 A;  1UYX A;  4B7E A;  3N36 A;  5FZF A;  2VM9 A;  4XXA A;  4CCD A;  3WNL A;  5A7S A;  2WFF 2;  1QXP A;  1W6O B;  1B35 A;  2VMH A;  1OOP B;  4FAH A;  1UIJ A;  3I2G A;  1LES A;  1N3P A;  3LA3 A;  4CCO A;  1ZBA 3;  2E32 A;  1KS5 A;  1GUI A;  2O8O A;  5DG2 A;  5GKA C;  4UW4 A;  2GC0 A;  1R08 3;  3MFA A;  1N1Y A;  1VBE 2;  2BDR A;  2DYC A;  2JG8 A;  2XUE A;  3SNM A;  4B3N A;  4JGZ B;  4LBN A;  2Q5T A;  4MHR A;  5BNO A;  3J9S A;  4PI2 A;  2WZE A;  4AFC A;  3PU3 A;  2YC4 A;  1JYC A;  5EJZ B;  3O0V A;  3VBO C;  3DPR B;  1V00 A;  2EXJ A;  3IDA A;  4CUC A;  1VAL A;  5GZF A;  4LT5 A;  3DXT A;  5C33 A;  2B5H A;  3AMQ A;  2KR2 A;  5EHD A;  1TEI A;  4BQY A;  5A33 B;  2DUR A;  1CR7 A;  1OOP C;  2VW1 A;  1W0O A;  2C4X A;  1FOD 3;  3ILN A;  2BW8 A;  3ZSJ A;  3RNS A;  4A44 A;  4TTG A;  3CJI C;  1O91 A;  3USU A;  3WLU A;  2YB7 A;  1ENS A;  4GA9 A;  2P3I A;  1IZ3 A;  3UKV A;  4NAO A;  3P6B A;  4JGZ C;  3JBG 3;  1MZE A;  4D8M A;  1HXS 2;  4HKL A;  2Y0I A;  2CGO A;  2VZQ A;  3CF6 E;  5DN2 A;  3ZSM A;  1GMM A;  4LIU A;  1WLD A;  1CAU B;  1ULC A;  1CAX B;  4A7Y A;  3KV4 A;  1XOY A;  4FFH A;  3B69 A;  2NN8 A;  1TMF 2;  1ZX5 A;  3BIE A;  1EPW A;  4RS5 A;  1NCQ A;  3A7Q A;  2ORX A;  4YZ3 A;  3RRD A;  4BLI A;  3LDR A;  2A7A A;  1PGL 2;  3FLT A;  2GAU A;  5A7Q A;  1YEW A;  1GFF 2;  3N7J A;  4LO7 A;  3KWV A;  3WVJ A;  4F7Z A;  2DVD A;  1JOP A;  4XUR A;  5FPX A;  3KCY A;  4Y5T A;  1S2B A;  3SCF A;  1TME 2;  4R4X A;  1LGN A;  4XQW A;  4Q4V 1;  3E6C C;  1H9W A;  4N53 C;  3NKT A;  2CU5 A;  1RUO A;  4PQQ A;  1GZT A;  1RUI 2;  3T30 A;  1PO2 3;  4GH4 A;  3V0B B;  3FC0 A;  4QX0 A;  3RFR A;  2GC1 A;  4AVB A;  1W0P A;  1C8M 1;  5FUP A;  1VMJ A;  5IHR A;  2R30 A;  2YZ4 A;  4UT5 A;  1GOF A;  1W8O A;  1PVC 2;  1Z7S 1;  2VOW A;  1QJY 3;  4M3C B;  4L9B A;  5AC9 3;  1VBA 3;  1W0N A;  1BXH A;  1W2O A;  5FZH A;  4SLI A;  1V6I A;  3ACH A;  4LO5 B;  3TN9 3;  1XSQ A;  3KCX A;  2LTN A;  1RUD 3;  3U14 A;  1GQG A;  2DU1 A;  4HVO A;  4WM7 A;  4FFI A;  3C7E A;  3B02 A;  5FY4 A;  3JZV A;  1NA1 C;  1REF A;  1UN1 A;  3MV1 1;  1G9D A;  4XXP A;  5CKQ A;  2PYT A;  3OBA A;  4HAN A;  3S30 A;  1SG3 A;  2I45 A;  1HV1 A;  2QQV A;  3DL3 A;  4LBQ D;  4AGV A;  3WW3 A;  3PUH A;  2UYA A;  5FO9 B;  4RHV 2;  3APB A;  4UF0 B;  4XAC A;  1DGR A;  4I30 A;  1L7Q A;  2OUH A;  4Q29 A;  1CIW A;  1FNZ A;  2DTY A;  1POV 3;  1GP6 A;  4OHV A;  3MIF A;  4AVA A;  4UOJ A;  3PJY A;  1XNB A;  3SEP A;  4C0B A;  4AI2 A;  3O1M A;  1RTV A;  4FTE A;  2ZA9 A;  2DUQ A;  3NNM A;  3PJQ A;  5FPZ A;  4KWJ A;  2ZMK A;  2QQW A;  1OUS A;  2BNN A;  4DNY A;  1AR6 1;  2V09 A;  1K5J A;  3LOI A;  2CY6 A;  1OA4 A;  2R04 1;  4K9S A;  4QB2 A;  4YVW B;  1J58 A;  4PLM A;  3ZXK A;  3W9A A;  1K5M A;  4N7U A;  3AP9 A;  4IQP A;  4LOS A;  1GBG A;  3INA A;  3LEK A;  5JSO A;  5F37 A;  3H1M A;  5FZB A;  5LBC A;  2WII B;  2GSY A;  2YXS A;  3P1I A;  1COV 3;  1G8W A;  3G7D A;  4XIL A;  1UY4 A;  4WM8 A;  4WVM B;  1VMF A;  2RMU 2;  2XVG A;  1R09 1;  3U07 A;  1UD1 A;  1DG6 A;  2BBV A;  4BMB A;  4E4D X;  2EID A;  2X5I A;  3WNX A;  3BTZ A;  4NMI A;  1HV0 A;  3KCC A;  4ZZ5 A;  3E6B A;  2W39 A;  1QJX 1;  2QQK A;  5FLH A;  1ENR A;  4QQ2 A;  4YVW C;  5F7U A;  1ZBA 1;  4AED B;  4LMF A;  1IHM A;  4CDX B;  2OPK A;  1QJE A;  2KD7 A;  2W46 A;  1LOA A;  2XGX A;  3AYC A;  2IXC A;  2WA4 A;  4OLL A;  5FZL A;  3WZ1 A;  5DAP A;  4IW3 A;  4XDO A;  1ND3 A;  3IPV A;  4QHZ A;  5T3N A;  2YGM A;  4DUW A;  1RUC 3;  5I91 A;  1N47 A;  1I1E A;  4CP9 A;  1D4V B;  4BLJ A;  4AHX A;  3FFZ A;  5GZG A;  3IDB B;  5F39 A;  4FXK B;  4N9I A;  5FPL A;  2RS3 2;  3O7O A;  1BBT 3;  3AMH A;  1ZZ8 A;  1ZRF A;  2QQN A;  3MO4 A;  1FOD 1;  1ULD A;  4JCK A;  2NM1 A;  3M3Q A;  2JD4 A;  5FZO A;  2ZZQ A;  4AED C;  1XXN A;  4XJ9 A;  3III A;  4CDX C;  2B9U A;  3FBM A;  4PF1 A;  3VZM A;  2C9A A;  2P6H A;  2WS9 1;  1HKD A;  1OF4 A;  2A1X A;  2GP5 A;  3KZ4 C;  3CLP A;  3AZV A;  5C7G A;  3JBG 1;  1YQ5 A;  3GF6 A;  1GP5 A;  1WLW A;  2HWF 3;  2WBK A;  2XML A;  1AR7 3;  4YPJ A;  3WHU A;  1M06 G;  4RS5 C;  4JKL A;  4FVV A;  1KIT A;  3GZA A;  1PX4 A;  1XND A;  1LOF C;  4QDS A;  3BAL A;  4AHY A;  2AH2 A;  2R07 3;  2NMO A;  4X6Q B;  5I8Y A;  2BGP A;  3ACF A;  2EAL A;  4PCR A;  1EP0 A;  2DBN A;  2P3Y A;  1ST8 A;  3WIN E;  4BK4 A;  3BKZ A;  4LA2 A;  5JLV A;  2VOV A;  3ORJ A;  1RUG 3;  2VOK A;  4LKD A;  1JZ4 A;  1BVV A;  4CDU A;  1ZZB A;  4BB3 A;  2FCV A;  4W4Z A;  3PLQ A;  5JR7 B;  2VPV A;  4QM9 A;  5DAB A;  2EXH A;  3AVR A;  4XMI A;  5HCF A;  5CKM A;  1KJR A;  4UFM A;  3RZH A;  1A3K A;  4FAG A;  2LM3 A;  4NE9 A;  1VR3 A;  2WJS A;  3VDD A;  3AZW A;  1A8D A;  1BK1 A;  4EJR A;  3ZPO A;  3K77 A;  5LY1 A;  2YU2 A;  5HPO A;  1PO2 1;  3SCG A;  2G19 A;  5F3G A;  3WQ7 A;  5FYH A;  4MVT A;  1ZM1 A;  1XE8 A;  2A70 A;  2HWB 2;  4XFF A;  2C0Z A;  1ZYB A;  3JQX A;  1QJY 1;  2ID4 A;  5AC9 1;  5KXE A;  2YUE A;  4AFM A;  1JZ2 A;  1HN0 A;  