5FZ9A

Crystal structure of the catalytic domain of human jarid1b in complex with maybridge fragment thieno(3,2-b)thiophene-5-carboxylic acid (n06263b) (ligand modelled based on pandda event map, sgc - diamond i04-1 fragment screening)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
462
structure length
440
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDAIIEDEALETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with Maybridge Fragment Thieno(3,2-B)Thiophene -5-Carboxylic Acid (N06263B) (Ligand Modelled Based on Pandda Event Map, Sgc - Diamond I04-1 Fragment Screening)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 144
structure length 440
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fz9A01
5F37A 5F5CA 5FZIA 3OPTA 2P5BA 4E4HA 3PUSA 5FBJA 2OT7A 5FZCA 5FPBA 5A3TA 2YU2A 5IVEA 2YBSA 5A7QA 5F3CA 5FUNA 5FYZA 4QU1A 3AL6A 5FXWA 5ANQA 4D6RA 5ISLA 5FZ3A 5FZOB 3LD8A 4IGQA 4BU2A 5IVVA 2YPDA 5F3EA 5FYTA 4LIVA 5FY5A 5FP4A 2OQ7A 3OPWA 5FZKA 4URAA 3PTRB 5FY0A 3K3NA 4CUGA 4QXCA 4GAZA 4Y3OA 3KV6A 5F2WA 5FYVA 3N9MA 3PUAA 4QX8A 5FXXA 5IVFA 4GJYA 5FYHA 5IVCA 2GP5A 2GP3A 5FJHA 3K3OA 5FZ0A 3PURA 3AVSA 2XXZA 4BXFA 4D6SA 5A3PA 5IW0A 2XUEA 2WWUA 3DXTA 3N9QA 2Q8DA 5KR7A 5LW9A 5FPLA 5A3WA 5FP7A 4ASKA 5FV3A 4HONA 3ZPOA 5FWEA 3N9NA 4BISA 4CCKA 4QXHA 4XDPA 2PXJA 2WWJA 4LITA 5FYIA 3PUQA 5FZ1A 5FZMA 4AAPA 5FZEA 5F3IA 5A7WA 5FYCA 3PDQA 4Y33A 3U78A 4DIQA 5FPUA 5FZ9A 5LY2A 4CCNA 5FYBA 2YBKA 2YU1A 3KVBA 3AL5A 4V2VA 5IVBA 5IWFA 5FY9A 5FZGA 3K2OA 3N9PA 5FY8A 4C8DA 4UF0A 4D6QA 4EYUA 4CSWA 4TN7A 3PU3A 4V2WA 5FZHA 5A7SA 2W2IA 3PU8A 5F5IA 5FXVA 4DO0A 5FP3A 5FZ6A 2OQ6A 5FUPA 5A1LA 2OX0A 5FZDA 5FZLA 3KV9A 3UYJA 5FPVA 5A80A 3U4SA 5FY7A 5FYUA 4GD4A 2XMLA 5FXZA 5K4LA 4QWNA 2OS2A 5FY4A 4CCOA 2Q8CA 3NJYA 5FJKA 5FZOA 4AI9A 5FYYA 5FP9A 4QX7A 4EZHA 5FZFA 5A7PA 4LXLA 2XDVA 5A1FA 3KV4A 5FZ8A 2Q8EA 4QXBA 5FP8A 3ZLIA 2VD7A 4GJZA 5FY1A 5FYMA 3N9LA 5IVYA 5IVJA 5A3NA 5A7WB 5LWBA 2YBPA 3KVAA 4LIUA 3KV5A 5F2SA 4XDOA 3AVRA 4HOOA 5FZ4A 5F32A 4NUBA 4CCJA 5E6HA 5FZBA 3DXUA 5F3GA 3N9OA 5A7OA 1VRBA 3RVHA 5FYSA 5FZAA 4Y4RA 4UF0B 4CCMA 5CEHA 5FPAA 5FZ7A 5A7NA 4IGOA 5F5AA 5FWJA 5F39A 4IGPA 4EZ4A 3LDBA 5LY1A 4CCLA
chains in the Genus database with same CATH superfamily
1ZRRA 3JQWA 4XVHA 1EY2A 1ZZ9A 1RGSA 1NCQB 5EJ1B 2BEOA 4JAAA 4OYUA 4Q1RA 5ANQA 1ASJ3 4GMP0 4A6SA 4R9BA 3CIHA 4KMQA 1KRIA 2XHKA 4XUTA 5C4WA 1OOPC 2QUOA 1FPN3 3J4UH 3TB0A 3ZSEA 1ONAA 1FATA 2YXSA 4YW7A 1SBDA 4MX3A 3FHQA 4GZ9A 3MICA 4XJAA 2QQWA 2UY8A 5EZWA 2HWC1 3T30A 4LO7A 2HWD3 3H8XA 2VUDA 3GBGA 4GJYA 4W4ZA 2WA4A 4XFCA 2KD7A 1G9AA 1YUDA 2WUHA 4XABA 4CP9B 1IS6A 2GP3A 2VJXA 1PIV1 2JJ6A 2GN3A 4META 3VBSC 1UW8A 2DVBA 3AVSA 4YM2A 3VBRC 5JZGA 4Y20A 1XPWA 5FQ0B 4DEVA 1R1A1 3DXTA 2GN7A 4C1XA 1T6BX 4ISQA 1DU3D 2WRAA 3IIAA 4ASKA 3WCRA 4LTAA 1JYTA 3D3AA 5JIUA 3KT1A 2P1BA 3ZPOA 3POSA 3ZKUA 1DDLA 5HPOA 4XFAA 1K5MB 3PIJA 5DABA 5E16A 3FL7A 2RVAA 1AR83 1PO11 1RITA 1VRH2 1JYNA 1MEC2 1RUE1 1OLQA 2KXLA 4ZU7A 3BPZA 4XBLA 3A22A 4YVWB 5FPUA 1BEV3 1H8TC 4FQ4A 3DKWA 2JE7A 5TSWA 3U11A 3AFGA 4LHNA 3R6SA 1NT0A 2P6CA 5DG1A 3AL5A 2R49A 2ZGNA 2ZX4A 2RS12 4BYYA 4DEQA 2EIGA 5BUVA 5KC6A 3GCWA 1NKGA 1VBA2 4C8DA 1KDMA 2D6KA 3MUY1 5GLUA 1KS4A 4Q4V2 2LW8A 4Z2AA 1OUXA 2MEV2 3E5XA 2FDIA 1IZ3A 4CDXA 2BZDA 3POYA 4I2OA 3H8UA 1D7PM 1W9WA 2PYTA 1D2SA 5A80A 2EICA 3O0VA 1NE6A 1VALA 4C91A 1LOGA 2VUCA 4N43A 4E4SA 5I8TA 3LA2A 3VHOA 1AR93 5A3LA 1PGW1 3DN7A 3AMPA 3FHAA 4PBPA 1QOOA 4C0BA 5DUVA 3AX4A 4O61A 2R1BA 3J7MA 1ZZBA 4NOTA 1XC6A 1QXJA 2A5ZA 1D4M3 3IDCB 1FMD2 1JODA 1OA4A 4W50A 2Q8EA 2HWB3 3W20A 3JQXA 2JEMA 4AZZA 3JD71 1RUD2 3E1F1 3N9LA 2PLV3 2GC2A 5BYNA 1J59A 1RUC3 3WG1A 1W8TA 5FFOC 4CDQA 3ZYHA 1Y7BA 1PX3A 2QNKA 2XL9A 3UKVA 4HKOA 1JMUB 1DYOA 5IK7A 4ZXEA 3MF9A 5L19A 2TBVA 5JI7A 4CU8A 1EP0A 2UY9A 2XHNA 3POIA 2NLRA 5DZEA 5FZAA 3ZYPA 2XKPA 4FPOB 3I2DA 4DNYA 1TG7A 5LRSA 1BEV2 2VR4A 3A7QA 4XHXA 2JD9A 5T5PA 4Z1VA 1GMMA 4J1XA 2RG4A 3AP7A 2ZMLA 2V5DA 4XCAA 5LY1A 4G4FA 1PGSA 3GGLA 4AI2A 3ZXAC 1OH3A 4NR1A 3T0BA 1QQP2 1QJY3 1R092 5IVEA 3ON7A 1QJX3 3CNAA 3INAA 1BHGA 3BIEA 3P3NA 4QM9A 4QKBA 3FE5A 1LU2A 4BU2A 1YIPA 2JENA 2YYOA 3ZXEA 2YPDA 2Q1MA 1H4HA 5DUXA 2JICA 1V6LA 1XNKA 1O6UA 4FPFA 2A70A 2JE9A 3T1MA 3N7LA 1QEXA 4X8NA 4Q0PA 5FYHA 1K42A 5BNNC 4QX1A 5IVCA 3WNXA 3VDBA 1UY2A 5CADA 2DVFA 2RE9A 3IZOA 5DUUA 1KQRA 2H6CA 4GWJA 1GP4A 3O1SA 2CYFA 4BQYA 3WW4A 1ND2C 3I49A 3AYDA 3N9QA 4YW2A 4KWLA 1TME2 4QPWA 4LO5B 5LBFA 2ARBA 5C9AC 1V6JA 3ACFA 4HXCA 4XPVA 5FBZA 2ZACA 2ARCA 4CEYB 2Y26A 2ZZQA 3AJYA 1GQHA 5A7WA 3SKVA 3VD9A 3WVJA 4ZXKA 5JSOA 1N3QA 2ZHNA 5GLWA 3W58A 4IXLA 4AI1A 1V6IA 3D6EA 2BNOA 3VBFC 5KHIA 5JPMB 1OKOA 2LALA 4DRVA 1EV12 1CR7A 5H9SA 1RUI1 3UGFA 3NAPA 4HKLA 4LKFA 4XDQA 4XXPA 4D8MA 2XLFA 4V2VA 3WR0A 3RDIA 2RS52 1S0BA 2XBO2 4EYUA 1PO22 1SLAA 1OH4A 1LHNA 4UBGA 3ZDVA 3MLJA 4YYOA 5FUPA 4RGKA 2W1SA 1HN1A 3VZKA 3C3VA 5J48A 2FCTA 1SQ4A 2WQZC 1F2NA 3LDKA 4BQ2A 2JDPA 1O91A 5EYYA 4G3YC 3ZYRA 5EQUA 4Y1ZA 2YDEA 4WM8C 3EQEA 2PMWB 4IE4A 3VBSB 1RJ8A 2TUNA 2JDAA 1IPJA 1W3XA 2XJSA 5E89A 1RC6A 3WP6A 2HH9A 1PVC1 5LRRA 3WF3A 1Q5OA 4LBMA 1YQ8A 4HK9A 1F4AA 4AI3A 1C3HA 5CA6A 4FPHA 1QKQA 4HK8A 1LESA 4NHMA 4I0WB 2ZGRA 4QHBA 2CGOA 4PI2A 3LFMA 1H8VA 1NX9A 1I5PA 1AX1A 4LK6A 4IERA 3ZXJA 5FQ0A 3M4FA 3DECA 4NJ4A 3VDDC 1RUJ3 2BRTA 4UF0B 4PLOA 3GZAA 3WQBA 1ZBA2 4GQ7A 5BV6A 1DGWA 2ZAAA 1S2EA 5FMCA 5F5AA 3RG0A 3HT2A 3I2JA 2WT2A 4BCUA 1IG3A 2FZ2A 4YZ1A 1K5MA 5L7OB 5F3CA 2TEPA 1H2NA 2OUHA 4A45A 1F5JA 4A3ZA 2XLGA 4YZ4A 5J7MA 4DB5A 4QU1A 2BGCA 4YVWA 1F31A 2ARXA 3KD4A 3L2HA 3O1MA 2PTMA 4YGEA 3SCHA 3VD3A 4ZU4A 3LWCA 3SISA 4BQ5A 2QQKA 2FD8A 4KBBA 3MYXA 4UI9L 3SMHA 3VBHA 1OD3A 2WNEA 2Y0IA 3QLQA 3S0MA 2P4EA 2AACA 3SH4A 1W06A 4Q4Y2 4QXCA 1VB4A 2A1XA 2GNMA 2YFZA 5CFCA 3WF4A 1OQDA 5BNPC 1H2LA 1YNAA 1A8MA 1GZTA 2X53S 1LEMA 3DPRA 2Y6JA 3DUIA 4GB32 1J1TA 2Q0AA 1HXS1 4ORFA 5JLVA 3AP4A 2ZHMA 3QOPA 3ES1A 2A6ZA 4XJ9A 5FWEA 1SFYA 2B46X 4CYDA 3GBFA 1GFF2 3KB5A 3QACA 4L97A 2A6XA 3T09A 3WDXA 1T2XA 4AEJA 4E8CA 4FP2A 5FMBA 3UT0A 5EIYB 1HLCA 4NHLA 4BQWA 3T2TA 4W8JA 1J3RA 2HWE3 3NSTA 4Z82A 3DV8A 2BBAA 2XH6A 1RUJ2 5FZEA 3RZKA 2F4PA 3WEZA 3ES4A 1XSQA 4CCNA 5EWSA 2VE1A 5F6KA 1CZVA 4FPEA 5HCFA 2N7GA 2O8QA 2YU1A 4LHKA 3W21A 4B1MA 1VRH1 2ZGMA 4MGTA 2HBUA 1MEC1 2QQNA 3GJBA 3HBKA 3PVBB 4AF9A 1OI6A 2AEZA 4IV1A 4UW6A 2RJLA 4CSWA 2IVIB 4RR3B 2E32A 5FZHA 4H7LA 2OPWA 5FZ6A 3H3LA 1AJOA 4GWMA 4XACA 2RS11 3QBQA 4AEDB 2Q4SA 2Y64A 2E7QA 1VBA1 2Z42A 4AI8A 1XU2A 2OYZA 4DXRA 3TEXA 4B7KA 2DCYA 4Q4V1 5HCBA 1B09A 1C8M2 2PHUA 1TZOA 2MEV1 3GYDA 3NJYA 4UBHA 1XYPA 3AP5A 3KT7A 3T2OA 2BNMA 1ND2B 3WDVA 1YRZA 3RMYA 3TEZA 3VHPA 3VLBB 2ZOEB 3JBG2 3KCXA 3Q8FA 3PMEA 1V6OA 1WCSA 1Y43B 2VOWA 4Z2WA 4K7JA 3CDZB 4AVVA 4EN6B 4MGYE 4PDWA 4W6YA 1CN1A 2QQJA 4AE2A 1M06G 5CIRA 1FMD1 1Z7S2 3FLPA 4HOOA 4HSJA 2XJQA 4RS5C 1RUD1 5J96B 2Z5WA 3R4DB 1CIWA 4MYEA 2QTWB 1JBCA 4Y5SA 2VOKA 4N53B 2D6LX 3MPPG 2ORZA 3CJXA 5A7NA 1GKBA 1AR73 3HAGA 3ZFFB 5A32A 3I2GA 2ZX2A 1PGL2 3U0ZA 3VL8A 3RZLA 2GNTA 4CEYA 1PHMA 3OF1A 2P34A 2OZJA 1NLRA 2YU2A 5D8AC 3AZVA 4M4RA 1IKPA 5JOYA 1IQAA 3R05A 3T2PA 2FBEA 2HKXA 3JZVA 1W9SA 1BQPA 1NCRC 1NXMA 4QDSA 4KU7A 4BH9A 3VZJA 4N8MA 1QQP1 4Y4YA 2RMU1 2YUEA 5CFDB 5EV7A 2DCJA 2E33A 2YFUA 1EAH2 2GC1A 3K3NA 2LS6A 4WM8B 4A42A 3KV6A 3GHNA 4CTEA 3EYPA 3HBZA 3MV11 5C3SA 5HCHA 2XJTA 2BV4A 1IS3A 1COV3 2V72A 5T5OA 4LT5A 1OFNA 2DCKA 5LCWL 2LTNA 4RA0A 2EXKA 3P5BA 3TOJA 5GZFA 4AAXA 1ULGA 1QOTA 5FJHA 4AI0A 2E51A 2B4KA 2CDOA 4F8AA 2VXJA 3B02A 3D0JA 4B29A 2BP6A 3ZIWA 4BLJA 4YFZA 3OG2A 3APBA 3I2HA 3DKQA 4XUNA 5AC93 4BJ0A 5GKAC 2SLIA 5JXGA 3NJZA 1RUNA 2Z69A 2JWPA 5C3QA 1KITA 3QD6A 3NO8A 1TME1 2HYKA 3I54A 3HQUA 4ARYA 2Y8KA 1QF3A 1LB2A 1AL22 4DIQA 3B93A 3H8RA 3SQOA 1OA3A 3W5MA 2I2SA 4P9JA 1N1TA 4HL0A 5C5UA 3E5UA 4LO6B 4HKWA 5ABJA 1YCIA 2I74A 1ZYBA 4CE8A 3N9PA 4AYUA 4UF0A 2GC0A 2WFF3 3CLPA 3P1IA 3MUZ1 3PU3A 4MV2A 4Q4W3 5GLZA 5L36A 2W2IA 4KWJA 1EV11 1KJRA 1ZBE2 2BGPA 1W9YA 2A3WA 4A7KA 4G9SB 2GNDA 4PIYA 5L7OA 4AFAA 3HQRA 1CAUB 2W52A 3M3IA 2RS51 3N3HA 4RHV2 4EWEA 2XBO1 3WP4A 4DOUA 1PO21 1OVSA 2B8MA 1GWLA 1W6NB 1YWKA 2HWF3 4LHLA 4JCKA 2ZEXA 1W99A 4BOWA 4Y26A 4I3PA 2G1MA 4BLIA 1JOBA 1DLCA 3PJQA 5CVRA 2I45A 3WP3A 4U36A 2TNFA 4FPJA 4XYXA 4HN0A 1Q56A 4OHVA 4QXBA 4CUBA 1MVEA 1OMIA 1W6MB 4GJZA 5KC5A 2KM2A 1WMDA 3OGRA 4CEWC 5KHKA 4GH4C 1G9BA 2YGLA 1W8FA 3AVRA 4I3GA 5E88A 3NNFA 1R082 5A6XA 1TMF2 1QMJA 3IKWA 3A0KA 3RVHA 2WKKA 4DUWA 2UYBA 1PNGA 4FBFA 4AWDA 4IE0A 5FZ7A 4ASMB 4QGNA 3PNAA 1DZQA 4RSUA 3TYJA 2KR2A 1RL3A 1NOVA 1FNZA 1RJ7A 1DCSA 2VW1A 2VTXJ 5DAPA 3ILFA 5K0UB 2R0HA 3OPTA 1S2KA 4L8QA 2W5FA 3MDPA 3PVEA 1ZBA1 1BMV2 3BU7A 2P6HA 1US3A 2ZHLA 5LA9A 1UOJA 1GNYA 2BFUS 4AL9A 4D6RA 1MS9A 1O3TA 3AZWA 3LIGA 2WBKA 1VBB2 2B9VA 5C4WC 2ENRA 3Q8CA 2PHTA 4NWWA 4F7ZA 4S2DA 1VBC3 4XC9A 3ST7A 1JH5A 1UOFA 1VMHA 3PTRB 4QMAA 1EYBA 2BOJA 3RPQA 3ZSMA 4URAA 4RR3A 2UWAA 2RS33 2VNRA 5T52A 3OUIA 4AEDA 1VBE2 3LEMA 4AK3A 2VO5A 4DFSA 5FZ0A 4CXYA 4J25A 4Q0SA 4EJRA 1CJDA 2A3XA 2OIIA 4Q4Y1 3SNMA 2BFUL 3OB8A 5APAA 1UMZA 4WZCA 2XLAA 1WLCA 2VW2A 2RJ2A 4KH9A 1HKDA 3RWNA 3NW4A 4RS5B 3A23A 1X9TA 2A75A 2RR12 3CQOA 4MADA 3N9NA 1W2TA 4AQ6A 3BOWA 4QXHA 3UESA 4FFFA 4NWVA 4K6BA 1WMFA 1YYNA 1UZ0A 