5FZ0A

Crystal structure of the catalytic domain of human jarid1b in complex with 2,5-dichloro-n-(pyridin-3-yl)thiophene-3-carboxamide (n08137b) (ligand modelled based on pandda event map, sgc - diamond i04-1 fragment screening)
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
462
structure length
453
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with N11213A
rcsb
source organism Homo sapiens
molecule tags Oxidoreuctase
total genus 143
structure length 453
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fz0A01
3N9PA 2OQ7A 4Y3OA 5FUPA 5FZOA 5FZ0A 2XMLA 4QXCA 5FYCA 1VRBA 3U78A 5FJKA 4GAZA 3LD8A 5F3EA 4IGOA 5FZBA 2P5BA 5FP8A 3KV6A 5FWJA 5FZ8A 4CCMA 4EZ4A 5A1LA 5F5AA 5A7NA 4GJYA 5IVJA 5LW9A 5FZGA 2Q8DA 4TN7A 5FP7A 2YU2A 3AL6A 4IGPA 2OQ6A 3N9NA 4LIVA 5FZ4A 3PU8A 2OX0A 4IGQA 4QX8A 4CSWA 3N9QA 4D6QA 3PUSA 5FYMA 5FZ7A 4D6SA 4DO0A 5LY2A 4HOOA 2XDVA 4DIQA 4CCKA 2YBKA 2Q8CA 3ZPOA 5CEHA 2OS2A 3LDBA 4URAA 5IVFA 5FP3A 4V2WA 2WWUA 5FZMA 5A3PA 5FYSA 5F3GA 3KV4A 3N9OA 3AVRA 5A7QA 5FPAA 5LWBA 5FY8A 5A80A 4QXBA 3KVAA 5F3IA 5FPBA 4XDPA 3ZLIA 3KVBA 3PU3A 4LIUA 5FZIA 5A3NA 5FYIA 4QWNA 3PDQA 5LY1A 4CCJA 5FPLA 3N9MA 4BXFA 5FZKA 5FWEA 5ANQA 5FPVA 5A7WB 4BU2A 3KV9A 5F5IA 5F2SA 2YBSA 4BISA 5ISLA 5FZCA 3OPWA 5FZAA 5A7SA 2YU1A 4CUGA 4UF0B 5FY5A 5FZ9A 5A1FA 3K3NA 5FZDA 5KR7A 4QU1A 3DXTA 3K2OA 5F39A 5FY0A 3PUQA 5FYUA 4C8DA 5IVBA 5FZFA 4V2VA 5FY1A 4EYUA 5FP9A 5FZ3A 5FY4A 5F37A 4NUBA 5IWFA 4Y4RA 3RVHA 5FYHA 5A7OA 4CCNA 5FBJA 2XXZA 3U4SA 3AVSA 5FXVA 5FYYA 3PTRB 5FJHA 3PUAA 5FZEA 5FZHA 3OPTA 4QXHA 5FZ1A 5A7PA 4ASKA 5IVVA 5IW0A 5A7WA 5FP4A 5F3CA 4QX7A 4LXLA 5FXXA 5FZOB 5FY7A 5A3TA 2GP5A 3DXUA 4XDOA 3KV5A 2OT7A 5FV3A 5FXZA 4UF0A 5IVEA 4CCLA 4AI9A 3PURA 3K3OA 4CCOA 2WWJA 5IVCA 4E4HA 4Y33A 2YPDA 3NJYA 5FYVA 5K4LA 5FZ6A 4HONA 2Q8EA 5FXWA 3AL5A 2YBPA 4D6RA 4GD4A 4AAPA 5E6HA 5FUNA 5FYTA 4GJZA 2W2IA 5FYZA 5A3WA 2VD7A 5FYBA 4EZHA 2XUEA 5F5CA 5FZLA 5FPUA 4LITA 5F2WA 5FY9A 3UYJA 3N9LA 5F32A 2PXJA 2GP3A 5IVYA
chains in the Genus database with same CATH superfamily
1O3QA 4XW3A 2F6BA 3J4UH 2JD4A 4NJ4A 5FYCA 1IG3A 3WHTA 1GSLA 4B29A 1ZM1A 1OLME 4CU7A 1FXZA 5I93A 3SQOA 4QT6A 2O8QA 1HKDA 1L7QA 4AQSA 2X09A 5C8CA 3O1SA 4LJHA 4COVA 2HLEA 4PF5A 3LAGA 3H1YA 4MXWA 4IGPA 1J58A 1OVSA 3H42B 3HJRA 4Z2WA 4BQ1A 1AL21 3TYJA 3NNLA 2BFUL 5CFCC 4Q4W2 3RI9A 4D6SA 2C1FA 1C28A 5T5JA 4D8MA 4I01A 1UCXA 1QQP2 2ZOEB 3RPQA 1E5RA 3ZPOA 3HNYM 4MGQA 4CU8A 4UAPA 5CISA 5LCWL 1ASJ1 4HVQA 1I9RA 3FN9A 4N43A 3WW1A 1VBD1 5FO7B 1DLCA 1JN2P 4CDQA 4DMIA 1C3HA 1NA1B 4FXKB 5LWBA 1JZ6A 4BM8A 2V5DA 2D44A 5GALA 3WDWA 3VBFB 3RMYA 3ZLIA 5EZWA 1AL0G 2JWPA 1AR73 2Z42A 1YFWA 4IEWA 5JR7B 3JBG1 2C24A 2CNAA 2X8KA 1PHMA 4GMP3 1RUNA 2RDSA 3J26N 3I3QA 1GV9A 4O61A 1NXD1 5FFOC 4OLLA 4QB6A 3CJIC 2Y26A 2YMZA 5IUQA 4FPHA 3HT2A 4V1PA 3VHRA 1B09A 3NNJA 4FP3A 4ONUA 4JRAA 4LPLA 1OOPB 1H4HA 2XWJB 3K2OA 1X8MA 3NJZA 5HXVA 1I5ZA 3UNPA 3PUQA 1ENSA 1ZZ9A 3DF0A 5DAQA 2Q1ZB 5IFTA 1UOFA 2A75A 4FXGB 2IFRA 3G6JB 4BMEA 2IC1A 4DXTA 2PHFA 1VRH1 4YW5A 5BPXA 2OPWA 2HWE3 2EIEA 4P5HA 5EIYB 2HWF2 1X33A 2WNVB 4MOAA 5FXVA 4LE3A 2ADEA 1SLCA 3ITQA 4AVBA 4LLFA 2D6MA 1WMDA 3ZDSA 2Y6KA 4R9BA 5LBBA 2A7AA 2BP6A 4NHXA 3B00A 1LTEA 5E8AA 5F3CA 4LXLA 1ZZCA 1W9SA 3C7HA 2AACA 5FXXA 5JXIA 1TNFA 2VR4A 3DUIA 4YVSC 2VTXJ 1UYYA 4GWIA 1AX0A 2EIBA 1GP4A 2XHNA 2YYOA 1JXNA 1F4AA 2J22A 2W1QA 4QDQA 4X8NA 1LAJA 2FCTA 1RUC3 1XRUA 2CDPA 1YI7A 1QDOA 1WW6A 4EQVA 2P17A 1UL9A 4ASMB 2DYCA 1K3IA 2MNGA 4AVSA 4BHPA 3KSCA 4FOVA 1W0NA 3WCSA 3WP3A 3USSA 2RV9A 1H8TC 3H0OA 4OCTA 5JSOA 3VLBB 1TMF2 2OA2A 1HRI3 1H9PA 1VJ2A 1Z7S1 3QH7A 4IEOA 4LITA 4KG8A 4N90A 5F5CA 5FY9A 4BH9A 4KGGA 1W6OB 3PVOA 2C26A 3T2TA 5HI0A 1EAH1 1KDMA 1OUXA 3LFMA 5EQUA 3WW3A 1YQ2A 3ZYBA 2ENRA 4IUGA 4R8HA 5FAXA 3WXPA 3ZXKA 4CRQA 4Y24A 1AYM1 4XZUG 5DUXA 2VZOA 5GM0A 2JX9A 4TWTA 2VMHA 5I0TA 2MEV1 4CP1A 2F17A 1CZTA 3ZXEA 3AMQA 3FZ3A 4Q26A 5GLVA 2R043 2WZR1 2WR9A 1YJKA 2X5IB 2VNGA 5ACA2 4I2OA 1AYN2 3S7IA 4UFIA 2Y6GA 3ACGA 3GZUC 5IAVA 1WBLA 1WCUA 4J1WA 4XF1A 3LKJA 3KCYA 2B45X 5F9TA 3VBRA 3TAYA 5CFDA 1U0AA 1FYUA 4AHZA 1IS6A 4QB2A 3VZNA 3ZM8A 4WVMA 2DFBA 4NIGA 3N36A 2PA7A 3DYPA 3IMMA 2QQJA 2QQPA 4GXLA 4CUAA 3THTA 2GMPA 4M3CA 4NVPA 1AF9A 4XXPA 2VOTA 5EPAA 2ZX1A 3JB4C 3NSTA 1FMD3 2EIGA 1W9TA 2QZ2A 3FUQA 5F3IA 5TSWA 4BQ2A 5JPNB 4M3CF 3CQOA 3KCCA 3ABZA 3KVBA 3PU3A 4A6OA 1VBC1 3MZHA 2HEWF 3CJXA 1O59A 3EMRA 2ZXQA 2VPVA 4CEWC 1H6XA 2GAUA 4BXFA 4IEVA 1IGOA 5FPVA 4QX1A 1SDWA 2D3PA 4CXYA 2VBDA 1LEMA 1C8NA 2BBAA 4YFWA 3UGHA 1DU3D 2DU1A 3UK9A 1GWLA 5A3OA 3LSDA 4NWWA 4CUGA 4TXWA 4GMP1 5FZ9A 4K40A 4YPJA 4Q4V3 2PHTA 1MEC2 5LBCA 1QQP1 3F95A 1EPWA 3WF2A 4XUOA 5IVBA 1YO8A 4FFGA 4YZ4A 3GZEA 1DQ6A 3VKFC 5FZ3A 1XNBA 1NQDA 4RFRB 4D7SA 4DEVA 2XJUA 5A7OA 4CUCA 4OUEA 3ZN6A 4NMIA 3OY8A 4U2AA 5JSPA 1SLIA 4LTAA 5F7UA 3AKTA 5A3UA 4XJ8A 4UI9L 4YG6A 1XXNA 3PMSA 3EYPA 4K8FA 1ND2B 4R9CA 1RIRA 3ZX7A 1UY1A 2DTWA 2R071 2HWE1 2ZMLA 3O5SA 5EYXA 1EUTA 4XFCA 4XIKA 4LORA 2AUYA 3AP9A 2Y0OA 2SBAA 2QFEA 1I5PA 4FAGA 3SCGA 1YXWA 3T08A 4L8QA 3KT1A 2ET7A 2A3WA 2VUCA 4LKSA 1ZBA1 1JMUB 4CCLA 5C8CB 1GWMA 3W5NA 2WT0A 2R1DA 3L2YA 4Q4X2 3I3DA 4UW4A 1H9WA 3RWNA 4A41A 4CDWB 4MXWB 4FAHA 3VKMA 5T5PA 2W68A 5A6XA 3AL5A 1VMFA 3ROUA 1CD3G 5ABJA 3O1VA 4LMFA 2GMMA 1B35C 1RUC1 2VL4A 3OYWB 4AGGA 4OYUA 1YC61 3JQWA 5L9RA 3OSDA 5T54A 1COV1 4PI0A 4Z2AA 5CA6A 1OQDA 1JU3A 4IE6A 3G7DA 3TN92 4R4XA 1CESA 1VBA2 4K1YA 4D7YA 2RDQA 1PX3A 2YFUA 2ZAAA 3NWKA 2ZGTA 4PT6A 1FPN3 3UESA 1CJPA 4Y22A 1W8UA 4CDQB 5KXBA 1RINA 4HSJA 1XSRA 4XDQA 3LPGA 5FWJA 1OT5A 2QQLA 1R082 5EFUA 4GJYA 1S0JA 4XBNA 4A4AA 5L7OC 3I3EA 3FFZA 2GN7A 1VBE1 3GJBA 1QXPA 3FUOA 4XETA 2VZSA 4GZ9A 1Y9QA 2WZ8A 1JW6A 1MR5A 3I8TA 2PHUA 2CSGA 4I09A 5CG9A 2VAUA 2DUQA 1BK0A 2J1VA 3D6EA 1CX4A 3PLQA 2EAKA 1ULDA 2V5YA 5LY2A 3WQBA 5BNOA 5IJRA 5GLZA 1RITA 1A78A 4QPIC 2WYSA 3O1OA 2Q30A 2VECA 4IL7A 3LWCA 1UO9A 1MS4A 4TLGA 5FDBA 5DUVA 4DQAA 3ZFGB 1G9FA 1NZIA 3DKWA 3OD4A 4O9GA 4ARXA 2EVXA 2D97A 4QMAA 1TVGA 4OI2A 4RS5B 5GZFA 1ZRDA 1V9U2 4QKDA 1PO12 5FYIA 5L36A 1N1SA 1PMIA 4AXOA 2A1XA 4XAAA 1J84A 3GGLA 5BY5A 1DDLA 4Q27A 5J7MA 2RS31 3E6CC 5AFBA 5KHGA 2OYZA 1DLLA 2VTXA 4AW7A 4L2NA 1NT0A 4IQPA 5ACA1 1BJQA 5EP9A 3N7JA 1O5UA 3MPBA 4Y1UA 3VZKA 1QNYA 4CP9B 3V0BA 4JCKA 5KWRA 1PZ9A 2XL7A 1PO21 3F2ZA 4I0WB 4QDSA 5DABA 3SISA 3WP6A 1QJX2 5L19A 2D43A 1BVVA 4Q4Y2 4YGCA 5J1XA 4FPFA 3WY6A 4C8DA 1GZ9A 3RZHA 3ZVXA 4EYUA 4E4DX 3DKQA 4SBVA 1XC6A 5F37A 2HWD2 3AKQA 1EYBA 4JGYC 4BOWA 1FOD1 1EV12 4Q4V1 5A1AA 3ECQA 2RR12 4B7KA 3MUY1 4NOTA 4JAAA 4N53C 1LOGA 1ZZ7A 3WG2A 1QGLA 4Z1VA 2O14A 4QXHA 1ODNA 2PLV2 4ASKA 5CFCA 2RDRA 3RRDA 4Y4YA 1K5MB 1ZRFA 1UQXA 1ZRIA 1W9YA 5D8AC 2GDFA 3RZZA 1KD7A 3GCWA 3VBHC 2OPKA 3D0JA 4LE4A 3N7MA 2UYBA 3JZVA 3I49A 1DZRA 2QQWA 4KBZA 5ANNA 4XFGA 5DXDA 4JHTA 1ND3C 2XOMA 4AGVA 1RHI2 5C33A 4HXCA 3J8F2 4Z82A 3VV1A 1OF3A 4GJZA 4XQ4A 2GU9A 1H30A 4GMP0 2VD7A 3S7EA 4ATFA 1D7PM 4N7IA 4D0QA 1TEIA 2AZ5A 1ZVFA 3VBRB 3WF4A 4EZHA 3VKOA 1H2KA 1POV3 5J37A 3B9CA 2DUOA 2JENA 3CJIA 4FQZA 1R093 5FUPA 1XQNA 1MS1A 4LOSA 4M3CB 3S57A 5GZEA 1JZ2A 3VHNA 3WX5A 3CDZB 4BE3A 5A6QA 5JZGB 4YARA 3O1UA 3HOBA 1BBT1 1NYWA 3GBFA 1D0HA 5FLHA 3BTXA 1VMJA 3N9NA 3O1PA 1UY4A 1QMJA 5FO9B 3OBAA 2XGXA 2DURA 3DV8A 3N9QA 3EBRA 3QBQA 4F3JA 4RHV2 1TQ5A 2WS92 3ILNA 1W8NA 4O7XA 1DGWA 4XF4A 3ES1A 3AYDA 4XEZA 5EJ1B 2G9FA 2RS13 1MZ5A 5J48A 4Y26A 4IW3A 4YVSA 3WG4A 4IV1C 2VY0A 3JCIA 4L97A 4OHXA 5A3PA 1PNFA 1A8DA 3J9SA 3WT3A 2R062 3B01A 4K3UA 1RJ7A 1CIYA 1AR91 4KWUA 3ST7A 1CAWA 4WV8A 2WNEA 4R9DA 1NG0A 1SEFA 4PHZA 3HR9A 2JEMA 1MS8A 1H8TA 4P9YA 1NY72 2RHPA 1X7NA 3MFAA 4MHRA 3VDAA 1Z0HA 4QX0A 1F35A 5KBFA 3VB9A 2GN3A 2WQ4A 2YG0A 3T4VA 1W8WA 4LUMA 4S2FA 4HZFA 3U1XA 4LBJA 1ENQA 4Q1RA 4OQ9A 1GP6A 3BALA 4LQRA 2VMDA 1H2LA 1QOOA 3MIHA 3AP6A 3VBUC 5FBZA 3DXTA 3M1HA 1BCXA 2JJ6A 5FPXA 3OB8A 5FZFA 4AI8A 1AR81 1XBFA 2Q0AA 3ZKYA 1WLTA 3D3AA 3QH6A 3A21A 2CDOA 1R1A1 5FMOS 4MGTA 3HPNA 4BQYA 1UXXX 2XJVA 3PIGA 3NAPC 3APBA 1PGW1 3SEEA 2RJ2A 3IIIA 1HB2A 1JBCA 1LB2A 2FDGA 3MHZA 5A7PA 4BLIA 4QKBA 4UW5A 3O1RA 4XUTA 1YRZA 3CF6E 3OGRA 4AI0A 3MIFA 2PAMA 4JKMA 1W3XA 3S5AA 4INDA 4Y22B 4ARYA 4RQPC 5AC93 1SBEA 1OBNA 1FNYA 4E4HA 2TEPA 4XBQA 3T1MA 4OHWA 2Q4SA 2XVKA 2W1SA 1QNWA 2B9VA 5GJ6A 2A73B 1RUF3 4XJWA 4OQ8A 1XYNA 1SQ4A 4HLTA 5FUNA 5BYNA 1RUI2 4QU2A 2ZGUA 4JDOA 4QQPA 4XHXA 4YG3A 1S55A 3FFQA 4CEWA 1H0BA 4CEYC 5FZLA 1PMJX 1ZZ6A 2CGOA 2RR11 5BNOB 1W90A 1RUE3 2JXAA 4LULA 2ZGPA 1YLLA 5IVYA 2ZX0A 4AVCA 3TNPB 5D1IA 2BWAA 3AYAA 4KG0A 4XCBA 4Y1YA 5ERLA 4UFHA 3VBSB 5FMDA 1XYPA 2JE8A 1MS9A 2XBO3 3OEBA 2BVBA 2IXKA 4GQ7A 5FP8A 3ZSMA 1F31A 1PIV1 5BNNA 1ONAA 1OXCA 5A7NA 1W2OA 3CBNA 2VUDA 4OI4A 1NCQC 4IEZA 4ZKTB 3PTYA 4M01A 3BUCA 2Q1FA 3WZ1A 4W6YA 4FPOB 2ARXA 4P9IA 1JYXA 1QJY2 1BKZA 4LHKA 2YPJA 1H4GA 3NO8A 4DRRA 4JC1A 3POGA 4GALA 1RUJ3 2RM23 5C4WA 1GZCA 1RHI1 4HL0A 4G4FA 1ASJ2 3DL3A 3J8F1 5T5LA 1JZ8A 1X8EA 1X82A 3UL2A 1VBD2 4MYEA 4XUNA 5IVFA 3NNMA 3AMHA 1GMMA 3AP7A 4AAXA 4IESA 1BEV3 2X29A 3GDBA 1A34A 3AVRA 1JZ3A 1ZA4A 4BQXA 3RZJA 3JBG2 4HVOA 4FI9A 1XPWA 1AZDA 4FPYA 4AEDA 4ZONA 5E89A 2E51A 2GNMA 2AENA 1W06A 2VZPA 1UMIA 4UFJA 3BB6A 3HIFA 3FX3A 1B35A 1UY2A 5T5OA 4QPGC 2HWB3 3NV4A 4YGEA 2XKPA 