3WCR A;  4EN6 B;  1Y7B A;  3WD5 A;  4XF9 A;  5JI7 A;  1RXG A;  3MBW A;  2BYV E;  4IEZ A;  3TN9 1;  1SPP B;  2FDF A;  4RN5 A;  1RUD 1;  2XJQ A;  1NLQ A;  4QXB A;  2XH6 A;  4OHW A;  5KHJ A;  1DQ0 A;  3BPS A;  5F5I A;  1ASJ 3;  4ZU4 A;  1EUU A;  2PFW A;  4CTE A;  4ZS3 A;  3MIB A;  1UXZ A;  3KB5 A;  2R7E B;  5D8A A;  4Z2A A;  4L11 A;  2JKX A;  5DPN A;  1KDM A;  4Y1Y A;  2C5D A;  1JZ6 A;  4QX5 A;  4IET A;  1ULG A;  1SLT A;  5KWR A;  2QUO A;  2IZW A;  3Q8E A;  4D94 A;  4MOA A;  3O0W A;  4TZD A;  4UW3 A;  4K6B A;  1UU6 A;  3BGA A;  1AYN 3;  1POV 1;  3LE0 A;  4GMP 1;  5D2A A;  2YRO A;  2Y33 A;  1LTE A;  1U0A A;  4EQV A;  2WNU A;  3EMR A;  4Q4V 2;  1PGW 1;  4SBV A;  5FYZ A;  4YM3 A;  2HJI A;  3L2Y A;  3RJR A;  2WKK A;  2O1Q A;  1S1A A;  3K51 A;  2BTV C;  1C8M 2;  4QB1 A;  3QBQ A;  1I5Z A;  3KGZ A;  3ZSK A;  4I3P A;  1D2Q A;  3IDC B;  4MZU A;  4GB3 3;  2RM2 2;  2ZX2 A;  4BK5 A;  1Z7S 2;  4ATE A;  4AHZ A;  3N9N A;  3LF7 A;  5I0R A;  2ZMN A;  1GSL A;  2HYX A;  4KU8 A;  2V5D A;  4N43 B;  2B46 X;  4YG0 A;  2G4I A;  5TSW A;  4FPF A;  1G86 A;  4I09 A;  1COV 1;  4BXF A;  5LZ6 A;  1YIF A;  5J37 A;  4NN0 A;  3AVS A;  3FLP A;  4JQR A;  1CN1 A;  5A32 A;  3PUQ A;  4JGY A;  1YJK A;  3BPZ A;  4IND A;  3RDI A;  2ATF A;  5IYY A;  2WA3 A;  1DZT A;  4XCA A;  2Q8D A;  3MZH A;  2X53 S;  3ST7 A;  1J3Q A;  1W9F A;  4ZXK A;  5CFD A;  5A7O A;  3T3Y A;  1POQ A;  1MS8 A;  3OD4 A;  4IL7 A;  5L9V A;  3F2Z A;  2Q0A A;  3O1U A;  1GNH A;  3CZJ A;  3ZFG A;  1H1I A;  1WBF A;  3DYO A;  4N43 C;  4YGC A;  3N4M A;  3E5U A;  3I54 A;  4B29 A;  1QQP 3;  3KV5 A;  1AVB A;  1Y9Q A;  3JB4 C;  5I0S A;  4BQ2 A;  1W9S A;  1RUC 1;  1CAV B;  2XJR A;  2ZGS A;  2GN3 A;  2PHW A;  5FPA A;  4BM8 A;  5LEJ A;  4Y33 A;  2BNM A;  3ZYP A;  3ZIX A;  5JZG B;  4OUE A;  3ZYI B;  4OHY A;  5FYV A;  2VVE A;  1NCR B;  4CEY A;  4CCC A;  2ZEX A;  5CG8 A;  1WWY A;  1AR6 2;  1SFN A;  4EN0 A;  1WD3 A;  1WMF A;  5IVB A;  2N7G A;  2R04 2;  1S0D A;  1UOG A;  4J1X A;  2PHL A;  5DUU A;  1MS1 A;  2VZV A;  5IT6 A;  5C6C A;  3D82 A;  1ND2 B;  1QKQ A;  1FV2 A;  4D69 A;  2WRA A;  3ZYJ B;  2VNR A;  2H6C A;  4C90 A;  1MR5 A;  1YFU A;  3MHZ A;  1R09 2;  3EB7 A;  5FPU A;  4TSV A;  4MV2 A;  1AR7 1;  5EWS A;  4DY5 A;  3ATG A;  2RR1 1;  3DYP A;  5FMO S;  1BEV 2;  3D0J A;  1QJX 2;  1Y4W A;  1RXF A;  3ZDV A;  2A5Z A;  3D5O A;  5FTT C;  2WZP P;  4S2G A;  4HFS A;  1J59 A;  1A8M A;  1ND2 C;  3VBR A;  3CEW A;  4BIF A;  1SBE A;  2ARX A;  2D44 A;  1RUG 1;  4C1W A;  4Y22 B;  4NIH A;  1ENQ A;  3IT8 A;  3UV9 A;  4Y1X A;  1XJA A;  1W6M A;  3POJ A;  3CJX A;  5DUX A;  5H9P A;  4HET A;  1DBN A;  1XYP A;  3FHQ A;  4IEO A;  4YYO A;  5BNQ A;  3T2T A;  5I93 A;  1GQH A;  4NID A;  2UY9 A;  3AMM A;  1BKZ A;  2DUP A;  3BOW A;  2PHT A;  4AXO A;  2JEN A;  3MW2 A;  2QZ3 A;  5FXX A;  4CSW A;  4I01 A;  1S0I A;  1FOD 2;  1QXR A;  5ISL A;  4IGP A;  4ES9 A;  1V6N A;  1UZ0 A;  1YQ2 A;  1CQ9 A;  2SLI A;  4LHK A;  5J7M A;  5IVV A;  1MQT A;  2WS9 2;  4CU6 A;  1EPZ A;  1JW6 A;  3OG2 A;  3SH5 A;  1EV1 2;  2VMF A;  4AVS A;  4KH9 A;  3CZU A;  1OFN A;  1K42 A;  3GCW A;  2FMY A;  2D6K A;  2VE1 A;  4COY A;  2RJ2 A;  4IEX A;  5F9T A;  4HPK B;  1GU3 A;  2F4P A;  4KL1 A;  1Z0H A;  4QX3 A;  1QU0 A;  1DQ2 A;  1FYU A;  1F4A A;  4OHX A;  3O14 A;  2J1V A;  2WC2 A;  1UZW A;  3AP7 A;  4LLO A;  3OPZ A;  1H4G A;  5EYY A;  4XIK A;  2VUA A;  4GWJ A;  3PUI A;  2ZOE B;  2HH9 A;  1S0E A;  4ZZ8 A;  3ZPY A;  1ULE A;  5IVJ A;  2DCK A;  4AR2 A;  1W6Q B;  5BNN B;  3V56 A;  2BQP A;  4H2A A;  1CON A;  2WR9 A;  4I0W B;  2ZX3 A;  3ZXD A;  2P5B A;  2R0H A;  1WW5 A;  4A6O A;  1HQW A;  2OX0 A;  1OLM E;  2VNV A;  4FPL A;  1UMI A;  1CIY A;  4D3W A;  5DZF A;  1OMI A;  5JIU A;  4ZU5 A;  5HCH A;  2IVI B;  1N3Q A;  1FPN 1;  1GLH A;  1PO2 2;  4MGK E;  3IAP A;  4QXH A;  5FYB A;  2FBE A;  1MEC 3;  4NWV A;  1D7P M;  4YG6 A;  1QWR A;  3TNQ A;  1K45 A;  1IS6 A;  4AHW A;  4GB3 1;  3MID A;  3KQR A;  5AC9 2;  3C7G A;  3IKW A;  5BNN C;  1IG0 A;  1VE0 A;  5SV8 A;  3U78 A;  3I2F A;  2CWS A;  3DUI A;  1UKR A;  2JG9 A;  4K3U A;  4QT6 A;  2ZZJ A;  3ZIW A;  4QQO A;  5L36 A;  4P14 A;  3TN9 2;  2WSU A;  3EYP A;  2A3Y A;  3T1M A;  1RMU 2;  2XHK A;  2D5H A;  3WOG A;  2Y6H A;  4K21 A;  5T5O A;  5GLT A;  4DXS A;  3U75 A;  3C2U A;  3BU7 A;  3S7I A;  1H30 A;  5JSR A;  4J25 A;  4HVQ A;  2JDA A;  3GBF A;  1LKN A;  1GR3 A;  2VMD A;  4BXS V;  1RJ7 A;  1QOS A;  2C6S A;  2JIG A;  4PHZ A;  1QQP 1;  1LOD A;  5FMB A;  3T08 A;  2WQZ C;  5GLZ A;  4YM2 A;  4KWL A;  3AX4 A;  4G4F A;  1AZD A;  1OA3 A;  1OD5 A;  5FDB A;  3VZK A;  2WO3 A;  3HOB A;  1W3X A;  2D7F A;  5CVR A;  4C8D A;  1RHI 2;  2ZGO A;  3KV6 A;  2Y60 A;  1S55 A;  2DWR A;  3RVH A;  1T6G C;  4P9J A;  5ACA 1;  1NYW A;  1AR8 3;  2B4K A;  3H3Z A;  2RS5 1;  5EYX A;  4HZF A;  1I9R A;  5BNP A;  3VUO A;  3I4I A;  2HYK A;  3MFC A;  2BVV A;  3I97 A;  1FT9 A;  1COV 2;  2BOJ A;  1F8V A;  5FYC