2JG8B 3ASIA 4QKFA 5F3IA 5CISA 3THDA 4JGYB 2BPA2 1MZFA 5IFPA 2WQ4A 3L2YA 3KMHA 4D7SA 2F17A 3FC0A 3Q8EA 1BKZA 3F2ZA 5FYBA 2YG0A 3LZZA 5D8AB 1E5IA 4AR2A 3VBOA 4LR4A 1BXHA 2ZS6B 2CSGA 1T6GC 5FY9A 1WMXA 2ID4A 2WJSA 3I3QA 5FY8A 4N53A 5JMCA 2D3RA 3PLQA 5GZGA 3ZFFA 5JI9A 2D97A 1RUG1 5A3UA 3GJAA 3LEGA 2P3JA 3ME2A 2BWCA 1VE0A 5FAXA 4HVOA 4TTGA 2VULA 2PAMA 4OZOA 1ULEA 3J7NA 2CGPA 1TVGA 1MZEA 4YRDA 1WW6A 2O0OA 3VL9A 2AEYA 4YLZA 1RMU3 2D6PA 4KU8A 2ZGSA 1EUUA 1QDCA 1B35C 3MBWA 1C5IA 1RVF3 2NM1A 3H42B 3LIHA 3Q8AA 4XURA 4PLNA 1JXNA 5CFDA 3RGBA 2AZ5A 3W59A 4WVZA 2NP0A 4JX0A 1S4CA 4WM8A 1E5SA 1PX4A 4P9LA 5IJRA 5FDBA 3KV5A 2IXIA 3O12A 3ZN5A 1FXZA 3ZXFA 3E6DA 3ZYJB 2CAUA 3SH3A 2R30A 4NROA 1AR63 2R072 3MIDA 1NA1B 4NUBA 5F32A 5BXXA 3JBG1 3LGRA 1QJU2 1AXYA 4FI9A 3VV1A 3TN92 1JZ4A 2D40A 1RHI1 2UU8A 2A6VA 2Y6HA 4S2GA 1CX4A 4XJZA 5DAQA 4C0HA 3NNLA 3NKTA 4YVSC 5FPAA 1LECA 5SV8A 5CEHA 4JHZA 1LGNA 4XTMA 5K8SA 5FUIA 4IW3A 1U5ZA 1S0CA 2ATFA 3POEA 4IUGA 4YFWA 5F5IA 1VBD2 3CL1A 1ZNPA 2P5BA 4PLMA 4LKSA 1KGYA 1BBT2 4ET7A 2W3JA 4P9GA 2NZ9A 3D5OA 1W3VA 5GJ6A 3BTYA 4BDVB 1HN0A 3ZSKA 4DY3A 1PGL1 3HNYM 3I7DA 1S0IA 5ANNA 3JXSA 3I3EA 3C2UA 5FP4A 1JOJA 1HXS3 2CDPA 1RIRA 4KBZA 3S57A 5J36A 3KGLA 1XU1A 1V70A 1BJQA 3O1TA 1IG0A 1TQ5A 2LROA 1WW5A 4E2GA 4H55A 4GMP3 1KDKA 5G04L 4P9XA 1CAUA 1EAH1 5F5QA 3V65A 3DF0A 2BYVE 1U0AA 3ZKYA 5C7GA 4M4PA 2YGMA 1W6NA 2WWUA 4OUEA 1JU3A 2JG9B 1KXGA 1YO8A 4GH4B 1IGOA 1VPHA 2W08A 1X9PA 3AK0A 4OZXA 4Q4X3 2G9FA 4UFJA 1OF3A 2W87A 1YJKA 4LPLA 5ACA3 4OHZA 4FCAA 1ZRIA 3T0AA 1C4RA 2JECA 3R4UA 4MLOA 4CCKA 5FO8B 1AR62 1I3HA 5JXHA 4LBNA 5EJZB 3WG3A 2D5FA 1W6MA 4FTEA 1YI7A 2VCMA 2D5HA 2X5IC 3AKRA 5DN2A 2WZR2 1YHFA 3I97A 4LQRA 3OYWA 5J09A 3TEYA 4JGZC 1X33A 3DCQA 2VZPA 2YBKA 1AX0A 1VIWB 5A1AA 1UPIA 3IAPA 3WQ7A 5DXDA 4WM7C 5EFUA 5B4XA 5BNOB 5IVBA 3AKQA 4BB3A 1CVNA 1AL21 1DGWX 4E2SA 1ZRCA 2DFCA 2R063 3KCYA 5LA0A 4F83A 5A7SA 3BCWA 3ACIA 5FP3A 1PNFA 4YW4A 1WD3A 4FPLA 5K0UA 1GNZA 1KFUL 4M0HA 3SC7X 2VNGA 2Y6KA 4QWNA 1MQTC 5FCCA 4YM3A 3K4ZA 2OS2A 1SFNA 1G6NA 3K4DA 4MUVA 1ZBE1 5IK8A 2LRPA 3NV3A 1WCUA 1NE4A 5CAZA 4AI9A 2XUMA 3ZFEA 2R042 4E8DA 3KF5A 1AYM3 1VR3A 4Q0VA 3CKHA 4RHV1 4ARXA 2WNUB 4COUA 1V9U2 2NMNA 4CUCA 4E2QA 1YQCA 1L7LA 2RDQA 2ZKNA 3AKSA 4NPMA 4XEZA 3DL3A 2HEYF 2ORXA 5A33A 3ZVXA 1DBNA 1FAYA 3ZSJA 3O1VA 1DGRA 1LTEA 2A71A 2VQTA 3AYEA 4KGGA 2VZRA 1ASJ2 3FLRA 3ZYBA 1ND3A 1DG6A 2G9GA 4AVAA 4YZ2A 3EHKA 2OXBA 4OUMA 5F3GA 3J7HA 4HLTA 4LORA 1FPN2 1CD3G 4K21A 1MS5A 4AFBA 3W5NA 3WNLA 3CJIB 1PK6B 4CDUC 1N3PA 1GOFA 2QDNA 2IFRA 2HWD2 5BY5A 4YG3A 1R081 3S7EA 1TMF1 2VM9A 4EE2A 4AXOA 3V0AB 4CCLA 2OPKA 4MG2A 5FZIA 2RMU3 3HEIA 2JG8A 4IEVA 5A6QA 2WDBA 4P08A 3ZMOA 5K7PA 5DZGA 1LJ7A 4JGYA 3THCA 4AVBA 4AW7A 3AL6A 1VJ2A 1QXRA 3T4HB 3G7DA 3S6PA 3R4SA 4R4XA 1UWWA 5IVVA 2OW4A 3AM2A 1O8SA 4ZZ8A 5CG8A 1BVP1 1GZ9A 3POFA 4AHWA 1DZRA 3H3ZA 5FZKA 4NIIA 4A44A 1AR82 1NLQA 3K51A 4GAZA 4LK7A 5DDJ3 1VBB1 2ZX0A 3N36A 5D21A 5DAWA 3ACLA 4Y5Z0 2VMDA 5H9RA 3VN4A 1W6OB 1LHUA 3VGIA 2WN2A 1FOD3 3WG4A 4K20A 4LLOA 1PZ9A 1ZA7A 4FFHA 4QPIC 5EP9A 1DIWA 4RQPB 4XBNA 1IQDC 1HRV1 2WSVA 1HV0A 3O0XA 3PUIA 2VG9A 4QKNA 2JDNA 1VBE1 4XTPA 2YPJA 4JTOA 2VTXA 1K12A 4OCTA 1GSLA 4KWUA 1OKQA 3C8XA 2WWJA 4L0PA 4TYSA 3PUQA 5FO7B 4AAPA 5A6YA 1SCSA 2RDNA 2EA7A 3FZ3A 1ALYA 4M0NA 1AR92 3FUOA 4PF1A 2RR11 1W6QB 1XE8A 2BGOA 3SEEA 4ASLA 2A6YA 1V0AA 1W2AX 3NNGA 4JRAA 2DFBA 1JI6A 1NA1A 1LODA 1Q8OA 3N35A 1D4M2 1ST8A 3KZ4C 4WVMB 4I0BA 2HWB2 3OY8A 3IMMA 3BTZA 2ZGOA 2CY6A 2NMOA 4MVTA 5C8CA 2PLV2 2YC4A 3RMXA 1YQ2A 1YEWA 1RUC2 3KGZA 3WX5A 5FPXA 4D94A 1S0DA 2R6QA 1HIXA 1G9CA 1WBLA 2PHFA 1UN1A 5JAXA 3CMGA 1HRI3 2ADEA 4IEQA 3U75A 2QCSB 1QJZA 2GAUA 3LDRA 2FZ1A 3S7IA 2VNOA 1LENA 2WFPA 4HPKB 4TSVA 4YW5A 2QQMA 2RM23 4O7XA 5FP9A 5FYYA 4A7ZA 4EN0A 4LA3A 2WZPP 2DBNA 3WF1A 1D0HA 1YFWA 2Z2SB 3ZYIB 4R9AA 1DFQA 2LM3A 5HXVA 3ZSLA 3ITQA 4OULA 3BU0A 5A3NA 1QJY2 2G4IA 4FPCA 1QJX2 2IXHA 4DRRA 1ZZ8A 4QX3A 4CCDA 1AXKA 2BW8A 2WS91 1REEA 3WZ1A 1W39A 1OOPB 4IV3C 4AQ2A 4LBLA 1FX5A 2JE8A 1O5UA 4JZRA 3K4AA 4KG8A 2Y33A 5A7OA 5FLHA 2E9QA 2JXAA 1IOAA 2ZAHA 3AFKA 1OA2A 1NQJA 1NCQA 1POV1 2BWAA 2JG9A 3UGHA 3SCGA 3RZZA 3GNEA 2PHXA 1CZTA 1GQPA 1JHJA 2IXCA 2WN3A 5LBEA 4RL7A 1OQ1A 4LE4A 2WYFA 4Q29A 1QJU1 4IGPA 2Z4FA 3TN91 3VBRB 1G8WA 1GZWB 1YFXA 5I0UA 1ODMA 1VMFA 3MIGA 1W0PA 2CV6A 2VZOA 5FYZA 5A6ZA 5FXWA 2FDJA 3OBRA 1OBNA 3TRSB 2VU9A 5ISLA 3LD8A 1VBD1 2D6MA 4YWAA 2XB6C 5F3EA 2XQXA 3BOPA 4CP9A 5BNOA 5J37A 1BBT1 1J3PA 4DS0A 3URFA 2C9AA 1UMHA 2EXIA 1X50A 2MPFA 2PHDA 4GWIA 5FY0A 4CUGA 4GULA 3S5AA 2ZKLA 5JDBA 1H8TB 5JUVA 1MZ5A 4J1WA 3ZFGC 1UKGA 4MHRA 1DLLA 2WT1A 4Z92B 2BQPA 2QQLA 4XAAA 4AVTA 4Y1VA 4NAOA 1OSGA 4BXFA 1JUIA 1WZXA 5I93A 4ITCA 4CDWC 4EN7B 3J8F1 1R64A 4LBKA 2ZGLA 2AR6A 2HJIA 2J1EA 3SEPA 3D0SA 4Z8BA 4MGKE 3OEBA 1UKRA 3UJOA 2CL2A 2G9ZA 4H14A 3T3YA 1O3RA 1PMHX 2I07B 1YQ6A 2WNUA 2CAVA 4V1PA 4XUQA 3DEMA 5CYYA 5FYIA 4AOCA 1LGCA 2JDHA 1IKQA 1TNRA 1ZA4A 2RDSA 3O7OA 4E4DX 4LJHA 2QQUA 2ZTNA 5DQ0A 4AVCA 3ACHA 3D82A 1MS0A 4Y1UA 5LY2A 1RUG3 4IE7A 1C8NA 2XJUA 2PAEA 1W90A 3OD4A 2WZR1 4RN5A 1C5HA 1ZZ7A 4BE3A 3WCSA 2VZUA 3THPA 3AXEA 4D6QA 2YC2A 1Q8SA 4BHPA 2P17A 3I2FA 3CJIA 1PK6A 1VAVA 3IDBB 5I91A 3EXUA 2QZ2A 3KLSA 2Y60A 4ZY9A 3CHXA 5JSRA 5A1LA 2Y38A 1ZREA 2C0ZA 3FMGA 3V0AA 4PIZA 5FIXA 5FPVA 1LHWA 2B9UA 3CU7A 3HNBM 3ZN6B 2WIIB 2VQ0A 4TXWA 2YY1A 3MIBA 3B00A 4BXSV 1JYXA 5KBFA 2J1AA 4XXAA 4B4RA 1MS3A 3EBRA 2FDKA 1ZVFA 4X6RB 2IC1A 4EWAA 4BIOA 2PN5A 5FP8A 1RHI3 1IS5A 1W9TA 2IXJA 2VD7A 1CAWB 2VMEA 2CHHA 4ONUA 5IVYA 4JKMA 3USSA 2AC1A 2JB4A 3T08A 1XYOA 1W6OA 1SLBA 3FBYA 4K8RB 4L9BA 1V9U1 3OBTA 1KEXA 2CTVA 2XJPA 4XJWA 3VBUC 1JN2P 1KS5A 5G05L 1AYN3 2D44A 3GXUA 2ET7A 2VC9A 3WNMA 4YGDA 2DVAA 2Y34A 3ZYFA 5JZGC 4FPGA 4RQPA 1A78A 1F35A 1N47A 1YXWA 1ASJ1 5BNNB 4CRQA 5LEKA 2DUOA 5CNAA 3VHRA 2V5YA 2XWBB 4N9IA 3LDBA 5DMYA 3GBWA 4ATEA 1FPN1 3K48A 5AVAA 3KF3A 3VZMA 1RUH3 5IHRA 2JKBA 2QQIA 1ZZCA 3IN9A 1LOFC 2YBSA 5CZKA 4I30A 4LBQB 2XKOA 1H1IA 4UW5A 1HB2A 3C7HA 1RUF3 3RJ2X 3TBDA 5C9AB 1W6QA 2A73B 1URXA 1Y9MA 1GWKA 5FZOB 4BQ3A 4OFGA 1S0GA 2AGSA 4PQ9A 2DYCA 4WVMA 2QJVA 4AHZA 4DXSA 2V09A 3RZGA 4BZ4A 4FTBA 1QNYA 4Q0UA 2HWE2 4FOQA 2UYAA 3MW3A 4P9WA 1XRUA 4BQ4A 5LA2A 2J1VA 3VBFB 3WDYA 4XAEA 5GZDA 4AGGA 2GZWA 1OVPA 4B4QA 4NHXA 5DZFA 5L9VA 4BK5A 2GP5A 4JDNA 2W91A 3RJRA 3UL2A 4N9HA 5IFTA 3D8CA 2H6BA 1OF4A 4OMCA 4CDXC 4P9YA 3H3UA 4Q2FA 4UYBA 1KD7A 4H3WA 3DYPA 1AUYA 5FREA 4A4AA 1YJLA 4QQPA 5LW9A 4N43C 5D2AA 1BEV1 5FP7A 3ZN4A 4HPKA 4LOTA 2HWC3 1UX6A 4M3CE 5FV3A 4O65A 2WO7A 3MEPA 3GF6A 2LUWA 3MO4A 4QX2A 4YZ3A 1S1AA 4BISA 4XCBA 3WF2A 2ZGKA 5IK5A 4RFT0 2DCZA 2NQYA 3FN9A 2PXJA 2WWSA 4S2FA 4XJ8A 5K9YA 1PIV3 3NJVA 1R091 1UXXX 1ODNA 1UOBA 2FQPA 4JRLA 1R1A3 4EROA 2WO3A 2DUPA 2WR9A 3LFIA 3MGUA 5EHDA 4CDQC 3V0BB 1OOPA 3M7AA 2ZGQA 3OGJA 4GALA 3NQHA 3U07A 3CBNA 3KHCA 4MXWB 2EAKA 5BNQA 1AR91 4XOGA 5JOWA 2ZGTA 1PO13 2VECA 4SBVA 5D1IA 4UAPA 1REDA 1RUE3 2WNVC 3D4KA 3BN6A 1X36A 1AL0G 4EV0A 4MHUA 4Y22B 1UX7A 3MV01 3HN3A 1BVVA 1D4M1 4YW3A 5FZDA 3VBSA 3VBRA 4YM1A 2HWB1 1GZWA 2GSYA 2VPVA 3VDDB 4KL1A 4UW3A 1E57A 5FXZA 1LKNA 2CU5A 2PLV1 4P00B 1SPPB 1SG3A 1RUC1 1STMA 4IEOA 2VY0A 4MSVA 4UWDA 3ZFGB 5F1RA 4K3UA 2QQOA 3KM5A 2ERFA 2CWSA 2P2KA 4FFIA 4FOWA 5AFEA 4NIAA 1AR72 3WUDA 1JUHA 3EJKA 2DTWA 1LOCA 4CDWB 3H7JA 4QGMA 3ZLIA 2EVXA 3I2KA 3UKTA 5IVJA 1O7FA 1H8TA 1PMIA 1V00A 4LUMA 4QDRA 3UJQA 3ZXLA 3BKZA 2EIEA 2ILMA 2HWC2 1APNA 1JTZX 1LHVA 3ATGA 3I59B 4QX0A 3TNPB 4RYDA 5IUQA 4CXXA 1H30A 2B5HA 2J1TA 4PIXA 4YG6A 5HV4A 4OI2A 3DXUA 1OPOA 1QJY1 3KSCA 5CKMA 1NYWA 2QDRA 3JD73 3WDUA 1GNHA 1UYZA 1ULFA 4DPNA 1DZTA 5BNPB 1COV2 4Q5OA 1LGBA 1OHFA 2Y0OA 3RWKX 4COYA 4EZ4A 2DURA 2VUAA 3LEKA 1HB3A 5B4NA 4Z07A 4S2HA 3U10A 4M00A 4DUVA 1ACCA 4D7YA 2EIBA 5I0RA 2FMDA 2Y6GA 4IGQA 2V73A 4COZA 2YC0A 3JCIA 2MHFA 5AC92 3FFQA 1GUIA 5FY5A 3IWZA 3OPWA 2ARAA 3NAPC 1JW6A 1MACA 2RV9A 2W95A 4A6OA 3VZNA 5FYVA 2VZ3A 1IPSA 1J84A 3PUAA 2VZTA 4YW6A 2XQRA 1X82A 1MZ6A 1QH6A 3IDEA 1RINA 4J6GA 1BLZA 3B3QE 3HPNA 5CKNA 1M4WA 1CONA 5FTTC 2QQVA 4YPJA 4AG4A 2Q8DA 4LEJA 1PGW2 1TNFA 2WFF2 3RSJA 3VBUB 1XNBA 2H0VA 5J3UA 4Q4W2 1BYHA 4QGLA 4XZUG 2ET1A 2C6SA 1PMJX 4HT1T 4ZZ5A 4IEUA 4H7MA 4XFFA 1YC61 2AREA 3BYWA 1DQ2A 3AMQA 3GHMA 4HG6B 1OPMA 2ZX3A 3SXWA 1CAWA 1RB8G 1H1AA 1LAJA 1LOAA 4L11A 3PDQA 2C24A 5DAXA 5IYYA 2DCTA 3H9AA 2HWF2 3RI8A 2VAUA 2R0FA 4IEYA 1WLWA 1XNDA 4L92A 4FAGA 3WDTA 1DQ0A 4RFRB 5LK7B 3HT1A 2WZ8A 5F7UA 1R1ZA 4K8FA 2J42A 5C70A 1MVQA 4BM8A 1REFA 4EN9B 4UFMA 4TWTA 3SITA 2Q30A 3K2OA 4IEXA 1OLME 3SHRA 2QQPA 3OOXA 4XFHA 5GLVA 5IT6A 4XUOA 4TN7A 1PVXA 5BNNA 3AZXA 1UOGA 4DO0A 1GANA 3OBAA 3B5LB 3HJRA 4HMZA 4EN8B 4D7TA 3RFRA 5LATA 4XMAA 3QCWA 5JVVA 3ZXKA 1QXPA 4BA6A 1PM7A 1J83A 1RUI3 1ND2A 1XB9A 4GB31 3VKNA 3BTXA 2ZMNA 5FYUA 1K5MC 5DAVA 3BB6A 1XE7A 1XNTA 2X10A 4LBQA 3WD5A 5C9AA 4DZGA 5JXIA 2WL1A 3CZJA 1UIJA 4QAWA 2AENA 4WV8A 3MHZA 3HR9A 4Y24A 5FZOA 3N4MA 4YVWC 4EZHA 2WS93 4PCRA 3IPVB 4N7UA 3KV4A 1EPZA 3PL0A 2BVBA 2E63A 3H1MA 5GM0A 1HDKA 1CIYA 4ZONA 1RUJ1 5LWBA 1Q43A 5I8SA 3I3BA 2VH9A 3UETA 3VBHC 2QFEA 4M3CF 1NCRB 3VBFA 5A3OA 4PI0A 5F6LB 1RXFA 3QH6A 4XQWA 2O8OA 5EPAA 4D0QA 1JZ3A 1ENRA 4K9SA 4KGQA 1V6KA 3AMMA 4NAMA 5CFCC 2Q1ZB 1UIKA 1VBC2 4IEPA 4B4PA 1CJPA 