1K12A 4NE9A 2GMEA 4YWAA 4Q0QA 3URFA 4QGNA 5FPZA 5FZAA 2Q5TA 4BLJA 3MIDA 5A7SA 4UFLA 4J1XA 4XQWA 1YQ8A 2HBTA 2WNUA 5DUWA 4W50A 5F39A 3VZJA 5C3PA 5KHHA 4NIIA 1ULOA 1CGPA 2HWC3 1VRH2 4OULA 3U11A 4YM0A 4BDVB 4IEXA 4QGMA 2JDKA 3FHIB 1U5ZA 1ZZBA 4D94A 3BOPA 5IAXA 2QQVA 5L7OA 1A6CA 2UY8A 3QOPA 3BPSA 3A0KA 2R061 1NQJA 1UYPA 1FX5A 4HANA 4RYDA 5FJHA 5FZEA 3BKZA 4FT8A 4LO5B 5FZ1A 3AZXA 4RR3A 1SFYA 1DQ1A 5IVVA 4YM2A 3CJIB 5FP4A 3ZYPA 3VBOC 2BGOA 2JDMA 1XE7A 2WDBA 3QCWA 4AWDA 1DGLA 4FPCA 1IS5A 2DVGA 1NY71 2GH8A 3R6SA 4A2UA 5JPMB 4XFFA 1N1TA 1W8TA 1XU2A 1ZBE3 1LGCA 3AZYA 3LIGA 1NCRA 4QPIA 4UFMA 1WCDJ 4HK8A 2BRTA 2NMOA 5IVEA 1VBB2 1QEXA 5K4LA 2BGCA 1W6NB 3IAQA 3SEPA 1FATA 4DY3A 2VMFA 1OC1A 4AK3A 1C1FA 1RMU3 4IV3C 2O8OA 4IETA 3WDXA 2OZ6A 3KCXA 4I0AA 2WINB 1EAH2 2BNMA 4AL9A 3ZXFA 5IT6A 4GKXA 2YGLA 2ZHKA 3CZUA 4JVAA 4D7TA 1DGWX 1YIPA 2DVAA 3DPRC 5GLTA 3O1MA 5H9RA 1YQCA 2D5HA 1AYM2 4S2DA 1UPSA 4BWOA 5FZOA 5IATA 4Z07A 2WJSA 1I6XA 3KQ4B 3ZN5A 1KFXL 2W0XA 3ALQA 1CAVB 1WW7A 2MEV2 1VRBA 1S4CA 2PHWA 5FZBA 1GOFA 1KQRA 1VAMA 2XJPA 1QJU3 2A6ZA 4AVVA 1LODA 2WZR2 4E27A 1CAWB 4I30A 5IVJA 1HJGA 5LW9A 1JHJA 4WM7A 1STMA 4JGYA 5B4XA 1FV3A 4H2AA 1V6NA 2A70A 3M70A 4N53A 4JZRA 4OI1A 3FHQA 2P37A 3VBHA 1C1LA 1BQPA 2ZABA 1CONA 2ZGMA 4FP2A 1SBDA 1G9DA 4DO0A 3R0RA 2ZGLA 2V4VA 1S0CA 3A0NA 3VD5A 4Q5OA 1LULA 1OPOA 1GWKA 1S2EA 2BTVC 2OS2A 3MDPA 5I0UA 5KXEA 1AR63 1RVF3 3KS7A 2EXHA 4V2WA 5KXDA 2RM21 1AJKA 3GCXA 1AVBA 1APNA 1PVC3 1U12A 1W6QA 2ZGRA 5CYYA 1VALA 1OFSA 4I3GA 4Y5TA 5BXXA 1SHWB 1VBC2 3T0AA 1UOBA 2V4AA 1CAXA 5BV6A 4YM1A 3KVAA 4LBQB 1Q5OA 2J1TA 4M4PA 1UF2C 1WD4A 1ND3A 1BEV1 3NRUA 3WG1A 5A3NA 2QDRA 3EB7A 1Q56A 4FVVA 2DBNA 4NPRA 3C2UA 2YGMA 5FPLA 1EUUA 3S6PA 3OUJA 1RXGA 2C6SA 4P02B 1GZWA 5JMCA 4FTSA 4IEPA 3RQ0A 1OLMA 1POV0 2Y33A 4LO8A 2I45A 1O91A 3PUHA 4JTNA 1DQ2A 3ZFEC 4A3ZA 3ZYFA 3ACLA 1QJY1 5FR3A 1O3TA 2LROA 2BQPA 5LB6A 3MIEA 2HWB1 3V65A 2HYKA 2R0FA 4M0NA 2RG4A 3ME2A 1KRIA 3MV01 3KGLA 2DCJA 4PLOA 5EJ3A 5FY4A 3AJZA 4B1MA 4Y4RA 5LASA 2BOJA 2CYFA 5HXMA 3C3VA 5T55A 1JOBA 4PI2A 3GYDA 1K42A 5A70A 4KU8A 2R072 1HRV1 2HWE2 1WD3A 4E4ZA 4QM9A 2VNOA 1CVNA 3KF5A 4NRMA 2OZJA 1G9CA 5IW0A 2J42A 1Q8SA 3H7YA 2UWCA 1ODMA 3NNFA 3ETQA 4P9JA 2JDHA 4CZSA 2V09A 3AZWA 1Z78A 1ZBA2 5CIRA 5B4NA 3UJQA 2HKXA 4MUVA 2UU8A 4ZU5A 1Q8QA 1W8HA 2QNKA 4IV1A 4KWKA 5BNNB 2R6QA 4XABA 1REEA 2D6KA 4ASLA 3KT7A 1RUC2 2X53S 4YGDA 3INAA 1ZBE1 2VBPA 5JSRA 2ZKNA 4AAPA 1COV2 3FLPA 2QQNA 3POJA 3NV2A 1C8M1 4E2SA 3HAGA 4QXKA 5DAWA 1YUDA 5K0UC 5C4WB 1AJOA 3IMNA 4YW1A 1SPPA 3C8XA 2Y6LA 1J1TA 1GNYA 5T3NA 1RMU1 2G9ZA 4GH4B 1D4M3 4Q2FA 4E9KA 4IXLA 3WW4A 5C9AC 2W52A 4MZUA 3ZXJA 5DZGA 2VNRA 2G1MA 1WCQA 2PYTA 1X36A 4NHLA 2PHDA 3D8CA 4QXCA 4RN5A 3O12A 4GAZA 3TEXA 1Y9MA 3LD8A 4TYSA 1VBE2 4FSJA 4I3PA 1TME3 4P9LA 2QE3A 1NOVA 2ARCA 3WNOA 3BPZA 4AEDB 5LEKA 4QKFA 1F4HA 1L7LA 3U14A 1LHUA 3UV9A 4LIVA 1VBB1 3PU8A 4MLOA 1B35B 1H2NA 4IGQA 2ZHNA 3AC0A 2EF6A 1AUYA 4UT5A 2JG9C 3U4XA 3ENRA 4NRQA 4KWJA 1JUHA 2VCBA 2CHHA 4GB31 4P14A 3VGIA 1YJLA 2WNUB 5LZ6A 2UYAA 3JD73 3WNXA 5D21A 3H9AA 4KH9A 4LHNA 5LA2A 4AFCA 1ZRCA 4GWNA 3K4DA 1JOPA 2HYXA 3R4UA 1OLQA 3CIHA 5FPAA 1LGNA 5KC6A 4AOCA 2HWF3 4YNIA 1E5SA 3DYOA 3OD0A 1PVC1 2RS32 4LIUA 2GNDA 4QM8A 4CE8A 4YZ5A 3C7EA 2VBBA 4AQ2A 2D6OX 4QPWA 4RR3B 4HETA 5FWEA 3SXWA 2BGPA 1MQTB 5FKCA 4CEYA 4YGBA 4E4SA 4QD2A 2YB7A 3I2KA 1G6NA 1PO22 2CTVA 3PVBB 2VZ3A 5FZCA 4LBNA 1WA6X 3OTFA 2YU1A 4QPIB 1NCRB 5JUVA 3K46A 5FZDA 1LENA 1YHFA 3T2QA 1YCIA 1FOD2 4Q4V2 2WWSA 4ET7A 4CDXB 2PTMA 1HN0A 3CMGA 1LESA 1NCQA 1T2XA 3H3UA 4CTEA 2KR2A 4CCNA 4N8MA 4GULA 3S30A 2H0BA 3C7FA 1TMF3 1G86A 2A6VA 2PAKA 5CAZA 4PDWA 3OPTA 2BBVA 3GNEA 5A7WA 2E32A 1FT9A 3K48A 1OA3A 5FZOB 1ST8A 1YYNA 2K9ZA 1AR71 2BVVA 3KB5A 1G7YA 3I97A 4K1ZA 1ULFA 4LHLA 2OT7A 5BUVA 1SG3A 1DGRA 1WKYA 3KQRA 4FOQA 5FXZA 2E9QA 4AHXA 4CCOA 5J36A 3V64A 2JDZA 4Y33A 4OVEA 1RUG3 1NA1C 1SLLA 2PHLA 3H3LA 4WM7B 4CCCA 4JGYB 2VCCA 5JOZA 1IS4A 1VLNA 3O0XA 3N4MA 3ZYRA 2ADDA 1RC6A 1AYN3 3HQUA 4GD4A 4N53B 3VBFC 3ZSEA 4L99A 2W39A 3VZOA 3GJAA 2VOXA 1DBNA 1YNAA 1IPKA 2QQUA 1HXS3 3I2IA 4QPGA 1UY0A 1OUSA 4P5YA 1UKRA 1HB4A 2VOWA 4Q1PA 1DP0A 2B46X 3L2HA 2B8MA 4KL1A 3UT0A 5IYYA 3LIHA 1HB1A 1QOTA 3UJOA 4Y3OA 4LO7A 4META 4Y5Z0 4LK6A 2EXKA 3WNMA 3VBHB 1W6QB 1M06G 1OOPC 1BBT2 5D2AA 5F3EA 4COUA 1D4M1 3M7AA 3KV6A 1CAXB 5E16A 2CU5A 3RS6A 2IFWA 2LUWA 5A1LA 5C3SA 4DFSA 2RS53 3NL1A 1JS9A 2BPA2 2W08A 1UX6A 5FZGA 2WQZC 2XHKA 2Q8DA 4AHYA 4KWLA 2B4KA 3VL8A 1LOBA 3WDUA 3ZSLA 1CR7A 2ERFA 1GZWB 2WNVC 1N3QA 3NVCA 3UGGA 1BZWA 5F5QA 4XYXA 4LO6B 4BXSV 5E88A 3VHOA 3Q8CA 4C0HA 2E7AA 5LA9A 2X10A 4NO4A 4CCKA 1UZVA 3AJYA 1A8MA 1MEC3 4RD7A 3H3ZA 4N43B 4YLZA 2NN8A 2IXIA 1HRI1 1AR92 1KS4A 5JCTA 4CU6A 5C3QA 1MVEA 4OUSA 4OHZA 2PMWB 1W05A 3RZKA 3WD5A 1H1MA 1PGL1 2IVIB 4C1WA 5IK5A 2ZCWA 4QXBA 3JXSA 3LE0A 2A3XA 4P00B 3JD71 1NX9A 4IV3A 2WA3A 1YQ5A 3E5XA 2QCSB 3UKNA 5HCHA 2J1RA 3MI8A 5LY1A 5LATA 1WLCA 3HQRA 4JGZC 5LA0A 2OUJA 4Z8BA 3D4KA 4QHZA 5ANQA 3MYXA 3R4DB 4MGYE 4BU2A 2Y0IA 3I4IA 2WIIB 5L73A 3ZIXA 4BQ3A 3GM8A 4MG2A 2JDAA 3DPRA 4MX3A 3OPWA 3J7NA 2R041 1NE4A 3LDKA 1XOYA 1O3SA 1DYKA 4IV1B 3POSA 1AR82 1GUIA 5A3LA 1YIFA 1GU3A 2EXIA 2KM2A 3FBYA 2JG8C 1WWYA 2VOKA 1JYTA 1R1A2 4FCAA 1L7RA 1UX7A 3KF3A 2CAVA 2UWAA 4V2VA 1D4VB 3AYEA 3POIA 5FY1A 4B8EA 4E8CA 4EV0A 3QACA 1PGW2 2BW8A 1NZCA 4H7LA 3RVHA 2XVGA 1V6MA 1UIKA 1DZTA 2X5IC 1K5JA 5JOXA 4S2GA 1J83A 1SPPB 2GC2A 2ZZQA 3TN93 2WO7A 3FLTA 4HT1T 1FMD1 3GALA 2XWBB 4K21A 1VBA3 3M4FA 2IWGB 4DOUA 4NROA 3SCHA 3VDBA 1OKQA 4QX7A 4DXZA 2GP5A 4LBOA 3VZMA 5CKQA 2AYHA 2W87A 4EE2A 2XKOA 2CWSA 3MW2A 2H6CA 4KU7A 2CAUA 4TSVA 4QAWA 3RYRA 5IVCA 1GLHA 2PQSA 2ATFA 5JXHA 3NJYA 5FYVA 2GH2A 4BIFA 3I59A 4BQ4A 4MSVA 3K75B 1S1AA 3IB3A 5FYTA 3I3MA 4OUMA 2B9UA 1MACA 1W9FA 5HV4A 1RUG1 4NN0A 2WA4A 2XUEA 2DDUA 2VW2A 4GKYA 2Q8OA 3ZIWA 5FPUA 4HBNA 3J7LA 1JYCA 1NLRA 1XE8A 1QU0A 2W92A 2JDNA 2BNNA 4TLFA 2OQ7A 1LOFC 2FMDA 1AHSA 2NMNA 1PIV2 4PF1A 3WQ1A 5DQ0A 4WZCA 4OI0A 2WUHA 1HXS1 3TRSB 5A32A 5LA1A 2Y8KA 1UIJA 4PLMA 3NKGA 3LEMA 4QQHA 2XPJA 4QDRA 5FZ8A 1UZZA 5LK5A 5A33A 1V9U3 4NIAA 5IFPA 2AR6A 3LSEA 1PO13 2FDJA 3FWEA 2GC0A 1GNHA 5FP7A 4XCAA 5DAPA 4AI1A 5C5UA 3AL6A 2OQ6A 4XILA 2WQ8A 5JWPA 3ZYJB 2NYYA 4CPBD 3K77A 4QX8A 3ACIA 4B7EA 2VNVA 1N3OA 4CEYB 1N1YA 1YEWA 2AEZA 2WT1A 1UYZA 2RS51 3H50A 5FLJA 5CB7A 4BCUA 1WCKA 2YXSA 4AG4A 2B5HA 5CFDB 3LDRA 1M4WA 3B3QE 3POWA 5FK7A 5H9SA 1SACA 1KS5A 4WVMB 4DIQA 3R05A 2YV8A 4Y1VA 4URAA 2CGPA 5FP3A 4Q4Y3 4A44A 3WP4A 3KM5A 3IN9A 2HWD3 3A4UA 4CDWC 1JOJA 1NCQB 4NPMA 3C7OA 2WO1A 1RGSA 3FL7A 3I7DA 2W95A 4XDPA 3CHXA 3OUHA 4Z92B 1JODA 3OCPA 1FPN1 3PDQA 5M0TA 4PDWB 4Q0PA 3LA7A 5CVRA 1HQLA 2RJKA 5FZKA 1TZOA 2DCYA 3M3IA 5A7WB 4NPLA 2W1UA 4LHSA 1A3KA 3B02A 2QTWB 4PBOA 2ORXA 2ZGSA 3CNAA 4A45A 2FDFA 5F2SA 2K0GA 1LHNA 4OFGA 3T2PA 1HIXA 1D0GA 4IEQA 2FQPA 5A1FA 5KR7A 3LFIA 4EWEA 1HV0A 1QOSA 1VR3A 4CDQC 1WW5A 3LEIA 1LJ7A 1UPIA 2WSVA 4MXVA 1EPZA 3IDCB 2DWRA 4NR1A 3VDDC 5CADA 4XZPA 5JI9A 3ZN6B 3OY8B 1V0AA 5FYHA 1CX1A 4M0HA 3ZR6A 2RMU3 4URTA 2YC0A 1REFA 4FPEA 1ENRA 1W03A 4XTPA 3USUA 4AYUA 4GWJA 5DDJ3 4WZFA 3HBZA 2VVEA 4AF9A 4I0BA 1C5HA 4W4ZA 5GLWA 1V6JA 1W2AX 2ARAA 1GQGA 2VCMA 1RUD3 3UGFA 2TBVA 3I2DA 1CAUA 1F15A 2XLGA 3EQEA 5FY7A 1QJFA 4EWDA 4AFMA 1PK6C 2D6LX 3MF9A 2XG3A 3NQHA 3H1WA 1N1VA 3PURA 3ZXDA 2VO5A 3CU7A 1ALYA 3ZFGC 4COYA 1W9WA 1RUH3 5FZ6A 1QWRA 5SV8A 3H8RA 4LT5A 5ABJB 3OGGA 1IG0A 4RS5C 2BUKA 4Y5SA 4RHV3 3MGUA 2W2IA 2QQMA 3OUIA 1KJRA 3ZDVA 2VMEA 5FMCA 3H8OA 1UMHA 2VUJA 4IEUA 4YZ1A 5LK7B 1PZ7A 5BNPC 4BK5A 4HK9A 3N9PA 1R1ZA 4CXWA 2XH6A 2XMLA 1R64A 3NV1A 4XF0A 2VC9A 1OQEA 1D2SA 1XE0A 1QDCA 4BQ5A 4KGQA 1T6GC 4XURA 4MADA 3KD4A 2VW1A 4QQ2A 4CU9A 4EZ4A 2V72A 1W8OA 3AFGA 1Y4WA 4XMIA 3ZO0B 1YFXA 4FPLA 2Z4FA 3E5UA 4UXAA 2VZTA 4S2HA 1WBFA 1YWKA 1H6YA 2PHRA 2WC2A 2WFF3 5L9VA 2BWCA 2ZMNA 4CSWA 2O1QA 4C91A 1LHWA 5CG8A 2QJVA 5I8SA 2DF7A 2F4PA 5CKMA 2Y64A 1PX4A 4XAEA 1UOGA 3DPRB 3HN1A 3WUCA 4UW3A 3CL1A 3WQ0A 1RUJ2 3HVDA 4JDMA 1K5MC 2RM22 4RGKA 4UBGA 5GZDA 1OPMA 2EA7A 4EN6B 5IK4A 3ZR5A 2HJIA 1LKNA 3LDBA 3SH4A 5KHJA 1LOAA 1EP0A 2R30A 1MZ6A 3K4AA 1SCRA 5FYSA 3VD7A 3WEZA 5C71A 4LBMA 1UMZA 1UU4A 3DEMA 3W5MA 5F3GA 4OHYA 1BEV2 1POV1 4HSLA 4M00A 4Q0VA 1R091 1W2UA 4YW2A 1CPNA 3LEGA 4QX3A 1GZTA 4BK4A 5DUUA 2MHFA 1F5FA 4QWNA 2A6XA 2D6NA 2ZJCA 5K9YA 2VMIA 4CUBA 2ZGNA 3PVEA 3Q9OA 3RZGA 5FQ0A 1WW4A 1TG7A 4ZS3A 4YW3A 3H1MA 2HWB2 1ZX5A 1BYHA 3KT4A 2P6CA 2YBSA 3X29B 2C9AA 1SCSA 4L9BA 3V0BB 1QXJA 2BOIA 1HQWA 2QQOA 2H0VA 3HD8B 5KXCA 3VD9A 4PQ9A 2CV6A 1OVPA 3SH5A 2Y38A 1OOPA 3T0BA 3I59B 3U37A 4J6GA 2JIJA 5FYUA 1MS5A 2JDYA 4E2QA 4GIQA 4C1XA 3VDCA 5JZGC 5FP9A 1HRV2 2RS11 3POYA 4X6RB 4XPVA 2IVJA 4AEKA 1W0PA 3M3EA 4P9GA 5IK7A 1ACCA 1QJZA 2DV9A 2WZPP 3SKJE 3TOJA 5J3UA 4QGLA 2XXZA 3U4SA 3O0WA 2WN2A 3WDTA 1OD5A 3OBRA 5CFCB 3RFRA 4ZXEA 4HKWA 1XU1A 2IZWA 3W20A 2XQRA 3K4ZA 1FAYA 4ZZ5A 2RMU1 1UZYA 1VB4A 4HPKA 2JECA 3E97A 4AVAA 1XSQA 3CZJA 5CNAA 4YRDA 2Z79A 1CN1A 3DCQA 2FDKA 2ILMA 3KLSA 4OZOA 4W6XA 4CP2A 2WSUA 4XIOA 1RUD1 1ZBE2 2W94A 5A33B 1AL23 4AEJA 3ZN4A 3WNPA 4ZU7A 1POQA 4KQ7A 1ULEA 2W91A 3RYKA 2E31A 2DU0A 3RI8A 1C8M2 4A6SA 3ORJA 2VJXA 1JHNA 3GZAA 3W58A 5L9BA 2FDHA 5E6HA 1GQPA 1RMU2 2RDNA 