5FZ9A

Crystal structure of the catalytic domain of human jarid1b in complex with maybridge fragment thieno(3,2-b)thiophene-5-carboxylic acid (n06263b) (ligand modelled based on pandda event map, sgc - diamond i04-1 fragment screening)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
462
structure length
440
Chain Sequence
b'SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDAIIEDEALETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRMNALKLRAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with Maybridge Fragment Thieno(3,2-B)Thiophene -5-Carboxylic Acid (N06263B) (Ligand Modelled Based on Pandda Event Map, Sgc - Diamond I04-1 Fragment Screening)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 144
structure length 440
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fz9A01
4IGOA 4NUBA 3PUSA 3K3OA 5FY9A 5FPVA 5FYTA 5FZBA 4QWNA 5FY1A 5FXWA 5LY2A 4BU2A 4CCNA 4GAZA 5A7PA 5K4LA 5FWJA 5FPAA 2XDVA 3KV9A 3ZLIA 3AVSA 5F5IA 5A7WA 5FZ0A 3RVHA 5E6HA 4GJYA 4GJZA 4QX7A 5FYUA 5FZ4A 3ZPOA 3DXTA 2GP5A 5IVBA 5LWBA 4TN7A 4URAA 3DXUA 3PU8A 4BISA 3N9OA 3PU3A 4UF0A 4QX8A 4CCLA 5FYCA 2Q8DA 2YPDA 5F3IA 4EYUA 5FV3A 2GP3A 4LITA 5IVYA 5FPLA 4AAPA 5A7OA 2PXJA 5FXXA 5LW9A 5FY7A 5FZ1A 3N9PA 2XXZA 4DO0A 2OX0A 5FP3A 4QXHA 5ISLA 5FBJA 5FJHA 5FYMA 5FP4A 4Y3OA 5FUNA 5IW0A 5A3NA 5F2WA 5A7WB 5FZ3A 4CCJA 4Y4RA 5FZEA 4C8DA 5CEHA 4HONA 3KVAA 2YBSA 4BXFA 2OQ7A 3OPTA 4AI9A 5A3TA 5FZ9A 3N9NA 3KV6A 4CCMA 4D6RA 5FZIA 4QXBA 5FXVA 5ANQA 5FZ6A 4UF0B 5A3PA 2OT7A 3LD8A 5FYIA 5FP7A 5F3EA 2OS2A 3AVRA 3N9QA 5FPBA 5FXZA 3UYJA 3AL5A 4V2VA 3K3NA 5FPUA 1VRBA 3N9LA 5FP8A 5FYZA 5KR7A 4GD4A 5IVCA 4QXCA 2Q8CA 5FJKA 4LIVA 4IGPA 4D6SA 3PURA 5LY1A 2YBPA 3KV5A 3KV4A 3PUQA 5A7QA 5F32A 5FYBA 5FZFA 4ASKA 4CSWA 4IGQA 5FY0A 5A80A 5FZ7A 3AL6A 3NJYA 5FZ8A 5FZOA 5FZOB 