3KQRA 1POV0 3BODA 3DPRC 1PZ7A 4Y4RA 1PVC3 2XVLA 2XJRA 3VDAA 3AYCA 4GA9A 1J1LA 2JKXA 2D98A 2RS32 4CCCA 1AZDA 1OXCA 5FWJA 5LBBA 5F5CA 3T2QA 3K75B 3ZO0B 5FPBA 1UPSA 4OQ8A 2WNVB 1C8M1 4YW1A 4NIGA 1OFSA 1X7NA 5FMOS 4CUAA 4FSJA 5FZ3A 3WNNA 1A3KA 3ZM8A 2VBPA 2VVDA 3MFAA 4ZS3A 5F9TA 1J58A 1NQDA 3MPBA 4MXWA 5DPNA 1H9PA 4COVA 3RS6A 3NVCA 1JZ5A 1QWRA 1UZZA 3O14A 4I02A 4MO3M 3N9MA 4IV1C 1WCQA 3POWA 1O3SA 4QX8A 5B2GB 2OUJA 1Z7S1 2V4AA 1UYXA 1WA4A 1I6XA 1QNWA 3LB9A 1O3QA 3VDDA 1YFUA 2HWE1 4M01A 2Y6LA 4NIDA 2BJSA 3IM0A 1SPPA 1ULPA 1W8WA 3H1YA 1SLTA 3M70A 4UXAA 2XWJB 2YHJA 2X05A 1I1EA 3HN1A 3K46A 4FAHA 4ZS2A 5EXOA 1AXZA 3Q9OA 2IFWA 2A6WA 1QOSA 2P3IA 3ZDSA 1L7RA 4JC1A 1CAVB 2JIJA 3WXPA 2D6NA 4QU2A 5LK5A 1Y3TA 4INDA 3I59A 4PF5A 4PDWC 3MZHA 3ZX7A 1RMU2 2JIGA 4AQTA 1UZWA 4FFGA 4JV4A 3MIFA 5I0DA 3WW1A 3USUB 5IWFA 3I4IA 1N1YA 1RVF2 3ABZA 4F3JA 2C1FA 4XE9A 4AVSA 3HWJA 2WLPA 4CEWB 4XHBA 5IATA 1ENXA 1NZCA 2OVUA 1WMEA 5GZEA 4NRPA 2VZ1A 2XGXA 3MF6A 5BNPA 3ECQA 3S30A 2OX0A 4Q8LA 4QQLA 4AQSA 2E53A 1VAMA 3BTAA 3EB7A 1W28A 3U4SA 1W2OA 1VRH3 3IBMA 1SLCA 4CEYC 1YLLA 1GR3A 1MEC3 2HBTA 2RJKA 4FOYA 3RI9A 5HXMA 1I9RA 4MGZE 4N90A 5C6CA 5HCAA 2PHRA 4QQOA 5FJKA 2VZVA 4QX5A 2JD4A 3H50A 4P02B 1WLDA 4PQQA 1A8DA 5AVPA 3UK9A 1SLLA 5LA1A 3ZPYA 5T55A 1JYWA 2RS13 5HBAA 3AJZA 2ES3A 3MFCA 4E9KA 4ZU5A 1BCXA 1VBA3 5FY1A 2VOTA 4HANA 4IL7A 1QH7A 2KA3A 2YBPA 4Q4V3 2IVJA 1W8HA 4LUKA 1AR71 3IAQA 1CX1A 2MEV3 2VMFA 1U5IA 2HLEA 1NZIA 2ZABA 4DXTA 1GBGA 3AB0A 1Q3EA 1Q8PA 3B94A 5FZ4A 3SCFA 3U4XA 1OC1A 1SLIA 5FPZA 1UYPA 3OBZA 2C9KA 1UY1A 4XW3A 4SLIA 2J1RA 1G86A 3N9OA 1O59A 1SBEA 1UY0A 3A4UA 5C8WA 1HXS2 5FO9B 1G9DA 3NRUA 3Q8BA 2R16A 3AMNA 1D2QA 4XJUA 3VBUA 4OHYA 5L9RA 1Y9QA 2VVEA 1DQ6A 3HNMA 4IE6A 1F15A 3PTYA 4URTA 1FMD3 5C33A 5JSPA 1K45A 5FMDA 5CU1A 5F37A 1SZBA 4E4HA 3E5QA 3OUHA 1BK1A 1RUD3 5FZCA 3AP6A 2W0XA 1GYKA 3T0DA 1WUVA 2W1UA 3LEIA 2J1SA 2VL4A 3RZMA 2DVGA 4NO4A 1COV1 2V4VA 4YARA 4BIFA 3E6BA 2GH2A 4XFIA 4MGIE 4Q4X2 4C1WA 3LPGA 3NMBA 3WLUA 5ACA2 1OQEA 1LOFA 3FWEA 4LIVA 4LLFA 2OQ7A 3S5QA 2W94A 2JDMA 2WINB 4IEWA 4D3WA 4XFBA 3POJA 5ABJC 3X29B 5JR2A 2XONA 1U5XA 1WKYA 2VZSA 4GKYA 3OGSA 4CXWA 5KHHA 5AC91 4RS5A 1JZ6A 4QB2A 5LZ6A 5I0TA 2JB8A 1H1MA 3PHMA 1FNYA 3VBHB 5L7OC 2VZQA 1QQP3 1R093 3M8LA 2XUEA 4UOJA 1LR5A 2CWMA 2XR4A 1JYCA 1C28A 5FPLA 1IHMA 1LCLA 4CU9A 3VHNA 4OI0A 1TE1B 1N1VA 2R062 4P5HA 5T54A 5CFCB 2FHRA 3OUJA 4XQDA 3SLIA 2H0BA 3IPVA 2W68A 1W05A 4LKDA 3WQ0A 1FV2A 2FCVA 3DPRB 1UD1A 4XDPA 3LF7A 4W65A 4XETA 5D8AA 3ZIXA 1BMV1 4Q1PA 5T5LA 2WFF1 1XNAA 1LRHA 4O9EA 4Q4W1 4Y33A 1NCRA 4QM8A 1UU4A 4FTSA 3NL1A 1UYYA 4UFIA 1LEDA 2W9XA 1B35B 1JZ2A 4CDUB 4H2AA 1AYM2 4MXVA 3WQ1A 1QHDA 4XILA 3P3PA 2IUWA 1DQ1A 2HWF1 1TME3 2O14A 3NNMA 3I3MA 1NY72 1G9FA 1VB2A 1DYKA 2DVDA 4DINB 5FK8A 4LNVA 5M0TA 1GOHA 2DDUA 1N3OA 1W6PB 3KCCA 2BUKA 2RDRA 4MOAA 1E5HA 1XJAA 4KNCA 4PHZA 3T1LA 5JWPA 5KHJA 5F8PA 5K4LA 4IV1B 2WNVA 2GDFA 4YVSB 3FUQA 2OZ6A 4LE3A 4MH0E 1H2KA 1AHSA 1EV13 5A7PA 3POBA 4ZKTB 1S0FA 1Q8VA 3AMHA 3NV2A 4JHTA 4FO9A 4QB1A 2RMU2 2RS53 1RUOA 2XBO3 3W9AA 1PO23 1LU1A 4FXGB 1HV1A 2E31A 3KVAA 5F2SA 1TEIA 1ZX5A 4RR3C 1UO9A 2NPIA 1ENQA 1HB4A 4QQ2A 1MS4A 4HZFA 1WCKA 4MGQA 5C5TA 1N1SA 3LA7A 4AEDC 1S0EA 4YZ5A 4XF4A 1GP6A 2O1QA 1WW4A 1FT9A 5LASA 1HX6A 1VRBA 1O4ZA 5FYSA 2ZA9A 1NAEA 5DG2A 4A7YA 3NV1A 4CCMA 3L9JT 4PDWB 2UWCA 5HV0A 1L3JA 5DDJ2 2WAAA 3RYPA 4AHYA 3SKJE 1JZ8A 3LAGA 3LSEA 1VBC1 4PJYA 1GV9A 3PUSA 1FOD2 2OT7A 1S2BA 5GLTA 2BTVC 5T5JA 5A3TA 1CAVA 1I5ZA 2VOXA 2W46A 2WLQA 3HIFA 2RS31 4QQHA 4JDMA 4AHXA 1H6XA 2VOVA 1ULCA 1FYUA 3M1HA 3OD0A 5A32B 5C3OA 1YI9A 3WP5A 1H6YA 4FPKA 1CZSA 4LBQD 3USUA 1XE0A 1HJGA 2X5IB 5IAXA 2E7AA 3OCPA 1ENSA 3OGVA 1L7QA 3VBOC 5C3RA 4CEWA 1ZBA3 4W6XA 4JGZB 4GH4A 3IDAA 5GALA 4N53C 4KI5M 3A0NA 3AKPA 5IVFA 4HBNA 1A34A 5FLIA 2ZPXA 4K1ZA 2R071 3PVNA 1DQ4A 3NJXA 4WM7B 3ZFFC 1ZRFA 4QHOA 1WCDJ 2DU0A 5J1XA 1DGLA 2XXZA 4QPGC 2K9ZA 2PHLA 4WVVA 4CU6A 4UW4A 2Q5TA 2Y6FA 1OURA 5IAVA 3LOBA 4B3NA 5A3WA 3F95A 1DGRN 5LBCA 2OKXA 2F4LA 4HFSA 3H7YA 1K3IA 2JDKA 5FZMA 1MQTB 4XF3A 4JKKA 2A7AA 3JB8A 1CGPA 2WO1A 2JX9A 4Q4Y3 1W03A 5CFDC 1HRI2 2K46A 3U78A 1MR5A 3FHIB 4NE9A 4QDQA 5BPXA 3M3CA 3WT3A 1UMIA 2NYYA 4W6WA 2RM22 2BBVA 4R4ZA 1O4YA 4LHSA 1WBFA 3BPSA 3EO6A 3HMYA 2HYXA 1BZWA 3KVBA 4GB33 2VW0A 4LULA 4RGAA 3GCXA 4A41A 4CZSA 4M3CB 4ISRA 3C7OA 4E4ZA 1RMU1 3PU8A 5FXVA 4DUXA 3ZYGA 2XPJA 3HOBA 2OQ6A 4ZHNA 1CPMA 2RHPA 3WSOA 4LO4B 5A3MA 5ABJB 1RVF1 1WGPA 4GKXA 2W39A 3ETPA 4GD4A 1HB1A 2X29A 2XMLA 3LQCA 4WBBA 4FQZA 4OQ9A 2FDFA 2ZEYA 4CCOA 3FBMA 2Q8CA 2ZGUA 4QB6A 4IDZA 4IE5A 1NLSA 3WW2A 5FZFA 1AR61 3VD7A 2XDVA 2K0GA 4NHYA 4FPYA 3I8TA 2Z79A 1SHWB 2DWRA 2UWBA 2ZJCA 2VNVA 2W47A 2EAAA 3FLTA 5DUWA 3ZR5A 4AFCA 3OGGA 3OSDA 3BGAA 4OUSA 2IWGB 3I3DA 2WABA 1W8NA 2XVKA 2VMCA 4QKDA 1W8UA 1W0OA 1JS9A 2PA7A 1QIQA 2YB7A 2YZ4A 3KS7A 2FDGA 2VXRA 1LOEA 3SH5A 3IB3A 5E6HA 2NN8A 1O8PA 5LEJA 1X8MA 2E7TA 4COWA 1C8M3 4FT8A 4UFKA 2ADDA 2HEWF 2GH8A 2PQSA 4XIOA 4NVPA 4XF9A 1W04A 2X09A 4B1LA 1UU5A 5FLJA 1QGLA 2B7YA 4CP1A 3RZJA 1QDOA 2ZEWA 3V64A 4QPIB 3JBG3 4QT6A 5JIAA 2ZEZA 2ZCWA 4ZPIA 1Y4WA 4RGGA 4UFLA 3B7MA 5A7QA 1HQLA 4EWDA 3ELNA 2VUJA 1AJKA 3WG2A 1Z7S3 2R041 3AYAA 4GWNA 1WLTA 4GMP1 1B35A 2QKDA 2VBBA 1QJEA 4CDUA 1IS4A 5FYTA 4I01A 2BOIA 3WDWA 1UU6A 5JCTA 1UZVA 1ZM1A 1H9WA 4KWKA 2GMEA 4L2NA 4WVWA 4Q4X1 1JZ7A 1WD4A 1JU4A 2WNOA 5ACA1 3WINE 4Y1XA 1GP5A 1W6PA 4IQPA 1RUG2 2WAOA 4OVEA 1XNCA 4HVQA 1HW5A 1OT5A 1UAIA 4BPZA 1G7YA 2OA2A 3PURA 1ZZ6A 4JKLA 4D6SA 4AEKA 3QH7A 5K0UC 3LA3A 3RRDA 5IW0A 3N7MA 4YVSA 5FOBB 4O9GA 5KR7A 4DMIA 3VD4A 4FP3A 5T3NA 2HWD1 1FI2A 4Y5TA 1YFYA 4XF0A 1AF9A 2SBAA 1LNSA 3CEWA 4CU7A 2P37A 4CPBA 3ZFEC 1QJFA 4E27A 3O0WA 1EAH3 2E26A 4FXKB 3RQ0A 3BVCA 4R52A 1F5FA 1AX2A 2ZZJA 2XVGA 2R061 3VUOA 2QE3A 4K40A 4IESA 2YMZA 3CO2A 4NMIA 4AEMA 4QD2A 3ZXGA 2DF7A 3K77A 1OD5A 1CAXB 1LOBA 1KFXL 3FJSA 2VCBA 1QU0A 3VD5A 1ND3C 1SFPA 4BWOA 1XSRA 4QPYA 2BDRA 1AR81 2GMMA 3JU9A 2W1QA 3ILRA 4EQVA 1RHI2 3OJBA 3B69A 4P9IA 4OHXA 1MS1A 5JPNB 2ZGPA 2GU9A 4IV3B 1HQNA 1AYM1 3VKFC 3WF0A 3V56A 3N7JA 1FV3A 2YROA 3WY6A 1F4HA 1UF2C 3VBOB 1AYN2 4ES8A 5HI0A 4QHZA 1DF0A 2CNAA 1NY71 2ETEA 5C71A 1YQ5A 2JG8C 1AL23 2VCCA 3H1WA 4OI1A 1SBFA 3VKLA 5JOZA 4NPLA 1HJFA 2PFWA 3AC0A 3CF6E 4JGYC 3ZXDA 2FCUA 2P3YA 4A2UA 1D4VB 4QPGB 2EF6A 2EXJA 5FZ8A 1UQXA 2VVFA 2X5IA 4X6QB 1LHOA 4GIQA 1RUH2 1GQGA 2ZHKA 3JB4C 2AYHA 4OMDA 4JGZA 4R8HA 3MIEA 4Q27A 3PUHA 5FRAA 1RUF2 1ZBE3 2BVVA 3MW4A 3WUCA 4YGCA 2AH2A 1OLRA 1YIFA 4XBQA 1U12A 4WM7A 1SDWA 4MGSA 5H9PA 3WNKA 4HVRA 2B39A 4RHV3 2FDHA 2ZXQA 2AUYA 2VMIA 4Y1YA 1QY4A 3O1RA 1W2UA 3UNPA 2DV9A 1DHKB 2XG3A 4AGRA 4NHKA 4QXKA 3M3QA 4IGOA 2DTYA 4X8PA 1H4GA 1GICA 1W9FA 2Q1FA 2WQ8A 3M3EA 5JR7B 2BU9A 2PQQA 4DY5A 2J1UA 4U2AA 2XJVA 3PIGA 2QVSB 1MQTA 5FBJA 2PHWA 5T50A 3WHUA 4BQXA 5DDJ1 2BERA 4B7EA 3GZUC 3O1PA 4LOSA 4CP2A 1J3QA 1SDDB 1DYPA 1EPWA 4P5YA 2DU1A 4K1YA 2VCAA 1UY3A 2E6VA 1R083 1FOD1 1TMF3 1RXGA 3HVDA 2D3SA 3N7KA 2IXKA 3MW2A 1NA1C 3NWKA 4YSFA 1PIV2 5L9BA 2J7MA 4M3CA 5C3PA 1QJX1 5F2WA 4Y3OA 3P6BA 1R1A2 5FXXA 5C8CC 3GZEA 5KXDA 3BIWE 4CP0A 3AP9A 1W8OA 4ES9A 4LA2A 5ERLA 1C1FA 1GOGA 3PMSA 2WA3A 3C7GA 3R0RA 2D6OX 3K3OA 4LO8A 2F6BA 5A3PA 5KXCA 4BMEA 1O4TA 2D43A 1E5RA 3LSDA 2EIDA 3H0OA 5L73A 1W0NA 1GU3A 1PO12 3B9IA 1K5JA 3DYOA 2VQUA 1VBB3 2ZBJA 1RUE2 3KQ4B 1Y9GA 3KT4A 3ACGA 2WT0A 5KXBA 2VBDA 3BI3A 3LE0A 2D7FA 3O1UA 4I09A 3IMNA 2HEVF 1Z0HA 4JQRA 4YM0A 1ULDA 2D3PA 5FYCA 1WWYA 3PVOA 2A3YA 4TLGA 3C7EA 1HRV3 5FKCA 4B8EA 5FZ9A 3HD8B 3AXDA 1VBE3 3ALQA 1C1LA 3I2IA 3POGA 3GZTB 3MLKA 1JYIA 1XQNA 1AVBA 3B01A 3ORJA 3UGGA 3WNPA 5C4WB 2BNNA 1HRI1 1Q8QA 5FZGA 4I0AA 3ZN6A 3BALA 4YGBA 3ZOIA 4Q26A 3OYWB 1NXD1 3TNQA 3ENRA 4V2WA 2VGDA 1NCQC 2JG9C 3IT8A 2RM21 3ZMNA 3NV4A 2RR13 4Q0QA 2IXLA 1LULA 1UY4A 1C57A 3KV9A 3KWVA 3UYJA 4NPRA 4QPIA 4FOVA 5FY7A 1UNBA 5JZGB 4Y20B 2B42B 1JHNA 5FY4A 3KHBA 3VKOA 3O1OA 3JD72 2Q8OA 3IIIA 5CBLA 3AZYA 2G19A 4XUPA 5IK4A 4LMFA 3UV9A 3TEWA 3C7FA 4FVVA 4LXLA 4AFMA 2XL7A 3GM8A 1CWPA 2DBIA 4CCEA 5A70A 5BNOC 5FR3A 5FYMA 3DYMA 2IZWA 2WZEA 3J7LA 2R32A 3FFZA 3LOIA 4OHWA 1CESA 4LIUA 1JOPA 5E1RA 5FK7A 3VZOA 3ZFEB 5FOJB 2B45X 3WOGA 3WHTA 2EXHA 1POQA 1GZCA 2JDYA 5FZBA 3U1XA 5I0SA 3H8OA 1VMJA 3M3OA 1SMVA 4BQ1A 3NKGA 4IEZA 4A3XA 3FX3A 3TWIA 5A33B 1MPXA 4JVAA 4CA9A 5I8YA 1WA6X 2JDZA 2YV8A 1GWMA 3O5SA 1HRV2 1W2NA 3GALA 1ND3B 5F39A 5AFBA 4CDXB 3J9SA 2C26A 4N7IA 3J26N 5LB6A 2WNUC 4DQAA 4N43B 4CVUA 5CG9A 5CKQA 1IPKA 1XXNA 1UZYA 5FUNA 5KWRA 1POV3 3RYKA 3E97A 1H0BA 4HETA 2EALA 2GNBA 5KHGA 1A6CA 3VZLA 2R073 1CAXA 1US2A 4JDOA 2D93A 1QJU3 1Z78A 1O5LA 3TN93 4DXZA 1UXZA 1PZ8A 1UL9A 2WC2A 2P3KA 4RD7A 1V6NA 4NIHA 3NNJA 4TLFA 1PM4A 2XOMA 3ROUA 3WW3A 4R9CA 4XQ4A 4IV3A 4CDQB 5GZCA 3CJIC 1PK6C 3EMRA 2VQAA 1VLNA 3B9CA 1VBD3 1DQ5A 3MLLA 5CB7A 3VB9A 1SACA 4JQTA 1BBT3 2GC3A 3A21A 4MZUA 4YNIA 1D0GA 4OI4A 1F9KA 4HN1A 3RNSA 3M2MA 2VTFA 4XFGA 3U37A 4KQ7A 5H9QA 1V6MA 4HONA 2QZ3A 3G6JB 1HQWA 2FMYA 5E8AA 3ETQA 4QPGA 3V0BA 4LBJA 3THTA 1H2MA 5SV5A 4GXLA 1OLMA 4LITA 4BK4A 1MS8A 5FZ1A 1RUI2 3TAYA 4NN0A 5J98B 3UKNA 3WNOA 1OUSA 3J8F3 4UT5A 2X8KA 1SCRA 2WSUA 2W92A 1XYNA 4UFHA 3CZUA 4LBOA 1RTVA 1EUTA 1P8JA 4Y22A 4NRQA 5FKBA 2WS92 3MI8A 4PT6A 1SEFA 2DUQA 1JYVA 5KXEA 2J22A 3ZR6A 3RZHA 3LPFA 5EYXA 2VMGA 4BMBA 5FMOL 4NRMA 3ZFGA 1S55A 2PELA 4RQPC 4HSLA 5JXJA 2JDUA 1ULOA 3ILNA 4XIKA 4AGVA 1ZRDA 5FZLA 2GALA 2VMHA 2ZX1A 4CDWA 1CPNA 2L9LA 3AZZA 3GDBA 3OY8B 3OTFA 3T4VA 3E6CC 2WZR3 5C8CB 2MNGA 3LKJA 5JMOA 1PVC2 3DGTA 4LKEA 2QBXA 5JOXA 3JUUA 4QX7A 2K2SA 4XF1A 1NG0A 2R1DA 3U14A 4AFDA 1XOYA 1AYN1 2C4XA 4PBOA 5A1FA 2ZMKA 4R9DA 2R7EB 4KG0A 1UCXA 3HQXA 5EJ3A 2C5DA 5A7WB 3PJYA 3BUCA 2WO2A 4YG0A 2WYSA 1WW7A 4OLLA 3MIHA 1GLHA 4CPBD 1F8VA 3LCPA 4XDOA 1NUKA 1W8ZA 3WV6A 1X8EA 2PAKA 3AKTA 2W1WA 3NAPB 1RUH1 4JTNA 1DP0A 4CCJA 1U5YA 4ATFA 3I2OA 3VKMA 4L99A 1BK0A 1RUF1 4P14A 1KJLA 3J8F2 3VDCA 3OPZA 1VAKA 1RYYA 1CQ9A 4TZDA 2UURA 4C90A 4XZPA 2CGNA 3OEAA 1VP6A 2R043 1S0JA 4D69A 4XMIA 4IETA 2GMPA 1V9U3 4WZFA 3RYRA 1XBFA 4Q8KA