2D5FA 3FMGA 3IWZA 3M2MA 3RMXA 2P2KA 1RUH1 3O1TA 2LM3A 3O0VA 4JGZA 3AM2A 2QUOA 3D82A 4XHBA 2WN3A 1VB2A 3UYJA 3BODA 3N9LA 2PFWA 4IE0A 1WZXA 2DTYA 3E1F1 3TNQA 4IE7A 5JXJA 4XFIA 1XNDA 1IQDC 1OD3A 1GYKA 2GNBA 3M3CA 4D69A 4C90A 3GBWA 1X9TA 2JG8A 2NQYA 3HEIA 4FPGA 1DYPA 3BCWA 4LUKA 3HNBM 1Q8PA 4EN9B 3NKTA 4CPBA 2E6VA 4TN7A 3MO4A 5AVAA 3IBMA 4I02A 4JKLA 4UOJA 5AC91 1RUOA 2ZTNA 3M3OA 1HLCA 2WLQA 4FFIA 2ZHLA 1BLZA 1XNTA 2XVLA 3PUSA 4FFFA 4GB32 4AFDA 1SZBA 4RL7A 2LW8A 4DRVA 1RUF1 5I91A 4AGRA 3WR0A 1RB8G 1W6PA 1JU4A 3LZZA 5GZGA 2YBKA 4YVSB 5DPNA 1C4RA 2AH2A 3NJXA 1VRH3 1WUVA 2PELA 1GFF2 4SLIA 1WMFA 5FMBA 1DHKB 2J7MA 4P08A 2BERA 2JB4A 3U0ZA 4AHWA 1PVC2 1RUE1 3CEWA 1J1LA 2DCTA 3OEAA 1QHDA 2WABA 1AXKA 4BMBA 3BU0A 2QQKA 2VQUA 4XFBA 4RGAA 2QDNA 4ZU4A 3ZYIB 3USUB 2XBO1 5FZIA 1RL3A 1H8TB 4HG6B 1L3JA 2I2SA 3AP4A 3WF3A 2XJQA 3SH3A 4HFSA 1BVP1 4PIYA 5JI7A 1AXZA 5EHDA 4F7ZA 4WM8C 1CAUB 2YDEA 3IAPA 4ZS2A 3S0MA 3BTZA 5ISLA 1UW8A 1GICA 1Q8VA 1W04A 2ETEA 4DINB 1LOEA 1LOFA 2ZBJA 1LHVA 2Y6HA 5D8AA 3VBSC 3K3NA 3AMNA 2JD9A 1RUJ1 1VIWB 4GA9A 2LRPA 3WDVA 1PM7A 3OG2A 3RZLA 3AKPA 3AP5A 4FPKA 3ELNA 5I0DA 2N7GA 1Z7S3 1NXMA 2VXRA 4NUBA 4PJYA 1RTVA 3I2JA 2IXJA 3ZSJA 3NJVA 5GZCA 1S2KA 4H14A 4L0PA 3QD6A 3IM0A 5J96B 3EO6A 1OKOA 1US2A 1SLTA 4P9WA 5HCBA 2ZEWA 2P3KA 1AR72 1O5LA 2R16A 2OVUA 1ZZ8A 2E26A 3POBA 2C9KA 4H3WA 3SKVA 4NAMA 5EXOA 3ZYHA 1P8JA 5I8TA 3FC0A 2MEV3 1AX1A 4MHUA 5FK8A 5H9PA 1DIWA 3IDEA 4PLNA 4XDOA 3KV5A 3WNNA 4YSFA 2XJTA 1E5IA 3OBZA 2WZR3 3V0AA 5HBAA 3JQXA 2WAAA 5FLIA 5C3RA 1DZQA 2UURA 4QHOA 1NLSA 5LBEA 3UETA 2GC3A 4CDWA 1OA2A 3BYWA 2VVFA 4R9AA 3T4HB 1TNRA 4LKEA 4X6QB 2GC1A 1GKBA 1OQ1A 1W39A 1V6KA 4CEWB 1UD1A 2HWC1 2VH9A 2XLFA 3AMPA 2XUMA 1W2NA 1OLRA 3OYWA 4FOWA 1I3HA 3HT1A 4B1LA 3CLPA 4DUVA 2IXHA 1RJ8A 4CDUC 1PM4A 5F32A 1VMHA 2P3YA 3QLQA 4G9SB 1D4M2 3K51A 1BMV1 1WGPA 5HV0A 2C5DA 3T0DA 3TEYA 4UYBA 3RDIA 1VBC3 3WINE 4HN0A 4DS0A 1NE6A 4ZZ8A 2Z5WA 5JLVA 1O7FA 4OMDA 4CCMA 2VGDA 4HN1A 1JH5A 1TME2 4A42A 3HNMA 2BYVE 1O3RA 1QF3A 2F4LA 3VDDA 1W3VA 1H8VA 2W5FA 1REDA 3SNMA 4A7ZA 4Q8KA 1GANA 1PZ8A 2XQXA 5FQ0B 3RWKX 1W99A 3OF1A 2JKBA 3T1LA 4DUXA 1F8VA 2QBXA 3B93A 5F1RA 4Q4W3 2E7QA 1IQAA 3LF7A 2PHXA 4UWDA 3MICA 4YW4A 4YYOA 3SLIA 1I1EA 1U5XA 3BI3A 1QQP3 2QZ3A 5HCAA 3BIEA 2XJSA 3RJ2X 3RYPA 2BJSA 2VOVA 1HRI2 2BNOA 3OJBA 4X8PA 3PIJA 4DXSA 1XYOA 5JAXA 1CWPA 3I2FA 1SMVA 2VMGA 4BZ4A 1PGL2 1PK6A 2WWUA 5FZMA 4CXXA 5JDBA 1G8WA 4AI3A 4WVWA 3VBUA 1YFYA 2Y34A 4Q0SA 3JD72 4YM3A 4XJUA 3N9OA 2KA3A 3EXUA 3E6DA 3B9IA 2AREA 4NAOA 4DUWA 3ZFGA 5A80A 1OFNA 2B39A 1V6LA 4P9XA 5C70A 2R073 1UZ0A 4OHVA 1W0OA 1WMEA 4RS5A 3J7HA 1CQ9A 4Q29A 1MZFA 4XJZA 4IDZA 4CCJA 2GSYA 5AVPA 1QJU1 2R042 3OPZA 3KHCA 3NAPA 1BHGA 1S0FA 3VD4A 2B42B 1ZBA3 1UOJA 4HPKB 1DG6A 5DN2A 5BNPA 5JXGA 5F5IA 2VZUA 2XR4A 4GWMA 3ZKUA 1UYXA 1GOHA 2YC4A 4LKFA 1IPJA 3LA2A 4CP9A 5FY5A 2ES3A 2VQ0A 2VU9A 4O9EA 4PIZA 3WLUA 1SBFA 4RQPA 1HV1A 3WUDA 2ZGQA 2Y6JA 2P4EA 1COV3 1GR3A 5L7OB 4YVWC 2FCUA 3VZLA 1AR61 1RVF1 2Z69A 3Q8BA 1FMD2 1RYYA 4LR4A 2W9XA 3AXDA 4QX5A 4JGZB 1GNZA 3AVSA 4ZY9A 3PTRB 4XUQA 1N3PA 1IHMA 4WVZA 3VN4A 5C5TA 3TEWA 1JTZX 1F9KA 2VW0A 3ZFFC 3ZOIA 1K5MA 2VMCA 4PQQA 3J7MA 3V56A 3DXUA 3RGBA 1W8ZA 3P6BA 4W6WA 3GZTB 1VBE3 4TZDA 1BK1A 2JG8B 3ILFA 4JTOA 4XQDA 5FUIA 4UF0A 4K8RB 1J3RA 1V00A 4LBLA 4XBLA 1J3PA 4AFBA 1KITA 2A3YA 1RUG2 1S0IA 2YBPA 3E5QA 4BIOA 2ZKLA 1LHOA 1JYIA 3FE5A 5FREA 3THDA 2JB8A 5FYZA 2JDUA 4M3CE 4AVTA 4QQOA 2O0OA 3LOBA 2WBKA 2CL2A 4KMQA 1DGRN 2VZVA 1W6PB 3A23A 2XB6C 1HXS2 2PXJA 2R0HA 2UWBA 2W46A 3UKTA 5DG1A 2EIDA 3BIWE 4BA6A 3BTAA 2FHRA 3DECA 3LEKA 3THPA 3C7GA 3FHAA 2D98A 3PL0A 5DZEA 1RXFA 3WF1A 1SFPA 2VE1A 2WNOA 1SLAA 1O4TA 3WW2A 4YFZA 2K46A 2P5BA 3P5BA 4ZHNA 3KWVA 2RS33 4IE4A 5JZGA 1SDDB 2RS52 1O6UA 2P6HA 5ACA3 4JRLA 4CCDA 2GZWA 5FZ4A 2JIGA 2ZEXA 4HKLA 1PO23 3ACHA 3P1IA 5FTTC 3SCFA 5HPOA 2FDIA 1KJLA 2YUEA 5DZFA 4DB5A 4DEQA 4WBBA 1JUIA 3CKHA 4QB1A 3WV6A 2BFUS 3OGJA 5FOBB 2WLPA 5D8AB 1ZA7A 4ISRA 5G05L 5CEHA 1UWWA 4Q4W1 3TBDA 1FOD3 1KXGA 4NRPA 4DXRA 5BNNC 4FTBA 4MGIE 3NW4A 1H1AA 1FPN2 5A7QA 3WSOA 5C8WA 2KXLA 2VVDA 1E57A 3Q8FA 4HMZA 3T2OA 1ND3B 2NPIA 4W65A 1XJAA 5FIXA 1V6OA 2P3JA 3AXEA 3ZMOA 3ZPYA 4CVUA 2G4IA 1TME1 5C4WC 2E33A 1IKQA 2VCAA 4LBQD 3S5QA 2EAAA 3I2HA 4GH4C 2LTNA 2D40A 4EN7B 5FKBA 4MV2A 4CCEA 1CZVA 2PAEA 2PN5A 4UFKA 3VBOA 4AEMA 1HN1A 4FPJA 2YROA 3V0AB 4ES8A 4BJ0A 1J59A 5FY0A 1YI9A 1CJDA 4FTEA 4AEDC 4H7MA 1TE1B 4XJ9A 2E63A 5FRAA 4BYYA 2W3JA 5IWFA 1US3A 3AFKA 3AMMA 5A6ZA 2LALA 2TUNA 5DAXA 1E5HA 4K9SA 4CYDA 1OI6A 4ORFA 1KFUL 2NZ9A 2HWF1 3JB8A 2ZX4A 4HKOA 5A3TA 1PGSA 3I2OA 3RSJA 3IT8A 1BBT3 2K2SA 2WNUC 5T52A 3WCRA 5F8PA 4NHMA 2Z2SB 2A71A 4XOGA 1WCSA 3POFA 5K7PA 1FNZA 2BZDA 4Q4X3 3T30A 1S0DA 1Q8OA 2X05A 1Q3EA 2ZEYA 5FMOL 3VDDB 2YC2A 3OGSA 2OXBA 2Q8EA 4COWA 3GHNA 3TB0A 4LA3A 2RE9A 4LO4B 1Q43A 4JV4A 2OUHA 4RR3C 5A3WA 2J1EA 3PNAA 2OKXA 1ZNPA 5FYBA 3BTYA 1MQTC 2J1UA 2DVBA 2NLRA 2ZS6B 1VPHA 4OMCA 3H8XA 1V6IA 4WM8A 4KI5M 3WF0A 1C5IA 3L9JT 4XJAA 4YG0A 1TMF1 1PK6B 1AR93 1NCRC 1UY3A 1OF4A 2XL9A 3N3HA 3VBUB 3VBSA 3U78A 1X50A 3SITA 4L11A 1R083 5BNQA 3ILRA 4IERA 5F5AA 4CDXC 4XUPA 1JYVA 1XNKA 3PHMA 2Q1MA 3H8UA 4O65A 2HH9A 4K7JA 4NIHA 3BOWA 3MW4A 2FD8A 1H2MA 3NAPB 1F2NA 3ES4A 4JX0A 1VP6A 4ISQA 5BNPB 4D6QA 1VAVA 3B5LB 5SV5A 1HW5A 1YQ6A 2BV4A 3EJKA 1W6MA 1AYN1 2R49A 1AR83 2ID4A 4HOOA 4MGSA 1UKGA 3ZFEA 3AKSA 1R1A3 1KGYA 4RQPB 2B7YA 1R092 4XFAA 4XMAA 1LGBA 1CIWA 3VHPA 1ULGA 5GLUA 3B69A 1C57A 3BGAA 1ZREA 3IIAA 4WM7C 1V70A 4Y20A 1S0BA 2D7FA 5FY8A 3VL9A 4OZXA 3FBMA 1XB9A 3AB0A 4A7YA 1JYWA 3BVCA 1JZ7A 3AK0A 3HBKA 2VQAA 3THCA 4DY5A 1ND2C 2A5ZA 2AC1A 4CDUA 1W8FA 3WG3A 3GF6A 3D5OA 4QQLA 5FCCA 3WP5A 1U5IA 4UF0B 5JIAA 1QJX3 1CZSA 3RNSA 1LEDA 1GOGA 2OW4A 2RS12 3KGZA 3PMEA 4BPZA 5JIUA 3N35A 5KC5A 2D93A 4YZ2A 5JMOA 3FLRA 4LK7A 2JE9A 3ATGA 2JDPA 5C8CC 3KMHA 3MW3A 4FQ4A 1S2BA 1EV13 4XXAA 3IDAA 2RR13 3ASIA 1MEC1 1QKQA 4R52A 4A7KA 4H55A 5FO8B 5FBJA 4PBPA 4B4QA 3MFCA 2RMU2 2PLV3 3IPVA 5CBLA 2WO3A 2ZA9A 1O4YA 3PUAA 5FZHA 5K0UA 5DDJ2 3AX4A 2J1SA 2ZACA 1DQ0A 2D3SA 2QKDA 1PIV3 3M8LA 1MPXA 2MPFA 3PVNA 5JOYA 4AR2A 4QKNA 1RUD2 1NAEA 4RA0A 4AE2A 1UU6A 1URXA 1D2QA 1HDKA 3JUUA 5C9AA 1SLBA 4JQTA 2YY1A 4N43C 3AZVA 5C3OA 1J3QA 3DN7A 4JDNA 1G9AA 3DYMA 4M4RA 5AFEA 4IE5A 5I0RA 1W6NA 2XLAA 4HONA 3LCPA 1RHI3 2I07B 1RUH2 1DF0A 2HEYF 3J8F3 5C7GA 2CWMA 4Q4X1 1OMIA 1QH6A 4ATEA 1GBGA 2ZGKA 4QPGB 3ZYGA 3AYCA 3LA3A 1OSGA 3ACFA 5EWSA 2ZX2A 3FJSA 4R4ZA 1IPSA 1IS3A 2JG9A 2SLIA 2TNFA 3MV11 3I2GA 2W1WA 2KD7A 1DQ5A 4J25A 2WFPA 1JI6A 3W9AA 1HB3A 4KNCA 3POEA 4NHKA 1CAVA 1XNAA 1BXHA 1KEXA 3PUIA 5FJKA 3RG0A 3TN91 5KHKA 4L92A 1VBA1 2EICA 5DAVA 5AC92 1VAKA 2H6BA 2IXLA 1QIQA 3VKNA 1W28A 1O8SA 1LNSA 4ZXKA 4B4PA 2UY9A 4YVWA 2YU2A 3ZMNA 1H1IA 1LCLA 4RSUA 3A7QA 5EYYA 4QX2A 1R081 2OX0A 1RUF2 2WKKA 2WFF2 1YFUA 1NLQA 3DGTA 2IXCA 2WS93 4UBHA 3TWIA 3ZXGA 1XNCA 1G9BA 4JKKA 3SHRA 4A3XA 3OGVA 1MZEA 1DYOA 5EV7A 3HQXA 5FZ7A 2G19A 5H9QA 2JICA 3LGRA 4Y1ZA 3VBOB 3ZFFA 2XDVA 3E6BA 3OOXA 4LLOA 2Q8CA 3R4SA 1RUE2 4B3NA 2C4XA 4ITCA 5JR2A 2G9GA 2ET1A 3SMHA 2R063 4G3YC 3WDYA 2ZZJA 2E53A 3VD3A 3KV4A 2XBO2 3NMBA 3WNLA 1ZRRA 2W47A 5KHIA 2VG9A 2L9LA 5CU1A 3N7LA 4NWVA 5FPBA 4IV3B 4LBQA 5F6LB 2DFCA 1LR5A 4EN0A 1ZYBA 3BN6A 1JZ5A 2DCKA 3GHMA 1QH7A 3AZZA 1OH3A 1HQNA 1KDKA 1OURA 2P3IA 1WMXA 1V9U1 4LBKA 3W59A 4LEJA 1PO11 3KV9A 2FMYA 3MLJA 2C0ZA 5F6KA 4BISA 2R1BA 4DPNA 1NKGA 3WHUA 3MBWA 3P3PA 4K6BA 1WLWA 3N7KA 4JHZA 5T50A 3WVJA 2WAOA 4MGKE 1PNGA 4Q8LA 4AQTA 4YW6A 1UXZA 3MUZ1 1LU2A 3OBTA 4IEYA 4N7UA 1QJX1 1LRHA 1NA1A 1UN1A 3U10A 2NM1A 4Q4Y1 1LECA 2YHJA 3ZXAC 2WL1A 2JKXA 5LBFA 3VBFA 2VTFA 5G04L 5FYYA 2HWD1 3A22A 3EHKA 3WOGA 1EV11 4WM8B 4XFHA 4F83A 2VZQA 3VBRC 1FV2A 5CFDC 5I8YA 2D3RA 1OA4A 2BDRA 3WQ7A 2ZGOA 3VKLA 4YZ3A 1OH4A 1PVXA 2PLV1 1O8PA 3ETPA 2NP0A 2BU9A 5DMYA 2RVAA 5FV3A 1Y9GA 1MS0A 4AI9A 2BEOA 3M3QA 4E2GA 2WWJA 4AZZA 2J1AA 4CA9A 3LOIA 4Q0UA 1AL22 3RJRA 4NIDA 3U75A 2HWC2 2A6YA 3ZSKA 4N9HA 2OIIA 5FXWA 1U5YA 1RUI3 2VUAA 5J98B 1WA4A 4BQWA 2WO2A 4PDWC 1Y3TA 4AFAA 3IKWA 5A6YA 2DVDA 5A3MA 2WNVA 1QXRA 1X9PA 1JYNA 1BMV2 1W6MB 5F2WA 3T3YA 5APAA 2Y60A 1Y43B 3ZFEB 4GH4A 2VZRA 4NHYA 1UNBA 5FOJB 5FZ0A 4DZGA 5DDJ1 2HEVF 5A32B 3GBGA 1O4ZA 1UZWA 3B94A 4COZA 3GXUA 4IGOA 4MVTA 1AX2A 4Y20B 5HCFA 3U07A 2R7EB 1S0GA 3WNKA 1ENXA 2DCZA 2P1BA 3AKRA 1MVQA 4EROA 4XC9A 4C0BA 1QJY3 2RJLA 2QQIA 3I54A 3Q8EA 3NNGA 1MS3A 4JQRA 4XVHA 3H7JA 5CKNA 3HN3A 2E7TA 2HBUA 1ASJ3 4KBBA 2AGSA 5FYMA 4W8JA 3P3NA 4CDUB 1VBD3 2CY6A 2ZPXA 2DVFA 4XTMA 4QPYA 3RZMA 3I3BA 4FBFA 2D6PA 1W6OA 2R32A 4LA2A 1IKPA 2I74A 2WS91 3LB9A 4MO3M 2VM9A 3MEPA 4RHV1 4ZPIA 4U36A 1HJFA 4PCRA 1NUKA 2PQQA 1LOCA 4XF9A 2WZEA 2EXJA 1HRV3 3PJYA 2WRAA 1DCSA 3JBG3 4E8DA 2XONA 1DQ4A 1LU1A 5CZKA 4EN8B 4Y1XA 3MIGA 4K20A 2VULA 1S0EA 3MPPG 5GKAC 1QJU2 4PIXA 4XE9A 5ABJC 4AQ6A 5I0SA 5E1RA 2VZ1A 3PJQA 3IPVB 2ZMKA 1UU5A 4B4RA 5B2GB 4AI2A 2Y6FA 5K0UB 5LRSA 2FZ2A 1VE0A 3LQCA 4XF3A 2VQTA 3N9MA 2X5IA 1SFNA 3D0SA 1MQTA 1JZ4A 1GQHA 5J09A 2GNTA 4UW6A 5EJZB 3IZOA 2QVSB 1QJEA 5C9AB 2WFF1 4FOYA 3VUOA 2ZHMA 2P34A 4EJRA 4QU1A 3TEZA 1C8M3 4ES9A 1RVF2 4MH0E 4CP0A 1AR62 3LPFA 1FI2A 4HVRA 1EY2A 3HWJA 1CPMA 4CDXA 2DUPA 3MLKA 1T6BX 4TTGA 3O7OA 4DNYA 2ZEZA 1Z7S2 2FZ1A 3T09A 3ON7A 4FFHA 3Q8AA 4XACA 3HMYA 2A6WA 4LKDA 1Y7BA 1QY4A 1DFQA 2JE7A 2JG9B 2VXJA 1GP5A 2WT2A 1OHFA 3IDBB 4D3WA 4MGZE 1IOAA 3W21A 2XJRA 3ZXLA 5BNOC 3B7MA 1UAIA 1ULPA 5IHRA 3MLLA 3O14A 2EALA 3JU9A 2AEYA 2GALA 1PMHX 4LOTA 3CO2A 1F5JA 2YFZA 5DG2A 5JVVA 1VBB3 4RFT0 5LRRA 2ORZA 4N9IA 3UKVA 5LEJA 5JOWA 2ZAHA 3K3OA 3KZ4C 2V73A 4F8AA 2ARBA 2YPDA 4QHBA 1AXYA 4RGGA 2LS6A 1ULCA 1N47A 3MF6A 4YVWB 2ZX3A 4YW7A 3BU7A 2DBIA 3MIBA 2FBEA 1K45A 2YZ4A 4D6RA 5C6CA 4WVVA 1W2TA 4EWAA 4BB3A 4GB33 1EAH3 2WYFA 3NV3A 1IZ3A 4LNVA 5IK8A 1AYM3 1HX6A 2CGNA 3KHBA 1RUI1 3ZFFB 2IUWA 3SC7X 4FO9A 2FCVA 1WLDA 2GP3A 1ND2A 5K8SA