3U4SA 2XMLA 4LIUA 5IWFA 5FY4A 2YBKA 4EZ4A 2WWUA 5FZAA 4CCOA 4XDPA 2WWJA 2YU2A 3PDQA 4LXLA 5A7SA 5F3GA 5FUPA 5FZHA 2Q8EA 5FZCA 5FZKA 3OPWA 5A1FA 5FYYA 2P5BA 3PTRB 5FYSA 3N9MA 4E4HA 3U78A 4D6QA 4CCKA 4QU1A 2W2IA 5F39A 5FZGA 4DIQA 5IVVA 5FZDA 4EZHA 2XUEA 5FYVA 2OQ6A 3PUAA 4V2WA 5A3WA 5F5AA 5A1LA 5IVFA 5F37A 3KVBA 5FY5A 3LDBA 5F5CA 5IVEA 2YU1A 5FYHA 5FZMA 5FY8A 5FP9A 5FZLA 5A7NA 4HOOA 5F3CA 5FWEA 5F2SA 2VD7A 3K2OA 4Y33A 4CUGA 5IVJA 4XDOA
chains in the Genus database with same CATH superfamily
1G8WA 3JD71 2GN7A 3F2ZA 1RJ7A 5FYTA 3WW2A 5APAA 5EJ3A 4BQ5A 5LY2A 1DZTA 3T0BA 3DPRB 4Z82A 4DPNA 3G7DA 5GZFA 3DF0A 4XJWA 1CPNA 5HXMA 4GA9A 1COV3 3AMQA 1OH3A 4X8PA 4YZ2A 4QPWA 2VZUA 5FMOL 5CKNA 1YQ2A 4XABA 4QX7A 1GSLA 3VD7A 4AW7A 1NXD1 2RDRA 3OB8A 3LSDA 4JX0A 1URXA 5J98B 1ULGA 1EAH2 1FYUA 3PU3A 2FDJA 5IK5A 4IEOA 4Q0QA 1ST8A 3RQ0A 2RR12 1FT9A 1F4AA 3POWA 3OG2A 2MEV3 4LO7A 2JIJA 5DDJ3 1N3OA 4UW6A 1CAXB 1KEXA 3M3OA 3VBOB 4BWOA 2HWD1 2O8OA 2XKPA 5FKBA 5LEKA 2UY8A 5FREA 2JD9A 4EWDA 5BY5A 1RMU1 5FZ1A 1JYVA 1J1LA 1RXGA 3FE5A 1QY4A 2J1RA 5GLZA 5IFTA 4L99A 1AL21 3IM0A 3NVCA 2H6CA 5JOYA 1WGPA 4UW5A 3KM5A 1ASJ3 5C3PA 4JDMA 3PLQA 3TN93 1GNYA 3OSDA 1ENQA 5KXDA 3WNPA 3KT7A 1X82A 3N9NA 4LKEA 4QKBA 5FZ9A 4QXKA 1K42A 1ULFA 3WEZA 2PQQA 1HRI2 5IHRA 4UF0B 1EY2A 4U36A 4XIKA 4XCBA 1ZBE3 3H1WA 2HWF3 4RS5C 5DN2A 5FP7A 2E33A 4JHZA 3DKWA 4XXAA 2XOMA 5D8AB 1ZNPA 1QNWA 4IV1C 1KDMA 1W3VA 3P3PA 3I2KA 1EV13 3MHZA 2WA4A 5KR7A 2Y0OA 1WLTA 4H7MA 5EP9A 2ID4A 3TWIA 1BBT2 3WNOA 2ZS6B 1YFWA 4ONUA 4TLGA 2BJSA 4QHBA 1SZBA 1DG6A 2Q0AA 3FZ3A 3HBKA 4I3GA 2IFRA 5FZ7A 4X6QB 4LIUA 2XHNA 3POYA 5IWFA 1W8WA 3CU7A 5GLWA 1DYOA 2BP6A 4CCOA 4FOQA 1BVP1 4JQTA 3QH6A 2VQ0A 4XDPA 1J1TA 1C3HA 1XBFA 1F5FA 2Q5TA 4LXLA 5AVPA 4AVVA 4LBJA 1N1SA 4J1WA 4JCKA 3H50A 3QH7A 3AKSA 5FZCA 4NWWA 2V73A 5J1XA 