A;  2J42 A;  1IG3 A;  3PDQ A;  5LA2 A;  1HRV 3;  4OVE A;  1W04 A;  1ZRE A;  1BCX A;  4LOT A;  3AM2 A;  3JCI A;  1DZR A;  3T0A A;  4PIZ A;  4AFD A;  3BU0 A;  4BPZ A;  1DDL A;  5K8S A;  2TUN A;  1F15 A;  1MS3 A;  3WEZ A;  1OA2 A;  1SQ4 A;  5FWE A;  3LIH A;  2A6W A;  4ZU7 A;  3J26 N;  4H3W A;  3FX3 A;  3ETQ A;  1W03 A;  1X8E A;  3LFI A;  1DQ6 A;  4Q8K A;  2WT0 A;  5CFC A;  1QJU 3;  1V70 A;  1EYB A;  4LK6 A;  1GYK A;  1BHG A;  5EJ1 B;  4D0Q A;  1N3O A;  5AFB A;  2PHU A;  1RUC 2;  1YI7 A;  4V1P A;  2J1E A;  2ZAH A;  1APN A;  3ZN5 A;  3DGT A;  3LAG A;  4PLN A;  2QQM A;  5FY0 A;  4PLO A;  5C3Q A;  5KXD A;  1RUH 3;  4HXC A;  4N7I A;  3AYD A;  4DXR A;  1R1A 3;  1US3 A;  4FTS A;  5FZ1 A;  3NJX A;  1WKY A;  2Z42 A;  5HV0 A;  3MYX A;  1FI2 A;  4CP1 A;  3IAQ A;  1RVF 3;  1CPN A;  3K46 A;  4A3X A;  4ET7 A;  5FZG A;  5ABJ B;  1ALY A;  1OQ1 A;  2ZGM A;  3VBF B;  2B45 X;  3DXU A;  1E57 A;  1W2U A;  1PMH X;  2BPA 2;  4Z82 A;  3JD7 3;  3R6S A;  2JWP A;  2QDN A;  1GZW B;  1AR7 2;  3GZE A;  3WDV A;  3WP6 A;  1US2 A;  2RR1 2;  4H14 A;  1IS5 A;  4DZG A;  3AKP A;  1KQR A;  1N1T A;  2XXZ A;  4JTO A;  4MXW A;  3ACI A;  1UY0 A;  4XBQ A;  3J7H A;  4Q4W 3;  1OPO A;  3ECQ A;  4RGG A;  1F9K A;  1FMD 1;  5IAX A;  4QPG B;  3VDB A;  2DU0 A;  3WG1 A;  4RQP C;  1W6P A;  5HCB A;  3ZFE B;  2P3K A;  5EQU A;  5FRA A;  4JKK A;  4BE3 A;  1CZV A;  3LCP A;  4DEQ A;  1D4M 3;  3DPR A;  4LBK A;  5FYM A;  4RFT 0;  4HK8 A;  3WF4 A;  4COV A;  5CBL A;  3ZN6 B;  1OUX A;  3ZYB A;  4HKW A;  3ZYF A;  2JDY A;  1KD7 A;  2FDJ A;  2F17 A;  1G9C A;  3K48 A;  4XBL A;  1TE1 B;  1U12 A;  3LGR A;  1MEC 1;  1OKO A;  1MS5 A;  1S2E A;  2OT7 A;  3PIJ A;  2WO1 A;  2IFW A;  4LBO A;  3WNO A;  1ZZ7 A;  1SLB A;  2JE8 A;  4Q5O A;  3SH4 A;  3OEB A;  2PLV 3;  3U1X A;  5FZ3 A;  2ZX0 A;  3UNP A;  5FP3 A;  3HT2 A;  1JZ5 A;  2D43 A;  3WDY A;  3SKV A;  2WDB A;  3RYR A;  2GMP A;  3D6E A;  1OFS A;  1YJL A;  3NV4 A;  5ANN A;  1J3R A;  2QKD A;  3D3A A;  5L9B A;  2ZJC A;  2VMC A;  1PZ9 A;  4XPV A;  4UBG A;  2MEV 2;  1A78 A;  1LEN A;  4BCU A;  2ILM A;  2W9X A;  2WYS A;  2ZXQ A;  4QKB A;  3VDC A;  4XHX A;  4Z2W A;  2FCU A;  3KF5 A;  4LUM A;  5J09 A;  4CU9 A;  2E26 A;  3BN6 A;  2RV9 A;  4A42 A;  4QDR A;  1UWW A;  3R4S A;  1ACC A;  1PMI A;  4NPL A;  1C1F A;  5FAX A;  4A45 A;  5IFP A;  4COZ A;  1CAW A;  5T5P A;  3VBS B;  3ZXG A;  1C5H A;  3BUC A;  1UX7 A;  3AK0 A;  3GHM A;  4AVV A;  4QDQ A;  3SIS A;  4E4Z A;  3ENR A;  3MIE A;  5LEK A;  2FZ2 A;  1AL2 3;  5LBE A;  4NPM A;  1I6X A;  3CQO A;  4AL9 A;  4YAR A;  1FPN 2;  5DDJ 1;  3B3Q E;  4XFH A;  4E9K A;  2HLE A;  3KLS A;  3POS A;  2H0B A;  2WNV A;  4FSJ A;  5A1L A;  1WBL A;  4M4P A;  4QQH A;  4ZON A;  1DGR N;  1GNZ A;  2GC3 A;  3FWE A;  4LHS A;  3NKG A;  4WZF A;  1YHF A;  3VB9 A;  3VBO B;  1OQD A;  4CDQ B;  3SKJ E;  4XF4 A;  4XDQ A;  2ZHM A;  1V9U 3;  2D6P A;  2R1B A;  2XUM A;  2X10 A;  1RUF 3;  3VBS C;  1HRI 1;  1GWK A;  4QHB A;  1WW4 A;  2IXJ A;  4IEU A;  4CEW C;  1W8F A;  4GJZ A;  5K0U B;  2JE7 A;  3M7A A;  2WZ8 A;  3AYA A;  3CJI B;  4FCA A;  3THT A;  3VKM A;  1Z78 A;  4CCJ A;  5J48 A;  2AEN A;  4OFG A;  4R4Z A;  5C8C B;  2A6Z A;  3BB6 A;  3DYM A;  4CUG A;  5FKB A;  4B1M A;  3CU7 A;  4QU2 A;  4CDQ C;  1FAT A;  2OZ6 A;  4GKX A;  3S5A A;  4Q4Y 3;  4A7K A;  3O1O A;  1QJU 1;  1R1Z A;  2HWE 2;  1H8T B;  1QQP 2;  3VN4 A;  1EUT A;  2DVG A;  2VVF A;  1PNF A;  3N9L A;  4QX1 A;  1SMV A;  2ZAB A;  3UK9 A;  1RJ8 A;  4KWK A;  1WGP A;  1SFY A;  2XKO A;  1VP6 A;  1ZBE 3;  3HBZ A;  5CIR A;  4W8J A;  1RUH 1;  4YRD A;  5C3P A;  5K0U C;  5K7P A;  4AFB A;  5DAV A;  4FP2 A;  4DPN A;  1NE6 A;  5IK4 A;  3ITQ A;  1RUJ 3;  3AKS A;  1R1A 1;  2WWS A;  1AR9 3;  3MIG A;  5CYY A;  5C8C C;  1S2K A;  2CGN A;  1QEX A;  4JHT A;  3SC7 X;  4R9C A;  1ZVF A;  5ACA 2;  2RS5 2;  3WW4 A;  1DFQ A;  3DEC A;  3WP5 A;  4IXL A;  5IVC A;  1MVQ A;  1H8T C;  4RYD A;  3Q8C A;  4WVM A;  4N53 B;  2XVL A;  2FQP A;  5LBF A;  2IFR A;  1A6C A;  2XJS A;  5APA A;  1JI6 A;  2BEO A;  5EJ3 A;  1KXG A;  4R8H A;  5HBA A;  1VJ2 A;  2V4V A;  3K75 B;  3FHI B;  1STM A;  3I3E A;  3IM0 A;  2JDZ A;  5LCW L;  5FQ0 A;  2HWC 3;  3D0S A;  5JDB A;  2X8K A;  2UYB A;  1W8T A;  4AEJ A;  5FXW A;  2YV8 A;  4Q4W 1;  5FP7 A;  1AF9 A;  1QH6 A;  2ZGK A;  4RR3 B;  2HWD 1;  2RDN A;  4PI0 A;  3ZSL A;  1OPM A;  5IVE A;  2XR4 A;  3SMH A;  5FZK A;  1NA1 B;  4FPO B;  4IV1 A;  1ZZ6 A;  1Y9G A;  2D5F A;  2Q8C A;  2BRT A;  1PK6 C;  3I2K A;  1JYN A;  2AYH A;  1YQC A;  3NMB A;  1O5L A;  3KD4 A;  3VHO A;  2BV4 A;  4CZS A;  1JYT A;  3IDE A;  4AG4 A;  4FP3 A;  4OZO A;  2WAO A;  1VAM A;  1JYI A;  3AZZ A;  3K4D A;  3ZKU A;  3U11 A;  1RYY A;  3OPT A;  1AL0 G;  4URA A;  5BUV A;  4CYD A;  1RUE 3;  5FY5 A;  1C5I A;  4RR3 C;  4GIQ A;  5DAX A;  2Y0O A;  3LQC A;  4GAZ A;  5IFT A;  3OB8 A;  4XF1 A;  1Q3E A;  2ARA A;  1EAH 3;  5F3C A;  1NAE A;  5DAQ A;  1W8N A;  1OT5 A;  4UWD A;  4Y5Z 