chains in the Genus database with same CATH topology
3N9PA 2OQ7A 4Y3OA 5FUPA 5FZOA 5FZ0A 2XMLA 4QXCA 5FYCA 1VRBA 3U78A 5FJKA 4GAZA 3LD8A 5F3EA 4IGOA 5FZBA 2P5BA 5FP8A 3KV6A 5FWJA 5FZ8A 4CCMA 4EZ4A 5A1LA 5F5AA 5A7NA 4GJYA 5IVJA 5LW9A 5FZGA 2Q8DA 4TN7A 5FP7A 2YU2A 3AL6A 4IGPA 2OQ6A 3N9NA 4LIVA 5FZ4A 3PU8A 2OX0A 4IGQA 4QX8A 4CSWA 3N9QA 4D6QA 3PUSA 5FYMA 5FZ7A 4D6SA 4DO0A 5LY2A 4HOOA 2XDVA 4DIQA 4CCKA 2YBKA 2Q8CA 3ZPOA 5CEHA 2OS2A 3LDBA 4URAA 5IVFA 5FP3A 4V2WA 2WWUA 5FZMA 5A3PA 5FYSA 5F3GA 3KV4A 3N9OA 3AVRA 5A7QA 5FPAA 5LWBA 5FY8A 5A80A 4QXBA 3KVAA 5F3IA 5FPBA 4XDPA 3ZLIA 3KVBA 3PU3A 4LIUA 5FZIA 5A3NA 5FYIA 4QWNA 3PDQA 5LY1A 4CCJA 5FPLA 3N9MA 4BXFA 5FZKA 5FWEA 5ANQA 5FPVA 5A7WB 4BU2A 3KV9A 5F5IA 5F2SA 2YBSA 4BISA 5ISLA 5FZCA 3OPWA 5FZAA 5A7SA 2YU1A 4CUGA 4UF0B 5FY5A 5FZ9A 5A1FA 3K3NA 5FZDA 5KR7A 4QU1A 3DXTA 3K2OA 5F39A 5FY0A 3PUQA 5FYUA 4C8DA 5IVBA 5FZFA 4V2VA 5FY1A 4EYUA 5FP9A 5FZ3A 5FY4A 5F37A 4NUBA 5IWFA 4Y4RA 3RVHA 5FYHA 5A7OA 4CCNA 5FBJA 2XXZA 3U4SA 3AVSA 5FXVA 5FYYA 3PTRB 5FJHA 3PUAA 5FZEA 5FZHA 3OPTA 4QXHA 5FZ1A 5A7PA 4ASKA 5IVVA 5IW0A 5A7WA 5FP4A 5F3CA 4QX7A 4LXLA 5FXXA 5FZOB 5FY7A 5A3TA 2GP5A 3DXUA 4XDOA 3KV5A 2OT7A 5FV3A 5FXZA 4UF0A 5IVEA 4CCLA 4AI9A 3PURA 3K3OA 4CCOA 2WWJA 5IVCA 4E4HA 4Y33A 2YPDA 3NJYA 5FYVA 5K4LA 5FZ6A 4HONA 2Q8EA 5FXWA 3AL5A 2YBPA 4D6RA 4GD4A 4AAPA 5E6HA 5FUNA 5FYTA 4GJZA 2W2IA 5FYZA 5A3WA 2VD7A 5FYBA 4EZHA 2XUEA 5F5CA 5FZLA 5FPUA 4LITA 5F2WA 5FY9A 3UYJA 3N9LA 5F32A 2PXJA 2GP3A 5IVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9P A;  2OQ7 A;  4Y3O A;  5FUP A;  5FZO A;  5FZ0 A;  2XML A;  4QXC A;  5FYC A;  1VRB A;  3U78 A;  5FJK A;  4GAZ A;  3LD8 A;  5F3E A;  4IGO A;  5FZB A;  2P5B A;  5FP8 A;  3KV6 A;  5FWJ A;  5FZ8 A;  4CCM A;  4EZ4 A;  5A1L A;  5F5A A;  5A7N A;  4GJY A;  5IVJ A;  5LW9 A;  5FZG A;  2Q8D A;  4TN7 A;  5FP7 A;  2YU2 A;  3AL6 A;  4IGP A;  2OQ6 A;  3N9N A;  4LIV A;  5FZ4 A;  3PU8 A;  2OX0 A;  4IGQ A;  4QX8 A;  4CSW A;  3N9Q A;  4D6Q A;  3PUS A;  5FYM A;  5FZ7 A;  4D6S A;  4DO0 A;  5LY2 A;  4HOO A;  2XDV A;  4DIQ A;  4CCK A;  2YBK A;  2Q8C A;  3ZPO A;  5CEH A;  2OS2 A;  3LDB A;  4URA A;  5IVF A;  5FP3 A;  4V2W A;  2WWU A;  5FZM A;  5A3P A;  5FYS A;  5F3G A;  3KV4 A;  3N9O A;  3AVR A;  5A7Q A;  5FPA A;  5LWB A;  5FY8 A;  5A80 A;  4QXB A;  3KVA A;  5F3I A;  5FPB A;  4XDP A;  3ZLI A;  3KVB A;  3PU3 A;  4LIU A;  5FZI A;  5A3N A;  5FYI A;  4QWN A;  3PDQ A;  5LY1 A;  4CCJ A;  5FPL A;  3N9M A;  4BXF A;  5FZK A;  5FWE A;  5ANQ A;  5FPV A;  5A7W B;  4BU2 A;  3KV9 A;  5F5I A;  5F2S A;  2YBS A;  4BIS A;  5ISL A;  5FZC A;  3OPW A;  5FZA A;  5A7S A;  2YU1 A;  4CUG A;  4UF0 B;  5FY5 A;  5FZ9 A;  5A1F A;  3K3N A;  5FZD A;  5KR7 A;  4QU1 A;  3DXT A;  3K2O A;  5F39 A;  5FY0 A;  3PUQ A;  5FYU A;  4C8D A;  5IVB A;  5FZF A;  4V2V A;  5FY1 A;  4EYU A;  5FP9 A;  5FZ3 A;  5FY4 A;  5F37 A;  4NUB A;  5IWF A;  4Y4R A;  3RVH A;  5FYH A;  5A7O A;  4CCN A;  5FBJ A;  2XXZ A;  3U4S A;  3AVS A;  5FXV A;  5FYY A;  3PTR B;  5FJH A;  3PUA A;  5FZE A;  5FZH A;  3OPT A;  4QXH A;  5FZ1 A;  5A7P A;  4ASK A;  5IVV A;  5IW0 A;  5A7W A;  5FP4 A;  5F3C A;  4QX7 A;  4LXL A;  5FXX A;  5FZO B;  5FY7 A;  5A3T A;  2GP5 A;  3DXU A;  4XDO A;  3KV5 A;  2OT7 A;  5FV3 A;  5FXZ A;  4UF0 A;  5IVE A;  4CCL A;  4AI9 A;  3PUR A;  3K3O A;  4CCO A;  2WWJ A;  5IVC A;  4E4H A;  4Y33 A;  2YPD A;  3NJY A;  5FYV A;  5K4L A;  5FZ6 A;  4HON A;  2Q8E A;  5FXW A;  3AL5 A;  2YBP A;  4D6R A;  4GD4 A;  4AAP A;  5E6H A;  5FUN A;  5FYT A;  4GJZ A;  2W2I A;  5FYZ A;  5A3W A;  2VD7 A;  5FYB A;  4EZH A;  2XUE A;  5F5C A;  5FZL A;  5FPU A;  4LIT A;  5F2W A;  5FY9 A;  3UYJ A;  3N9L A;  5F32 A;  2PXJ A;  2GP3 A;  5IVY A; 
#chains in the Genus database with same CATH topology
 1O3Q A;  4XW3 A;  2F6B A;  3J4U H;  2JD4 A;  4NJ4 A;  5FYC A;  1IG3 A;  3WHT A;  1GSL A;  4B29 A;  1ZM1 A;  1OLM E;  4CU7 A;  1FXZ A;  5I93 A;  3SQO A;  4QT6 A;  2O8Q A;  1HKD A;  1L7Q A;  4AQS A;  2X09 A;  5C8C A;  3O1S A;  4LJH A;  4COV A;  2HLE A;  4PF5 A;  3LAG A;  3H1Y A;  4MXW A;  4IGP A;  1J58 A;  1OVS A;  3H42 B;  3HJR A;  4Z2W A;  4BQ1 A;  1AL2 1;  3TYJ A;  3NNL A;  2BFU L;  5CFC C;  4Q4W 2;  3RI9 A;  4D6S A;  2C1F A;  1C28 A;  5T5J A;  4D8M A;  4I01 A;  1UCX A;  1QQP 2;  2ZOE B;  3RPQ A;  1E5R A;  3ZPO A;  3HNY M;  4MGQ A;  4CU8 A;  4UAP A;  5CIS A;  5LCW L;  1ASJ 1;  4HVQ A;  1I9R A;  3FN9 A;  4N43 A;  3WW1 A;  1VBD 1;  5FO7 B;  1DLC A;  1JN2 P;  4CDQ A;  4DMI A;  1C3H A;  1NA1 B;  4FXK B;  5LWB A;  1JZ6 A;  4BM8 A;  2V5D A;  2D44 A;  5GAL A;  3WDW A;  3VBF B;  3RMY A;  3ZLI A;  5EZW A;  1AL0 G;  2JWP A;  1AR7 3;  2Z42 A;  1YFW A;  4IEW A;  5JR7 B;  3JBG 1;  2C24 A;  2CNA A;  2X8K A;  1PHM A;  4GMP 3;  1RUN A;  2RDS A;  3J26 N;  3I3Q A;  1GV9 A;  4O61 A;  1NXD 1;  5FFO C;  4OLL A;  4QB6 A;  3CJI C;  2Y26 A;  2YMZ A;  5IUQ A;  4FPH A;  3HT2 A;  4V1P A;  3VHR A;  1B09 A;  3NNJ A;  4FP3 A;  4ONU A;  4JRA A;  4LPL A;  1OOP B;  1H4H A;  2XWJ B;  3K2O A;  1X8M A;  3NJZ A;  5HXV A;  1I5Z A;  3UNP A;  3PUQ A;  1ENS A;  1ZZ9 A;  3DF0 A;  5DAQ A;  2Q1Z B;  5IFT A;  1UOF A;  2A75 A;  4FXG B;  2IFR A;  3G6J B;  4BME A;  2IC1 A;  4DXT A;  2PHF A;  1VRH 1;  4YW5 A;  5BPX A;  2OPW A;  2HWE 3;  2EIE A;  4P5H A;  5EIY B;  2HWF 2;  1X33 A;  2WNV B;  4MOA A;  5FXV A;  4LE3 A;  2ADE A;  1SLC A;  3ITQ A;  4AVB A;  4LLF A;  2D6M A;  1WMD A;  3ZDS A;  2Y6K A;  4R9B A;  5LBB A;  2A7A A;  2BP6 A;  4NHX A;  3B00 A;  1LTE A;  5E8A A;  5F3C A;  4LXL A;  1ZZC A;  1W9S A;  3C7H A;  2AAC A;  5FXX A;  5JXI A;  1TNF A;  2VR4 A;  3DUI A;  4YVS C;  2VTX J;  1UYY A;  4GWI A;  1AX0 A;  2EIB A;  1GP4 A;  2XHN A;  2YYO A;  1JXN A;  1F4A A;  2J22 A;  2W1Q A;  4QDQ A;  4X8N A;  1LAJ A;  2FCT A;  1RUC 3;  1XRU A;  2CDP A;  1YI7 A;  1QDO A;  1WW6 A;  4EQV A;  2P17 A;  1UL9 A;  4ASM B;  2DYC A;  1K3I A;  2MNG A;  4AVS A;  4BHP A;  3KSC A;  4FOV A;  1W0N A;  3WCS A;  3WP3 A;  3USS A;  2RV9 A;  1H8T C;  3H0O A;  4OCT A;  5JSO A;  3VLB B;  1TMF 2;  2OA2 A;  1HRI 3;  1H9P A;  1VJ2 A;  1Z7S 1;  3QH7 A;  4IEO A;  4LIT A;  4KG8 A;  4N90 A;  5F5C A;  5FY9 A;  4BH9 A;  4KGG A;  1W6O B;  3PVO A;  2C26 A;  3T2T A;  5HI0 A;  1EAH 1;  1KDM A;  1OUX A;  3LFM A;  5EQU A;  3WW3 A;  1YQ2 A;  3ZYB A;  2ENR A;  4IUG A;  4R8H A;  5FAX A;  3WXP A;  3ZXK A;  4CRQ A;  4Y24 A;  1AYM 1;  4XZU G;  5DUX A;  2VZO A;  5GM0 A;  2JX9 A;  4TWT A;  2VMH A;  5I0T A;  2MEV 1;  4CP1 A;  2F17 A;  1CZT A;  3ZXE A;  3AMQ A;  3FZ3 A;  4Q26 A;  5GLV A;  2R04 3;  2WZR 1;  2WR9 A;  1YJK A;  2X5I B;  2VNG A;  5ACA 2;  4I2O A;  1AYN 2;  3S7I A;  4UFI A;  2Y6G A;  3ACG A;  3GZU C;  5IAV A;  1WBL A;  1WCU A;  4J1W A;  4XF1 A;  3LKJ A;  3KCY A;  2B45 X;  5F9T A;  3VBR A;  3TAY A;  5CFD A;  1U0A A;  1FYU A;  4AHZ A;  1IS6 A;  4QB2 A;  3VZN A;  3ZM8 A;  4WVM A;  2DFB A;  4NIG A;  3N36 A;  2PA7 A;  3DYP A;  3IMM A;  2QQJ A;  2QQP A;  4GXL A;  4CUA A;  3THT A;  2GMP A;  4M3C A;  4NVP A;  1AF9 A;  4XXP A;  2VOT A;  5EPA A;  2ZX1 A;  3JB4 C;  3NST A;  1FMD 3;  2EIG A;  1W9T A;  2QZ2 A;  3FUQ A;  5F3I A;  5TSW A;  4BQ2 A;  5JPN B;  4M3C F;  3CQO A;  3KCC A;  3ABZ A;  3KVB A;  3PU3 A;  4A6O A;  1VBC 1;  3MZH A;  2HEW F;  3CJX A;  1O59 A;  3EMR A;  2ZXQ A;  2VPV A;  4CEW C;  1H6X A;  2GAU A;  4BXF A;  4IEV A;  1IGO A;  5FPV A;  4QX1 A;  1SDW A;  2D3P A;  4CXY A;  2VBD A;  1LEM A;  1C8N A;  2BBA A;  4YFW A;  3UGH A;  1DU3 D;  2DU1 A;  3UK9 A;  1GWL A;  5A3O A;  3LSD A;  4NWW A;  4CUG A;  4TXW A;  4GMP 1;  5FZ9 A;  4K40 A;  4YPJ A;  4Q4V 3;  2PHT A;  1MEC 2;  5LBC A;  1QQP 1;  3F95 A;  1EPW A;  3WF2 A;  4XUO A;  5IVB A;  1YO8 A;  4FFG A;  4YZ4 A;  3GZE A;  1DQ6 A;  3VKF C;  5FZ3 A;  1XNB A;  1NQD A;  4RFR B;  4D7S A;  4DEV A;  2XJU A;  5A7O A;  4CUC A;  4OUE A;  3ZN6 A;  4NMI A;  3OY8 A;  4U2A A;  5JSP A;  1SLI A;  4LTA A;  5F7U A;  3AKT A;  5A3U A;  4XJ8 A;  4UI9 L;  4YG6 A;  1XXN A;  3PMS A;  3EYP A;  4K8F A;  1ND2 B;  4R9C A;  1RIR A;  3ZX7 A;  1UY1 A;  2DTW A;  2R07 1;  2HWE 1;  2ZML A;  3O5S A;  5EYX A;  1EUT A;  4XFC A;  4XIK A;  4LOR A;  2AUY A;  3AP9 A;  2Y0O A;  2SBA A;  2QFE A;  1I5P A;  4FAG A;  3SCG A;  1YXW A;  3T08 A;  4L8Q A;  3KT1 A;  2ET7 A;  2A3W A;  2VUC A;  4LKS A;  1ZBA 1;  1JMU B;  4CCL A;  5C8C B;  1GWM A;  3W5N A;  2WT0 A;  2R1D A;  3L2Y A;  4Q4X 2;  3I3D A;  4UW4 A;  1H9W A;  3RWN A;  4A41 A;  4CDW B;  4MXW B;  4FAH A;  3VKM A;  5T5P A;  2W68 A;  5A6X A;  3AL5 A;  1VMF A;  3ROU A;  