4HZFA 4L0PA 1R1A1 3CJIC 4Q4V1 5I91A 4GB31 2WNEA 3MF9A 4GIQA 2WS92 3N9MA 3MV01 4BH9A 2GH2A 4RR3A 4UAPA 3T1MA 1WA6X 2CNAA 2GU9A 2HYXA 4XZUG 1SFYA 1VRH2 2HWC2 4UFMA 1S2EA 2Q4SA 1K5MB 2UYBA 3AZXA 5F39A 3GZTB 5FYVA 3NNMA 2HEWF 3LKJA 1O5UA 4AHYA 2R32A 4I2OA 4JGYA 3KVBA 4NHYA 3PMEA 2VECA 3ZDVA 4CDWC 3N7MA 3BODA 3AFGA 1H2MA 4CDQC 4DY3A 5J7MA 1LHVA 4Y20B 1DFQA 3AKRA 3WUDA 3AKPA 3OEAA 1QXRA 4JGYC 4BMEA 2ZX4A 1A8DA 2WWSA 3OJBA 1CD3G 4G3YC 1YJLA 5JXJA 2HWE1 2OYZA 3VBFA 3K3OA 4QPGB 3ENRA 5EFUA 4DNYA 3WW1A 2WRAA 3VHOA 1J3RA 3MV11 1NXMA 4I0AA 1ZREA 1US3A 5A7PA 5K4LA 2XH6A 1D4M3 1PHMA 5A7WA 1DHKB 3VBFC 3DYOA 4A7KA 2XB6C 2GN3A 4QPYA 3R4DB 5EQUA 2VC9A 3V0BB 1W9SA 3LEGA 4YLZA 3I3MA 2R1DA 4URAA 3DXUA 1NE4A 3KGZA 3FHIB 4IQPA 5FO7B 4I02A 3DUIA 1KJRA 5CFCA 1NCRA 1GICA 3OBZA 5FCCA 4QQ2A 1BKZA 2XJRA 5KXCA 1QH6A 1W6NA 1XPWA 4NIDA 3MICA 1QGLA 1E5RA 1BZWA 3HOBA 4CEYB 4D0QA 3KQRA 4LMFA 2KXLA 3N35A 3T30A 2ZHKA 5C9AA 5CFCC 5FJHA 3ZFEB 3VLBB 2ZZQA 4AVCA 4Y3OA 3HNYM 2D40A 1JHNA 2WO1A 3OUHA 4QD2A 5BV6A 5KHJA 1UMIA 3BIWE 2YBSA 5C9AC 3OPTA 1JUIA 1OUSA 3QOPA 4Q0UA 4GH4A 2R0FA 5J96B 2X53S 4AFAA 1NLQA 4Z92B 1DP0A 3WDWA 1CN1A 1AXYA 4QQPA 3ZYIB 2VNVA 3SEEA 1MQTC 1ODMA 1W6PA 2E51A 5C71A 5KC5A 4GH4C 2J1VA 1OVSA 3Q8BA 4QMAA 3OD4A 5DUVA 4BCUA 5CA6A 4D8MA 4CUAA 4A7ZA 4AEMA 2XBO3 2PHTA 4P00B 1VMHA 4QX0A 4D3WA 5GALA 3ZIWA 4LHSA 1AYM3 3JD72 3RRDA 3O1MA 4LBQB 5HBAA 3BIEA 3UGGA 2R073 3U4SA 3AL6A 2GDFA 4H14A 3RJRA 4EN9B 3B5LB 2FBEA 5GZCA 1QXPA 2GC1A 4XJZA 3IIAA 5A3LA 1K45A 1GFF2 4BYYA 1RUJ3 2E26A 4Q0VA 3UGHA 3HR9A 3BI3A 3PDQA 1H2NA 1KS5A 1CZTA 2W92A 4GMP3 1XYOA 2JG8B 2CY6A 4JTNA 1YFUA 2J1UA 2N7GA 2VPVA 3MLJA 3RI9A 3AMNA 1X8MA 4K3UA 1LAJA 1DBNA 4YFZA 4B7EA 4GWIA 1VBA1 3ACLA 2ADDA 3FL7A 4Y1YA 2HWD2 3ZYJB 5IVVA 5CISA 1KJLA 2VE1A 3SNMA 2ZEYA 3S0MA 3IB3A 3PUAA 1RUF2 5JR2A 1B35A 