chains in the Genus database with same CATH topology
5F37A 5F5CA 5FZIA 3OPTA 2P5BA 4E4HA 3PUSA 5FBJA 2OT7A 5FZCA 5FPBA 5A3TA 2YU2A 5IVEA 2YBSA 5A7QA 5F3CA 5FUNA 5FYZA 4QU1A 3AL6A 5FXWA 5ANQA 4D6RA 5ISLA 5FZ3A 5FZOB 3LD8A 4IGQA 4BU2A 5IVVA 2YPDA 5F3EA 5FYTA 4LIVA 5FY5A 5FP4A 2OQ7A 3OPWA 5FZKA 4URAA 3PTRB 5FY0A 3K3NA 4CUGA 4QXCA 4GAZA 4Y3OA 3KV6A 5F2WA 5FYVA 3N9MA 3PUAA 4QX8A 5FXXA 5IVFA 4GJYA 5FYHA 5IVCA 2GP5A 2GP3A 5FJHA 3K3OA 5FZ0A 3PURA 3AVSA 2XXZA 4BXFA 4D6SA 5A3PA 5IW0A 2XUEA 2WWUA 3DXTA 3N9QA 2Q8DA 5KR7A 5LW9A 5FPLA 5A3WA 5FP7A 4ASKA 5FV3A 4HONA 3ZPOA 5FWEA 3N9NA 4BISA 4CCKA 4QXHA 4XDPA 2PXJA 2WWJA 4LITA 5FYIA 3PUQA 5FZ1A 5FZMA 4AAPA 5FZEA 5F3IA 5A7WA 5FYCA 3PDQA 4Y33A 3U78A 4DIQA 5FPUA 5FZ9A 5LY2A 4CCNA 5FYBA 2YBKA 2YU1A 3KVBA 3AL5A 4V2VA 5IVBA 5IWFA 5FY9A 5FZGA 3K2OA 3N9PA 5FY8A 4C8DA 4UF0A 4D6QA 4EYUA 4CSWA 4TN7A 3PU3A 4V2WA 5FZHA 5A7SA 2W2IA 3PU8A 5F5IA 5FXVA 4DO0A 5FP3A 5FZ6A 2OQ6A 5FUPA 5A1LA 2OX0A 5FZDA 5FZLA 3KV9A 3UYJA 5FPVA 5A80A 3U4SA 5FY7A 5FYUA 4GD4A 2XMLA 5FXZA 5K4LA 4QWNA 2OS2A 5FY4A 4CCOA 2Q8CA 3NJYA 5FJKA 5FZOA 4AI9A 5FYYA 5FP9A 4QX7A 4EZHA 5FZFA 5A7PA 4LXLA 2XDVA 5A1FA 3KV4A 5FZ8A 2Q8EA 4QXBA 5FP8A 3ZLIA 2VD7A 4GJZA 5FY1A 5FYMA 3N9LA 5IVYA 5IVJA 5A3NA 5A7WB 5LWBA 2YBPA 3KVAA 4LIUA 3KV5A 5F2SA 4XDOA 3AVRA 4HOOA 5FZ4A 5F32A 4NUBA 4CCJA 5E6HA 5FZBA 3DXUA 5F3GA 3N9OA 5A7OA 1VRBA 3RVHA 5FYSA 5FZAA 4Y4RA 4UF0B 4CCMA 5CEHA 5FPAA 5FZ7A 5A7NA 4IGOA 5F5AA 5FWJA 5F39A 4IGPA 4EZ4A 3LDBA 5LY1A 4CCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F37 A;  5F5C A;  5FZI A;  3OPT A;  2P5B A;  4E4H A;  3PUS A;  5FBJ A;  2OT7 A;  5FZC A;  5FPB A;  5A3T A;  2YU2 A;  5IVE A;  2YBS A;  5A7Q A;  5F3C A;  5FUN A;  5FYZ A;  4QU1 A;  3AL6 A;  5FXW A;  5ANQ A;  4D6R A;  5ISL A;  5FZ3 A;  5FZO B;  3LD8 A;  4IGQ A;  4BU2 A;  5IVV A;  2YPD A;  5F3E A;  5FYT A;  4LIV A;  5FY5 A;  5FP4 A;  2OQ7 A;  3OPW A;  5FZK A;  4URA A;  3PTR B;  5FY0 A;  3K3N A;  4CUG A;  4QXC A;  4GAZ A;  4Y3O A;  3KV6 A;  5F2W A;  5FYV A;  3N9M A;  3PUA A;  4QX8 A;  5FXX A;  5IVF A;  4GJY A;  5FYH A;  5IVC A;  2GP5 A;  2GP3 A;  5FJH A;  3K3O A;  5FZ0 A;  3PUR A;  3AVS A;  2XXZ A;  4BXF A;  4D6S A;  5A3P A;  5IW0 A;  2XUE A;  2WWU A;  3DXT A;  3N9Q A;  2Q8D A;  5KR7 A;  5LW9 A;  5FPL A;  5A3W A;  5FP7 A;  4ASK A;  5FV3 A;  4HON A;  3ZPO A;  5FWE A;  3N9N A;  4BIS A;  4CCK A;  4QXH A;  4XDP A;  2PXJ A;  2WWJ A;  4LIT A;  5FYI A;  3PUQ A;  5FZ1 A;  5FZM A;  4AAP A;  5FZE A;  5F3I A;  5A7W A;  5FYC A;  3PDQ A;  4Y33 A;  3U78 A;  4DIQ A;  5FPU A;  5FZ9 A;  5LY2 A;  4CCN A;  5FYB A;  2YBK A;  2YU1 A;  3KVB A;  3AL5 A;  4V2V A;  5IVB A;  5IWF A;  5FY9 A;  5FZG A;  3K2O A;  3N9P A;  5FY8 A;  4C8D A;  4UF0 A;  4D6Q A;  4EYU A;  4CSW A;  4TN7 A;  3PU3 A;  4V2W A;  5FZH A;  5A7S A;  2W2I A;  3PU8 A;  5F5I A;  5FXV A;  4DO0 A;  5FP3 A;  5FZ6 A;  2OQ6 A;  5FUP A;  5A1L A;  2OX0 A;  5FZD A;  5FZL A;  3KV9 A;  3UYJ A;  5FPV A;  5A80 A;  3U4S A;  5FY7 A;  5FYU A;  4GD4 A;  2XML A;  5FXZ A;  5K4L A;  4QWN A;  2OS2 A;  5FY4 A;  4CCO A;  2Q8C A;  3NJY A;  5FJK A;  5FZO A;  4AI9 A;  5FYY A;  5FP9 A;  4QX7 A;  4EZH A;  5FZF A;  5A7P A;  4LXL A;  2XDV A;  5A1F A;  3KV4 A;  5FZ8 A;  2Q8E A;  4QXB A;  5FP8 A;  3ZLI A;  2VD7 A;  4GJZ A;  5FY1 A;  5FYM A;  3N9L A;  5IVY A;  5IVJ A;  5A3N A;  5A7W B;  5LWB A;  2YBP A;  3KVA A;  4LIU A;  3KV5 A;  5F2S A;  4XDO A;  3AVR A;  4HOO A;  5FZ4 A;  5F32 A;  4NUB A;  4CCJ A;  5E6H A;  5FZB A;  3DXU A;  5F3G A;  3N9O A;  5A7O A;  1VRB A;  3RVH A;  5FYS A;  5FZA A;  4Y4R A;  4UF0 B;  4CCM A;  5CEH A;  5FPA A;  5FZ7 A;  5A7N A;  4IGO A;  5F5A A;  5FWJ A;  5F39 A;  4IGP A;  4EZ4 A;  3LDB A;  5LY1 A;  4CCL A; 
#chains in the Genus database with same CATH topology
 1ZRR A;  3JQW A;  4XVH A;  1EY2 A;  1ZZ9 A;  1RGS A;  1NCQ B;  5EJ1 B;  2BEO A;  4JAA A;  4OYU A;  4Q1R A;  5ANQ A;  1ASJ 3;  4GMP 0;  4A6S A;  4R9B A;  3CIH A;  4KMQ A;  1KRI A;  2XHK A;  4XUT A;  5C4W A;  1OOP C;  2QUO A;  1FPN 3;  3J4U H;  3TB0 A;  3ZSE A;  1ONA A;  1FAT A;  2YXS A;  4YW7 A;  1SBD A;  4MX3 A;  3FHQ A;  4GZ9 A;  3MIC A;  4XJA A;  2QQW A;  2UY8 A;  5EZW A;  2HWC 1;  3T30 A;  4LO7 A;  2HWD 3;  3H8X A;  2VUD A;  3GBG A;  4GJY A;  4W4Z A;  2WA4 A;  4XFC A;  2KD7 A;  1G9A A;  1YUD A;  2WUH A;  4XAB A;  4CP9 B;  1IS6 A;  2GP3 A;  2VJX A;  1PIV 1;  2JJ6 A;  2GN3 A;  4MET A;  3VBS C;  1UW8 A;  2DVB A;  3AVS A;  4YM2 A;  3VBR C;  5JZG A;  4Y20 A;  1XPW A;  5FQ0 B;  4DEV A;  1R1A 1;  3DXT A;  2GN7 A;  4C1X A;  1T6B X;  4ISQ A;  1DU3 D;  2WRA A;  3IIA A;  4ASK A;  3WCR A;  4LTA A;  1JYT A;  3D3A A;  5JIU A;  3KT1 A;  2P1B A;  3ZPO A;  3POS A;  3ZKU A;  1DDL A;  5HPO A;  4XFA A;  1K5M B;  3PIJ A;  5DAB A;  5E16 A;  3FL7 A;  2RVA A;  1AR8 3;  1PO1 1;  1RIT A;  1VRH 2;  1JYN A;  1MEC 2;  1RUE 1;  1OLQ A;  2KXL A;  4ZU7 A;  3BPZ A;  4XBL A;  3A22 A;  4YVW B;  5FPU A;  1BEV 3;  1H8T C;  4FQ4 A;  3DKW A;  2JE7 A;  5TSW A;  3U11 A;  3AFG A;  4LHN A;  3R6S A;  1NT0 A;  2P6C A;  5DG1 A;  3AL5 A;  2R49 A;  2ZGN A;  2ZX4 A;  2RS1 2;  4BYY A;  4DEQ A;  2EIG A;  5BUV A;  5KC6 A;  3GCW A;  1NKG A;  1VBA 2;  4C8D A;  1KDM A;  2D6K A;  3MUY 1;  5GLU A;  1KS4 A;  4Q4V 2;  2LW8 A;  4Z2A A;  1OUX A;  2MEV 2;  3E5X A;  2FDI A;  1IZ3 A;  4CDX A;  2BZD A;  3POY A;  4I2O A;  3H8U A;  1D7P M;  1W9W A;  2PYT A;  1D2S A;  5A80 A;  2EIC A;  3O0V A;  1NE6 A;  1VAL A;  4C91 A;  1LOG A;  2VUC A;  4N43 A;  4E4S A;  5I8T A;  3LA2 A;  3VHO A;  1AR9 3;  5A3L A;  1PGW 1;  3DN7 A;  3AMP A;  3FHA A;  4PBP A;  1QOO A;  4C0B A;  5DUV A;  3AX4 A;  4O61 A;  2R1B A;  3J7M A;  1ZZB A;  4NOT A;  1XC6 A;  1QXJ A;  2A5Z A;  1D4M 3;  3IDC B;  1FMD 2;  1JOD A;  1OA4 A;  4W50 A;  2Q8E A;  2HWB 3;  3W20 A;  3JQX A;  2JEM A;  4AZZ A;  3JD7 1;  1RUD 2;  3E1F 1;  3N9L A;  2PLV 3;  2GC2 A;  5BYN A;  1J59 A;  1RUC 3;  3WG1 A;  1W8T A;  5FFO C;  4CDQ A;  3ZYH A;  1Y7B A;  1PX3 A;  2QNK A;  2XL9 A;  3UKV A;  4HKO A;  1JMU B;  1DYO A;  5IK7 A;  4ZXE A;  3MF9 A;  5L19 A;  2TBV A;  5JI7 A;  4CU8 A;  1EP0 A;  2UY9 A;  2XHN A;  3POI A;  2NLR A;  5DZE A;  5FZA A;  3ZYP A;  2XKP A;  4FPO B;  3I2D A;  4DNY A;  1TG7 A;  5LRS A;  1BEV 2;  2VR4 A;  3A7Q A;  4XHX A;  2JD9 A;  5T5P A;  4Z1V A;  1GMM A;  4J1X A;  2RG4 A;  3AP7 A;  2ZML A;  2V5D A;  4XCA A;  5LY1 A;  4G4F A;  1PGS A;  3GGL A;  4AI2 A;  3ZXA C;  1OH3 A;  4NR1 A;  3T0B A;  1QQP 2;  1QJY 3;  1R09 2;  5IVE A;  3ON7 A;  1QJX 3;  3CNA A;  3INA A;  1BHG A;  3BIE A;  3P3N A;  4QM9 A;  4QKB A;  3FE5 A;  1LU2 A;  4BU2 A;  1YIP A;  2JEN A;  2YYO A;  3ZXE A;  2YPD A;  2Q1M A;  1H4H A;  5DUX A;  2JIC A;  1V6L A;  1XNK A;  1O6U A;  4FPF A;  2A70 A;  2JE9 A;  3T1M A;  3N7L A;  1QEX A;  4X8N A;  4Q0P A;  5FYH A;  1K42 A;  5BNN C;  4QX1 A;  5IVC A;  3WNX A;  3VDB A;  1UY2 A;  5CAD A;  2DVF A;  2RE9 A;  3IZO A;  5DUU A;  1KQR A;  2H6C A;  4GWJ A;  1GP4 A;  3O1S A;  2CYF A;  4BQY A;  3WW4 A;  1ND2 C;  3I49 A;  3AYD A;  3N9Q A;  4YW2 A;  4KWL A;  1TME 2;  4QPW A;  4LO5 B;  5LBF A;  2ARB A;  5C9A C;  1V6J A;  3ACF A;  4HXC A;  4XPV A;  5FBZ A;  2ZAC A;  2ARC A;  4CEY B;  2Y26 A;  2ZZQ A;  3AJY A;  1GQH A;  5A7W A;  3SKV A;  3VD9 A;  3WVJ A;  4ZXK A;  5JSO A;  1N3Q A;  2ZHN A;  5GLW A;  3W58 A;  4IXL A;  4AI1 A;  1V6I A;  3D6E A;  2BNO A;  3VBF C;  5KHI A;  5JPM B;  1OKO A;  2LAL A;  4DRV A;  1EV1 2;  1CR7 A;  5H9S A;  1RUI 1;  3UGF A;  3NAP A;  4HKL A;  4LKF A;  4XDQ A;  4XXP A;  4D8M A;  2XLF A;  4V2V A;  3WR0 A;  3RDI A;  2RS5 2;  1S0B A;  2XBO 2;  4EYU A;  1PO2 2;  1SLA A;  1OH4 A;  1LHN A;  4UBG A;  3ZDV A;  3MLJ A;  4YYO A;  5FUP A;  4RGK A;  2W1S A;  1HN1 A;  3VZK A;  3C3V A;  5J48 A;  2FCT A;  1SQ4 A;  2WQZ C;  1F2N A;  3LDK A;  4BQ2 A;  2JDP A;  1O91 A;  5EYY A;  4G3Y C;  3ZYR A;  5EQU A;  4Y1Z A;  2YDE A;  4WM8 C;  3EQE A;  2PMW B;  4IE4 A;  3VBS B;  1RJ8 A;  2TUN A;  2JDA A;  1IPJ A;  1W3X A;  2XJS A;  5E89 A;  1RC6 A;  3WP6 A;  2HH9 A;  1PVC 1;  5LRR A;  3WF3 A;  1Q5O A;  4LBM A;  1YQ8 A;  4HK9 A;  1F4A A;  4AI3 A;  1C3H A;  5CA6 A;  4FPH A;  1QKQ A;  4HK8 A;  1LES A;  4NHM A;  4I0W B;  2ZGR A;  4QHB A;  2CGO A;  4PI2 A;  3LFM A;  1H8V A;  1NX9 A;  1I5P A;  1AX1 A;  4LK6 A;  4IER A;  3ZXJ A;  5FQ0 A;  3M4F A;  3DEC A;  4NJ4 A;  3VDD C;  1RUJ 3;  2BRT A;  4UF0 B;  4PLO A;  3GZA A;  3WQB A;  1ZBA 2;  4GQ7 A;  5BV6 A;  1DGW A;  2ZAA