1CD3 G;  5ABJ A;  3O1V A;  4LMF A;  2GMM A;  1B35 C;  1RUC 1;  2VL4 A;  3OYW B;  4AGG A;  4OYU A;  1YC6 1;  3JQW A;  5L9R A;  3OSD A;  5T54 A;  1COV 1;  4PI0 A;  4Z2A A;  5CA6 A;  1OQD A;  1JU3 A;  4IE6 A;  3G7D A;  3TN9 2;  4R4X A;  1CES A;  1VBA 2;  4K1Y A;  4D7Y A;  2RDQ A;  1PX3 A;  2YFU A;  2ZAA A;  3NWK A;  2ZGT A;  4PT6 A;  1FPN 3;  3UES A;  1CJP A;  4Y22 A;  1W8U A;  4CDQ B;  5KXB A;  1RIN A;  4HSJ A;  1XSR A;  4XDQ A;  3LPG A;  5FWJ A;  1OT5 A;  2QQL A;  1R08 2;  5EFU A;  4GJY A;  1S0J A;  4XBN A;  4A4A A;  5L7O C;  3I3E A;  3FFZ A;  2GN7 A;  1VBE 1;  3GJB A;  1QXP A;  3FUO A;  4XET A;  2VZS A;  4GZ9 A;  1Y9Q A;  2WZ8 A;  1JW6 A;  1MR5 A;  3I8T A;  2PHU A;  2CSG A;  4I09 A;  5CG9 A;  2VAU A;  2DUQ A;  1BK0 A;  2J1V A;  3D6E A;  1CX4 A;  3PLQ A;  2EAK A;  1ULD A;  2V5Y A;  5LY2 A;  3WQB A;  5BNO A;  5IJR A;  5GLZ A;  1RIT A;  1A78 A;  4QPI C;  2WYS A;  3O1O A;  2Q30 A;  2VEC A;  4IL7 A;  3LWC A;  1UO9 A;  1MS4 A;  4TLG A;  5FDB A;  5DUV A;  4DQA A;  3ZFG B;  1G9F A;  1NZI A;  3DKW A;  3OD4 A;  4O9G A;  4ARX A;  2EVX A;  2D97 A;  4QMA A;  1TVG A;  4OI2 A;  4RS5 B;  5GZF A;  1ZRD A;  1V9U 2;  4QKD A;  1PO1 2;  5FYI A;  5L36 A;  1N1S A;  1PMI A;  4AXO A;  2A1X A;  4XAA A;  1J84 A;  3GGL A;  5BY5 A;  1DDL A;  4Q27 A;  5J7M A;  2RS3 1;  3E6C C;  5AFB A;  5KHG A;  2OYZ A;  1DLL A;  2VTX A;  4AW7 A;  4L2N A;  1NT0 A;  4IQP A;  5ACA 1;  1BJQ A;  5EP9 A;  3N7J A;  1O5U A;  3MPB A;  4Y1U A;  3VZK A;  1QNY A;  4CP9 B;  3V0B A;  4JCK A;  5KWR A;  1PZ9 A;  2XL7 A;  1PO2 1;  3F2Z A;  4I0W B;  4QDS A;  5DAB A;  3SIS A;  3WP6 A;  1QJX 2;  5L19 A;  2D43 A;  1BVV A;  4Q4Y 2;  4YGC A;  5J1X A;  4FPF A;  3WY6 A;  4C8D A;  1GZ9 A;  3RZH A;  3ZVX A;  4EYU A;  4E4D X;  3DKQ A;  4SBV A;  1XC6 A;  5F37 A;  2HWD 2;  3AKQ A;  1EYB A;  4JGY C;  4BOW A;  1FOD 1;  1EV1 2;  4Q4V 1;  5A1A A;  3ECQ A;  2RR1 2;  4B7K A;  3MUY 1;  4NOT A;  4JAA A;  4N53 C;  1LOG A;  1ZZ7 A;  3WG2 A;  1QGL A;  4Z1V A;  2O14 A;  4QXH A;  1ODN A;  2PLV 2;  4ASK A;  5CFC A;  2RDR A;  3RRD A;  4Y4Y A;  1K5M B;  1ZRF A;  1UQX A;  1ZRI A;  1W9Y A;  5D8A C;  2GDF A;  3RZZ A;  1KD7 A;  3GCW A;  3VBH C;  2OPK A;  3D0J A;  4LE4 A;  3N7M A;  2UYB A;  3JZV A;  3I49 A;  1DZR A;  2QQW A;  4KBZ A;  5ANN A;  4XFG A;  5DXD A;  4JHT A;  1ND3 C;  2XOM A;  4AGV A;  1RHI 2;  5C33 A;  4HXC A;  3J8F 2;  4Z82 A;  3VV1 A;  1OF3 A;  4GJZ A;  4XQ4 A;  2GU9 A;  1H30 A;  4GMP 0;  2VD7 A;  3S7E A;  4ATF A;  1D7P M;  4N7I A;  4D0Q A;  1TEI A;  2AZ5 A;  1ZVF A;  3VBR B;  3WF4 A;  4EZH A;  3VKO A;  1H2K A;  1POV 3;  5J37 A;  3B9C A;  2DUO A;  2JEN A;  3CJI A;  4FQZ A;  1R09 3;  5FUP A;  1XQN A;  1MS1 A;  4LOS A;  4M3C B;  3S57 A;  5GZE A;  1JZ2 A;  3VHN A;  3WX5 A;  3CDZ B;  4BE3 A;  5A6Q A;  5JZG B;  4YAR A;  3O1U A;  3HOB A;  1BBT 1;  1NYW A;  3GBF A;  1D0H A;  5FLH A;  3BTX A;  1VMJ A;  3N9N A;  3O1P A;  1UY4 A;  1QMJ A;  5FO9 B;  3OBA A;  2XGX A;  2DUR A;  3DV8 A;  3N9Q A;  3EBR A;  3QBQ A;  4F3J A;  4RHV 2;  1TQ5 A;  2WS9 2;  3ILN A;  1W8N A;  4O7X A;  1DGW A;  4XF4 A;  3ES1 A;  3AYD A;  4XEZ A;  5EJ1 B;  2G9F A;  2RS1 3;  1MZ5 A;  5J48 A;  4Y26 A;  4IW3 A;  4YVS A;  3WG4 A;  4IV1 C;  2VY0 A;  3JCI A;  4L97 A;  4OHX A;  5A3P A;  1PNF A;  1A8D A;  3J9S A;  3WT3 A;  2R06 2;  3B01 A;  4K3U A;  1RJ7 A;  1CIY A;  1AR9 1;  4KWU A;  3ST7 A;  1CAW A;  4WV8 A;  2WNE A;  4R9D A;  1NG0 A;  1SEF A;  4PHZ A;  3HR9 A;  2JEM A;  1MS8 A;  1H8T A;  4P9Y A;  1NY7 2;  2RHP A;  1X7N A;  3MFA A;  4MHR A;  3VDA A;  1Z0H A;  4QX0 A;  1F35 A;  5KBF A;  3VB9 A;  2GN3 A;  2WQ4 A;  2YG0 A;  3T4V A;  1W8W A;  4LUM A;  4S2F A;  4HZF A;  3U1X A;  4LBJ A;  1ENQ A;  4Q1R A;  4OQ9 A;  1GP6 A;  3BAL A;  4LQR A;  2VMD A;  1H2L A;  1QOO A;  3MIH A;  3AP6 A;  3VBU C;  5FBZ A;  3DXT A;  3M1H A;  1BCX A;  2JJ6 A;  5FPX A;  3OB8 A;  5FZF A;  4AI8 A;  1AR8 1;  1XBF A;  2Q0A A;  3ZKY A;  1WLT A;  3D3A A;  3QH6 A;  3A21 A;  2CDO A;  1R1A 1;  5FMO S;  4MGT A;  3HPN A;  4BQY A;  1UXX X;  2XJV A;  3PIG A;  3NAP C;  3APB A;  1PGW 1;  3SEE A;  2RJ2 A;  3III A;  1HB2 A;  1JBC A;  1LB2 A;  2FDG A;  3MHZ A;  5A7P A;  4BLI A;  4QKB A;  4UW5 A;  3O1R A;  4XUT A;  1YRZ A;  3CF6 E;  3OGR A;  4AI0 A;  3MIF A;  2PAM A;  4JKM A;  1W3X A;  3S5A A;  4IND A;  4Y22 B;  4ARY A;  4RQP C;  5AC9 3;  1SBE A;  1OBN A;  1FNY A;  4E4H A;  2TEP A;  4XBQ A;  3T1M A;  4OHW A;  2Q4S A;  2XVK A;  2W1S A;  1QNW A;  2B9V A;  5GJ6 A;  2A73 B;  1RUF 3;  4XJW A;  4OQ8 A;  1XYN A;  1SQ4 A;  4HLT A;  5FUN A;  5BYN A;  1RUI 2;  4QU2 A;  2ZGU A;  4JDO A;  4QQP A;  4XHX A;  4YG3 A;  1S55 A;  3FFQ A;  4CEW A;  1H0B A;  4CEY C;  5FZL A;  1PMJ X;  1ZZ6 A;  2CGO A;  2RR1 1;  5BNO B;  1W90 A;  1RUE 3;  2JXA A;  4LUL A;  2ZGP A;  1YLL A;  5IVY A;  2ZX0 A;  4AVC A;  3TNP B;  5D1I A;  2BWA A;  3AYA A;  4KG0 A;  4XCB A;  4Y1Y A;  5ERL A;  4UFH A;  3VBS B;  5FMD A;  1XYP A;  2JE8 A;  1MS9 A;  2XBO 3;  3OEB A;  2BVB A;  2IXK A;  4GQ7 A;  5FP8 A;  3ZSM A;  1F31 A;  1PIV 1;  5BNN A;  1ONA A;  1OXC A;  5A7N A;  1W2O A;  3CBN A;  2VUD A;  4OI4 A;  1NCQ C;  4IEZ A;  4ZKT B;  3PTY A;  4M01 A;  3BUC A;  2Q1F A;  3WZ1 A;  4W6Y A;  4FPO B;  2ARX A;  4P9I A;  1JYX A;  1QJY 2;  1BKZ A;  4LHK A;  2YPJ A;  1H4G A;  3NO8 A;  4DRR A;  4JC1 A;  3POG A;  4GAL A;  1RUJ 3;  2RM2 3;  5C4W A;  1GZC A;  1RHI 1;  4HL0 A;  4G4F A;  1ASJ 2;  3DL3 A;  3J8F 1;  5T5L A;  1JZ8 A;  1X8E A;  1X82 A;  3UL2 A;  1VBD 2;  4MYE A;  4XUN A;  5IVF A;  3NNM A;  3AMH A;  1GMM A;  3AP7 A;  4AAX A;  4IES A;  1BEV 3;  2X29 A;  3GDB A;  1A34 A;  3AVR A;  1JZ3 A;  1ZA4 A;  4BQX A;  3RZJ A;  3JBG 2;  4HVO A;  4FI9 A;  1XPW A;  1AZD A;  4FPY A;  4AED A;  4ZON A;  5E89 A;  2E51 A;  2GNM A;  2AEN A;  1W06 A;  2VZP A;  1UMI A;  4UFJ A;  3BB6 A;  3HIF A;  3FX3 A;  1B35 A;  1UY2 A;  5T5O A;  4QPG C;  2HWB 3;  3NV4 A;  4YGE A;  2XKP A;  1K12 A;  4NE9 A;  2GME A;  4YWA A;  4Q0Q A;  3URF A;  4QGN A;  5FPZ A;  5FZA A;  2Q5T A;  4BLJ A;  3MID A;  5A7S A;  4UFL A;  4J1X A;  4XQW A;  1YQ8 A;  2HBT A;  2WNU A;  5DUW A;  4W50 A;  5F39 A;  3VZJ A;  5C3P A;  5KHH A;  4NII A;  1ULO A;  1CGP A;  2HWC 3;  1VRH 2;  4OUL A;  3U11 A;  4YM0 A;  4BDV B;  4IEX A;  4QGM A;  2JDK A;  3FHI B;  1U5Z A;  1ZZB A;  4D94 A;  3BOP A;  5IAX A;  2QQV A;  5L7O A;  1A6C A;  2UY8 A;  3QOP A;  3BPS A;  3A0K A;  2R06 1;  1NQJ A;  1UYP A;  1FX5 A;  4HAN A;  4RYD A;  5FJH A;  5FZE A;  3BKZ A;  4FT8 A;  4LO5 B;  5FZ1 A;  3AZX A;  4RR3 A;  1SFY A;  1DQ1 A;  5IVV A;  4YM2 A;  3CJI B;  5FP4 A;  3ZYP A;  3VBO C;  2BGO A;  2JDM A;  1XE7 A;  2WDB A;  3QCW A;  4AWD A;  1DGL A;  4FPC A;  1IS5 A;  2DVG A;  1NY7 1;  2GH8 A;  3R6S A;  4A2U A;  5JPM B;  4XFF A;  1N1T A;  1W8T A;  1XU2 A;  1ZBE 3;  1LGC A;  3AZY A;  3LIG A;  1NCR A;  4QPI A;  4UFM A;  1WCD J;  4HK8 A;  2BRT A;  2NMO A;  5IVE A;  1VBB 2;  1QEX A;  5K4L A;  2BGC A;  1W6N B;  3IAQ A;  3SEP A;  1FAT A;  4DY3 A;  2VMF A;  1OC1 A;  4AK3 A;  1C1F A;  1RMU 3;  4IV3 C;  2O8O A;  4IET A;  3WDX A;  2OZ6 A;  3KCX A;  4I0A A;  2WIN B;  1EAH 2;  2BNM A;  4AL9 A;  3ZXF A;  5IT6 A;  4GKX A;  2YGL A;  2ZHK A;  3CZU A;  4JVA A;  4D7T A;  1DGW X;  1YIP A;  2DVA A;  3DPR C;  5GLT A;  3O1M A;  5H9R A;  1YQC A;  2D5H A;  1AYM 2;  4S2D A;  1UPS A;  4BWO A;  5FZO A;  5IAT A;  4Z07 A;  2WJS A;  1I6X A;  3KQ4 B;  3ZN5 A;  1KFX L;  2W0X A;  3ALQ A;  1CAV B;  1WW7 A;  2MEV 2;  1VRB A;  1S4C A;  2PHW A;  5FZB A;  1GOF A;  1KQR A;  1VAM A;  2XJP A;  1QJU 3;  2A6Z A;  4AVV A;  1LOD A;  2WZR 2;  4E27 A;  1CAW B;  4I30 A;  5IVJ A;  1HJG A;  5LW9 A;  1JHJ A;  4WM7 A;  1STM A;  4JGY A;  5B4X A;  1FV3 A;  4H2A A;  1V6N A;  2A70 A;  3M70 A;  4N53 A;  4JZR A;  4OI1 A;  3FHQ A;  2P37 A;  3VBH A;  1C1L A;  1BQP A;  2ZAB A;  1CON A;  2ZGM A;  4FP2 A;  1SBD A;  1G9D A;  4DO0 A;  3R0R A;  2ZGL A;  2V4V A;  1S0C A;  3A0N A;  3VD5 A;  4Q5O A;  1LUL A;  1OPO A;  1GWK A;  1S2E A;  2BTV C;  2OS2 A;  3MDP A;  5I0U A;  5KXE A;  1AR6 3;  1RVF 3;  3KS7 A;  2EXH A;  4V2W A;  5KXD A;  2RM2 1;  1AJK A;  3GCX A;  1AVB A;  1APN A;  1PVC 3;  1U12 A;  1W6Q A;  2ZGR A;  5CYY A;  1VAL A;  1OFS A;  4I3G A;  4Y5T A;  5BXX A;  1SHW B;  1VBC 2;  3T0A A;  1UOB A;  2V4A A;  1CAX A;  5BV6 A;  4YM1 A;  3KVA A;  4LBQ B;  1Q5O A;  2J1T A;  4M4P A;  1UF2 C;  1WD4 A;  1ND3 A;  1BEV 1;  3NRU A;  3WG1 A;  5A3N A;  2QDR A;  3EB7 A;  1Q56 A;  4FVV A;  2DBN A;  4NPR A;  3C2U A;  2YGM A;  5FPL A;  1EUU A;  3S6P A;  3OUJ A;  1RXG A;  2C6S A;  4P02 B;  1GZW A;  5JMC A;  4FTS A;  4IEP A;  3RQ0 A;  1OLM A;  1POV 0;  2Y33 A;  4LO8 A;  2I45 A;  1O91 A;  3PUH A;  4JTN A;  1DQ2 A;  3ZFE C;  4A3Z A;  3ZYF A;  3ACL A;  1QJY 1;  5FR3 A;  1O3T A;  2LRO A;  2BQP A;  5LB6 A;  3MIE A;  2HWB 1;  3V65 A;  2HYK A;  2R0F A;  4M0N A;  2RG4 A;  3ME2 A;  1KRI A;  3MV0 1;  3KGL A;  2DCJ A;  4PLO A;  5EJ3 A;  5FY4 A;  3AJZ A;  4B1M A;  4Y4R A;  5LAS A;  2BOJ A;  2CYF A;  5HXM A;  3C3V A;  5T55 A;  1JOB A;  4PI2 A;  3GYD A;  1K42 A;  5A70 A;  4KU8 A;  2R07 2;  1HRV 1;  2HWE 2;  1WD3 A;  4E4Z A;  4QM9 A;  2VNO A;  1CVN A;  3KF5 A;  4NRM A;  2OZJ A;  1G9C A;  5IW0 