1G9FA 4HSJA 3V0AA 4LR4A 5IVFA 1RMU2 1ZYBA 3NQHA 4CDUB 1GOGA 4W8JA 5LBFA 4LO5B 4W6WA 2RDNA 1XYNA 1AL22 1S55A 2YU1A 5CKMA 2QTWB 3APBA 2LALA 2W68A 2RR13 2W95A 5DG2A 2JEMA 1RUI1 3FN9A 1Q8SA 4ZONA 3Q8EA 2EIGA 3W59A 2VNRA 4C91A 1RUG2 4NHMA 4CP9B 3VZKA 4FTSA 3A4UA 1DDLA 3C7HA 5CYYA 1QJFA 4L97A 5F6LB 3AZWA 2XLGA 2H6BA 1GZWA 5CFDA 2XJVA 3MUZ1 2LM3A 3LPFA 1OQEA 3GJAA 4TXWA 4BQ3A 2YGMA 1XE7A 4IE6A 4PIZA 5F7UA 2VZSA 5C3QA 2GZWA 4XUTA 1H4GA 1LOAA 3R4SA 4F83A 4JRAA 3MI8A 4J6GA 4MVTA 4Y22B 1OF4A 5CKQA 5A3OA 5FYCA 3GZAA 4PT6A 2YDEA 1REEA 1ULCA 2VZOA 2Y6HA 3MW4A 2Z69A 1CX4A 2PYTA 4GWNA 1QEXA 4LITA 1IS4A 4LK7A 1AR61 2VUJA 4OHYA 5IAVA 1S2KA 2R1BA 1UF2C 4XHXA 4PHZA 2P6CA 4I09A 1BBT3 1UWWA 1VBE2 1O91A 3WF2A 4AG4A 4Q4V2 1R1A2 1PZ8A 2HWB3 4GB32 4IXLA 4FPFA 3RI8A 2WUHA 4CU7A 4S2FA 4AK3A 1PK6C 4CCJA 3KD4A 4D7YA 1O4TA 5CEHA 4FTBA 4BPZA 2UY9A 1SACA 3MO4A 1TMF1 3DEMA 3UKVA 4D6RA 1ZRRA 5ABJC 3R0RA 5FLIA 3LD8A 3EJKA 4ARXA 1QDCA 5FR3A 1DQ2A 3I49A 2Y0IA 3AL5A 1SFPA 2JXAA 2V72A 1UOJA 1MS8A 2A6YA 4BQYA 1H6XA 1H9WA 2WS93 3J7MA 3N9LA 1RUH2 2PHFA 3ON7A 3DCQA 4LNVA 2DCYA 4XFFA 4YVSC 3VBSA 2ILMA 3C8XA 4CUCA 1VRH3 5FDBA 2ARBA 2HWC3 4NIHA 4KG0A 1ALYA 3KV4A 3KV5A 2Y6FA 2HWE2 4HPKA 4XVHA 5BNNB 3TBDA 2BW8A 2I74A 5CZKA 1ACCA 3FHAA 4AYUA 4CDXB 1NKGA 3WQ1A 3BOWA 2WWJA 3M70A 1AHSA 2HEYF 2Z5WA 4CRQA 2Y8KA 3VBRA 3N4MA 1ND2A 3VBHC 3SCGA 3POFA 4MHUA 5JDBA 2W52A 4XUQA 5LASA 5A1FA 1YQCA 4CU6A 1KDKA 4K8FA 4CA9A 3IDCB 3DPRA 1L7QA 1IPJA 2D5HA 1QJY3 4H55A 2DTWA 3BCWA 3KHBA 1GZ9A 3ACGA 3LSEA 5C3SA 2QZ2A 2OXBA 4EZHA 2R6QA 2XUEA 3WT3A 1WMXA 3ZXJA 4FAGA 1MS9A 3DYPA 4LORA 4QQLA 1YFYA 1GANA 2XWJB 3JCIA 4UXAA 1QIQA 1CAUB 2AGSA 1WCUA 4WVZA 1JU4A 5JVVA 1POQA 1HQNA 4K40A 3VKMA 4BQWA 1OSGA 2RDQA 5C4WC 1XE0A 2ZGLA 4MOAA 3VBOA 2XJUA 4AVBA 2O14A 2JX9A 5AC91 2YY1A 1I6XA 1BMV1 2X05A 2SBAA 2VVDA 