0;  2Y64 A;  5H9Q A;  3TEW A;  4YVS A;  4AQS A;  3GXU A;  4XMA A;  4XJ8 A;  1VRH 2;  4CCE A;  1O8P A;  3E5Q A;  3Q9O A;  2WQ8 A;  3A0N A;  2E51 A;  4P08 A;  3HT1 A;  3PVB B;  5D1I A;  4AVT A;  2A75 A;  1OD3 A;  3LD8 A;  5LBB A;  4C1X A;  3T1L A;  2P3J A;  3ILR A;  2ZX4 A;  2YC2 A;  2D6M A;  4OMC A;  3OGV A;  1FMD 2;  3WDX A;  4YFZ A;  3VZJ A;  1TNR A;  1KRI A;  4NRM A;  1IS3 A;  1B35 B;  2YFU A;  4I2O A;  5FY9 A;  4L99 A;  4FTB A;  2OII A;  2RHP A;  4L92 A;  2CAV A;  2BGO A;  3TBD A;  2ZEY A;  2VTX A;  5F3E A;  4Q0V A;  2VR4 A;  2NP0 A;  3RYK A;  4CDW C;  1SDW A;  5FYY A;  4Q0Q A;  4DMI A;  3EHK A;  3UGH A;  3WF0 A;  1OI6 A;  5CIS A;  3T2O A;  2CHH A;  1UL9 A;  4YG3 A;  4C0H A;  4A4A A;  4CU8 A;  5A6Q A;  5J98 B;  2XLG A;  3A4U A;  3J4U H;  1VBB 3;  1B35 C;  1LAJ A;  4IES A;  1JXN A;  3GNE A;  1JBC A;  2FDI A;  3RZZ A;  5JI9 A;  1V9U 1;  2KA3 A;  3FLR A;  1RUF 1;  1VRB A;  2AC1 A;  3S5Q A;  1Q8P A;  4XFB A;  5M0T A;  1LGC A;  1F35 A;  2QFE A;  2JG8 C;  5LK5 A;  3ETP A;  3SCH A;  3VD7 A;  2YBS A;  3OBZ A;  5BNO C;  2GNM A;  4OUM A;  3VBU A;  2Q1Z B;  2BUK A;  4HSL A;  5I8S A;  2HEV F;  1LU2 A;  1R08 1;  4ZXE A;  1IOA A;  1UY3 A;  3GBW A;  1LHU A;  2IUW A;  1ULO A;  2VQU A;  2IXL A;  2PTM A;  3KVB A;  3SXW A;  2VG9 A;  4WZC A;  5C8W A;  4MAD A;  4KNC A;  1PHM A;  1W3V A;  2FHR A;  2J1S A;  4RS5 B;  4URT A;  4Y3O A;  1NCQ B;  1GWM A;  3ZYG A;  4PDW A;  4CXY A;  1PIV 3;  4YSF A;  1QMJ A;  5JVV A;  4QXC A;  5IJR A;  5A80 A;  2R06 3;  3QCW A;  4ZPI A;  5JXJ A;  2QTW B;  5DDJ 2;  5A70 A;  1LEM A;  2VZO A;  5EIY B;  1UO9 A;  1RUJ 1;  1AR9 1;  5C4W A;  2EIC A;  3D8C A;  3VD4 A;  5FMC A;  1YQ8 A;  5EPA A;  2FCT A;  4LBQ B;  2W47 A;  3BTY A;  2VZS A;  2FMD A;  5C5U A;  4GH4 B;  3KHB A;  4P00 B;  1NCQ C;  3UL2 A;  1WZX A;  3C8X A;  5D21 A;  1HRI 2;  3WV6 A;  3NNJ A;  4AF9 A;  2O8Q A;  4QMA A;  5L7O A;  1O3S A;  1MZF A;  4Y4Y A;  4I02 A;  2QCS B;  1HQL A;  1ZZ9 A;  2ETE A;  4MGY E;  5A7N A;  1RIR A;  5BXX A;  1FXZ A;  2XL9 A;  5FBZ A;  5BYN A;  3LOB A;  3QLQ A;  3N7L A;  1PNG A;  2Q4S A;  5FZD A;  3ZFF A;  4XUN A;  3PUA A;  3WDT A;  5J3U A;  3HN3 A;  4BQW A;  1G7Y A;  2VQT A;  4GH4 C;  5FLI A;  1QJU 2;  2IXI A;  5EXO A;  1OLR A;  1AJO A;  1P8J A;  1CAV A;  4M3C F;  3LA7 A;  4U36 A;  4QQP A;  4UI9 L;  5JMC A;  1DZQ A;  3OOX A;  5JZG A;  3I2O A;  1Y9M A;  1RUH 2;  5F1R A;  4ASL A;  2E33 A;  2V73 A;  3RMY A;  1NCR A;  3M3C A;  3S0M A;  3MDP A;  3VZO A;  2VEC A;  5KHG A;  4FOV A;  5FLJ A;  3H9A A;  1VBA 1;  2OS2 A;  2YPJ A;  3POY A;  4WM7 C;  1RGS A;  4XUQ A;  1LJ7 A;  1ZNP A;  3HQU A;  5EFU A;  5LA0 A;  3RI8 A;  5I8T A;  3BCW A;  4R52 A;  4OZX A;  3LSE A;  4Y1Z A;  4HK9 A;  1WW6 A;  4A7Z A;  2WAB A;  1K5M B;  1YFX A;  2AGS A;  2JDH A;  2QBX A;  4AZZ A;  3NRU A;  1C3H A;  3WF3 A;  2QQP A;  4AI1 A;  4WM8 B;  4GJY A;  4Q4W 2;  1O3Q A;  2D6O X;  1KFX L;  1WW7 A;  3UGF A;  2C24 A;  3J8F 3;  3WQ1 A;  1D0G A;  2HWD 2;  2X5I B;  4Y22 A;  5KHI A;  2C9K A;  4W65 A;  1CX4 A;  5FPV A;  1N1V A;  4COW A;  2BJS A;  2CAU A;  1OVP A;  4K1Z A;  5DZG A;  3KQ4 B;  5IAT A;  4HKO A;  4XYX A;  5JXI A;  1JS9 A;  1QH7 A;  1UIK A;  1IQD C;  3FJS A;  1K5M C;  2CL2 A;  1MS4 A;  3KF3 A;  4QPI A;  3M3O A;  3N9Q A;  4YW5 A;  3T09 A;  5CEH A;  1ND3 B;  1OLQ A;  4WM8 C;  3IPV B;  1WCD J;  4JVA A;  5F8P A;  1NXM A;  1YC6 1;  2AEZ A;  2VNO A;  4XC9 A;  1AX2 A;  4CP9 B;  3OJB A;  2XOM A;  4K1Y A;  4MX3 A;  5FZA A;  4EYU A;  1OQE A;  4O65 A;  1OHF A;  5JAX A;  2DFC A;  3GM8 A;  2X5I C;  3UKT A;  4RGK A;  4CPB A;  4XVH A;  2RS1 3;  1HB1 A;  4F83 A;  3JB8 A;  1AXY A;  4YGE A;  3VBH A;  1ZZC A;  1U5X A;  3J7L A;  4YGD A;  1LB2 A;  3FHA A;  1UMH A;  3DF0 A;  4ZHN A;  5BY5 A;  4D7Y A;  2OYZ A;  4HPK A;  1FNY A;  3C7H A;  4FOW A;  4NPR A;  1NXD 1;  1JYX A;  5KC5 A;  1GOH A;  3CIH A;  4D6Q A;  1X9P A;  3PU8 A;  1ND3 C;  3OCP A;  3FUO A;  2Q8O A;  1ODN A;  1AUY A;  1C28 A;  3WQB A;  2XKP A;  4CE8 A;  3KT1 A;  3RS6 A;  2A6V A;  2VCC A;  2Z4F A;  5A3U A;  5A1F A;  1RED A;  2BWC A;  2BZD A;  5A7W A;  1SCR A;  5LY2 A;  2WFF 3;  1QGL A;  4I0B A;  5JMO A;  1W6Q A;  3UKN A;  4XJU A;  4JHZ A;  2MHF A;  5FZ8 A;  2W87 A;  2VUC A;  2YHJ A;  3BTA A;  4PBO A;  1SBD A;  2YY1 A;  4TN7 A;  4XJW A;  1XU1 A;  3GHN A;  4V2W A;  4MH0 E;  1H2L A;  1BBT 1;  3JQW A;  1VBE 3;  4YZ2 A;  2RDQ A;  2GAL A;  4CDU B;  3L2H A;  3B00 A;  1XNT A;  2R06 1;  4MGT A;  3QD6 A;  4EWA A;  3OYW B;  4LLF A;  4XUT A;  3GYD A;  3EJK A;  3M70 A;  2ZGR A;  4IEV A;  4XJA A;  5H9R A;  2RJL A;  5C3O A;  5DXD A;  2YMZ A;  1SLL A;  1DYK A;  4XTP A;  5DZE A;  2LS6 A;  4CUB A;  4FQ4 A;  1G9F A;  2YGL A;  5CAZ A;  3KS7 A;  3OEA A;  2HWF 1;  4W6W A;  1W99 A;  1H1A A;  4XDP A;  4XF0 A;  1V9U 2;  3T2Q A;  1A34 A;  1RUF 2;  4GUL A;  2WSV A;  2R07 1;  4CDU C;  1CVN A;  3H42 B;  1GQP A;  1ZBA 2;  2BER A;  2TEP A;  3AL6 A;  1VBD 3;  4G3Y C;  1Q8S A;  