A;  2J42 A;  1Q8S A;  3H7Y A;  2UWC A;  1ODM A;  3NNF A;  3ETQ A;  4P9J A;  2JDH A;  4CZS A;  2V09 A;  3AZW A;  1Z78 A;  1ZBA 2;  5CIR A;  5B4N A;  3UJQ A;  2HKX A;  4MUV A;  2UU8 A;  4ZU5 A;  1Q8Q A;  1W8H A;  2QNK A;  4IV1 A;  4KWK A;  5BNN B;  2R6Q A;  4XAB A;  1REE A;  2D6K A;  4ASL A;  3KT7 A;  1RUC 2;  2X53 S;  4YGD A;  3INA A;  1ZBE 1;  2VBP A;  5JSR A;  2ZKN A;  4AAP A;  1COV 2;  3FLP A;  2QQN A;  3POJ A;  3NV2 A;  1C8M 1;  4E2S A;  3HAG A;  4QXK A;  5DAW A;  1YUD A;  5K0U C;  5C4W B;  1AJO A;  3IMN A;  4YW1 A;  1SPP A;  3C8X A;  2Y6L A;  1J1T A;  1GNY A;  5T3N A;  1RMU 1;  2G9Z A;  4GH4 B;  1D4M 3;  4Q2F A;  4E9K A;  4IXL A;  3WW4 A;  5C9A C;  2W52 A;  4MZU A;  3ZXJ A;  5DZG A;  2VNR A;  2G1M A;  1WCQ A;  2PYT A;  1X36 A;  4NHL A;  2PHD A;  3D8C A;  4QXC A;  4RN5 A;  3O12 A;  4GAZ A;  3TEX A;  1Y9M A;  3LD8 A;  4TYS A;  1VBE 2;  4FSJ A;  4I3P A;  1TME 3;  4P9L A;  2QE3 A;  1NOV A;  2ARC A;  3WNO A;  3BPZ A;  4AED B;  5LEK A;  4QKF A;  1F4H A;  1L7L A;  3U14 A;  1LHU A;  3UV9 A;  4LIV A;  1VBB 1;  3PU8 A;  4MLO A;  1B35 B;  1H2N A;  4IGQ A;  2ZHN A;  3AC0 A;  2EF6 A;  1AUY A;  4UT5 A;  2JG9 C;  3U4X A;  3ENR A;  4NRQ A;  4KWJ A;  1JUH A;  2VCB A;  2CHH A;  4GB3 1;  4P14 A;  3VGI A;  1YJL A;  2WNU B;  5LZ6 A;  2UYA A;  3JD7 3;  3WNX A;  5D21 A;  3H9A A;  4KH9 A;  4LHN A;  5LA2 A;  4AFC A;  1ZRC A;  4GWN A;  3K4D A;  1JOP A;  2HYX A;  3R4U A;  1OLQ A;  3CIH A;  5FPA A;  1LGN A;  5KC6 A;  4AOC A;  2HWF 3;  4YNI A;  1E5S A;  3DYO A;  3OD0 A;  1PVC 1;  2RS3 2;  4LIU A;  2GND A;  4QM8 A;  4CE8 A;  4YZ5 A;  3C7E A;  2VBB A;  4AQ2 A;  2D6O X;  4QPW A;  4RR3 B;  4HET A;  5FWE A;  3SXW A;  2BGP A;  1MQT B;  5FKC A;  4CEY A;  4YGB A;  4E4S A;  4QD2 A;  2YB7 A;  3I2K A;  1G6N A;  1PO2 2;  2CTV A;  3PVB B;  2VZ3 A;  5FZC A;  4LBN A;  1WA6 X;  3OTF A;  2YU1 A;  4QPI B;  1NCR B;  5JUV A;  3K46 A;  5FZD A;  1LEN A;  1YHF A;  3T2Q A;  1YCI A;  1FOD 2;  4Q4V 2;  2WWS A;  4ET7 A;  4CDX B;  2PTM A;  1HN0 A;  3CMG A;  1LES A;  1NCQ A;  1T2X A;  3H3U A;  4CTE A;  2KR2 A;  4CCN A;  4N8M A;  4GUL A;  3S30 A;  2H0B A;  3C7F A;  1TMF 3;  1G86 A;  2A6V A;  2PAK A;  5CAZ A;  4PDW A;  3OPT A;  2BBV A;  3GNE A;  5A7W A;  2E32 A;  1FT9 A;  3K48 A;  1OA3 A;  5FZO B;  1ST8 A;  1YYN A;  2K9Z A;  1AR7 1;  2BVV A;  3KB5 A;  1G7Y A;  3I97 A;  4K1Z A;  1ULF A;  4LHL A;  2OT7 A;  5BUV A;  1SG3 A;  1DGR A;  1WKY A;  3KQR A;  4FOQ A;  5FXZ A;  2E9Q A;  4AHX A;  4CCO A;  5J36 A;  3V64 A;  2JDZ A;  4Y33 A;  4OVE A;  1RUG 3;  1NA1 C;  1SLL A;  2PHL A;  3H3L A;  4WM7 B;  4CCC A;  4JGY B;  2VCC A;  5JOZ A;  1IS4 A;  1VLN A;  3O0X A;  3N4M A;  3ZYR A;  2ADD A;  1RC6 A;  1AYN 3;  3HQU A;  4GD4 A;  4N53 B;  3VBF C;  3ZSE A;  4L99 A;  2W39 A;  3VZO A;  3GJA A;  2VOX A;  1DBN A;  1YNA A;  1IPK A;  2QQU A;  1HXS 3;  3I2I A;  4QPG A;  1UY0 A;  1OUS A;  4P5Y A;  1UKR A;  1HB4 A;  2VOW A;  4Q1P A;  1DP0 A;  2B46 X;  3L2H A;  2B8M A;  4KL1 A;  3UT0 A;  5IYY A;  3LIH A;  1HB1 A;  1QOT A;  3UJO A;  4Y3O A;  4LO7 A;  4MET A;  4Y5Z 0;  4LK6 A;  2EXK A;  3WNM A;  3VBH B;  1W6Q B;  1M06 G;  1OOP C;  1BBT 2;  5D2A A;  5F3E A;  4COU A;  1D4M 1;  3M7A A;  3KV6 A;  1CAX B;  5E16 A;  2CU5 A;  3RS6 A;  2IFW A;  2LUW A;  5A1L A;  5C3S A;  4DFS A;  2RS5 3;  3NL1 A;  1JS9 A;  2BPA 2;  2W08 A;  1UX6 A;  5FZG A;  2WQZ C;  2XHK A;  2Q8D A;  4AHY A;  4KWL A;  2B4K A;  3VL8 A;  1LOB A;  3WDU A;  3ZSL A;  1CR7 A;  2ERF A;  1GZW B;  2WNV C;  1N3Q A;  3NVC A;  3UGG A;  1BZW A;  5F5Q A;  4XYX A;  4LO6 B;  4BXS V;  5E88 A;  3VHO A;  3Q8C A;  4C0H A;  2E7A A;  5LA9 A;  2X10 A;  4NO4 A;  4CCK A;  1UZV A;  3AJY A;  1A8M A;  1MEC 3;  4RD7 A;  3H3Z A;  4N43 B;  4YLZ A;  2NN8 A;  2IXI A;  1HRI 1;  1AR9 2;  1KS4 A;  5JCT A;  4CU6 A;  5C3Q A;  1MVE A;  4OUS A;  4OHZ A;  2PMW B;  1W05 A;  3RZK A;  3WD5 A;  1H1M A;  1PGL 1;  2IVI B;  4C1W A;  5IK5 A;  2ZCW A;  4QXB A;  3JXS A;  3LE0 A;  2A3X A;  4P00 B;  3JD7 1;  1NX9 A;  4IV3 A;  2WA3 A;  1YQ5 A;  3E5X A;  2QCS B;  3UKN A;  5HCH A;  2J1R A;  3MI8 A;  5LY1 A;  5LAT A;  1WLC A;  3HQR A;  4JGZ C;  5LA0 A;  2OUJ A;  4Z8B A;  3D4K A;  4QHZ A;  5ANQ A;  3MYX A;  3R4D B;  4MGY E;  4BU2 A;  2Y0I A;  3I4I A;  2WII B;  5L73 A;  3ZIX A;  4BQ3 A;  3GM8 A;  4MG2 A;  2JDA A;  3DPR A;  4MX3 A;  3OPW A;  3J7N A;  2R04 1;  1NE4 A;  3LDK A;  1XOY A;  1O3S A;  1DYK A;  4IV1 B;  3POS A;  1AR8 2;  1GUI A;  5A3L A;  1YIF A;  1GU3 A;  2EXI A;  2KM2 A;  3FBY A;  2JG8 C;  1WWY A;  2VOK A;  1JYT A;  1R1A 2;  4FCA A;  1L7R A;  1UX7 A;  3KF3 A;  2CAV A;  2UWA A;  4V2V A;  1D4V B;  3AYE A;  3POI A;  5FY1 A;  4B8E A;  4E8C A;  4EV0 A;  3QAC A;  1PGW 2;  2BW8 A;  1NZC A;  4H7L A;  3RVH A;  2XVG A;  1V6M A;  1UIK A;  1DZT A;  2X5I C;  1K5J A;  5JOX A;  4S2G A;  1J83 A;  1SPP B;  2GC2 A;  2ZZQ A;  3TN9 3;  2WO7 A;  3FLT A;  4HT1 T;  1FMD 1;  3GAL A;  2XWB B;  4K21 A;  1VBA 3;  3M4F A;  2IWG B;  4DOU A;  4NRO A;  3SCH A;  3VDB A;  1OKQ A;  4QX7 A;  4DXZ A;  2GP5 A;  4LBO A;  3VZM A;  5CKQ A;  2AYH A;  2W87 A;  4EE2 A;  2XKO A;  2CWS A;  3MW2 A;  2H6C A;  4KU7 A;  2CAU A;  4TSV A;  4QAW A;  3RYR A;  5IVC A;  1GLH A;  2PQS A;  2ATF A;  5JXH A;  3NJY A;  5FYV A;  2GH2 A;  4BIF A;  3I59 A;  4BQ4 A;  4MSV A;  3K75 B;  1S1A A;  3IB3 A;  5FYT A;  3I3M A;  4OUM A;  2B9U A;  1MAC A;  1W9F A;  5HV4 A;  1RUG 1;  4NN0 A;  2WA4 A;  2XUE A;  2DDU A;  2VW2 A;  4GKY A;  2Q8O A;  3ZIW A;  5FPU A;  4HBN A;  3J7L A;  1JYC A;  1NLR A;  1XE8 A;  1QU0 A;  2W92 A;  2JDN A;  2BNN A;  4TLF A;  2OQ7 A;  1LOF C;  2FMD A;  1AHS A;  2NMN A;  1PIV 2;  4PF1 A;  3WQ1 A;  5DQ0 A;  4WZC A;  4OI0 A;  2WUH A;  1HXS 1;  3TRS B;  5A32 A;  5LA1 A;  2Y8K A;  1UIJ A;  4PLM A;  3NKG A;  3LEM A;  4QQH A;  2XPJ A;  4QDR A;  5FZ8 A;  1UZZ A;  5LK5 A;  5A33 A;  1V9U 3;  4NIA A;  5IFP A;  2AR6 A;  3LSE A;  1PO1 3;  2FDJ A;  3FWE A;  2GC0 A;  1GNH A;  5FP7 A;  4XCA A;  5DAP A;  4AI1 A;  5C5U A;  3AL6 A;  2OQ6 A;  4XIL A;  2WQ8 A;  5JWP A;  3ZYJ B;  2NYY A;  4CPB D;  3K77 A;  4QX8 A;  3ACI A;  4B7E A;  2VNV A;  1N3O A;  4CEY B;  1N1Y A;  1YEW A;  2AEZ A;  2WT1 A;  1UYZ A;  2RS5 1;  3H50 A;  5FLJ A;  5CB7 A;  4BCU A;  1WCK A;  2YXS A;  4AG4 A;  2B5H A;  5CFD B;  3LDR A;  1M4W A;  3B3Q E;  3POW A;  5FK7 A;  5H9S A;  1SAC A;  1KS5 A;  4WVM B;  4DIQ A;  3R05 A;  2YV8 A;  4Y1V A;  4URA A;  2CGP A;  5FP3 A;  4Q4Y 3;  4A44 A;  3WP4 A;  3KM5 A;  3IN9 A;  2HWD 3;  3A4U A;  4CDW C;  1JOJ A;  1NCQ B;  4NPM A;  3C7O A;  2WO1 A;  1RGS A;  3FL7 A;  3I7D A;  2W95 A;  4XDP A;  3CHX A;  3OUH A;  4Z92 B;  1JOD A;  3OCP A;  1FPN 1;  3PDQ A;  5M0T A;  4PDW B;  4Q0P A;  3LA7 A;  5CVR A;  1HQL A;  2RJK A;  5FZK A;  1TZO A;  2DCY A;  3M3I A;  5A7W B;  4NPL A;  2W1U A;  4LHS A;  1A3K A;  3B02 A;  2QTW B;  4PBO A;  2ORX A;  2ZGS A;  3CNA A;  4A45 A;  2FDF A;  5F2S A;  2K0G A;  1LHN A;  4OFG A;  3T2P A;  1HIX A;  1D0G A;  4IEQ A;  2FQP A;  5A1F A;  5KR7 A;  3LFI A;  4EWE A;  1HV0 A;  1QOS A;  1VR3 A;  4CDQ C;  1WW5 A;  3LEI A;  1LJ7 A;  1UPI A;  2WSV A;  4MXV A;  1EPZ A;  3IDC B;  2DWR A;  4NR1 A;  3VDD C;  5CAD A;  4XZP A;  5JI9 A;  3ZN6 B;  3OY8 B;  1V0A A;  5FYH A;  1CX1 A;  4M0H A;  3ZR6 A;  2RMU 3;  4URT A;  2YC0 A;  1REF A;  4FPE A;  1ENR A;  1W03 A;  4XTP A;  3USU A;  4AYU A;  4GWJ A;  5DDJ 3;  4WZF A;  3HBZ A;  2VVE A;  4AF9 A;  4I0B A;  1C5H A;  4W4Z A;  5GLW A;  1V6J A;  1W2A X;  2ARA A;  1GQG A;  2VCM A;  1RUD 3;  3UGF A;  2TBV A;  3I2D A;  1CAU A;  1F15 A;  2XLG A;  3EQE A;  5FY7 A;  1QJF A;  4EWD A;  4AFM A;  1PK6 C;  2D6L X;  3MF9 A;  2XG3 A;  3NQH A;  3H1W A;  1N1V A;  3PUR A;  3ZXD A;  2VO5 A;  3CU7 A;  1ALY A;  3ZFG C;  4COY A;  1W9W A;  1RUH 3;  5FZ6 A;  1QWR A;  5SV8 A;  3H8R A;  4LT5 A;  5ABJ B;  3OGG A;  1IG0 A;  4RS5 C;  2BUK A;  4Y5S A;  4RHV 3;  3MGU A;  2W2I A;  2QQM A;  3OUI A;  1KJR A;  3ZDV A;  2VME A;  5FMC A;  3H8O A;  1UMH A;  2VUJ A;  4IEU A;  4YZ1 A;  5LK7 B;  1PZ7 A;  5BNP C;  4BK5 A;  4HK9 A;  3N9P A;  1R1Z A;  4CXW A;  2XH6 A;  2XML A;  1R64 A;  3NV1 A;  4XF0 A;  2VC9 A;  1OQE A;  1D2S A;  1XE0 A;  1QDC A;  4BQ5 A;  4KGQ A;  1T6G C;  4XUR A;  4MAD A;  3KD4 A;  2VW1 A;  4QQ2 A;  4CU9 A;  4EZ4 A;  2V72 A;  1W8O A;  3AFG A;  1Y4W A;  4XMI A;  3ZO0 B;  1YFX A;  4FPL A;  2Z4F A;  3E5U A;  4UXA A;  2VZT A;  4S2H A;  1WBF A;  1YWK A;  1H6Y A;  2PHR A;  2WC2 A;  2WFF 3;  5L9V A;  2BWC A;  2ZMN A;  4CSW A;  2O1Q A;  4C91 A;  1LHW A;  5CG8 A;  2QJV A;  5I8S A;  2DF7 A;  2F4P A;  5CKM A;  2Y64 A;  1PX4 A;  4XAE A;  1UOG A;  3DPR B;  3HN1 A;  3WUC A;  4UW3 A;  3CL1 A;  3WQ0 A;  1RUJ 2;  3HVD A;  4JDM A;  1K5M C;  2RM2 2;  4RGK A;  4UBG A;  5GZD A;  1OPM A;  2EA7 A;  4EN6 B;  5IK4 A;  3ZR5 A;  2HJI A;  1LKN A;  3LDB A;  3SH4 A;  5KHJ A;  1LOA A;  1EP0 A;  2R30 A;  1MZ6 A;  3K4A A;  1SCR A;  5FYS A;  3VD7 A;  3WEZ A;  5C71 A;  4LBM A;  1UMZ A;  1UU4 A;  3DEM A;  3W5M A;  5F3G A;  4OHY A;  1BEV 2;  1POV 1;  4HSL A;  4M00 A;  4Q0V A;  1R09 1;  1W2U A;  4YW2 A;  1CPN A;  3LEG A;  4QX3 A;  1GZT A;  4BK4 A;  5DUU A;  2MHF A;  1F5F A;  4QWN A;  2A6X A;  2D6N A;  2ZJC A;  5K9Y