A;  1S2E A;  5FMC A;  5F5A A;  3RG0 A;  3HT2 A;  3I2J A;  2WT2 A;  4BCU A;  1IG3 A;  2FZ2 A;  4YZ1 A;  1K5M A;  5L7O B;  5F3C A;  2TEP A;  1H2N A;  2OUH A;  4A45 A;  1F5J A;  4A3Z A;  2XLG A;  4YZ4 A;  5J7M A;  4DB5 A;  4QU1 A;  2BGC A;  4YVW A;  1F31 A;  2ARX A;  3KD4 A;  3L2H A;  3O1M A;  2PTM A;  4YGE A;  3SCH A;  3VD3 A;  4ZU4 A;  3LWC A;  3SIS A;  4BQ5 A;  2QQK A;  2FD8 A;  4KBB A;  3MYX A;  4UI9 L;  3SMH A;  3VBH A;  1OD3 A;  2WNE A;  2Y0I A;  3QLQ A;  3S0M A;  2P4E A;  2AAC A;  3SH4 A;  1W06 A;  4Q4Y 2;  4QXC A;  1VB4 A;  2A1X A;  2GNM A;  2YFZ A;  5CFC A;  3WF4 A;  1OQD A;  5BNP C;  1H2L A;  1YNA A;  1A8M A;  1GZT A;  2X53 S;  1LEM A;  3DPR A;  2Y6J A;  3DUI A;  4GB3 2;  1J1T A;  2Q0A A;  1HXS 1;  4ORF A;  5JLV A;  3AP4 A;  2ZHM A;  3QOP A;  3ES1 A;  2A6Z A;  4XJ9 A;  5FWE A;  1SFY A;  2B46 X;  4CYD A;  3GBF A;  1GFF 2;  3KB5 A;  3QAC A;  4L97 A;  2A6X A;  3T09 A;  3WDX A;  1T2X A;  4AEJ A;  4E8C A;  4FP2 A;  5FMB A;  3UT0 A;  5EIY B;  1HLC A;  4NHL A;  4BQW A;  3T2T A;  4W8J A;  1J3R A;  2HWE 3;  3NST A;  4Z82 A;  3DV8 A;  2BBA A;  2XH6 A;  1RUJ 2;  5FZE A;  3RZK A;  2F4P A;  3WEZ A;  3ES4 A;  1XSQ A;  4CCN A;  5EWS A;  2VE1 A;  5F6K A;  1CZV A;  4FPE A;  5HCF A;  2N7G A;  2O8Q A;  2YU1 A;  4LHK A;  3W21 A;  4B1M A;  1VRH 1;  2ZGM A;  4MGT A;  2HBU A;  1MEC 1;  2QQN A;  3GJB A;  3HBK A;  3PVB B;  4AF9 A;  1OI6 A;  2AEZ A;  4IV1 A;  4UW6 A;  2RJL A;  4CSW A;  2IVI B;  4RR3 B;  2E32 A;  5FZH A;  4H7L A;  2OPW A;  5FZ6 A;  3H3L A;  1AJO A;  4GWM A;  4XAC A;  2RS1 1;  3QBQ A;  4AED B;  2Q4S A;  2Y64 A;  2E7Q A;  1VBA 1;  2Z42 A;  4AI8 A;  1XU2 A;  2OYZ A;  4DXR A;  3TEX A;  4B7K A;  2DCY A;  4Q4V 1;  5HCB A;  1B09 A;  1C8M 2;  2PHU A;  1TZO A;  2MEV 1;  3GYD A;  3NJY A;  4UBH A;  1XYP A;  3AP5 A;  3KT7 A;  3T2O A;  2BNM A;  1ND2 B;  3WDV A;  1YRZ A;  3RMY A;  3TEZ A;  3VHP A;  3VLB B;  2ZOE B;  3JBG 2;  3KCX A;  3Q8F A;  3PME A;  1V6O A;  1WCS A;  1Y43 B;  2VOW A;  4Z2W A;  4K7J A;  3CDZ B;  4AVV A;  4EN6 B;  4MGY E;  4PDW A;  4W6Y A;  1CN1 A;  2QQJ A;  4AE2 A;  1M06 G;  5CIR A;  1FMD 1;  1Z7S 2;  3FLP A;  4HOO A;  4HSJ A;  2XJQ A;  4RS5 C;  1RUD 1;  5J96 B;  2Z5W A;  3R4D B;  1CIW A;  4MYE A;  2QTW B;  1JBC A;  4Y5S A;  2VOK A;  4N53 B;  2D6L X;  3MPP G;  2ORZ A;  3CJX A;  5A7N A;  1GKB A;  1AR7 3;  3HAG A;  3ZFF B;  5A32 A;  3I2G A;  2ZX2 A;  1PGL 2;  3U0Z A;  3VL8 A;  3RZL A;  2GNT A;  4CEY A;  1PHM A;  3OF1 A;  2P34 A;  2OZJ A;  1NLR A;  2YU2 A;  5D8A C;  3AZV A;  4M4R A;  1IKP A;  5JOY A;  1IQA A;  3R05 A;  3T2P A;  2FBE A;  2HKX A;  3JZV A;  1W9S A;  1BQP A;  1NCR C;  1NXM A;  4QDS A;  4KU7 A;  4BH9 A;  3VZJ A;  4N8M A;  1QQP 1;  4Y4Y A;  2RMU 1;  2YUE A;  5CFD B;  5EV7 A;  2DCJ A;  2E33 A;  2YFU A;  1EAH 2;  2GC1 A;  3K3N A;  2LS6 A;  4WM8 B;  4A42 A;  3KV6 A;  3GHN A;  4CTE A;  3EYP A;  3HBZ A;  3MV1 1;  5C3S A;  5HCH A;  2XJT A;  2BV4 A;  1IS3 A;  1COV 3;  2V72 A;  5T5O A;  4LT5 A;  1OFN A;  2DCK A;  5LCW L;  2LTN A;  4RA0 A;  2EXK A;  3P5B A;  3TOJ A;  5GZF A;  4AAX A;  1ULG A;  1QOT A;  5FJH A;  4AI0 A;  2E51 A;  2B4K A;  2CDO A;  4F8A A;  2VXJ A;  3B02 A;  3D0J A;  4B29 A;  2BP6 A;  3ZIW A;  4BLJ A;  4YFZ A;  3OG2 A;  3APB A;  3I2H A;  3DKQ A;  4XUN A;  5AC9 3;  4BJ0 A;  5GKA C;  2SLI A;  5JXG A;  3NJZ A;  1RUN A;  2Z69 A;  2JWP A;  5C3Q A;  1KIT A;  3QD6 A;  3NO8 A;  1TME 1;  2HYK A;  3I54 A;  3HQU A;  4ARY A;  2Y8K A;  1QF3 A;  1LB2 A;  1AL2 2;  4DIQ A;  3B93 A;  3H8R A;  3SQO A;  1OA3 A;  3W5M A;  2I2S A;  4P9J A;  1N1T A;  4HL0 A;  5C5U A;  3E5U A;  4LO6 B;  4HKW A;  5ABJ A;  1YCI A;  2I74 A;  1ZYB A;  4CE8 A;  3N9P A;  4AYU A;  4UF0 A;  2GC0 A;  2WFF 3;  3CLP A;  3P1I A;  3MUZ 1;  3PU3 A;  4MV2 A;  4Q4W 3;  5GLZ A;  5L36 A;  2W2I A;  4KWJ A;  1EV1 1;  1KJR A;  1ZBE 2;  2BGP A;  1W9Y A;  2A3W A;  4A7K A;  4G9S B;  2GND A;  4PIY A;  5L7O A;  4AFA A;  3HQR A;  1CAU B;  2W52 A;  3M3I A;  2RS5 1;  3N3H A;  4RHV 2;  4EWE A;  2XBO 1;  3WP4 A;  4DOU A;  1PO2 1;  1OVS A;  2B8M A;  1GWL A;  1W6N B;  1YWK A;  2HWF 3;  4LHL A;  4JCK A;  2ZEX A;  1W99 A;  4BOW A;  4Y26 A;  4I3P A;  2G1M A;  4BLI A;  1JOB A;  1DLC A;  3PJQ A;  5CVR A;  2I45 A;  3WP3 A;  4U36 A;  2TNF A;  4FPJ A;  4XYX A;  4HN0 A;  1Q56 A;  4OHV A;  4QXB A;  4CUB A;  1MVE A;  1OMI A;  1W6M B;  4GJZ A;  5KC5 A;  2KM2 A;  1WMD A;  3OGR A;  4CEW C;  5KHK A;  4GH4 C;  1G9B A;  2YGL A;  1W8F A;  3AVR A;  4I3G A;  5E88 A;  3NNF A;  1R08 2;  5A6X A;  1TMF 2;  1QMJ A;  3IKW A;  3A0K A;  3RVH A;  2WKK A;  4DUW A;  2UYB A;  1PNG A;  4FBF A;  4AWD A;  4IE0 A;  5FZ7 A;  4ASM B;  4QGN A;  3PNA A;  1DZQ A;  4RSU A;  3TYJ A;  2KR2 A;  1RL3 A;  1NOV A;  1FNZ A;  1RJ7 A;  1DCS A;  2VW1 A;  2VTX J;  5DAP A;  3ILF A;  5K0U B;  2R0H A;  3OPT A;  1S2K A;  4L8Q A;  2W5F A;  3MDP A;  3PVE A;  1ZBA 1;  1BMV 2;  3BU7 A;  2P6H A;  1US3 A;  2ZHL A;  5LA9 A;  1UOJ A;  1GNY A;  2BFU S;  4AL9 A;  4D6R A;  1MS9 A;  1O3T A;  3AZW A;  3LIG A;  2WBK A;  1VBB 2;  2B9V A;  5C4W C;  2ENR A;  3Q8C A;  2PHT A;  4NWW A;  4F7Z A;  4S2D A;  1VBC 3;  4XC9 A;  3ST7 A;  1JH5 A;  1UOF A;  1VMH A;  3PTR B;  4QMA A;  1EYB A;  2BOJ A;  3RPQ A;  3ZSM A;  4URA A;  4RR3 A;  2UWA A;  2RS3 3;  2VNR A;  5T52 A;  3OUI A;  4AED A;  1VBE 2;  3LEM A;  4AK3 A;  2VO5 A;  4DFS A;  5FZ0 A;  4CXY A;  4J25 A;  4Q0S A;  4EJR A;  1CJD A;  2A3X A;  2OII A;  4Q4Y 1;  3SNM A;  2BFU L;  3OB8 A;  5APA A;  1UMZ A;  4WZC A;  2XLA A;  1WLC A;  2VW2 A;  2RJ2 A;  4KH9 A;  1HKD A;  3RWN A;  3NW4 A;  4RS5 B;  3A23 A;  1X9T A;  2A75 A;  2RR1 2;  3CQO A;  4MAD A;  3N9N A;  1W2T A;  4AQ6 A;  3BOW A;  4QXH A;  3UES A;  4FFF A;  4NWV A;  4K6B A;  1WMF A;  1YYN A;  1UZ0 A;  2JG8 B;  3ASI A;  4QKF A;  5F3I A;  5CIS A;  3THD A;  4JGY B;  2BPA 2;  1MZF A;  5IFP A;  2WQ4 A;  3L2Y A;  3KMH A;  4D7S A;  2F17 A;  3FC0 A;  3Q8E A;  1BKZ A;  3F2Z A;  5FYB A;  2YG0 A;  3LZZ A;  5D8A B;  1E5I A;  4AR2 A;  3VBO A;  4LR4 A;  1BXH A;  2ZS6 B;  2CSG A;  1T6G C;  5FY9 A;  1WMX A;  2ID4 A;  2WJS A;  3I3Q A;  5FY8 A;  4N53 A;  5JMC A;  2D3R A;  3PLQ A;  5GZG A;  3ZFF A;  5JI9 A;  2D97 A;  1RUG 1;  5A3U A;  3GJA A;  3LEG A;  2P3J A;  3ME2 A;  2BWC A;  1VE0 A;  5FAX A;  4HVO A;  4TTG A;  2VUL A;  2PAM A;  4OZO A;  1ULE A;  3J7N A;  2CGP A;  1TVG A;  1MZE A;  4YRD A;  1WW6 A;  2O0O A;  3VL9 A;  2AEY A;  4YLZ A;  1RMU 3;  2D6P A;  4KU8 A;  2ZGS A;  1EUU A;  1QDC A;  1B35 C;  3MBW A;  1C5I A;  1RVF 3;  2NM1 A;  3H42 B;  3LIH A;  3Q8A A;  4XUR A;  4PLN A;  1JXN A;  5CFD A;  3RGB A;  2AZ5 A;  3W59 A;  4WVZ A;  2NP0 A;  4JX0 A;  1S4C A;  4WM8 A;  1E5S A;  1PX4 A;  4P9L A;  5IJR A;  5FDB A;  3KV5 A;  2IXI A;  3O12 A;  3ZN5 A;  1FXZ A;  3ZXF A;  3E6D A;  3ZYJ B;  2CAU A;  3SH3 A;  2R30 A;  4NRO A;  1AR6 3;  2R07 2;  3MID A;  1NA1 B;  4NUB A;  5F32 A;  5BXX A;  3JBG 1;  3LGR A;  1QJU 2;  1AXY A;  4FI9 A;  3VV1 A;  3TN9 2;  1JZ4 A;  2D40 A;  1RHI 1;  2UU8 A;  2A6V A;  2Y6H A;  4S2G A;  1CX4 A;  4XJZ A;  5DAQ A;  4C0H A;  3NNL A;  3NKT A;  4YVS C;  5FPA A;  1LEC A;  5SV8 A;  5CEH A;  4JHZ A;  1LGN A;  4XTM A;  5K8S A;  5FUI A;  4IW3 A;  1U5Z A;  1S0C A;  2ATF A;  3POE A;  4IUG A;  4YFW A;  5F5I A;  1VBD 2;  3CL1 A;  1ZNP A;  2P5B A;  4PLM A;  4LKS A;  1KGY A;  1BBT 2;  4ET7 A;  2W3J A;  4P9G A;  2NZ9 A;  3D5O A;  1W3V A;  5GJ6 A;  3BTY A;  4BDV B;  1HN0 A;  3ZSK A;  4DY3 A;  1PGL 1;  3HNY M;  3I7D A;  1S0I A;  5ANN A;  3JXS A;  3I3E A;  3C2U A;  5FP4 A;  1JOJ A;  1HXS 3;  2CDP A;  1RIR A;  4KBZ A;  3S57 A;  5J36 A;  3KGL A;  1XU1 A;  1V70 A;  1BJQ A;  3O1T A;  1IG0 A;  1TQ5 A;  2LRO A;  1WW5 A;  4E2G A;  4H55 A;  4GMP 3;  1KDK A;  5G04 L;  4P9X A;  1CAU A;  1EAH 1;  5F5Q A;  3V65 A;  3DF0 A;  2BYV E;  1U0A A;  3ZKY A;  5C7G A;  4M4P A;  2YGM A;  1W6N A;  2WWU A;  4OUE A;  1JU3 A;  2JG9 B;  1KXG A;  1YO8 A;  4GH4 B;  1IGO A;  1VPH A;  2W08 A;  1X9P A;  3AK0 A;  4OZX A;  4Q4X 3;  2G9F A;  4UFJ A;  1OF3 A;  2W87 A;  1YJK A;  4LPL A;  5ACA 3;  4OHZ A;  4FCA A;  1ZRI A;  3T0A A;  1C4R A;  2JEC A;  3R4U A;  4MLO A;  4CCK A;  5FO8 B;  1AR6 2;  1I3H A;  5JXH A;  4LBN A;  5EJZ B;  3WG3 A;  2D5F A;  1W6M A;  4FTE A;  1YI7 A;  2VCM A;  2D5H A;  2X5I C;  3AKR A;  5DN2 A;  2WZR 2;  1YHF A;  3I97 A;  4LQR A;  3OYW A;  5J09 A;  3TEY A;  4JGZ C;  1X33 A;  3DCQ A;  2VZP A;  2YBK A;  1AX0 A;  1VIW B;  5A1A A;  1UPI A;  3IAP A;  3WQ7 A;  5DXD A;  4WM7 C;  5EFU A;  5B4X A;  5BNO B;  5IVB A;  3AKQ A;  4BB3 A;  1CVN A;  1AL2 1;  1DGW X;  4E2S A;  1ZRC A;  2DFC A;  2R06 3;  3KCY A;  5LA0 A;  4F83 A;  5A7S A;  3BCW A;  3ACI A;  5FP3 A;  1PNF A;  4YW4 A;  1WD3 A;  4FPL A;  5K0U A;  1GNZ A;  1KFU L;  4M0H A;  3SC7 X;  2VNG A;  2Y6K A;  4QWN A;  1MQT C;  5FCC A;  4YM3 A;  3K4Z A;  2OS2 A;  1SFN A;  1G6N A;  3K4D A;  4MUV A;  1ZBE 1;  5IK8 A;  2LRP A;  3NV3 A;  1WCU A;  1NE4 A;  5CAZ A;  4AI9 A;  2XUM A;  3ZFE A;  2R04 2;  4E8D A;  3KF5 A;  1AYM 3;  1VR3 A;  4Q0V A;  3CKH A;  4RHV 1;  4ARX A;  2WNU B;  4COU A;  1V9U 2;  2NMN A;  4CUC A;  4E2Q A;  1YQC A;  1L7L A;  2RDQ A;  2ZKN A;  3AKS A;  4NPM A;  4XEZ A;  3DL3 A;  2HEY F;  2ORX A;  5A33 A;  