3E6D A;  1WA6 X;  4XFA A;  1JMU B;  2O0O A;  3UT0 A;  1R08 2;  3J7M A;  4ZKT B;  3HQX A;  3I2D A;  3K4Z A;  5I0D A;  4XE9 A;  5LWB A;  3V0A A;  3S57 A;  4GAL A;  3VDD C;  2EXI A;  3JU9 A;  5DMY A;  4L8Q A;  1JN2 P;  1IGO A;  1O4Y A;  4IV3 A;  3NAP A;  5I0U A;  2NQY A;  2VME A;  5D8A B;  4MSV A;  4NOT A;  3VD3 A;  3EXU A;  2K0G A;  2P6C A;  3UET A;  4AI9 A;  5IK7 A;  2YBK A;  3FBY A;  5C3S A;  3ZXF A;  1SLA A;  2VCM A;  1NLR A;  4DB5 A;  1UYZ A;  5ANQ A;  2ZTN A;  1RUJ 2;  3THD A;  2JEM A;  1AR9 2;  3MIH A;  4QGL A;  4DY3 A;  1TME 3;  3P3N A;  5FZ7 A;  3U0Z A;  3JBG 2;  3VL8 A;  2CV6 A;  2LUW A;  2WNU B;  1HB2 A;  2ZKN A;  2DFB A;  1XNK A;  4LKE A;  1RUI 3;  1DYP A;  1CES A;  4OI4 A;  2A73 B;  5D8A C;  2DVB A;  3MPB A;  3ZMN A;  1ASJ 1;  2F4L A;  1Q8V A;  4L2N A;  1PVC 3;  2IXK A;  2WWJ A;  3TEZ A;  2XJV A;  3T0D A;  2XDV A;  3I3B A;  3OUJ A;  4KQ7 A;  5EZW A;  5A1A A;  1J1L A;  4LUL A;  4CCL A;  1FV3 A;  2VTX J;  4IEW A;  1PM4 A;  4BYY A;  2PMW B;  3RSJ A;  1S0C A;  1GZC A;  3VD9 A;  1GOG A;  2R32 A;  4N9H A;  1VBC 3;  2WNU C;  5AVP A;  3VKL A;  5LW9 A;  5T50 A;  3PVO A;  4JGY B;  1YLL A;  2UWA A;  5G05 L;  4ARY A;  5K9Y A;  1IPK A;  1AYN 1;  2P1B A;  4IGO A;  2P37 A;  2XL7 A;  5JIA A;  4QX2 A;  3PHM A;  2EAK A;  4KU7 A;  2W91 A;  5FUN A;  3IZO A;  3U4X A;  4MGS A;  1XQN A;  5E8A A;  5CFD B;  3OGG A;  1D2S A;  2PHR A;  4LR4 A;  4RHV 3;  4TYS A;  4RD7 A;  3HMY A;  3ZFG B;  3SEE A;  1UCX A;  3KMH A;  3NW4 A;  2R6Q A;  4XFI A;  1H2M A;  2UY8 A;  3HWJ A;  3OF1 A;  4NVP A;  1QJY 2;  4OUL A;  4QPW A;  1VBA 2;  4BQ5 A;  4JRA A;  1F4H A;  4QX7 A;  3WG4 A;  5JWP A;  2VW2 A;  2ZAA A;  4H7M A;  4JGY C;  3OSD A;  1L7R A;  3NNG A;  3WNP A;  4LEJ A;  1RUD 2;  1BK0 A;  2IWG B;  5FP9 A;  5ABJ A;  1YIP A;  3VBF A;  3UES A;  1H6Y A;  1TG7 A;  4LIT A;  4LIV A;  1YFW A;  2HBT A;  5CFD C;  5FR3 A;  1OUR A;  2Y6K A;  3GJA A;  4JDN A;  3ZFG C;  2G9F A;  4DIQ A;  2JDU A;  4CXX A;  4YW4 A;  2PAE A;  4NRQ A;  4AFA A;  5B4X A;  4Y20 B;  2WFP A;  2Q8E A;  2JE9 A;  1XPW A;  2V4A A;  1PVX A;  3POW A;  4Q2F A;  2YDE A;  1DQ4 A;  2QVS B;  2CTV A;  4PBP A;  5GJ6 A;  1XB9 A;  1ZRI A;  4IE4 A;  4MET A;  3ZFE A;  2ZGQ A;  1CPM A;  5JR2 A;  4MGZ E;  4BQX A;  2QQL A;  4CEY C;  5A3O A;  2XWJ B;  1O8S A;  1PGW 2;  1F2N A;  2XON A;  3OTF A;  1J3P A;  4ZS2 A;  5JXG A;  2DCY A;  4AEK A;  4YLZ A;  2W1U A;  2R1D A;  3TRS B;  2A6Y A;  4HMZ A;  3Q8A A;  1DYO A;  1GAN A;  2JX9 A;  2ARE A;  3VBR B;  5CKN A;  1Q8O A;  3A22 A;  1VBE 1;  4RGA A;  1CZS A;  1UXX X;  1NE4 A;  3E5X A;  3ILF A;  3WF2 A;  1YNA A;  2PAM A;  3LIG A;  3VD5 A;  4GZ9 A;  2P34 A;  2JDM A;  3W5M A;  2ZHK A;  5FOB B;  2G1M A;  2JKB A;  1QNW A;  4E4S A;  2D3P A;  1GKB A;  4XBN A;  1SFP A;  4P9L A;  3SLI A;  1LU1 A;  1G9A A;  4AWD A;  3PUS A;  2QQI A;  4OUS A;  5F2W A;  1LOE A;  3POE A;  1IS4 A;  1GZ9 A;  2CDO A;  2MPF A;  2E6V A;  2IVJ A;  1VB2 A;  1W2N A;  1I3H A;  3WY6 A;  1K12 A;  4DIN B;  3VBR C;  2FDK A;  4DRV A;  1Y3T A;  2ZGP A;  4X8P A;  2FDG A;  3LFM A;  5KR7 A;  3K2O A;  1VBD 1;  3MUY 1;  4KBZ A;  4RSU A;  1DQ1 A;  3IMM A;  4EN7 B;  4EN8 B;  3CDZ B;  3VKN A;  3QOP A;  3DKW A;  2W68 A;  1ZRD A;  5IK8 A;  3T0B A;  1W8W A;  4ITC A;  4FOY A;  4UFJ A;  3H1Y A;  4F3J A;  2ZCW A;  3RMX A;  2YPD A;  4OI0 A;  5C9A A;  5FMD A;  5C70 A;  4LUK A;  3HD8 B;  3UJQ A;  4KI5 M;  4COU A;  1UX6 A;  2VTF A;  1MQT C;  2ZHL A;  1BBT 2;  4E8C A;  3HBK A;  2ORZ A;  2UWB A;  2VXJ A;  1UPI A;  3WW1 A;  1LOB A;  1NG0 A;  4AOC A;  5E16 A;  4JQT A;  1W6N B;  3HVD A;  4RQP B;  1UYP A;  1QOT A;  1VAV A;  4W6Y A;  1GP4 A;  4BQ3 A;  4MO3 M;  1VPH A;  4FPH A;  2HWF 2;  1L7L A;  1LOC A;  2VC9 A;  1RUI 1;  5A3L A;  1BYH A;  3Q8F A;  3ZM8 A;  1HN1 A;  3VLB B;  1W6O A;  2HWB 3;  2OQ6 A;  3MUZ 1;  5EV7 A;  1DU3 D;  1OOP A;  2R07 2;  4HLT A;  1PVC 1;  2GH2 A;  2XLF A;  5DUV A;  3VZN A;  2RDR A;  2A3X A;  2C26 A;  1XYO A;  4YM1 A;  3LA2 A;  2PQQ A;  3CJI A;  2JG9 B;  2Y6J A;  3B9C A;  1MZ5 A;  1U5I A;  2BVB A;  1RUG 2;  3HPN A;  4JGZ A;  2EAA A;  4LHN A;  2CGP A;  1JTZ X;  1VBC 1;  2O14 A;  1ZRR A;  1V6L A;  1RC6 A;  2JDP A;  3CBN A;  1NT0 A;  1UF2 C;  5FZE A;  1NQJ A;  2VMI A;  2BFU S;  5CNA A;  4OI2 A;  1H6X A;  2VUL A;  3W58 A;  2PAK A;  1UYY A;  3ZR5 A;  4XW3 A;  4DEV A;  3F95 A;  5A33 A;  3UYJ A;  1JZ8 A;  2J22 A;  2A71 A;  4B1L A;  5B2G B;  1UZV A;  3SH3 A;  3UJO A;  4HN0 A;  4RHV 1;  3NNF A;  2JG9 C;  4KWU A;  4R9A A;  1UZZ A;  5IW0 A;  3E1F 1;  4EWD A;  3VHP A;  3HAG A;  4XEZ A;  2J1A A;  3NNL A;  4YW6 A;  3ES1 A;  3LEM A;  2VNG A;  2DBI A;  3LEG A;  2OW4 A;  5AVA A;  3RZK A;  1CAU A;  1CAX A;  1WMX A;  2YBP A;  2XVK A;  1I5P A;  3DN7 A;  5T54 A;  2AR6 A;  1W39 A;  5FYU A;  1T2X A;  2DCJ A;  1ASJ 2;  3BIW E;  3DCQ A;  4GQ7 A;  2XLA A;  2RM2 3;  4QXK A;  1Z7S 3;  3WG3 A;  3OUH A;  2DCT A;  4LJH A;  4OI1 A;  2KM2 A;  5BNP B;  3RPQ A;  3OY8 