A;  2VMI A;  4CUB A;  2ZGN A;  3PVE A;  3Q9O A;  3RZG A;  5FQ0 A;  1WW4 A;  1TG7 A;  4ZS3 A;  4YW3 A;  3H1M A;  2HWB 2;  1ZX5 A;  1BYH A;  3KT4 A;  2P6C A;  2YBS A;  3X29 B;  2C9A A;  1SCS A;  4L9B A;  3V0B B;  1QXJ A;  2BOI A;  1HQW A;  2QQO A;  2H0V A;  3HD8 B;  5KXC A;  3VD9 A;  4PQ9 A;  2CV6 A;  1OVP A;  3SH5 A;  2Y38 A;  1OOP A;  3T0B A;  3I59 B;  3U37 A;  4J6G A;  2JIJ A;  5FYU A;  1MS5 A;  2JDY A;  4E2Q A;  4GIQ A;  4C1X A;  3VDC A;  5JZG C;  5FP9 A;  1HRV 2;  2RS1 1;  3POY A;  4X6R B;  4XPV A;  2IVJ A;  4AEK A;  1W0P A;  3M3E A;  4P9G A;  5IK7 A;  1ACC A;  1QJZ A;  2DV9 A;  2WZP P;  3SKJ E;  3TOJ A;  5J3U A;  4QGL A;  2XXZ A;  3U4S A;  3O0W A;  2WN2 A;  3WDT A;  1OD5 A;  3OBR A;  5CFC B;  3RFR A;  4ZXE A;  4HKW A;  1XU1 A;  2IZW A;  3W20 A;  2XQR A;  3K4Z A;  1FAY A;  4ZZ5 A;  2RMU 1;  1UZY A;  1VB4 A;  4HPK A;  2JEC A;  3E97 A;  4AVA A;  1XSQ A;  3CZJ A;  5CNA A;  4YRD A;  2Z79 A;  1CN1 A;  3DCQ A;  2FDK A;  2ILM A;  3KLS A;  4OZO A;  4W6X A;  4CP2 A;  2WSU A;  4XIO A;  1RUD 1;  1ZBE 2;  2W94 A;  5A33 B;  1AL2 3;  4AEJ A;  3ZN4 A;  3WNP A;  4ZU7 A;  1POQ A;  4KQ7 A;  1ULE A;  2W91 A;  3RYK A;  2E31 A;  2DU0 A;  3RI8 A;  1C8M 2;  4A6S A;  3ORJ A;  2VJX A;  1JHN A;  3GZA A;  3W58 A;  5L9B A;  2FDH A;  5E6H A;  1GQP A;  1RMU 2;  2RDN A;  2D5F A;  3FMG A;  3IWZ A;  3M2M A;  3RMX A;  2P2K A;  1RUH 1;  3O1T A;  2LM3 A;  3O0V A;  4JGZ A;  3AM2 A;  2QUO A;  3D82 A;  4XHB A;  2WN3 A;  1VB2 A;  3UYJ A;  3BOD A;  3N9L A;  2PFW A;  4IE0 A;  1WZX A;  2DTY A;  3E1F 1;  3TNQ A;  4IE7 A;  5JXJ A;  4XFI A;  1XND A;  1IQD C;  1OD3 A;  1GYK A;  2GNB A;  3M3C A;  4D69 A;  4C90 A;  3GBW A;  1X9T A;  2JG8 A;  2NQY A;  3HEI A;  4FPG A;  1DYP A;  3BCW A;  4LUK A;  3HNB M;  1Q8P A;  4EN9 B;  3NKT A;  4CPB A;  2E6V A;  4TN7 A;  3MO4 A;  5AVA A;  3IBM A;  4I02 A;  4JKL A;  4UOJ A;  5AC9 1;  1RUO A;  2ZTN A;  3M3O A;  1HLC A;  2WLQ A;  4FFI A;  2ZHL A;  1BLZ A;  1XNT A;  2XVL A;  3PUS A;  4FFF A;  4GB3 2;  4AFD A;  1SZB A;  4RL7 A;  2LW8 A;  4DRV A;  1RUF 1;  5I91 A;  4AGR A;  3WR0 A;  1RB8 G;  1W6P A;  1JU4 A;  3LZZ A;  5GZG A;  2YBK A;  4YVS B;  5DPN A;  1C4R A;  2AH2 A;  3NJX A;  1VRH 3;  1WUV A;  2PEL A;  1GFF 2;  4SLI A;  1WMF A;  5FMB A;  1DHK B;  2J7M A;  4P08 A;  2BER A;  2JB4 A;  3U0Z A;  4AHW A;  1PVC 2;  1RUE 1;  3CEW A;  1J1L A;  2DCT A;  3OEA A;  1QHD A;  2WAB A;  1AXK A;  4BMB A;  3BU0 A;  2QQK A;  2VQU A;  4XFB A;  4RGA A;  2QDN A;  4ZU4 A;  3ZYI B;  3USU B;  2XBO 1;  5FZI A;  1RL3 A;  1H8T B;  4HG6 B;  1L3J A;  2I2S A;  3AP4 A;  3WF3 A;  2XJQ A;  3SH3 A;  4HFS A;  1BVP 1;  4PIY A;  5JI7 A;  1AXZ A;  5EHD A;  4F7Z A;  4WM8 C;  1CAU B;  2YDE A;  3IAP A;  4ZS2 A;  3S0M A;  3BTZ A;  5ISL A;  1UW8 A;  1GIC A;  1Q8V A;  1W04 A;  2ETE A;  4DIN B;  1LOE A;  1LOF A;  2ZBJ A;  1LHV A;  2Y6H A;  5D8A A;  3VBS C;  3K3N A;  3AMN A;  2JD9 A;  1RUJ 1;  1VIW B;  4GA9 A;  2LRP A;  3WDV A;  1PM7 A;  3OG2 A;  3RZL A;  3AKP A;  3AP5 A;  4FPK A;  3ELN A;  5I0D A;  2N7G A;  1Z7S 3;  1NXM A;  2VXR A;  4NUB A;  4PJY A;  1RTV A;  3I2J A;  2IXJ A;  3ZSJ A;  3NJV A;  5GZC A;  1S2K A;  4H14 A;  4L0P A;  3QD6 A;  3IM0 A;  5J96 B;  3EO6 A;  1OKO A;  1US2 A;  1SLT A;  4P9W A;  5HCB A;  2ZEW A;  2P3K A;  1AR7 2;  1O5L A;  2R16 A;  2OVU A;  1ZZ8 A;  2E26 A;  3POB A;  2C9K A;  4H3W A;  3SKV A;  4NAM A;  5EXO A;  3ZYH A;  1P8J A;  5I8T A;  3FC0 A;  2MEV 3;  1AX1 A;  4MHU A;  5FK8 A;  5H9P A;  1DIW A;  3IDE A;  4PLN A;  4XDO A;  3KV5 A;  3WNN A;  4YSF A;  2XJT A;  1E5I A;  3OBZ A;  2WZR 3;  3V0A A;  5HBA A;  3JQX A;  2WAA A;  5FLI A;  5C3R A;  1DZQ A;  2UUR A;  4QHO A;  1NLS A;  5LBE A;  3UET A;  2GC3 A;  4CDW A;  1OA2 A;  3BYW A;  2VVF A;  4R9A A;  3T4H B;  1TNR A;  4LKE A;  4X6Q B;  2GC1 A;  1GKB A;  1OQ1 A;  1W39 A;  1V6K A;  4CEW B;  1UD1 A;  2HWC 1;  2VH9 A;  2XLF A;  3AMP A;  2XUM A;  1W2N A;  1OLR A;  3OYW A;  4FOW A;  1I3H A;  3HT1 A;  4B1L A;  3CLP A;  4DUV A;  2IXH A;  1RJ8 A;  4CDU C;  1PM4 A;  5F32 A;  1VMH A;  2P3Y A;  3QLQ A;  4G9S B;  1D4M 2;  3K51 A;  1BMV 1;  1WGP A;  5HV0 A;  2C5D A;  3T0D A;  3TEY A;  4UYB A;  3RDI A;  1VBC 3;  3WIN E;  4HN0 A;  4DS0 A;  1NE6 A;  4ZZ8 A;  2Z5W A;  5JLV A;  1O7F A;  4OMD A;  4CCM A;  2VGD A;  4HN1 A;  1JH5 A;  1TME 2;  4A42 A;  3HNM A;  2BYV E;  1O3R A;  1QF3 A;  2F4L A;  3VDD A;  1W3V A;  1H8V A;  2W5F A;  1RED A;  3SNM A;  4A7Z A;  4Q8K A;  1GAN A;  1PZ8 A;  2XQX A;  5FQ0 B;  3RWK X;  1W99 A;  3OF1 A;  2JKB A;  3T1L A;  4DUX A;  1F8V A;  2QBX A;  3B93 A;  5F1R A;  4Q4W 3;  2E7Q A;  1IQA A;  3LF7 A;  2PHX A;  4UWD A;  3MIC A;  4YW4 A;  4YYO A;  3SLI A;  1I1E A;  1U5X A;  3BI3 A;  1QQP 3;  2QZ3 A;  5HCA A;  3BIE A;  2XJS A;  3RJ2 X;  3RYP A;  2BJS A;  2VOV A;  1HRI 2;  2BNO A;  3OJB A;  4X8P A;  3PIJ A;  4DXS A;  1XYO A;  5JAX A;  1CWP A;  3I2F A;  1SMV A;  2VMG A;  4BZ4 A;  1PGL 2;  1PK6 A;  2WWU A;  5FZM A;  4CXX A;  5JDB A;  1G8W A;  4AI3 A;  4WVW A;  3VBU A;  1YFY A;  2Y34 A;  4Q0S A;  3JD7 2;  4YM3 A;  4XJU A;  3N9O A;  2KA3 A;  3EXU A;  3E6D A;  3B9I A;  2ARE A;  4NAO A;  4DUW A;  3ZFG A;  5A80 A;  1OFN A;  2B39 A;  1V6L A;  4P9X A;  5C70 A;  2R07 3;  1UZ0 A;  4OHV A;  1W0O A;  1WME A;  4RS5 A;  3J7H A;  1CQ9 A;  4Q29 A;  1MZF A;  4XJZ A;  4IDZ A;  4CCJ A;  2GSY A;  5AVP A;  1QJU 1;  2R04 2;  3OPZ A;  3KHC A;  3NAP A;  1BHG A;  1S0F A;  3VD4 A;  2B42 B;  1ZBA 3;  1UOJ A;  4HPK B;  1DG6 A;  5DN2 A;  5BNP A;  5JXG A;  5F5I A;  2VZU A;  2XR4 A;  4GWM A;  3ZKU A;  1UYX A;  1GOH A;  2YC4 A;  4LKF A;  1IPJ A;  3LA2 A;  4CP9 A;  5FY5 A;  2ES3 A;  2VQ0 A;  2VU9 A;  4O9E A;  4PIZ A;  3WLU A;  1SBF A;  4RQP A;  1HV1 A;  3WUD A;  2ZGQ A;  2Y6J A;  2P4E A;  1COV 3;  1GR3 A;  5L7O B;  4YVW C;  2FCU A;  3VZL A;  1AR6 1;  1RVF 1;  2Z69 A;  3Q8B A;  1FMD 2;  1RYY A;  4LR4 A;  2W9X A;  3AXD A;  4QX5 A;  4JGZ B;  1GNZ A;  3AVS A;  4ZY9 A;  3PTR B;  4XUQ A;  1N3P A;  1IHM A;  4WVZ A;  3VN4 A;  5C5T A;  3TEW A;  1JTZ X;  1F9K A;  2VW0 A;  3ZFF C;  3ZOI A;  1K5M A;  2VMC A;  4PQQ A;  3J7M A;  3V56 A;  3DXU A;  3RGB A;  1W8Z A;  3P6B A;  4W6W A;  3GZT B;  1VBE 3;  4TZD A;  1BK1 A;  2JG8 B;  3ILF A;  4JTO A;  4XQD A;  5FUI A;  4UF0 A;  4K8R B;  1J3R A;  1V00 A;  4LBL A;  4XBL A;  1J3P A;  4AFB A;  1KIT A;  2A3Y A;  1RUG 2;  1S0I A;  2YBP A;  3E5Q A;  4BIO A;  2ZKL A;  1LHO A;  1JYI A;  3FE5 A;  5FRE A;  3THD A;  2JB8 A;  5FYZ A;  2JDU A;  4M3C E;  4AVT A;  4QQO A;  2O0O A;  3LOB A;  2WBK A;  2CL2 A;  4KMQ A;  1DGR N;  2VZV A;  1W6P B;  3A23 A;  2XB6 C;  1HXS 2;  2PXJ A;  2R0H A;  2UWB A;  2W46 A;  3UKT A;  5DG1 A;  2EID A;  3BIW E;  4BA6 A;  3BTA A;  2FHR A;  3DEC A;  3LEK A;  3THP A;  3C7G A;  3FHA A;  2D98 A;  3PL0 A;  5DZE A;  1RXF A;  3WF1 A;  1SFP A;  2VE1 A;  2WNO A;  1SLA A;  1O4T A;  3WW2 A;  4YFZ A;  2K46 A;  2P5B A;  3P5B A;  4ZHN A;  3KWV A;  2RS3 3;  4IE4 A;  5JZG A;  1SDD B;  2RS5 2;  1O6U A;  2P6H A;  5ACA 3;  4JRL A;  4CCD A;  2GZW A;  5FZ4 A;  2JIG A;  2ZEX A;  4HKL A;  1PO2 3;  3ACH A;  3P1I A;  5FTT C;  3SCF A;  5HPO A;  2FDI A;  1KJL A;  2YUE A;  5DZF A;  4DB5 A;  4DEQ A;  4WBB A;  1JUI A;  3CKH A;  4QB1 A;  3WV6 A;  2BFU S;  3OGJ A;  5FOB B;  2WLP A;  5D8A B;  1ZA7 A;  4ISR A;  5G05 L;  5CEH A;  1UWW A;  4Q4W 1;  3TBD A;  1FOD 3;  1KXG A;  4NRP A;  4DXR A;  5BNN C;  4FTB A;  4MGI E;  3NW4 A;  1H1A A;  1FPN 2;  5A7Q A;  3WSO A;  5C8W A;  2KXL A;  2VVD A;  1E57 A;  3Q8F A;  4HMZ A;  3T2O A;  1ND3 B;  2NPI A;  4W65 A;  1XJA A;  5FIX A;  1V6O A;  2P3J A;  3AXE A;  3ZMO A;  3ZPY A;  4CVU A;  2G4I A;  1TME 1;  5C4W C;  2E33 A;  1IKQ A;  2VCA A;  4LBQ D;  3S5Q A;  2EAA A;  3I2H A;  4GH4 C;  2LTN A;  2D40 A;  4EN7 B;  5FKB A;  4MV2 A;  4CCE A;  1CZV A;  2PAE A;  2PN5 A;  4UFK A;  3VBO A;  4AEM A;  1HN1 A;  4FPJ A;  2YRO A;  3V0A B;  4ES8 A;  4BJ0 A;  1J59 A;  5FY0 A;  1YI9 A;  1CJD A;  4FTE A;  4AED C;  4H7M A;  1TE1 B;  4XJ9 A;  2E63 A;  5FRA A;  4BYY A;  2W3J A;  5IWF A;  1US3 A;  3AFK A;  3AMM A;  5A6Z A;  2LAL A;  2TUN A;  5DAX A;  1E5H A;  4K9S A;  4CYD A;  1OI6 A;  4ORF A;  1KFU L;  2NZ9 A;  2HWF 1;  3JB8 A;  2ZX4 A;  4HKO A;  5A3T A;  1PGS A;  3I2O A;  3RSJ A;  3IT8 A;  1BBT 3;  2K2S A;  2WNU C;  5T52 A;  3WCR A;  5F8P A;  4NHM A;  2Z2S B;  2A71 A;  4XOG A;  1WCS A;  3POF A;  5K7P A;  1FNZ A;  2BZD A;  4Q4X 3;  3T30 A;  1S0D A;  1Q8O A;  2X05 A;  1Q3E A;  2ZEY A;  5FMO L;  3VDD B;  2YC2 A;  3OGS A;  2OXB A;  2Q8E A;  4COW A;  3GHN A;  3TB0 A;  4LA3 A;  2RE9 A;  4LO4 B;  1Q43 A;  4JV4 A;  2OUH A;  4RR3 C;  5A3W A;  2J1E A;  3PNA A;  2OKX A;  1ZNP A;  5FYB A;  3BTY A;  1MQT C;  2J1U A;  2DVB A;  2NLR A;  2ZS6 B;  1VPH A;  4OMC A;  3H8X A;  1V6I A;  4WM8 A;  4KI5 M;  3WF0 A;  1C5I A;  3L9J T;  4XJA A;  4YG0 A;  1TMF 1;  1PK6 B;  1AR9 3;  1NCR C;  1UY3 A;  1OF4 A;  2XL9 A;  3N3H A;  3VBU B;  3VBS A;  3U78 A;  1X50 A;  3SIT A;  4L11 A;  1R08 3;  5BNQ A;  3ILR A;  4IER A;  5F5A A;  4CDX C;  4XUP A;  1JYV A;  1XNK A;  3PHM A;  2Q1M A;  3H8U A;  4O65 A;  2HH9 A;  4K7J A;  4NIH A;  3BOW A;  3MW4 A;  2FD8 A;  1H2M A;  3NAP B;  1F2N A;  3ES4 A;  4JX0 