4IGOA 3TAYA 3TEXA 2VO5A 4XBLA 5FZBA 3U1XA 1OD5A 2JG9B 2P4EA 2QCSB 4LUKA 5FY1A 5JIUA 4DMIA 3U14A 3VBOC 1HW5A 4YARA 2UWAA 3OYWB 4DFSA 5F8PA 3WNNA 4V1PA 4K1ZA 1GP4A 1ND3C 1DIWA 3VDBA 1ZZBA 3WF4A 5FZ4A 1XC6A 1SBFA 3SISA 2GP5A 2HBUA 3E5QA 1NA1B 3IBMA 5LWBA 3A0KA 1I5PA 1EPWA 2D44A 1KGYA 4LPLA 3VD5A 2BWCA 3ZKUA 4UF0A 3CJIB 3PVNA 3ECQA 4FFIA 1IS5A 4XFIA 1UKGA 2VUCA 5D8AA 3HVDA 4Q4W1 2TBVA 3C7EA 4HKWA 5IVYA 1G9CA 2PN5A 4XAAA 3ZSLA 4GWMA 2RM21 5LK7B 1DYPA 4Q4Y1 5T5LA 2PHWA 4IEPA 4Q1RA 1HQLA 1JUHA 5LW9A 3LDRA 2D6MA 1O8PA 3N9PA 3ZFFB 3FLPA 3T2QA 4AL9A 3JD73 4R8HA 2OKXA 3ZFGB 4KWUA 4B3NA 4DUXA 3I3BA 2UWCA 4JGZC 5LRSA 3I97A 3L2HA 2J7MA 3K48A 2RS31 5ANNA 5CBLA 4YW6A 4BK4A 2VBBA 4FXGB 3VV1A 3HPNA 3ZYFA 3L9JT 1LULA 3SCFA 1OH4A 2WDBA 1O4ZA 2BV4A 2WFF1 3D6EA 3H1MA 3B3QE 3GBFA 5FXVA 3SITA 2ZX2A 2OS2A 5C3OA 1L7LA 5FRAA 2D5FA 1IZ3A 3AXEA 2DU0A 3RZKA 1AUYA 4A7YA 3HNBM 3WX5A 1RUI2 1AVBA 2QZ3A 3DKQA 2HWD3 3H3ZA 1QOSA 1VBD1 4P9JA 4OQ8A 3SHRA 5FYBA 3MIEA 4CSWA 1W03A 3ACHA 3CQOA 4ZY9A 4YZ4A 1RB8G 3NJYA 3I2OA 5FZOA 4OHZA 1W0PA 1ZRDA 4KU7A 2FZ2A 1NCQC 3M7AA 3H8UA 1FV3A 1K5MC 4C0HA 1F4HA 3SCHA 4XBNA 5FPXA 2AEZA 2QFEA 2XJTA 2GALA 1WMFA 2AC1A 3VDAA 2E63A 2B42B 4GKYA 1JN2P 2JDKA 3LEMA 1GZCA 2F17A 5FZKA 3JQXA 1JZ6A 3AYAA 5DDJ2 1KFUL 1RUC1 2DCKA 4RQPB 3ZR6A 1CWPA 2AEYA 5DUUA 4CEWB 2VZRA 5C70A 2XL7A 1VP6A 3H42B 4UYBA 1F31A 1Q8VA 2CAUA 4J1XA 4PBPA 3OGGA 4N9IA 2JB8A 4P9IA 4Z1VA 2XQRA 4QPGC 1QWRA 3THDA 4E4SA 2D98A 2VMCA 2VQUA 5JI9A 2H0VA 2VW1A 3V0BA 2VZPA 4PBOA 3TB0A 1UNBA 3S7IA 5F5CA 1ASJ2 3NNGA 1NLSA 3TN92 1VAVA 2ZHNA 1AX1A 2VNOA 3EQEA 4HN1A 4E4DX 4QU2A 5EIYB 2B4KA 4FPEA 1GMMA 2C9KA 4NMIA 2HWF2 1OA3A 1F9KA 4DB5A 1CJDA 2ZJCA 1SLTA 3FFQA 4B1LA 4DQAA 4MGYE 4CEYA 4DXRA 1OA2A 1EV12 1RYYA 1SBEA 3AM2A 3VKLA 3AMPA 4OUEA 4UFHA 2W08A 1R1A3 4Q4V3 4XQDA 3KV9A 4GB33 4LLOA 