B;  4Q0S A;  4HOO A;  5K4L A;  2A6X A;  3P3P A;  3RZL A;  1J84 A;  3POI A;  4GMP 0;  3DKQ A;  4UW5 A;  4AEM A;  4O9E A;  1S0G A;  3IMN A;  3NJY A;  4X8N A;  3KGL A;  4LBJ A;  3VGI A;  1AYN 2;  2CSG A;  3GBG A;  5KC6 A;  1REE A;  4IEY A;  4PF5 A;  4LE4 A;  2HBU A;  1MZ6 A;  4CEW B;  1Y43 B;  1DCS A;  2GND A;  3U10 A;  4M00 A;  5T5L A;  4NIA A;  3RQ0 A;  1V6M A;  3V0B A;  5F6K A;  3NO8 A;  4QGN A;  1FAY A;  1UU4 A;  2B42 B;  3A23 A;  5BNP C;  4FPJ A;  3UGG A;  4O61 A;  4NII A;  1TZO A;  4FPG A;  4Y24 A;  4GB3 2;  2HKX A;  3RJ2 X;  2PHD A;  1AR8 1;  1KS4 A;  4M3C A;  3N9M A;  4NHM A;  4BHP A;  3GCX A;  5FY7 A;  4FI9 A;  3O1T A;  4D6S A;  4XQ4 A;  3PTR B;  4YZ1 A;  3GJB A;  5DAW A;  1MPX A;  1HW5 A;  2K2S A;  3AL5 A;  1QHD A;  1HRV 1;  3O1V A;  1AR6 3;  2LRO A;  2R04 3;  3MV0 1;  2BWA A;  2VBD A;  1DQ5 A;  1LNS A;  1X7N A;  1DF0 A;  1YQ6 A;  4AGR A;  1SEF A;  2B8M A;  3HNY M;  1LEC A;  2H0V A;  3WR0 A;  5CFC C;  4S2H A;  4KG0 A;  4ISR A;  4LK7 A;  1WA4 A;  4JZR A;  1X9T A;  2QZ2 A;  1DGW X;  4UF0 A;  2VOT A;  4Y1U A;  1R09 3;  2GDF A;  5FPB A;  4GKY A;  2TNF A;  4YW7 A;  4LO4 B;  4XET A;  5FYI A;  4DXT A;  4ES8 A;  2VY0 A;  4IE7 A;  3H8O A;  1LHO A;  2PEL A;  1VLN A;  2J1R A;  1E5S A;  2RG4 A;  2VCA A;  3PMS A;  4XZU G;  5SV5 A;  5FP4 A;  4D6R A;  4YZ5 A;  1BEV 3;  5JXH A;  1NZC A;  1QJX 3;  1KEX A;  4MXW B;  5FZM A;  5HV4 A;  4FT8 A;  4YW2 A;  1C1L A;  2VH9 A;  3WG2 A;  2W2I A;  1LRH A;  2ZEW A;  1DIW A;  4AYU A;  2D6L X;  1W6P B;  4XIO A;  2FDH A;  4YW3 A;  2YC0 A;  4YVW A;  4NJ4 A;  4BIS A;  4NHX A;  3W20 A;  5IVY A;  5JPM B;  1XU2 A;  4IEQ A;  5A6Z A;  2DDU A;  3VHN A;  1RVF 1;  4QB6 A;  4QWN A;  4K8F A;  4LA3 A;  4AQT A;  3BYW A;  5GLW A;  1PZ7 A;  1CX1 A;  5FOJ B;  2VBB A;  4LPL A;  3AZY A;  3HIF A;  1UY1 A;  3O12 A;  5GZE A;  3JD7 1;  4MGI E;  4UW6 A;  1PK6 B;  1WCK A;  2W94 A;  5L73 A;  2LAL A;  2Q1F A;  4EWE A;  1BQP A;  2B39 A;  3I59 B;  4Q4X 3;  2VQA A;  3AFG A;  2SBA A;  1DLC A;  2HWB 1;  4V2V A;  4LBL A;  5GLV A;  2VL4 A;  4QPY A;  2WS9 3;  2P4E A;  3H7J A;  4U2A A;  2XG3 A;  1EV1 3;  3RI9 A;  1YFY A;  2V72 A;  4AED A;  4CDX A;  1VBD 2;  5HI0 A;  5HXV A;  1F5J A;  1NKG A;  3K3O A;  5F5Q A;  3MIC A;  2P2K A;  4CXW A;  3MI8 A;  3DPR C;  2VGD A;  4XUO A;  3I2H A;  3VV1 A;  4Q0P A;  1IPJ A;  2JD9 A;  1UY2 A;  5KXB A;  2ET7 A;  3OUI A;  1OXC A;  3M8L A;  4DO0 A;  1D4M 1;  2VOX A;  3N3H A;  4H55 A;  1XE0 A;  4QHO A;  3NQH A;  2WWU A;  2MNG A;  3ES4 A;  4JX0 A;  4UFH A;  1LOF A;  4BZ4 A;  5KHH A;  2VZR A;  4AK3 A;  3LPF A;  1NZI A;  3ME2 A;  2W95 A;  3HR9 A;  3ZXE A;  1YUD A;  2WN2 A;  2VQ0 A;  2CNA A;  5T55 A;  2QJV A;  2VXR A;  1LHV A;  2ZPX A;  3ROU A;  4MXV A;  4GMP 3;  3C7O A;  1CAW B;  3KVA A;  3WSO A;  4XZP A;  5JOZ A;  2WNE A;  1UU5 A;  2PLV 1;  3R05 A;  3ABZ A;  2Q30 A;  4Q26 A;  5JSP A;  4LBQ A;  3I3M A;  3VKF C;  4UYB A;  3S7E A;  3O1P A;  4N90 A;  4NRP A;  2WLP A;  3NV2 A;  4E2G A;  4XTM A;  4CDW B;  4Z07 A;  2WNV B;  4HL0 A;  2RJK A;  5FZ0 A;  1OSG A;  5IAV A;  2RM2 1;  4D7S A;  1V6J A;  1NY7 1;  1YI9 A;  1NQD A;  4PT6 A;  1S4C A;  2EA7 A;  1VB4 A;  2YG0 A;  4GWM A;  3GZU C;  1O3T A;  4WVW A;  3AKR A;  3ZX7 A;  1W8Z A;  1RMU 3;  3WP4 A;  1VBC 2;  2D3S A;  3RG0 A;  2ES3 A;  3SHR A;  3GDB A;  4RL7 A;  2I2S A;  4AQ2 A;  4KMQ A;  4IE6 A;  4WV8 A;  3NJV A;  1LED A;  4AI0 A;  1O4Z A;  5C71 A;  1IKP A;  2JG8 B;  2WNV C;  1AL2 1;  4FPE A;  5BNO B;  2BFU L;  4H7L A;  4PIY A;  1KJL A;  2BNO A;  3H7Y A;  1MEC 2;  1X33 A;  3TEX A;  3MF9 A;  4E2S A;  2J7M A;  2YFZ A;  3THP A;  1E5I A;  1PX3 A;  1UNB A;  1X82 A;  1YO8 A;  5DUW A;  4LQR A;  2VW0 A;  3LDK A;  2DVF A;  1HQN A;  2Z69 A;  1SPP A;  5FYT A;  4DQA A;  3CMG A;  1IKQ A;  3Q8B A;  1UOJ A;  1RIT A;  3USU B;  2AZ5 A;  3D4K A;  3ASI A;  1RHI 3;  4UFK A;  1H0B A;  2PN5 A;  1BLZ A;  3WNM A;  1AXK A;  5CAD A;  3L9J T;  1H4H A;  4ASM B;  2XJU A;  1W06 A;  5FKC A;  2NLR A;  2E7A A;  4FXG B;  3RGB A;  2XHN A;  1O7F A;  4JAA A;  3T2P A;  1PGS A;  3OD0 A;  1QDC A;  3K4A A;  5JOW A;  1YWK A;  2WZR 3;  4ONU A;  3VL9 A;  1C4R A;  1SBF A;  4Q4Y 1;  4BU2 A;  4E2Q A;  4A6S A;  3OBT A;  4CP2 A;  3WT3 A;  1AX1 A;  4S2F A;  3T4V A;  3ZSE A;  5FQ0 B;  3MLK A;  2W1S A;  4MHU A;  4YFW A;  1BEV 1;  5FZ4 A;  2W1Q A;  1ZA4 A;  1ZBE 1;  2WO7 A;  2GMM A;  4Y4R A;  2Y8K A;  5LRR A;  1AYM 3;  3BVC A;  3S6P A;  5FV3 A;  4AAP A;  4HON A;  4IE5 A;  2WQ4 A;  1QXJ A;  3AP4 A;  5LRS A;  1JUI A;  5C5T A;  1CJP A;  4B8E A;  2JB4 A;  2Z79 A;  4NUB A;  4DRR A;  1AR8 2;  4E4H A;  2VBP A;  1PO1 3;  5A6Y A;  3M4F A;  2P17 A;  4IV1 B;  2Y26 A;  1W90 A;  4DS0 A;  4N43 A;  2YYO A;  4XUP A;  3PNA A;  5F5A A;  1GNY A;  1ULF A;  2ADE A;  2JEC A;  1HRV 2;  5BV6 A;  3FL7 A;  3AP5 A;  1LHW A;  2I74 A;  5FBJ A;  3KSC A;  2ZGN A;  4DUX A;  4LHL A;  4Q4X 1;  4XFC A;  3ZDS A;  2HEY F;  2D97 A;  1OVS A;  2HWC 1;  2W1W A;  3AB0 A;  4LNV