3ZVX A;  1DBN A;  1FAY A;  3ZSJ A;  3O1V A;  1DGR A;  1LTE A;  2A71 A;  2VQT A;  3AYE A;  4KGG A;  2VZR A;  1ASJ 2;  3FLR A;  3ZYB A;  1ND3 A;  1DG6 A;  2G9G A;  4AVA A;  4YZ2 A;  3EHK A;  2OXB A;  4OUM A;  5F3G A;  3J7H A;  4HLT A;  4LOR A;  1FPN 2;  1CD3 G;  4K21 A;  1MS5 A;  4AFB A;  3W5N A;  3WNL A;  3CJI B;  1PK6 B;  4CDU C;  1N3P A;  1GOF A;  2QDN A;  2IFR A;  2HWD 2;  5BY5 A;  4YG3 A;  1R08 1;  3S7E A;  1TMF 1;  2VM9 A;  4EE2 A;  4AXO A;  3V0A B;  4CCL A;  2OPK A;  4MG2 A;  5FZI A;  2RMU 3;  3HEI A;  2JG8 A;  4IEV A;  5A6Q A;  2WDB A;  4P08 A;  3ZMO A;  5K7P A;  5DZG A;  1LJ7 A;  4JGY A;  3THC A;  4AVB A;  4AW7 A;  3AL6 A;  1VJ2 A;  1QXR A;  3T4H B;  3G7D A;  3S6P A;  3R4S A;  4R4X A;  1UWW A;  5IVV A;  2OW4 A;  3AM2 A;  1O8S A;  4ZZ8 A;  5CG8 A;  1BVP 1;  1GZ9 A;  3POF A;  4AHW A;  1DZR A;  3H3Z A;  5FZK A;  4NII A;  4A44 A;  1AR8 2;  1NLQ A;  3K51 A;  4GAZ A;  4LK7 A;  5DDJ 3;  1VBB 1;  2ZX0 A;  3N36 A;  5D21 A;  5DAW A;  3ACL A;  4Y5Z 0;  2VMD A;  5H9R A;  3VN4 A;  1W6O B;  1LHU A;  3VGI A;  2WN2 A;  1FOD 3;  3WG4 A;  4K20 A;  4LLO A;  1PZ9 A;  1ZA7 A;  4FFH A;  4QPI C;  5EP9 A;  1DIW A;  4RQP B;  4XBN A;  1IQD C;  1HRV 1;  2WSV A;  1HV0 A;  3O0X A;  3PUI A;  2VG9 A;  4QKN A;  2JDN A;  1VBE 1;  4XTP A;  2YPJ A;  4JTO A;  2VTX A;  1K12 A;  4OCT A;  1GSL A;  4KWU A;  1OKQ A;  3C8X A;  2WWJ A;  4L0P A;  4TYS A;  3PUQ A;  5FO7 B;  4AAP A;  5A6Y A;  1SCS A;  2RDN A;  2EA7 A;  3FZ3 A;  1ALY A;  4M0N A;  1AR9 2;  3FUO A;  4PF1 A;  2RR1 1;  1W6Q B;  1XE8 A;  2BGO A;  3SEE A;  4ASL A;  2A6Y A;  1V0A A;  1W2A X;  3NNG A;  4JRA A;  2DFB A;  1JI6 A;  1NA1 A;  1LOD A;  1Q8O A;  3N35 A;  1D4M 2;  1ST8 A;  3KZ4 C;  4WVM B;  4I0B A;  2HWB 2;  3OY8 A;  3IMM A;  3BTZ A;  2ZGO A;  2CY6 A;  2NMO A;  4MVT A;  5C8C A;  2PLV 2;  2YC4 A;  3RMX A;  1YQ2 A;  1YEW A;  1RUC 2;  3KGZ A;  3WX5 A;  5FPX A;  4D94 A;  1S0D A;  2R6Q A;  1HIX A;  1G9C A;  1WBL A;  2PHF A;  1UN1 A;  5JAX A;  3CMG A;  1HRI 3;  2ADE A;  4IEQ A;  3U75 A;  2QCS B;  1QJZ A;  2GAU A;  3LDR A;  2FZ1 A;  3S7I A;  2VNO A;  1LEN A;  2WFP A;  4HPK B;  4TSV A;  4YW5 A;  2QQM A;  2RM2 3;  4O7X A;  5FP9 A;  5FYY A;  4A7Z A;  4EN0 A;  4LA3 A;  2WZP P;  2DBN A;  3WF1 A;  1D0H A;  1YFW A;  2Z2S B;  3ZYI B;  4R9A A;  1DFQ A;  2LM3 A;  5HXV A;  3ZSL A;  3ITQ A;  4OUL A;  3BU0 A;  5A3N A;  1QJY 2;  2G4I A;  4FPC A;  1QJX 2;  2IXH A;  4DRR A;  1ZZ8 A;  4QX3 A;  4CCD A;  1AXK A;  2BW8 A;  2WS9 1;  1REE A;  3WZ1 A;  1W39 A;  1OOP B;  4IV3 C;  4AQ2 A;  4LBL A;  1FX5 A;  2JE8 A;  1O5U A;  4JZR A;  3K4A A;  4KG8 A;  2Y33 A;  5A7O A;  5FLH A;  2E9Q A;  2JXA A;  1IOA A;  2ZAH A;  3AFK A;  1OA2 A;  1NQJ A;  1NCQ A;  1POV 1;  2BWA A;  2JG9 A;  3UGH A;  3SCG A;  3RZZ A;  3GNE A;  2PHX A;  1CZT A;  1GQP A;  1JHJ A;  2IXC A;  2WN3 A;  5LBE A;  4RL7 A;  1OQ1 A;  4LE4 A;  2WYF A;  4Q29 A;  1QJU 1;  4IGP A;  2Z4F A;  3TN9 1;  3VBR B;  1G8W A;  1GZW B;  1YFX A;  5I0U A;  1ODM A;  1VMF A;  3MIG A;  1W0P A;  2CV6 A;  2VZO A;  5FYZ A;  5A6Z A;  5FXW A;  2FDJ A;  3OBR A;  1OBN A;  3TRS B;  2VU9 A;  5ISL A;  3LD8 A;  1VBD 1;  2D6M A;  4YWA A;  2XB6 C;  5F3E A;  2XQX A;  3BOP A;  4CP9 A;  5BNO A;  5J37 A;  1BBT 1;  1J3P A;  4DS0 A;  3URF A;  2C9A A;  1UMH A;  2EXI A;  1X50 A;  2MPF A;  2PHD A;  4GWI A;  5FY0 A;  4CUG A;  4GUL A;  3S5A A;  2ZKL A;  5JDB A;  1H8T B;  5JUV A;  1MZ5 A;  4J1W A;  3ZFG C;  1UKG A;  4MHR A;  1DLL A;  2WT1 A;  4Z92 B;  2BQP A;  2QQL A;  4XAA A;  4AVT A;  4Y1V A;  4NAO A;  1OSG A;  4BXF A;  1JUI A;  1WZX A;  5I93 A;  4ITC A;  4CDW C;  4EN7 B;  3J8F 1;  1R64 A;  4LBK A;  2ZGL A;  2AR6 A;  2HJI A;  2J1E A;  3SEP A;  3D0S A;  4Z8B A;  4MGK E;  3OEB A;  1UKR A;  3UJO A;  2CL2 A;  2G9Z A;  4H14 A;  3T3Y A;  1O3R A;  1PMH X;  2I07 B;  1YQ6 A;  2WNU A;  2CAV A;  4V1P A;  4XUQ A;  3DEM A;  5CYY A;  5FYI A;  4AOC A;  1LGC A;  2JDH A;  1IKQ A;  1TNR A;  1ZA4 A;  2RDS A;  3O7O A;  4E4D X;  4LJH A;  2QQU A;  2ZTN A;  5DQ0 A;  4AVC A;  3ACH A;  3D82 A;  1MS0 A;  4Y1U A;  5LY2 A;  1RUG 3;  4IE7 A;  1C8N A;  2XJU A;  2PAE A;  1W90 A;  3OD4 A;  2WZR 1;  4RN5 A;  1C5H A;  1ZZ7 A;  4BE3 A;  3WCS A;  2VZU A;  3THP A;  3AXE A;  4D6Q A;  2YC2 A;  1Q8S A;  4BHP A;  2P17 A;  3I2F A;  3CJI A;  1PK6 A;  1VAV A;  3IDB B;  5I91 A;  3EXU A;  2QZ2 A;  3KLS A;  2Y60 A;  4ZY9 A;  3CHX A;  5JSR A;  5A1L A;  2Y38 A;  1ZRE A;  2C0Z A;  3FMG A;  3V0A A;  4PIZ A;  5FIX A;  5FPV A;  1LHW A;  2B9U A;  3CU7 A;  3HNB M;  3ZN6 B;  2WII B;  2VQ0 A;  4TXW A;  2YY1 A;  3MIB A;  3B00 A;  4BXS V;  1JYX A;  5KBF A;  2J1A A;  4XXA A;  4B4R A;  1MS3 A;  3EBR A;  2FDK A;  1ZVF A;  4X6R B;  2IC1 A;  4EWA A;  4BIO A;  2PN5 A;  5FP8 A;  1RHI 3;  1IS5 A;  1W9T A;  2IXJ A;  2VD7 A;  1CAW B;  2VME A;  2CHH A;  4ONU A;  5IVY A;  4JKM A;  3USS A;  2AC1 A;  2JB4 A;  3T08 A;  1XYO A;  1W6O A;  1SLB A;  3FBY A;  4K8R B;  4L9B A;  1V9U 1;  3OBT A;  1KEX A;  2CTV A;  2XJP A;  4XJW A;  3VBU C;  1JN2 P;  1KS5 A;  5G05 L;  1AYN 3;  2D44 A;  3GXU A;  2ET7 A;  2VC9 A;  3WNM A;  4YGD A;  2DVA A;  2Y34 A;  3ZYF A;  5JZG C;  4FPG A;  4RQP A;  1A78 A;  1F35 A;  1N47 A;  1YXW A;  1ASJ 1;  5BNN B;  4CRQ A;  5LEK A;  2DUO A;  5CNA A;  3VHR A;  2V5Y A;  2XWB B;  4N9I A;  3LDB A;  5DMY A;  3GBW A;  4ATE A;  1FPN 1;  3K48 A;  5AVA A;  3KF3 A;  3VZM A;  1RUH 3;  5IHR A;  2JKB A;  2QQI A;  1ZZC A;  3IN9 A;  1LOF C;  2YBS A;  5CZK A;  4I30 A;  4LBQ B;  2XKO A;  1H1I A;  4UW5 A;  1HB2 A;  3C7H A;  1RUF 3;  3RJ2 X;  3TBD A;  5C9A B;  1W6Q A;  2A73 B;  1URX A;  1Y9M A;  1GWK A;  5FZO B;  4BQ3 A;  4OFG A;  1S0G A;  2AGS A;  4PQ9 A;  2DYC A;  4WVM A;  2QJV A;  4AHZ A;  4DXS A;  2V09 A;  3RZG A;  4BZ4 A;  4FTB A;  1QNY A;  4Q0U A;  2HWE 2;  4FOQ A;  2UYA A;  3MW3 A;  4P9W A;  1XRU A;  4BQ4 A;  5LA2 A;  2J1V A;  3VBF B;  3WDY A;  4XAE A;  5GZD A;  4AGG A;  2GZW A;  1OVP A;  4B4Q A;  4NHX A;  5DZF A;  5L9V A;  4BK5 A;  2GP5 A;  4JDN A;  2W91 A;  3RJR A;  3UL2 A;  4N9H A;  5IFT A;  3D8C A;  2H6B A;  1OF4 A;  4OMC A;  4CDX C;  4P9Y A;  3H3U A;  4Q2F A;  4UYB A;  1KD7 A;  4H3W A;  3DYP A;  1AUY A;  5FRE A;  4A4A A;  1YJL A;  4QQP A;  5LW9 A;  4N43 C;  5D2A A;  1BEV 1;  5FP7 A;  3ZN4 A;  4HPK A;  4LOT A;  2HWC 3;  1UX6 A;  4M3C E;  5FV3 A;  4O65 A;  2WO7 A;  3MEP A;  3GF6 A;  2LUW A;  3MO4 A;  4QX2 A;  4YZ3 A;  1S1A A;  4BIS A;  4XCB A;  3WF2 A;  2ZGK A;  5IK5 A;  4RFT 0;  2DCZ A;  2NQY A;  3FN9 A;  2PXJ A;  2WWS A;  4S2F A;  4XJ8 A;  5K9Y A;  1PIV 3;  3NJV A;  1R09 1;  1UXX X;  1ODN A;  1UOB A;  2FQP A;  4JRL A;  1R1A 3;  4ERO A;  2WO3 A;  2DUP A;  2WR9 A;  3LFI A;  3MGU A;  5EHD A;  4CDQ C;  3V0B B;  1OOP A;  3M7A A;  2ZGQ A;  3OGJ A;  4GAL A;  3NQH A;  3U07 A;  3CBN A;  3KHC A;  4MXW B;  2EAK A;  5BNQ A;  1AR9 1;  4XOG A;  5JOW A;  2ZGT A;  1PO1 3;  2VEC A;  4SBV A;  5D1I A;  4UAP A;  1RED A;  1RUE 3;  2WNV C;  3D4K A;  3BN6 A;  1X36 A;  1AL0 G;  4EV0 A;  4MHU A;  4Y22 B;  1UX7 A;  3MV0 1;  3HN3 A;  1BVV A;  1D4M 1;  4YW3 A;  5FZD A;  3VBS A;  3VBR A;  4YM1 A;  2HWB 1;  1GZW A;  2GSY A;  2VPV A;  3VDD B;  4KL1 A;  4UW3 A;  1E57 A;  5FXZ A;  1LKN A;  2CU5 A;  2PLV 1;  4P00 B;  1SPP B;  1SG3 A;  1RUC 1;  1STM A;  4IEO A;  2VY0 A;  4MSV A;  4UWD A;  3ZFG B;  5F1R A;  4K3U A;  2QQO A;  3KM5 A;  2ERF A;  2CWS A;  2P2K A;  4FFI A;  4FOW A;  5AFE A;  4NIA A;  1AR7 2;  3WUD A;  1JUH A;  3EJK A;  2DTW A;  1LOC A;  4CDW B;  3H7J A;  4QGM A;  3ZLI A;  2EVX A;  3I2K A;  3UKT A;  5IVJ A;  1O7F A;  1H8T A;  1PMI A;  1V00 A;  4LUM A;  4QDR A;  3UJQ A;  3ZXL A;  3BKZ A;  2EIE A;  2ILM A;  2HWC 2;  1APN A;  1JTZ X;  1LHV A;  3ATG A;  3I59 B;  4QX0 A;  3TNP B;  4RYD A;  5IUQ A;  4CXX A;  1H30 A;  2B5H A;  2J1T A;  4PIX A;  4YG6 A;  5HV4 A;  4OI2 A;  3DXU A;  1OPO A;  1QJY 1;  3KSC A;  5CKM A;  1NYW A;  2QDR A;  3JD7 3;  3WDU A;  1GNH A;  1UYZ A;  1ULF A;  4DPN A;  1DZT A;  5BNP B;  1COV 2;  4Q5O A;  1LGB A;  1OHF A;  2Y0O A;  3RWK X;  4COY A;  4EZ4 A;  2DUR A;  2VUA A;  3LEK A;  1HB3 A;  5B4N A;  4Z07 A;  4S2H A;  3U10 A;  4M00 A;  4DUV A;  1ACC A;  4D7Y A;  2EIB A;  5I0R A;  2FMD A;  2Y6G A;  4IGQ A;  2V73 A;  4COZ A;  2YC0 A;  3JCI A;  2MHF A;  5AC9 2;  3FFQ A;  1GUI A;  5FY5 A;  3IWZ A;  3OPW A;  2ARA A;  3NAP C;  1JW6 A;  1MAC A;  2RV9 A;  2W95 A;  4A6O A;  3VZN A;  5FYV A;  2VZ3 A;  1IPS A;  1J84 A;  3PUA A;  2VZT A;  4YW6 A;  2XQR A;  1X82 A;  1MZ6 A;  1QH6 A;  3IDE A;  1RIN A;  4J6G A;  1BLZ A;  3B3Q E;  3HPN A;  5CKN A;  1M4W A;  1CON A;  5FTT C;  2QQV A;  4YPJ A;  4AG4 A;  2Q8D A;  4LEJ A;  1PGW 2;  1TNF A;  2WFF 2;  3RSJ A;  3VBU B;  1XNB A;  2H0V A;  5J3U A;  4Q4W 2;  1BYH A;  4QGL A;  4XZU G;  2ET1 A;  2C6S A;  1PMJ X;  4HT1 T;  4ZZ5 A;  4IEU A;  4H7M A;  4XFF A;  1YC6 1;  2ARE A;  3BYW A;  1DQ2 A;  3AMQ A;  3GHM A;  4HG6 B;  1OPM A;  2ZX3 A;  3SXW A;  1CAW A;  1RB8 G;  1H1A A;  1LAJ A;  1LOA A;  4L11 A;  3PDQ A;  2C24 A;  5DAX A;  5IYY A;  2DCT A;  3H9A A;  2HWF 2;  3RI8 A;  2VAU A;  2R0F A;  4IEY A;  1WLW A;  1XND A;  4L92 A;  4FAG A;  3WDT A;  1DQ0 A;  4RFR B;  5LK7 B;  3HT1 A;  2WZ8 A;  5F7U A;  1R1Z A;  4K8F A;  2J42 A;  5C70 A;  