3ZFEA 4META 4EWAA 1UZVA 2E53A 1UCXA 4C90A 2V4AA 4FOWA 4BA6A 1WMEA 4GMP0 4LHNA 3W9AA 4AXOA 4F7ZA 3ZN6B 3HQRA 4CE8A 4LULA 4YZ1A 4FTEA 2IXLA 1C57A 2IC1A 4YW2A 5SV8A 1S2BA 1LHUA 4OHWA 4AI0A 1AZDA 1MEC1 2EXKA 1KQRA 2VMHA 3POEA 4OFGA 2BZDA 3ILNA 3K46A 4XILA 3NNJA 2ZACA 2VUDA 2OUHA 4IV3B 3ITQA 4LA2A 1VMFA 2YFUA 3O0XA 2GC0A 3A23A 3FBYA 5A6YA 1EUTA 5K8SA 4LBQA 2HWE3 3CZJA 5FMBA 5FYMA 3FMGA 4P9XA 4DRRA 1D0GA 1FNZA 2IXKA 1O6UA 5IUQA 3GHMA 2RS11 1MZEA 3NSTA 4FFHA 3SH3A 1VAKA 2W91A 2WR9A 3WNKA 4R9DA 2D6KA 1JOBA 2JG8A 1QDOA 3T2TA 1TVGA 5FBZA 3N7JA 2WO7A 4WVMA 2BOIA 1MZFA 2DVDA 2JG8C 3M3CA 3ELNA 3PJQA 2BFUL 2WO3A 4QB2A 2DCTA 1BMV2 2TNFA 4ZZ5A 1IS3A 2X09A 5F32A 4PF5A 5A80A 4KI5M 1SEFA 4QX5A 1WCQA 1Y9QA 5L9VA 3LQCA 3I2IA 5FY4A 3EO6A 4EZ4A 2WWUA 1NZCA 1PNGA 3K51A 1NT0A 1AYN1 4UFJA 2W94A 2UYAA 5H9PA 5IK8A 1AR91 4UW3A 4CDUC 4YW4A 1LOBA 1AR71 1ULEA 1VB4A 4OLLA 3UESA 4CP9A 1H1MA 1CX1A 4IL7A 3WCRA 2DUPA 4Y24A 4I30A 5FKCA 1UW8A 1UZYA 1JI6A 1UQXA 1NUKA 1PK6B 2WZPP 4AF9A 1EYBA 3FX3A 4JKLA 4OCTA 3VHRA 5FZDA 4P08A 2RM22 3WW4A 1H2KA 4DY5A 1CPMA 5EWSA 3SMHA 2VMFA 4IEUA 1POV1 1UU6A 4Q4Y2 5A3WA 2CDPA 5ABJB 3Q8CA 5TSWA 1J59A 1OQDA 4K9SA 2QQLA 4QX2A 5FFOC 4Y22A 3WY6A 5F3CA 3MF6A 1SPPB 2J1SA 4S2DA 3RMYA 2MPFA 3UV9A 1O3TA 1QOTA 4DEVA 1V70A 4YVSB 1CIYA 2WNUB 4K8RB 3ROUA 1LESA 1LOGA 1OOPB 2PMWB 4CUGA 2NP0A 2WN2A 2GSYA 3M4FA 2PAMA 2VJXA 2V5YA 1VAMA 1CAWB 4CXXA 2E7AA 1W6QB 2VCMA 2ARCA 4QHZA 3RSJA 2B8MA 2BBAA 2ZX1A 4Q5OA 1FXZA 1V6OA 2XBO2 4XF3A 5A3MA 5IK4A 1O4YA 1QNYA 4M4PA 3LOBA 1JU3A 3D0JA 3HT2A 1E5SA 2WINB 2R072 3MIDA 1VBA3 4NAMA 5FYUA 4AQSA 3WDTA 4HANA 3T3YA 1VBD2 3VBHB 3WP5A 1YQ8A 4L92A 1Q5OA 1U5XA 3S5AA 1WZXA 1HJGA 3MIBA 3RPQA 5JOXA 2ZGMA 4IE4A 1O59A 2MHFA 1FOD1 1S0BA 2W1UA 5KHHA 5A33B 2GP3A 4YZ3A 4CCCA 1Q8QA 4QKNA 1JW6A 4YWAA 4TZDA 3BTZA 4ZHNA 1RUI3 