A;  2J1T A;  2CYF A;  3B5L B;  3R4U A;  5F3I A;  3AKT A;  1EV1 1;  3KT7 A;  4WM7 B;  1Q5O A;  3ZYR A;  1WMD A;  4Q1R A;  4TLF A;  4IV1 C;  3ZOI A;  1HB4 A;  1IPS A;  4XQD A;  2JB8 A;  1JOB A;  3H50 A;  4YVS B;  2EXK A;  2RR1 3;  3AC0 A;  5GM0 A;  3T4H B;  5FY8 A;  3RWN A;  4OYU A;  1BMV 1;  5DQ0 A;  5CZK A;  3NWK A;  4O7X A;  2ZKL A;  3M2M A;  3WW2 A;  3ACL A;  4M01 A;  2PHX A;  1BVP 1;  1JOJ A;  1ZA7 A;  2XB6 C;  4J1W A;  4P9Y A;  3WNK A;  1R1A 2;  1QJZ A;  4DXZ A;  4BME A;  3P5B A;  2XJT A;  4ERO A;  4DFS A;  2WLQ A;  2XBO 3;  2EIB A;  4AW7 A;  1RUE 1;  4WVZ A;  3OYW A;  4CRQ A;  1ND2 A;  1Q43 A;  1SAC A;  1RVF 2;  1S0F A;  3N35 A;  2X29 A;  1BJQ A;  1EY2 A;  1MVE A;  2QQO A;  3AFK A;  3NL1 A;  4M4R A;  4CVU A;  3WQ0 A;  4YVS C;  4CA9 A;  2OXB A;  4C91 A;  1EAH 1;  1U5Z A;  2B7Y A;  3IN9 A;  4QAW A;  4RA0 A;  3V65 A;  3WX5 A;  4BH9 A;  4CP0 A;  3POB A;  3JD7 2;  5J1X A;  1HIX A;  3AMN A;  1UMZ A;  3MW4 A;  3ZVX A;  3WHT A;  3B9I A;  2H6B A;  3GZT B;  3ZO0 B;  2AAC A;  2VMG A;  4M0N A;  2R0F A;  4BOW A;  2GH8 A;  5A6X A;  1WLC A;  4BQ1 A;  4B4R A;  2W52 A;  3J7N A;  3QAC A;  4XAE A;  1RMU 1;  1SHW B;  4HG6 B;  4MG2 A;  1M4W A;  1OF3 A;  3ZMO A;  2FZ1 A;  2Z2S B;  2WNO A;  1D4M 2;  2AEY A;  2MEV 3;  3VBU B;  4HSJ A;  2VAU A;  4IEP A;  1QNY A;  4OCT A;  2LW8 A;  3C7F A;  3ACG A;  1DP0 A;  4JRL A;  2KXL A;  2WAA A;  3RWK X;  1XC6 A;  4UFI A;  2A3W A;  2EF6 A;  4NO4 A;  3WDU A;  4CCM A;  2ZS6 B;  4A41 A;  1U5Y A;  4XAB A;  2BGC A;  2CWM A;  4IUG A;  4L97 A;  3A21 A;  4PDW B;  2JIJ A;  4BDV B;  1VBB 1;  3MLL A;  2PLV 2;  4OMD A;  3HQR A;  2XJP A;  1H2N A;  3W59 A;  3MEP A;  4R9D A;  3WDW A;  4QKD A;  5GZD A;  1B09 A;  1HB3 A;  3AZX A;  5FZO B;  1FPN 3;  2VVD A;  3I8T A;  3BI3 A;  4CCK A;  5A7P A;  3VBU C;  3O0X A;  1JU4 A;  2ENR A;  2OVU A;  1RHI 1;  5A3M A;  5A3N A;  5C4W B;  5BPX A;  4Y5S A;  3USS A;  1ONA A;  1NY7 2;  5LA9 A;  4K20 A;  3H1W A;  1DGL A;  2OPW A;  1G6N A;  2ARB A;  3PIG A;  4LXL A;  3JXS A;  3BOD A;  2X05 A;  3I3D A;  4UBH A;  5FWJ A;  1GWL A;  4PDW C;  2UWC A;  3THC A;  4OQ8 A;  1MS0 A;  1UZY A;  3LDB A;  2WZR 1;  5BNN A;  4AVC A;  3IIA A;  2EIE A;  5L7O B;  2W3J A;  3K3N A;  1V0A A;  1W2A X;  4F8A A;  1R64 A;  1PIV 1;  2WT1 A;  5DG1 A;  4Z8B A;  3ZXA C;  2Y6F A;  3EO6 A;  1O5U A;  3H8U A;  1H8V A;  3KT4 A;  4IER A;  4P9X A;  4CPB D;  1AL2 2;  5C4W C;  1RB8 G;  5F5C A;  4NAM A;  2XPJ A;  5FJH A;  3ZFF B;  1C8N A;  1AYM 1;  1JH5 A;  1RIN A;  2V5Y A;  3CL1 A;  3TB0 A;  2E63 A;  2VD7 A;  1LOG A;  2NYY A;  3LSD A;  3LWC A;  1W9W A;  3NV3 A;  4E8D A;  2HWE 3;  2VZ3 A;  4NWW A;  3HNB M;  3VDD B;  2OA2 A;  4WVV A;  5JPN B;  5CA6 A;  4YM0 A;  1PO1 1;  1W28 A;  4TLG A;  2WT2 A;  4KGG A;  3VDA A;  1JZ7 A;  4I0A A;  5L7O C;  1G9B A;  4TXW A;  5EP9 A;  1NLS A;  2B9V A;  2VZ1 A;  2Y34 A;  2D98 A;  3B93 A;  2D6N A;  2ZGU A;  4FPY A;  4HVR A;  1AXZ A;  1AX0 A;  4K8R B;  4ZY9 A;  3TAY A;  1Q8Q A;  3WXP A;  2ERF A;  3G6J B;  5GZC A;  4FQZ A;  5ACA 3;  1HXS 3;  3M3E A;  4Q1P A;  4IE0 A;  3VZL A;  3N9P A;  1W9T A;  1T6B X;  2RS5 3;  3ZFF C;  4LBM A;  1DHK B;  4AAX A;  1RUN A;  1CZT A;  2UUR A;  4MYE A;  1XNA A;  1JHJ A;  1W8U A;  2QNK A;  3OGS A;  4Y20 A;  4E27 A;  5LA1 A;  2DV9 A;  2G9G A;  1TMF 3;  1UQX A;  5FP8 A;  3X29 B;  3TEY A;  3ZYH A;  4Q4Y 2;  4CCN A;  1ZRC A;  2VZU A;  2JDK A;  5JZG C;  1BZW A;  3B7M A;  5FO8 B;  4QU1 A;  3GGL A;  3R4D B;  5IVF A;  1E5R A;  1NCR C;  2DTW A;  4Q0U A;  3WUC A;  1URX A;  4EV0 A;  1ZBE 2;  4YWA A;  4P9W A;  2WO2 A;  3ZKY A;  3WP3 A;  2QQU A;  3N9O A;  5A3P A;  1LUL A;  4PQ9 A;  1HLC A;  4NHL A;  1X50 A;  1VIW B;  4JV4 A;  2EVX A;  3TOJ A;  3ZXL A;  1XYN A;  3OGJ A;  4GD4 A;  2L9L A;  4WBB A;  3DEM A;  4LTA A;  2GNB A;  2XBO 1;  5J96 B;  2VJX A;  2QE3 A;  3TYJ A;  4K40 A;  1J1T A;  2JXA A;  4QKF A;  1V6K A;  4QPI B;  4QM8 A;  3WF1 A;  2NMN A;  4FFF A;  2GME A;  3CNA A;  5E1R A;  1W9Y A;  3PL0 A;  3FMG A;  4IDZ A;  5FXZ A;  3SQO A;  3LZZ A;  4AI8 A;  5FZ9 A;  3OBR A;  4Q4X 2;  1HJF A;  2XWB B;  4PJY A;  2HWC 2;  4FPK A;  4B4P A;  4EZH A;  2VCB A;  4KBB A;  5FRE A;  3U37 A;  2LRP A;  5AFE A;  3POF A;  5J36 A;  3C3V A;  1H9P A;  3VBH B;  3H8X A;  5A32 B;  3J8F 1;  3AJY A;  2K9Z A;  4DUV A;  2WN3 A;  4ISQ A;  4NRO A;  4QPI C;  1H1M A;  1NUK A;  1RL3 A;  2Q1M A;  4ASK A;  2E7Q A;  1VRH 3;  1YCI A;  2E9Q A;  4ORF A;  4Y1V A;  4OQ9 A;  2W08 A;  4ATF A;  4HT1 T;  1NOV A;  1BMV 2;  4YZ4 A;  1H2K A;  4Z1V A;  2MEV 1;  2VU9 A;  4BIO A;  4P02 B;  1FMD 3;  1MAC A;  4P5Y A;  5IWF A;  4QQL A;  5LK7 B;  4MGQ A;  1O59 A;  5A7W B;  1WCU A;  2CDP A;  5F6L B;  4PIX A;  5KBF A;  3I2J A;  3FUQ A;  4DOU A;  5FFO C;  2BOI A;  3VBH C;  4NIG A;  1RUE 2;  4IGQ A;  1W05 A;  5FIX A;  1W6N A;  4M0H A;  2J1U A;  2ZML A;  4QD2 A;  4RQP A;  3W21 A;  1SDD B;  1CWP A;  3EQE A;  5H9S A;  5E88 A;  3DV8 A;  4GWI A;  4Q8L A;  1YXW A;  