1MVQ A;  4BM8 A;  1REF A;  4EN9 B;  4UFM A;  4TWT A;  3SIT A;  2Q30 A;  3K2O A;  4IEX A;  1OLM E;  3SHR A;  2QQP A;  3OOX A;  4XFH A;  5GLV A;  5IT6 A;  4XUO A;  4TN7 A;  1PVX A;  5BNN A;  3AZX A;  1UOG A;  4DO0 A;  1GAN A;  3OBA A;  3B5L B;  3HJR A;  4HMZ A;  4EN8 B;  4D7T A;  3RFR A;  5LAT A;  4XMA A;  3QCW A;  5JVV A;  3ZXK A;  1QXP A;  4BA6 A;  1PM7 A;  1J83 A;  1RUI 3;  1ND2 A;  1XB9 A;  4GB3 1;  3VKN A;  3BTX A;  2ZMN A;  5FYU A;  1K5M C;  5DAV A;  3BB6 A;  1XE7 A;  1XNT A;  2X10 A;  4LBQ A;  3WD5 A;  5C9A A;  4DZG A;  5JXI A;  2WL1 A;  3CZJ A;  1UIJ A;  4QAW A;  2AEN A;  4WV8 A;  3MHZ A;  3HR9 A;  4Y24 A;  5FZO A;  3N4M A;  4YVW C;  4EZH A;  2WS9 3;  4PCR A;  3IPV B;  4N7U A;  3KV4 A;  1EPZ A;  3PL0 A;  2BVB A;  2E63 A;  3H1M A;  5GM0 A;  1HDK A;  1CIY A;  4ZON A;  1RUJ 1;  5LWB A;  1Q43 A;  5I8S A;  3I3B A;  2VH9 A;  3UET A;  3VBH C;  2QFE A;  4M3C F;  1NCR B;  3VBF A;  5A3O A;  4PI0 A;  5F6L B;  1RXF A;  3QH6 A;  4XQW A;  2O8O A;  5EPA A;  4D0Q A;  1JZ3 A;  1ENR A;  4K9S A;  4KGQ A;  1V6K A;  3AMM A;  4NAM A;  5CFC C;  2Q1Z B;  1UIK A;  1VBC 2;  4IEP A;  4B4P A;  1CJP A;  3KQR A;  1POV 0;  3BOD A;  3DPR C;  1PZ7 A;  4Y4R A;  1PVC 3;  2XVL A;  2XJR A;  3VDA A;  3AYC A;  4GA9 A;  1J1L A;  2JKX A;  2D98 A;  2RS3 2;  4CCC A;  1AZD A;  1OXC A;  5FWJ A;  5LBB A;  5F5C A;  3T2Q A;  3K75 B;  3ZO0 B;  5FPB A;  1UPS A;  4OQ8 A;  2WNV B;  1C8M 1;  4YW1 A;  4NIG A;  1OFS A;  1X7N A;  5FMO S;  4CUA A;  4FSJ A;  5FZ3 A;  3WNN A;  1A3K A;  3ZM8 A;  2VBP A;  2VVD A;  3MFA A;  4ZS3 A;  5F9T A;  1J58 A;  1NQD A;  3MPB A;  4MXW A;  5DPN A;  1H9P A;  4COV A;  3RS6 A;  3NVC A;  1JZ5 A;  1QWR A;  1UZZ A;  3O14 A;  4I02 A;  4MO3 M;  3N9M A;  4IV1 C;  1WCQ A;  3POW A;  1O3S A;  4QX8 A;  5B2G B;  2OUJ A;  1Z7S 1;  2V4A A;  1UYX A;  1WA4 A;  1I6X A;  1QNW A;  3LB9 A;  1O3Q A;  3VDD A;  1YFU A;  2HWE 1;  4M01 A;  2Y6L A;  4NID A;  2BJS A;  3IM0 A;  1SPP A;  1ULP A;  1W8W A;  3H1Y A;  1SLT A;  3M70 A;  4UXA A;  2XWJ B;  2YHJ A;  2X05 A;  1I1E A;  3HN1 A;  3K46 A;  4FAH A;  4ZS2 A;  5EXO A;  1AXZ A;  3Q9O A;  2IFW A;  2A6W A;  1QOS A;  2P3I A;  3ZDS A;  1L7R A;  4JC1 A;  1CAV B;  2JIJ A;  3WXP A;  2D6N A;  4QU2 A;  5LK5 A;  1Y3T A;  4IND A;  3I59 A;  4PF5 A;  4PDW C;  3MZH A;  3ZX7 A;  1RMU 2;  2JIG A;  4AQT A;  1UZW A;  4FFG A;  4JV4 A;  3MIF A;  5I0D A;  3WW1 A;  3USU B;  5IWF A;  3I4I A;  1N1Y A;  1RVF 2;  3ABZ A;  4F3J A;  2C1F A;  4XE9 A;  4AVS A;  3HWJ A;  2WLP A;  4CEW B;  4XHB A;  5IAT A;  1ENX A;  1NZC A;  2OVU A;  1WME A;  5GZE A;  4NRP A;  2VZ1 A;  2XGX A;  3MF6 A;  5BNP A;  3ECQ A;  3S30 A;  2OX0 A;  4Q8L A;  4QQL A;  4AQS A;  2E53 A;  1VAM A;  3BTA A;  3EB7 A;  1W28 A;  3U4S A;  1W2O A;  1VRH 3;  3IBM A;  1SLC A;  4CEY C;  1YLL A;  1GR3 A;  1MEC 3;  2HBT A;  2RJK A;  4FOY A;  3RI9 A;  5HXM A;  1I9R A;  4MGZ E;  4N90 A;  5C6C A;  5HCA A;  2PHR A;  4QQO A;  5FJK A;  2VZV A;  4QX5 A;  2JD4 A;  3H50 A;  4P02 B;  1WLD A;  4PQQ A;  1A8D A;  5AVP A;  3UK9 A;  1SLL A;  5LA1 A;  3ZPY A;  5T55 A;  1JYW A;  2RS1 3;  5HBA A;  3AJZ A;  2ES3 A;  3MFC A;  4E9K A;  4ZU5 A;  1BCX A;  1VBA 3;  5FY1 A;  2VOT A;  4HAN A;  4IL7 A;  1QH7 A;  2KA3 A;  2YBP A;  4Q4V 3;  2IVJ A;  1W8H A;  4LUK A;  1AR7 1;  3IAQ A;  1CX1 A;  2MEV 3;  2VMF A;  1U5I A;  2HLE A;  1NZI A;  2ZAB A;  4DXT A;  1GBG A;  3AB0 A;  1Q3E A;  1Q8P A;  3B94 A;  5FZ4 A;  3SCF A;  3U4X A;  1OC1 A;  1SLI A;  5FPZ A;  1UYP A;  3OBZ A;  2C9K A;  1UY1 A;  4XW3 A;  4SLI A;  2J1R A;  1G86 A;  3N9O A;  1O59 A;  1SBE A;  1UY0 A;  3A4U A;  5C8W A;  1HXS 2;  5FO9 B;  1G9D A;  3NRU A;  3Q8B A;  2R16 A;  3AMN A;  1D2Q A;  4XJU A;  3VBU A;  4OHY A;  5L9R A;  1Y9Q A;  2VVE A;  1DQ6 A;  3HNM A;  4IE6 A;  1F15 A;  3PTY A;  4URT A;  1FMD 3;  5C33 A;  5JSP A;  1K45 A;  5FMD A;  5CU1 A;  5F37 A;  1SZB A;  4E4H A;  3E5Q A;  3OUH A;  1BK1 A;  1RUD 3;  5FZC A;  3AP6 A;  2W0X A;  1GYK A;  3T0D A;  1WUV A;  2W1U A;  3LEI A;  2J1S A;  2VL4 A;  3RZM A;  2DVG A;  4NO4 A;  1COV 1;  2V4V A;  4YAR A;  4BIF A;  3E6B A;  2GH2 A;  4XFI A;  4MGI E;  4Q4X 2;  4C1W A;  3LPG A;  3NMB A;  3WLU A;  5ACA 2;  1OQE A;  1LOF A;  3FWE A;  4LIV A;  4LLF A;  2OQ7 A;  3S5Q A;  2W94 A;  2JDM A;  2WIN B;  4IEW A;  4D3W A;  4XFB A;  3POJ A;  5ABJ C;  3X29 B;  5JR2 A;  2XON A;  1U5X A;  1WKY A;  2VZS A;  4GKY A;  3OGS A;  4CXW A;  5KHH A;  5AC9 1;  4RS5 A;  1JZ6 A;  4QB2 A;  5LZ6 A;  5I0T A;  2JB8 A;  1H1M A;  3PHM A;  1FNY A;  3VBH B;  5L7O C;  2VZQ A;  1QQP 3;  1R09 3;  3M8L A;  2XUE A;  4UOJ A;  1LR5 A;  2CWM A;  2XR4 A;  1JYC A;  1C28 A;  5FPL A;  1IHM A;  1LCL A;  4CU9 A;  3VHN A;  4OI0 A;  1TE1 B;  1N1V A;  2R06 2;  4P5H A;  5T54 A;  5CFC B;  2FHR A;  3OUJ A;  4XQD A;  3SLI A;  2H0B A;  3IPV A;  2W68 A;  1W05 A;  4LKD A;  3WQ0 A;  1FV2 A;  2FCV A;  3DPR B;  1UD1 A;  4XDP A;  3LF7 A;  4W65 A;  4XET A;  5D8A A;  3ZIX A;  1BMV 1;  4Q1P A;  5T5L A;  2WFF 1;  1XNA A;  1LRH A;  4O9E A;  4Q4W 1;  4Y33 A;  1NCR A;  4QM8 A;  1UU4 A;  4FTS A;  3NL1 A;  1UYY A;  4UFI A;  1LED A;  2W9X A;  1B35 B;  1JZ2 A;  4CDU B;  4H2A A;  1AYM 2;  4MXV A;  3WQ1 A;  1QHD A;  4XIL A;  3P3P A;  2IUW A;  1DQ1 A;  2HWF 1;  1TME 3;  2O14 A;  3NNM A;  3I3M A;  1NY7 2;  1G9F A;  1VB2 A;  1DYK A;  2DVD A;  4DIN B;  5FK8 A;  4LNV A;  5M0T A;  1GOH A;  2DDU A;  1N3O A;  1W6P B;  3KCC A;  2BUK A;  2RDR A;  4MOA A;  1E5H A;  1XJA A;  4KNC A;  4PHZ A;  3T1L A;  5JWP A;  5KHJ A;  5F8P A;  5K4L A;  4IV1 B;  2WNV A;  2GDF A;  4YVS B;  3FUQ A;  2OZ6 A;  4LE3 A;  4MH0 E;  1H2K A;  1AHS A;  1EV1 3;  5A7P A;  3POB A;  4ZKT B;  1S0F A;  1Q8V A;  3AMH A;  3NV2 A;  4JHT A;  4FO9 A;  4QB1 A;  2RMU 2;  2RS5 3;  1RUO A;  2XBO 3;  3W9A A;  1PO2 3;  1LU1 A;  4FXG B;  1HV1 A;  2E31 A;  3KVA A;  5F2S A;  1TEI A;  1ZX5 A;  4RR3 C;  1UO9 A;  2NPI A;  1ENQ A;  1HB4 A;  4QQ2 A;  1MS4 A;  4HZF A;  1WCK A;  4MGQ A;  5C5T A;  1N1S A;  3LA7 A;  4AED C;  1S0E A;  4YZ5 A;  4XF4 A;  1GP6 A;  2O1Q A;  1WW4 A;  1FT9 A;  5LAS A;  1HX6 A;  1VRB A;  1O4Z A;  5FYS A;  2ZA9 A;  1NAE A;  5DG2 A;  4A7Y A;  3NV1 A;  4CCM A;  3L9J T;  4PDW B;  2UWC A;  5HV0 A;  1L3J A;  5DDJ 2;  2WAA A;  3RYP A;  4AHY A;  3SKJ E;  1JZ8 A;  3LAG A;  3LSE A;  1VBC 1;  4PJY A;  1GV9 A;  3PUS A;  1FOD 2;  2OT7 A;  1S2B A;  5GLT A;  2BTV C;  5T5J A;  5A3T A;  1CAV A;  1I5Z A;  2VOX A;  2W46 A;  2WLQ A;  3HIF A;  2RS3 1;  4QQH A;  4JDM A;  4AHX A;  1H6X A;  2VOV A;  1ULC A;  1FYU A;  3M1H A;  3OD0 A;  5A32 B;  5C3O A;  1YI9 A;  3WP5 A;  1H6Y A;  4FPK A;  1CZS A;  4LBQ D;  3USU A;  1XE0 A;  1HJG A;  2X5I B;  5IAX A;  2E7A A;  3OCP A;  1ENS A;  3OGV A;  1L7Q A;  3VBO C;  5C3R A;  4CEW A;  1ZBA 3;  4W6X A;  4JGZ B;  4GH4 A;  3IDA A;  5GAL A;  4N53 C;  4KI5 M;  3A0N A;  3AKP A;  5IVF A;  4HBN A;  1A34 A;  5FLI A;  2ZPX A;  4K1Z A;  2R07 1;  3PVN A;  1DQ4 A;  3NJX A;  4WM7 B;  3ZFF C;  1ZRF A;  4QHO A;  1WCD J;  2DU0 A;  5J1X A;  1DGL A;  2XXZ A;  4QPG C;  2K9Z A;  2PHL A;  4WVV A;  4CU6 A;  4UW4 A;  2Q5T A;  2Y6F A;  1OUR A;  5IAV A;  3LOB A;  4B3N A;  5A3W A;  3F95 A;  1DGR N;  5LBC A;  2OKX A;  2F4L A;  4HFS A;  3H7Y A;  1K3I A;  2JDK A;  5FZM A;  1MQT B;  4XF3 A;  4JKK A;  2A7A A;  3JB8 A;  1CGP A;  2WO1 A;  2JX9 A;  4Q4Y 3;  1W03 A;  5CFD C;  1HRI 2;  2K46 A;  3U78 A;  1MR5 A;  3FHI B;  4NE9 A;  4QDQ A;  5BPX A;  3M3C A;  3WT3 A;  1UMI A;  2NYY A;  4W6W A;  2RM2 2;  2BBV A;  4R4Z A;  1O4Y A;  4LHS A;  1WBF A;  3BPS A;  3EO6 A;  3HMY A;  2HYX A;  1BZW A;  3KVB A;  4GB3 3;  2VW0 A;  4LUL A;  4RGA A;  3GCX A;  4A41 A;  4CZS A;  4M3C B;  4ISR A;  3C7O A;  4E4Z A;  1RMU 1;  3PU8 A;  5FXV A;  4DUX A;  3ZYG A;  2XPJ A;  3HOB A;  2OQ6 A;  4ZHN A;  1CPM A;  2RHP A;  3WSO A;  4LO4 B;  5A3M A;  5ABJ B;  1RVF 1;  1WGP A;  4GKX A;  2W39 A;  3ETP A;  4GD4 A;  1HB1 A;  2X29 A;  2XML A;  3LQC A;  4WBB A;  4FQZ A;  4OQ9 A;  2FDF A;  2ZEY A;  4CCO A;  3FBM A;  2Q8C A;  2ZGU A;  4QB6 A;  4IDZ A;  4IE5 A;  1NLS A;  3WW2 A;  5FZF A;  1AR6 1;  3VD7 A;  2XDV A;  2K0G A;  4NHY A;  4FPY A;  3I8T A;  2Z79 A;  1SHW B;  2DWR A;  2UWB A;  2ZJC A;  2VNV A;  2W47 A;  2EAA A;  3FLT A;  5DUW A;  3ZR5 A;  4AFC A;  3OGG A;  3OSD A;  3BGA A;  4OUS A;  2IWG B;  3I3D A;  2WAB A;  1W8N A;  2XVK A;  2VMC A;  4QKD A;  1W8U A;  1W0O A;  1JS9 A;  2PA7 A;  1QIQ A;  2YB7 A;  2YZ4 A;  3KS7 A;  2FDG A;  2VXR A;  1LOE A;  3SH5 A;  3IB3 A;  5E6H A;  2NN8 A;  1O8P A;  5LEJ A;  1X8M A;  2E7T A;  4COW A;  1C8M 3;  4FT8 A;  4UFK A;  2ADD A;  2HEW F;  2GH8 A;  2PQS A;  4XIO A;  4NVP A;  4XF9 A;  1W04 A;  2X09 A;  4B1L A;  1UU5 A;  5FLJ A;  1QGL A;  2B7Y A;  4CP1 A;  3RZJ A;  1QDO A;  2ZEW A;  3V64 A;  4QPI B;  3JBG 3;  4QT6 A;  5JIA A;  2ZEZ A;  2ZCW A;  4ZPI A;  1Y4W A;  4RGG A;  4UFL A;  3B7M A;  5A7Q A;  1HQL A;  4EWD A;  3ELN A;  2VUJ A;  1AJK A;  3WG2 A;  1Z7S 3;  2R04 1;  3AYA A;  4GWN A;  1WLT A;  4GMP 1;  1B35 A;  2QKD A;  2VBB A;  1QJE A;  4CDU A;  1IS4 A;  5FYT A;  4I01 A;  2BOI A;  3WDW A;  1UU6 A;  5JCT A;  1UZV A;  1ZM1 A;  1H9W A;  4KWK A;  2GME A;  4L2N A;  4WVW A;  4Q4X 1;  1JZ7 A;  1WD4 A;  1JU4 A;  2WNO A;  5ACA 1;  3WIN E;  