A;  1VP6 A;  4ISQ A;  5BNP B;  4D6Q A;  1VAV A;  3B5L B;  5SV5 A;  1HW5 A;  1YQ6 A;  2BV4 A;  3EJK A;  1W6M A;  1AYN 1;  2R49 A;  1AR8 3;  2ID4 A;  4HOO A;  4MGS A;  1UKG A;  3ZFE A;  3AKS A;  1R1A 3;  1KGY A;  4RQP B;  2B7Y A;  1R09 2;  4XFA A;  4XMA A;  1LGB A;  1CIW A;  3VHP A;  1ULG A;  5GLU A;  3B69 A;  1C57 A;  3BGA A;  1ZRE A;  3IIA A;  4WM7 C;  1V70 A;  4Y20 A;  1S0B A;  2D7F A;  5FY8 A;  3VL9 A;  4OZX A;  3FBM A;  1XB9 A;  3AB0 A;  4A7Y A;  1JYW A;  3BVC A;  1JZ7 A;  3AK0 A;  3HBK A;  2VQA A;  3THC A;  4DY5 A;  1ND2 C;  2A5Z A;  2AC1 A;  4CDU A;  1W8F A;  3WG3 A;  3GF6 A;  3D5O A;  4QQL A;  5FCC A;  3WP5 A;  1U5I A;  4UF0 B;  5JIA A;  1QJX 3;  1CZS A;  3RNS A;  1LED A;  1GOG A;  2OW4 A;  2RS1 2;  3KGZ A;  3PME A;  4BPZ A;  5JIU A;  3N35 A;  5KC5 A;  2D93 A;  4YZ2 A;  5JMO A;  3FLR A;  4LK7 A;  2JE9 A;  3ATG A;  2JDP A;  5C8C C;  3KMH A;  3MW3 A;  4FQ4 A;  1S2B A;  1EV1 3;  4XXA A;  3IDA A;  2RR1 3;  3ASI A;  1MEC 1;  1QKQ A;  4R52 A;  4A7K A;  4H55 A;  5FO8 B;  5FBJ A;  4PBP A;  4B4Q A;  3MFC A;  2RMU 2;  2PLV 3;  3IPV A;  5CBL A;  2WO3 A;  2ZA9 A;  1O4Y A;  3PUA A;  5FZH A;  5K0U A;  5DDJ 2;  3AX4 A;  2J1S A;  2ZAC A;  1DQ0 A;  2D3S A;  2QKD A;  1PIV 3;  3M8L A;  1MPX A;  2MPF A;  3PVN A;  5JOY A;  4AR2 A;  4QKN A;  1RUD 2;  1NAE A;  4RA0 A;  4AE2 A;  1UU6 A;  1URX A;  1D2Q A;  1HDK A;  3JUU A;  5C9A A;  1SLB A;  4JQT A;  2YY1 A;  4N43 C;  3AZV A;  5C3O A;  1J3Q A;  3DN7 A;  4JDN A;  1G9A A;  3DYM A;  4M4R A;  5AFE A;  4IE5 A;  5I0R A;  1W6N A;  2XLA A;  4HON A;  3LCP A;  1RHI 3;  2I07 B;  1RUH 2;  1DF0 A;  2HEY F;  3J8F 3;  5C7G A;  2CWM A;  4Q4X 1;  1OMI A;  1QH6 A;  4ATE A;  1GBG A;  2ZGK A;  4QPG B;  3ZYG A;  3AYC A;  3LA3 A;  1OSG A;  3ACF A;  5EWS A;  2ZX2 A;  3FJS A;  4R4Z A;  1IPS A;  1IS3 A;  2JG9 A;  2SLI A;  2TNF A;  3MV1 1;  3I2G A;  2W1W A;  2KD7 A;  1DQ5 A;  4J25 A;  2WFP A;  1JI6 A;  3W9A A;  1HB3 A;  4KNC A;  3POE A;  4NHK A;  1CAV A;  1XNA A;  1BXH A;  1KEX A;  3PUI A;  5FJK A;  3RG0 A;  3TN9 1;  5KHK A;  4L92 A;  1VBA 1;  2EIC A;  5DAV A;  5AC9 2;  1VAK A;  2H6B A;  2IXL A;  1QIQ A;  3VKN A;  1W28 A;  1O8S A;  1LNS A;  4ZXK A;  4B4P A;  2UY9 A;  4YVW A;  2YU2 A;  3ZMN A;  1H1I A;  1LCL A;  4RSU A;  3A7Q A;  5EYY A;  4QX2 A;  1R08 1;  2OX0 A;  1RUF 2;  2WKK A;  2WFF 2;  1YFU A;  1NLQ A;  3DGT A;  2IXC A;  2WS9 3;  4UBH A;  3TWI A;  3ZXG A;  1XNC A;  1G9B A;  4JKK A;  3SHR A;  4A3X A;  3OGV A;  1MZE A;  1DYO A;  5EV7 A;  3HQX A;  5FZ7 A;  2G19 A;  5H9Q A;  2JIC A;  3LGR A;  4Y1Z A;  3VBO B;  3ZFF A;  2XDV A;  3E6B A;  3OOX A;  4LLO A;  2Q8C A;  3R4S A;  1RUE 2;  4B3N A;  2C4X A;  4ITC A;  5JR2 A;  2G9G A;  2ET1 A;  3SMH A;  2R06 3;  4G3Y C;  3WDY A;  2ZZJ A;  2E53 A;  3VD3 A;  3KV4 A;  2XBO 2;  3NMB A;  3WNL A;  1ZRR A;  2W47 A;  5KHI A;  2VG9 A;  2L9L A;  5CU1 A;  3N7L A;  4NWV A;  5FPB A;  4IV3 B;  4LBQ A;  5F6L B;  2DFC A;  1LR5 A;  4EN0 A;  1ZYB A;  3BN6 A;  1JZ5 A;  2DCK A;  3GHM A;  1QH7 A;  3AZZ A;  1OH3 A;  1HQN A;  1KDK A;  1OUR A;  2P3I A;  1WMX A;  1V9U 1;  4LBK A;  3W59 A;  4LEJ A;  1PO1 1;  3KV9 A;  2FMY A;  3MLJ A;  2C0Z A;  5F6K A;  4BIS A;  2R1B A;  4DPN A;  1NKG A;  3WHU A;  3MBW A;  3P3P A;  4K6B A;  1WLW A;  3N7K A;  4JHZ A;  5T50 A;  3WVJ A;  2WAO A;  4MGK E;  1PNG A;  4Q8L A;  4AQT A;  4YW6 A;  1UXZ A;  3MUZ 1;  1LU2 A;  3OBT A;  4IEY A;  4N7U A;  1QJX 1;  1LRH A;  1NA1 A;  1UN1 A;  3U10 A;  2NM1 A;  4Q4Y 1;  1LEC A;  2YHJ A;  3ZXA C;  2WL1 A;  2JKX A;  5LBF A;  3VBF A;  2VTF A;  5G04 L;  5FYY A;  2HWD 1;  3A22 A;  3EHK A;  3WOG A;  1EV1 1;  4WM8 B;  4XFH A;  4F83 A;  2VZQ A;  3VBR C;  1FV2 A;  5CFD C;  5I8Y A;  2D3R A;  1OA4 A;  2BDR A;  3WQ7 A;  2ZGO A;  3VKL A;  4YZ3 A;  1OH4 A;  1PVX A;  2PLV 1;  1O8P A;  3ETP A;  2NP0 A;  2BU9 A;  5DMY A;  2RVA A;  5FV3 A;  1Y9G A;  1MS0 A;  4AI9 A;  2BEO A;  3M3Q A;  4E2G A;  2WWJ A;  4AZZ A;  2J1A A;  4CA9 A;  3LOI A;  4Q0U A;  1AL2 2;  3RJR A;  4NID A;  3U75 A;  2HWC 2;  2A6Y A;  3ZSK A;  4N9H A;  2OII A;  5FXW A;  1U5Y A;  1RUI 3;  2VUA A;  5J98 B;  1WA4 A;  4BQW A;  2WO2 A;  4PDW C;  1Y3T A;  4AFA A;  3IKW A;  5A6Y A;  2DVD A;  5A3M A;  2WNV A;  1QXR A;  1X9P A;  1JYN A;  1BMV 2;  1W6M B;  5F2W A;  3T3Y A;  5APA A;  2Y60 A;  1Y43 B;  3ZFE B;  4GH4 A;  2VZR A;  4NHY A;  1UNB A;  5FOJ B;  5FZ0 A;  4DZG A;  5DDJ 1;  2HEV F;  5A32 B;  3GBG A;  1O4Z A;  1UZW A;  3B94 A;  4COZ A;  3GXU A;  4IGO A;  4MVT A;  1AX2 A;  4Y20 B;  5HCF A;  3U07 A;  2R7E B;  1S0G A;  3WNK A;  1ENX A;  2DCZ A;  2P1B A;  3AKR A;  1MVQ A;  4ERO A;  4XC9 A;  4C0B A;  1QJY 3;  2RJL A;  2QQI A;  3I54 A;  3Q8E A;  3NNG A;  1MS3 A;  4JQR A;  4XVH A;  3H7J A;  5CKN A;  3HN3 A;  2E7T A;  2HBU A;  1ASJ 3;  4KBB A;  2AGS A;  5FYM A;  4W8J A;  3P3N A;  4CDU B;  1VBD 3;  2CY6 A;  2ZPX A;  2DVF A;  4XTM A;  4QPY A;  3RZM A;  3I3B A;  4FBF A;  2D6P A;  1W6O A;  2R32 A;  4LA2 A;  1IKP A;  2I74 A;  2WS9 1;  3LB9 A;  4MO3 M;  2VM9 A;  3MEP A;  4RHV 1;  4ZPI A;  4U36 A;  1HJF A;  4PCR A;  1NUK A;  2PQQ A;  1LOC A;  4XF9 A;  2WZE A;  2EXJ A;  1HRV 3;  3PJY A;  2WRA A;  1DCS A;  3JBG 3;  4E8D A;  2XON A;  1DQ4 A;  1LU1 A;  5CZK A;  4EN8 B;  4Y1X A;  3MIG A;  4K20 A;  2VUL A;  1S0E A;  3MPP G;  5GKA C;  1QJU 2;  4PIX A;  4XE9 A;  5ABJ C;  4AQ6 A;  5I0S A;  5E1R A;  2VZ1 A;  3PJQ A;  3IPV B;  2ZMK A;  1UU5 A;  4B4R A;  5B2G B;  4AI2 A;  2Y6F A;  5K0U B;  5LRS A;  2FZ2 A;  1VE0 A;  3LQC A;  4XF3 A;  2VQT A;  3N9M A;  2X5I A;  1SFN A;  3D0S A;  1MQT A;  1JZ4 A;  1GQH A;  5J09 A;  2GNT A;  4UW6 A;  5EJZ B;  3IZO A;  2QVS B;  1QJE A;  5C9A B;  2WFF 1;  4FOY A;  3VUO A;  2ZHM A;  2P34 A;  4EJR A;  4QU1 A;  3TEZ A;  1C8M 3;  4ES9 A;  1RVF 2;  4MH0 E;  4CP0 A;  1AR6 2;  3LPF A;  1FI2 A;  4HVR A;  1EY2 A;  3HWJ A;  1CPM A;  4CDX A;  2DUP A;  3MLK A;  1T6B X;  4TTG A;  3O7O A;  4DNY A;  2ZEZ A;  1Z7S 2;  2FZ1 A;  3T09 A;  3ON7 A;  4FFH A;  3Q8A A;  4XAC A;  3HMY A;  2A6W A;  4LKD A;  1Y7B A;  1QY4 A;  1DFQ A;  2JE7 A;  2JG9 B;  2VXJ A;  1GP5 A;  2WT2 A;  1OHF A;  3IDB B;  4D3W A;  4MGZ E;  1IOA A;  3W21 A;  2XJR A;  3ZXL A;  5BNO C;  3B7M A;  1UAI A;  1ULP A;  5IHR A;  3MLL A;  3O14 A;  2EAL A;  3JU9 A;  2AEY A;  2GAL A;  1PMH X;  4LOT A;  3CO2 A;  1F5J A;  2YFZ A;  5DG2 A;  5JVV A;  1VBB 3;  4RFT 0;  5LRR A;  2ORZ A;  4N9I A;  3UKV A;  5LEJ A;  5JOW A;  2ZAH A;  3K3O A;  3KZ4 C;  2V73 A;  4F8A A;  2ARB A;  2YPD A;  4QHB A;  1AXY A;  4RGG A;  2LS6 A;  1ULC A;  1N47 A;  3MF6 A;  4YVW B;  2ZX3 A;  4YW7 A;  3BU7 A;  2DBI A;  3MIB A;  2FBE A;  1K45 A;  2YZ4 A;  4D6R A;  5C6C A;  4WVV A;  1W2T A;  4EWA A;  4BB3 A;  4GB3 3;  1EAH 3;  2WYF A;  3NV3 A;  1IZ3 A;  4LNV A;  5IK8 A;  1AYM 3;  1HX6 A;  2CGN A;  3KHB A;  1RUI 1;  3ZFF B;  2IUW A;  3SC7 X;  4FO9 A;  2FCV A;  1WLD A;  2GP3 A;  1ND2 A;  5K8S A; 
#chains in the Genus database with same CATH homology
 3N9P A;  2OQ7 A;  4Y3O A;  5FUP A;  5FZO A;  5FZ0 A;  2XML A;  4QXC A;  5FYC A;  1VRB A;  3U78 A;  5FJK A;  4GAZ A;  3LD8 A;  5F3E A;  4IGO A;  5FZB A;  2P5B A;  5FP8 A;  3KV6 A;  5FWJ A;  5FZ8 A;  4CCM A;  4EZ4 A;  5A1L A;  5F5A A;  5A7N A;  4GJY A;  5IVJ A;  5LW9 A;  5FZG A;  2Q8D A;  4TN7 A;  5FP7 A;  2YU2 A;  3AL6 A;  4IGP A;  2OQ6 A;  3N9N A;  4LIV A;  5FZ4 A;  3PU8 A;  2OX0 A;  4IGQ A;  4QX8 A;  4CSW A;  3N9Q A;  4D6Q A;  3PUS A;  5FYM A;  5FZ7 A;  4D6S A;  4DO0 A;  5LY2 A;  4HOO A;  2XDV A;  4DIQ A;  4CCK A;  2YBK A;  2Q8C A;  3ZPO A;  5CEH A;  2OS2 A;  3LDB A;  4URA A;  5IVF A;  5FP3 A;  4V2W A;  2WWU A;  5FZM A;  5A3P A;  5FYS A;  5F3G A;  3KV4 A;  3N9O A;  3AVR A;  5A7Q A;  5FPA A;  5LWB A;  5FY8 A;  5A80 A;  4QXB A;  3KVA A;  5F3I A;  5FPB A;  4XDP A;  3ZLI A;  3KVB A;  3PU3 A;  4LIU A;  5FZI A;  5A3N A;  5FYI A;  4QWN A;  3PDQ A;  5LY1 A;  4CCJ A;  5FPL A;  3N9M A;  4BXF A;  5FZK A;  5FWE A;  5ANQ A;  5FPV A;  5A7W B;  4BU2 A;  3KV9 A;  5F5I A;  5F2S A;  2YBS A;  4BIS A;  5ISL A;  5FZC A;  3OPW A;  5FZA A;  5A7S A;  2YU1 A;  4CUG A;  4UF0 B;  5FY5 A;  5FZ9 A;  5A1F A;  3K3N A;  5FZD A;  5KR7 A;  4QU1 A;  3DXT A;  3K2O A;  5F39 A;  5FY0 A;  3PUQ A;  5FYU A;  4C8D A;  5IVB A;  5FZF A;  4V2V A;  5FY1 A;  4EYU A;  5FP9 A;  5FZ3 A;  5FY4 A;  5F37 A;  4NUB A;  5IWF A;  4Y4R A;  3RVH A;  5FYH A;  5A7O A;  4CCN A;  5FBJ A;  2XXZ A;  3U4S A;  3AVS A;  5FXV A;  5FYY A;  3PTR B;  5FJH A;  3PUA A;  5FZE A;  5FZH A;  3OPT A;  4QXH A;  5FZ1 A;  5A7P A;  4ASK A;  5IVV A;  5IW0 A;  5A7W A;  5FP4 A;  5F3C A;  4QX7 A;  4LXL A;  5FXX A;  5FZO B;  5FY7 A;  5A3T A;  2GP5 A;  3DXU A;  4XDO A;  3KV5 A;  2OT7 A;  5FV3 A;  5FXZ A;  4UF0 A;  5IVE A;  4CCL A;  4AI9 A;  3PUR A;  3K3O A;  4CCO A;  2WWJ A;  5IVC A;  4E4H A;  4Y33 A;  2YPD A;  3NJY A;  5FYV A;  5K4L A;  5FZ6 A;  4HON A;  2Q8E A;  5FXW A;  3AL5 A;  2YBP A;  4D6R A;  4GD4 A;  4AAP A;  5E6H A;  5FUN A;  5FYT A;  4GJZ A;  2W2I A;  5FYZ A;  5A3W A;  2VD7 A;  5FYB A;  4EZH A;  2XUE A;  5F5C A;  5FZL A;  5FPU A;  4LIT A;  5F2W A;  5FY9 A;  3UYJ A;  3N9L A;  5F32 A;  2PXJ A;  2GP3 A;  5IVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...