4LOR A;  3IWZ A;  2RS1 1;  2PQS A;  3VKO A;  1EAH 2;  4AGG A;  4CEY B;  1WCS A;  3URF A;  5T52 A;  1KDK A;  2FD8 A;  1TVG A;  5G04 L;  1GZW A;  3RZG A;  1W8H A;  5FUI A;  3MLJ A;  1F31 A;  5LB6 A;  1E5H A;  5CB7 A;  1OLM A;  3AMP A;  4FO9 A;  4YNI A;  2RMU 3;  1AJK A;  3WUD A;  1MS9 A;  5JOX A;  3LKJ A;  2E7T A;  2IXH A;  1JHN A;  2VUD A;  1WD4 A;  4QPG A;  1O4T A;  3V64 A;  1W2T A;  2UU8 A;  1TNF A;  1WUV A;  2WFF 1;  1KFU L;  3H3L A;  3PVN A;  5FZI A;  4EN9 B;  1UAI A;  4AE2 A;  4FPC A;  4XF3 A;  3MPP G;  4RFR B;  2E31 A;  1X8M A;  2WL1 A;  3HJR A;  4JDO A;  4L0P A;  5HCA A;  2D40 A;  3ZN6 A;  1UOB A;  5CU1 A;  1W6M B;  3V0A B;  3E97 A;  4JC1 A;  2PXJ A;  4YW1 A;  4IV3 B;  4O9G A;  3NAP B;  2GN7 A;  4BA6 A;  2R49 A;  2D3R A;  2HWE 1;  4ARX A;  5FK7 A;  1WME A;  2YU1 A;  4S2D A;  1VBB 2;  3PME A;  4MLO A;  5FZ6 A;  3JUU A;  2RS3 3;  1QDO A;  2W0X A;  3CHX A;  3MW3 A;  3NJZ A;  3NST A;  3H3U A;  2JJ6 A;  4LKS A;  5JOY A;  1GV9 A;  1OBN A;  5GLU A;  4JKM A;  1D0H A;  1YRZ A;  5DDJ 3;  4B7K A;  4D7T A;  1MQT B;  2X09 A;  3I3Q A;  1HX6 A;  1HXS 1;  1OH3 A;  1N1S A;  2ZX1 A;  3A0K A;  1AHS A;  3R0R A;  4K7J A;  5KHK A;  1K3I A;  4IV3 C;  3OY8 A;  3NAP C;  2DUO A;  2ET1 A;  1XSR A;  5A3T A;  3OGR A;  2E53 A;  1LGB A;  3KM5 A;  5I0T A;  5FXV A;  4YGB A;  3U4S A;  1HDK A;  1TMF 1;  1HRI 3;  2WZR 2;  2ZGL A;  3I7D A;  4P9I A;  5HXM A;  2Y6L A;  2I07 B;  3VBS A;  5L9R A;  1LR5 A;  3O1S A;  2GC2 A;  2OUJ A;  1PIV 2;  1J83 A;  4NHK A;  1FX5 A;  3HN1 A;  5KXC A;  1V6O A;  4XOG A;  4JTN A;  4P9G A;  4CEW A;  1PGL 1;  4HN1 A;  5JCT A;  2R06 2;  4MUV A;  3FN9 A;  2BP6 A;  5E6H A;  3QH6 A;  1WLT A;  2VUJ A;  1AYM 2;  3AP6 A;  3TNP B;  1SLC A;  1VAK A;  1OKQ A;  2DVA A;  3CKH A;  3LPG A;  5FYS A;  4Z92 B;  2EIG A;  4TWT A;  2DCZ A;  3OPW A;  1TME 1;  4FBF A;  3RZM A;  2R16 A;  1CD3 G;  1QF3 A;  2F6B A;  1XRU A;  1PO1 2;  1X36 A;  4CUA A;  1JZ3 A;  4CDQ A;  5GAL A;  3VBO A;  2QQJ A;  1JYV A;  5FK8 A;  2TBV A;  2JDN A;  1UKG A;  3M3I A;  2Y38 A;  3IBM A;  4A3Z A;  4KG8 A;  2GNT A;  2JIC A;  3QH7 A;  3ALQ A;  5K0U A;  4Y26 A;  4EE2 A;  5IUQ A;  2ZHN A;  1TQ5 A;  1XNC A;  4GXL A;  5CG9 A;  1YYN A;  1PMJ X;  3AXD A;  4P5H A;  2BU9 A;  2ZAC A;  1QIQ A;  5C8C A;  5IK5 A;  5JUV A;  5FCC A;  4NR1 A;  5FY1 A;  4Q27 A;  4XFG A;  3TWI A;  3AYE A;  3I49 A;  3IB3 A;  1H8T A;  4XCB A;  4GWN A;  5C3R A;  4J6G A;  1VRH 1;  2Y6G A;  3B01 A;  5LAS A;  3ZXJ A;  1UW8 A;  3NV1 A;  3O5S A;  4LE3 A;  2GP3 A;  2NZ9 A;  4BJ0 A;  4XAA A;  3LEI A;  4W6X A;  1UPS A;  5FMO L;  4BQ4 A;  3ELN A;  3B94 A;  4X6R B;  2ADD A;  3FE5 A;  4LO8 A;  4XJZ A; 
#chains in the Genus database with same CATH homology
 5FZL A;  5FYY A;  5FZ1 A;  4AI9 A;  3N9N A;  3PUS A;  5F2W A;  4XDO A;  4LIU A;  4CCJ A;  2YBK A;  3ZLI A;  5IVJ A;  5FY8 A;  3KV4 A;  5FZI A;  4BXF A;  4CUG A;  4GJY A;  5FZG A;  5FJK A;  5ANQ A;  5F39 A;  3AVS A;  5KR7 A;  3DXU A;  5FZ0 A;  2P5B A;  3K2O A;  3PUQ A;  5FZ7 A;  5FPL A;  2OX0 A;  3N9P A;  3N9M A;  3N9L A;  5FY7 A;  5FPV A;  2Q8D A;  5FZO A;  1VRB A;  5FYB A;  4D6S A;  4QXH A;  3PTR B;  5A7Q A;  2PXJ A;  2YPD A;  2XXZ A;  5A7O A;  2GP5 A;  5FP8 A;  3AL5 A;  3N9Q A;  2WWJ A;  2YBS A;  2XDV A;  4CCN A;  2YU1 A;  5FZ6 A;  3KV5 A;  5CEH A;  4CCL A;  2XML A;  4QU1 A;  5F2S A;  3U78 A;  5IVF A;  5FPA A;  5FZA A;  4EYU A;  3NJY A;  4Y33 A;  5IVC A;  3KVB A;  3KV9 A;  5LW9 A;  5FUP A;  5F32 A;  5FYV A;  5FYM A;  5A3P A;  3N9O A;  4UF0 A;  5FPB A;  4Y3O A;  4IGO A;  4GD4 A;  5IVB A;  5FYI A;  5FUN A;  5FZH A;  2OQ7 A;  4QXC A;  4D6R A;  5A80 A;  5A3T A;  5FP4 A;  2OT7 A;  3U4S A;  5FYT A;  3PUR A;  5FXV A;  3AVR A;  5FZM A;  5A3W A;  4D6Q A;  2OQ6 A;  3PU8 A;  5FXW A;  5FP7 A;  5FY4 A;  5FZC A;  2W2I A;  5FPU A;  5FZ3 A;  4BIS A;  5FP3 A;  5FXZ A;  5IVE A;  4QX7 A;  4QX8 A;  3ZPO A;  5A1F A;  5FZK A;  5IVY A;  5FZ9 A;  2YU2 A;  5A7W A;  5LY2 A;  4EZ4 A;  4CCM A;  5F3G A;  5FYH A;  4EZH A;  4QWN A;  5E6H A;  2Q8C A;  5FZ8 A;  5FP9 A;  4UF0 B;  5FZE A;  5FYS A;  4C8D A;  4TN7 A;  4BU2 A;  3KV6 A;  3OPW A;  4LIT A;  4LIV A;  3RVH A;  4V2W A;  5A7N A;  4ASK A;  3UYJ A;  5FZF A;  4DIQ A;  3OPT A;  4URA A;  5FZO B;  5FZ4 A;  5A7S A;  4CCK A;  4V2V A;  5FY5 A;  5A7P A;  4QXB A;  5FZD A;  4Y4R A;  2Q8E A;  4GAZ A;  5F5I A;  5FYC A;  5LY1 A;  3PDQ A;  3PUA A;  5A3N A;  4AAP A;  5FV3 A;  5IW0 A;  4CCO A;  5F3C A;  4HON A;  5FXX A;  4CSW A;  5IWF A;  3K3O A;  4NUB A;  5A7W B;  4E4H A;  2XUE A;  4LXL A;  4XDP A;  5ISL A;  4IGP A;  5FWJ A;  5F37 A;  4IGQ A;  5F5A A;  2YBP A;  5FWE A;  5FZB A;  3LDB A;  3PU3 A;  5IVV A;  4DO0 A;  5FY1 A;  5FYU A;  3LD8 A;  3AL6 A;  2WWU A;  3DXT A;  3K3N A;  5A1L A;  5FBJ A;  2OS2 A;  5FYZ A;  4HOO A;  5K4L A;  5F5C A;  5LWB A;  2GP3 A;  5FJH A;  5F3I A;  5FY9 A;  5FY0 A;  3KVA A;  2VD7 A;  5F3E A;  4GJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...