4Y1X A;  1GP5 A;  1W6P A;  4IQP A;  1RUG 2;  2WAO A;  4OVE A;  1XNC A;  4HVQ A;  1HW5 A;  1OT5 A;  1UAI A;  4BPZ A;  1G7Y A;  2OA2 A;  3PUR A;  1ZZ6 A;  4JKL A;  4D6S A;  4AEK A;  3QH7 A;  5K0U C;  3LA3 A;  3RRD A;  5IW0 A;  3N7M A;  4YVS A;  5FOB B;  4O9G A;  5KR7 A;  4DMI A;  3VD4 A;  4FP3 A;  5T3N A;  2HWD 1;  1FI2 A;  4Y5T A;  1YFY A;  4XF0 A;  1AF9 A;  2SBA A;  1LNS A;  3CEW A;  4CU7 A;  2P37 A;  4CPB A;  3ZFE C;  1QJF A;  4E27 A;  3O0W A;  1EAH 3;  2E26 A;  4FXK B;  3RQ0 A;  3BVC A;  4R52 A;  1F5F A;  1AX2 A;  2ZZJ A;  2XVG A;  2R06 1;  3VUO A;  2QE3 A;  4K40 A;  4IES A;  2YMZ A;  3CO2 A;  4NMI A;  4AEM A;  4QD2 A;  3ZXG A;  2DF7 A;  3K77 A;  1OD5 A;  1CAX B;  1LOB A;  1KFX L;  3FJS A;  2VCB A;  1QU0 A;  3VD5 A;  1ND3 C;  1SFP A;  4BWO A;  1XSR A;  4QPY A;  2BDR A;  1AR8 1;  2GMM A;  3JU9 A;  2W1Q A;  3ILR A;  4EQV A;  1RHI 2;  3OJB A;  3B69 A;  4P9I A;  4OHX A;  1MS1 A;  5JPN B;  2ZGP A;  2GU9 A;  4IV3 B;  1HQN A;  1AYM 1;  3VKF C;  3WF0 A;  3V56 A;  3N7J A;  1FV3 A;  2YRO A;  3WY6 A;  1F4H A;  1UF2 C;  3VBO B;  1AYN 2;  4ES8 A;  5HI0 A;  4QHZ A;  1DF0 A;  2CNA A;  1NY7 1;  2ETE A;  5C71 A;  1YQ5 A;  2JG8 C;  1AL2 3;  2VCC A;  3H1W A;  4OI1 A;  1SBF A;  3VKL A;  5JOZ A;  4NPL A;  1HJF A;  2PFW A;  3AC0 A;  3CF6 E;  4JGY C;  3ZXD A;  2FCU A;  2P3Y A;  4A2U A;  1D4V B;  4QPG B;  2EF6 A;  2EXJ A;  5FZ8 A;  1UQX A;  2VVF A;  2X5I A;  4X6Q B;  1LHO A;  4GIQ A;  1RUH 2;  1GQG A;  2ZHK A;  3JB4 C;  2AYH A;  4OMD A;  4JGZ A;  4R8H A;  3MIE A;  4Q27 A;  3PUH A;  5FRA A;  1RUF 2;  1ZBE 3;  2BVV A;  3MW4 A;  3WUC A;  4YGC A;  2AH2 A;  1OLR A;  1YIF A;  4XBQ A;  1U12 A;  4WM7 A;  1SDW A;  4MGS A;  5H9P A;  3WNK A;  4HVR A;  2B39 A;  4RHV 3;  2FDH A;  2ZXQ A;  2AUY A;  2VMI A;  4Y1Y A;  1QY4 A;  3O1R A;  1W2U A;  3UNP A;  2DV9 A;  1DHK B;  2XG3 A;  4AGR A;  4NHK A;  4QXK A;  3M3Q A;  4IGO A;  2DTY A;  4X8P A;  1H4G A;  1GIC A;  1W9F A;  2Q1F A;  2WQ8 A;  3M3E A;  5JR7 B;  2BU9 A;  2PQQ A;  4DY5 A;  2J1U A;  4U2A A;  2XJV A;  3PIG A;  2QVS B;  1MQT A;  5FBJ A;  2PHW A;  5T50 A;  3WHU A;  4BQX A;  5DDJ 1;  2BER A;  4B7E A;  3GZU C;  3O1P A;  4LOS A;  4CP2 A;  1J3Q A;  1SDD B;  1DYP A;  1EPW A;  4P5Y A;  2DU1 A;  4K1Y A;  2VCA A;  1UY3 A;  2E6V A;  1R08 3;  1FOD 1;  1TMF 3;  1RXG A;  3HVD A;  2D3S A;  3N7K A;  2IXK A;  3MW2 A;  1NA1 C;  3NWK A;  4YSF A;  1PIV 2;  5L9B A;  2J7M A;  4M3C A;  5C3P A;  1QJX 1;  5F2W A;  4Y3O A;  3P6B A;  1R1A 2;  5FXX A;  5C8C C;  3GZE A;  5KXD A;  3BIW E;  4CP0 A;  3AP9 A;  1W8O A;  4ES9 A;  4LA2 A;  5ERL A;  1C1F A;  1GOG A;  3PMS A;  2WA3 A;  3C7G A;  3R0R A;  2D6O X;  3K3O A;  4LO8 A;  2F6B A;  5A3P A;  5KXC A;  4BME A;  1O4T A;  2D43 A;  1E5R A;  3LSD A;  2EID A;  3H0O A;  5L73 A;  1W0N A;  1GU3 A;  1PO1 2;  3B9I A;  1K5J A;  3DYO A;  2VQU A;  1VBB 3;  2ZBJ A;  1RUE 2;  3KQ4 B;  1Y9G A;  3KT4 A;  3ACG A;  2WT0 A;  5KXB A;  2VBD A;  3BI3 A;  3LE0 A;  2D7F A;  3O1U A;  4I09 A;  3IMN A;  2HEV F;  1Z0H A;  4JQR A;  4YM0 A;  1ULD A;  2D3P A;  5FYC A;  1WWY A;  3PVO A;  2A3Y A;  4TLG A;  3C7E A;  1HRV 3;  5FKC A;  4B8E A;  5FZ9 A;  3HD8 B;  3AXD A;  1VBE 3;  3ALQ A;  1C1L A;  3I2I A;  3POG A;  3GZT B;  3MLK A;  1JYI A;  1XQN A;  1AVB A;  3B01 A;  3ORJ A;  3UGG A;  3WNP A;  5C4W B;  2BNN A;  1HRI 1;  1Q8Q A;  5FZG A;  4I0A A;  3ZN6 A;  3BAL A;  4YGB A;  3ZOI A;  4Q26 A;  3OYW B;  1NXD 1;  3TNQ A;  3ENR A;  4V2W A;  2VGD A;  1NCQ C;  2JG9 C;  3IT8 A;  2RM2 1;  3ZMN A;  3NV4 A;  2RR1 3;  4Q0Q A;  2IXL A;  1LUL A;  1UY4 A;  1C57 A;  3KV9 A;  3KWV A;  3UYJ A;  4NPR A;  4QPI A;  4FOV A;  5FY7 A;  1UNB A;  5JZG B;  4Y20 B;  2B42 B;  1JHN A;  5FY4 A;  3KHB A;  3VKO A;  3O1O A;  3JD7 2;  2Q8O A;  3III A;  5CBL A;  3AZY A;  2G19 A;  4XUP A;  5IK4 A;  4LMF A;  3UV9 A;  3TEW A;  3C7F A;  4FVV A;  4LXL A;  4AFM A;  2XL7 A;  3GM8 A;  1CWP A;  2DBI A;  4CCE A;  5A70 A;  5BNO C;  5FR3 A;  5FYM A;  3DYM A;  2IZW A;  2WZE A;  3J7L A;  2R32 A;  3FFZ A;  3LOI A;  4OHW A;  1CES A;  4LIU A;  1JOP A;  5E1R A;  5FK7 A;  3VZO A;  3ZFE B;  5FOJ B;  2B45 X;  3WOG A;  3WHT A;  2EXH A;  1POQ A;  1GZC A;  2JDY A;  5FZB A;  3U1X A;  5I0S A;  3H8O A;  1VMJ A;  3M3O A;  1SMV A;  4BQ1 A;  3NKG A;  4IEZ A;  4A3X A;  3FX3 A;  3TWI A;  5A33 B;  1MPX A;  4JVA A;  4CA9 A;  5I8Y A;  1WA6 X;  2JDZ A;  2YV8 A;  1GWM A;  3O5S A;  1HRV 2;  1W2N A;  3GAL A;  1ND3 B;  5F39 A;  5AFB A;  4CDX B;  3J9S A;  2C26 A;  4N7I A;  3J26 N;  5LB6 A;  2WNU C;  4DQA A;  4N43 B;  4CVU A;  5CG9 A;  5CKQ A;  1IPK A;  1XXN A;  1UZY A;  5FUN A;  5KWR A;  1POV 3;  3RYK A;  3E97 A;  1H0B A;  4HET A;  2EAL A;  2GNB A;  5KHG A;  1A6C A;  3VZL A;  2R07 3;  1CAX A;  1US2 A;  4JDO A;  2D93 A;  1QJU 3;  1Z78 A;  1O5L A;  3TN9 3;  4DXZ A;  1UXZ A;  1PZ8 A;  1UL9 A;  2WC2 A;  2P3K A;  4RD7 A;  1V6N A;  4NIH A;  3NNJ A;  4TLF A;  1PM4 A;  2XOM A;  3ROU A;  3WW3 A;  4R9C A;  4XQ4 A;  4IV3 A;  4CDQ B;  5GZC A;  3CJI C;  1PK6 C;  3EMR A;  2VQA A;  1VLN A;  3B9C A;  1VBD 3;  1DQ5 A;  3MLL A;  5CB7 A;  3VB9 A;  1SAC A;  4JQT A;  1BBT 3;  2GC3 A;  3A21 A;  4MZU A;  4YNI A;  1D0G A;  4OI4 A;  1F9K A;  4HN1 A;  3RNS A;  3M2M A;  2VTF A;  4XFG A;  3U37 A;  4KQ7 A;  5H9Q A;  1V6M A;  4HON A;  2QZ3 A;  3G6J B;  1HQW A;  2FMY A;  5E8A A;  3ETQ A;  4QPG A;  3V0B A;  4LBJ A;  3THT A;  1H2M A;  5SV5 A;  4GXL A;  1OLM A;  4LIT A;  4BK4 A;  1MS8 A;  5FZ1 A;  1RUI 2;  3TAY A;  4NN0 A;  5J98 B;  3UKN A;  3WNO A;  1OUS A;  3J8F 3;  4UT5 A;  2X8K A;  1SCR A;  2WSU A;  2W92 A;  1XYN A;  4UFH A;  3CZU A;  4LBO A;  1RTV A;  1EUT A;  1P8J A;  4Y22 A;  4NRQ A;  5FKB A;  2WS9 2;  3MI8 A;  4PT6 A;  1SEF A;  2DUQ A;  1JYV A;  5KXE A;  2J22 A;  3ZR6 A;  3RZH A;  3LPF A;  5EYX A;  2VMG A;  4BMB A;  5FMO L;  4NRM A;  3ZFG A;  1S55 A;  2PEL A;  4RQP C;  4HSL A;  5JXJ A;  2JDU A;  1ULO A;  3ILN A;  4XIK A;  4AGV A;  1ZRD A;  5FZL A;  2GAL A;  2VMH A;  2ZX1 A;  4CDW A;  1CPN A;  2L9L A;  3AZZ A;  3GDB A;  3OY8 B;  3OTF A;  3T4V A;  3E6C C;  2WZR 3;  5C8C B;  2MNG A;  3LKJ A;  5JMO A;  1PVC 2;  3DGT A;  4LKE A;  2QBX A;  5JOX A;  3JUU A;  4QX7 A;  2K2S A;  4XF1 A;  1NG0 A;  2R1D A;  3U14 A;  4AFD A;  1XOY A;  1AYN 1;  2C4X A;  4PBO A;  5A1F A;  2ZMK A;  4R9D A;  2R7E B;  4KG0 A;  1UCX A;  3HQX A;  5EJ3 A;  2C5D A;  5A7W B;  3PJY A;  3BUC A;  2WO2 A;  4YG0 A;  2WYS A;  1WW7 A;  4OLL A;  3MIH A;  1GLH A;  4CPB D;  1F8V A;  3LCP A;  4XDO A;  1NUK A;  1W8Z A;  3WV6 A;  1X8E A;  2PAK A;  3AKT A;  2W1W A;  3NAP B;  1RUH 1;  4JTN A;  1DP0 A;  4CCJ A;  1U5Y A;  4ATF A;  3I2O A;  3VKM A;  4L99 A;  1BK0 A;  1RUF 1;  4P14 A;  1KJL A;  3J8F 2;  3VDC A;  3OPZ A;  1VAK A;  1RYY A;  1CQ9 A;  4TZD A;  2UUR A;  4C90 A;  4XZP A;  2CGN A;  3OEA A;  1VP6 A;  2R04 3;  1S0J A;  4D69 A;  4XMI A;  4IET A;  2GMP A;  1V9U 3;  4WZF A;  3RYR A;  1XBF A;  4Q8K A; 
#chains in the Genus database with same CATH homology
 5F37 A;  5F5C A;  5FZI A;  3OPT A;  2P5B A;  4E4H A;  3PUS A;  5FBJ A;  2OT7 A;  5FZC A;  5FPB A;  5A3T A;  2YU2 A;  5IVE A;  2YBS A;  5A7Q A;  5F3C A;  5FUN A;  5FYZ A;  4QU1 A;  3AL6 A;  5FXW A;  5ANQ A;  4D6R A;  5ISL A;  5FZ3 A;  5FZO B;  3LD8 A;  4IGQ A;  4BU2 A;  5IVV A;  2YPD A;  5F3E A;  5FYT A;  4LIV A;  5FY5 A;  5FP4 A;  2OQ7 A;  3OPW A;  5FZK A;  4URA A;  3PTR B;  5FY0 A;  3K3N A;  4CUG A;  4QXC A;  4GAZ A;  4Y3O A;  3KV6 A;  5F2W A;  5FYV A;  3N9M A;  3PUA A;  4QX8 A;  5FXX A;  5IVF A;  4GJY A;  5FYH A;  5IVC A;  2GP5 A;  2GP3 A;  5FJH A;  3K3O A;  5FZ0 A;  3PUR A;  3AVS A;  2XXZ A;  4BXF A;  4D6S A;  5A3P A;  5IW0 A;  2XUE A;  2WWU A;  3DXT A;  3N9Q A;  2Q8D A;  5KR7 A;  5LW9 A;  5FPL A;  5A3W A;  5FP7 A;  4ASK A;  5FV3 A;  4HON A;  3ZPO A;  5FWE A;  3N9N A;  4BIS A;  4CCK A;  4QXH A;  4XDP A;  2PXJ A;  2WWJ A;  4LIT A;  5FYI A;  3PUQ A;  5FZ1 A;  5FZM A;  4AAP A;  5FZE A;  5F3I A;  5A7W A;  5FYC A;  3PDQ A;  4Y33 A;  3U78 A;  4DIQ A;  5FPU A;  5FZ9 A;  5LY2 A;  4CCN A;  5FYB A;  2YBK A;  2YU1 A;  3KVB A;  3AL5 A;  4V2V A;  5IVB A;  5IWF A;  5FY9 A;  5FZG A;  3K2O A;  3N9P A;  5FY8 A;  4C8D A;  4UF0 A;  4D6Q A;  4EYU A;  4CSW A;  4TN7 A;  3PU3 A;  4V2W A;  5FZH A;  5A7S A;  2W2I A;  3PU8 A;  5F5I A;  5FXV A;  4DO0 A;  5FP3 A;  5FZ6 A;  2OQ6 A;  5FUP A;  5A1L A;  2OX0 A;  5FZD A;  5FZL A;  3KV9 A;  3UYJ A;  5FPV A;  5A80 A;  3U4S A;  5FY7 A;  5FYU A;  4GD4 A;  2XML A;  5FXZ A;  5K4L A;  4QWN A;  2OS2 A;  5FY4 A;  4CCO A;  2Q8C A;  3NJY A;  5FJK A;  5FZO A;  4AI9 A;  5FYY A;  5FP9 A;  4QX7 A;  4EZH A;  5FZF A;  5A7P A;  4LXL A;  2XDV A;  5A1F A;  3KV4 A;  5FZ8 A;  2Q8E A;  4QXB A;  5FP8 A;  3ZLI A;  2VD7 A;  4GJZ A;  5FY1 A;  5FYM A;  3N9L A;  5IVY A;  5IVJ A;  5A3N A;  5A7W B;  5LWB A;  2YBP A;  3KVA A;  4LIU A;  3KV5 A;  5F2S A;  4XDO A;  3AVR A;  4HOO A;  5FZ4 A;  5F32 A;  4NUB A;  4CCJ A;  5E6H A;  5FZB A;  3DXU A;  5F3G A;  3N9O A;  5A7O A;  1VRB A;  3RVH A;  5FYS A;  5FZA A;  4Y4R A;  4UF0 B;  4CCM A;  5CEH A;  5FPA A;  5FZ7 A;  5A7N A;  4IGO A;  5F5A A;  5FWJ A;  5F39 A;  4IGP A;  4EZ4 A;  3LDB A;  5LY1 A;  4CCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...