2L9LA 1OHFA 2XKOA 4A3ZA 1RIRA 4HMZA 5LB6A 4NHKA 3BGAA 4E8CA 4R4XA 3FC0A 5ISLA 2W87A 4MGIE 1FI2A 4A6SA 1IPKA 2JDPA 5FLHA 3ZMNA 5A3NA 4FPYA 5GJ6A 2VMEA 3M2MA 5FZEA 4F8AA 2VTFA 4HONA 5DZFA 3RG0A 1C8NA 2QQKA 3TNQA 5C4WB 1RTVA 5BNNC 2G1MA 3RZJA 3VL9A 4IEQA 4O9GA 1RUOA 3LA3A 4QDQA 1QJU1 2AREA 4QX1A 3ZDSA 3UGFA 4CDXC 1LR5A 1GP6A 2CL2A 3AVRA 3LEKA 3T0DA 1YWKA 3RZGA 3POJA 1YEWA 4BIFA 3HIFA 4WM7B 4XMIA 1YIPA 5HCAA 3B9IA 4KQ7A 3WZ1A 4GD4A 1GOFA 4Z2WA 1ND3B 3W5NA 2JB4A 3IWZA 4UBHA 5IJRA 3HJRA 3OGJA 2YBPA 1AR63 5A7QA 2AYHA 4ASKA 3MYXA 4WZCA 2ZGUA 4E2SA 1A6CA 1J83A 1TNFA 1CAUA 2ZX3A 1HKDA 1V9U1 1W99A 1XB9A 2YBKA 4RS5A 4YFWA 5DZGA 5FZAA 1DGWX 5KHIA 4SLIA 2X29A 1HRV1 3MLKA 4IV1A 4XCAA 5JR7B 3ZO0B 1VMJA 2Q8EA 3A0NA 3VBUB 3BKZA 1GP5A 1DF0A 1TMF3 1SHWB 4RGGA 1V6NA 5DQ0A 2VOVA 2VXJA 3WDXA 1MEC2 4NPRA 2NMNA 3CEWA 4JGZB 2QJVA 3OYWA 3WOGA 1N1TA 1H6YA 1YI7A 4OI2A 1LOFC 4DIQA 2J1AA 1PVXA 2ES3A 2HWB2 5A1LA 1JZ5A 2JG9C 4K21A 3VDDC 2OPKA 3GM8A 1US2A 3OBRA 2CGOA 2IXCA 4RL7A 2Q1ZB 1X50A 2A1XA 5FY5A 3CNAA 5FY8A 3CJIA 1AX0A 2E7QA 2QNKA 3TEYA 3VHNA 2TUNA 4NAOA 1R081 1WLWA 4YGCA 1HJFA 1NA1C 3DL3A 4DUWA 4BOWA 1ZA4A 1TNRA 1X9PA 1LGNA 2EALA 4NUBA 5KWRA 4XPVA 3ZSEA 3FWEA 5LK5A 3AP9A 4O7XA 3POBA 5LRRA 4Q8KA 3RZHA 4GAZA 4CPBA 3ZFGA 5I8SA 1NCQB 3PIJA 3AVSA 4CDWA 4CDQA 5L7OC 2A5ZA 3S7EA 1WCKA 3WLUA 3B7MA 1XXNA 3ZFFC 1ZRCA 2WJSA 1O3RA 1OLMA 1PGL1 3ZFGC 2WT1A 4P14A 4ZKTB 4MSVA 1LEDA 5DUWA 4DXTA 1PZ7A 1UU5A 1WD3A 4QX8A 4BQ2A 2JWPA 2D3SA 1Y43B 3VDCA 2Y6KA 2VH9A 4XTPA 2PAEA 2D3PA 3FBMA 5FMOS 5K0UB 1IQDC 1BJQA 2A6XA 2VM9A 1SDWA 1OA4A 1AYN2 2QQWA 4L11A 3VN4A 4UW4A 4E2QA 1W0OA 4KG8A 5A6ZA 1QU0A 2WZR3 1AR72 1RUD1 2PFWA 1QJY2 5AC93 2JKBA 3GGLA 5B2GB 2QQOA 5FP4A 3U10A 1C5HA 2ZGNA 3GCWA 1TZOA 3M3QA 5EYYA 3UKNA 3ZM8A 2BOJA 3RFRA 2FDFA 4W65A 4AI1A 4BXFA 1UMZA 1VBC1 2YGLA 1MS5A 2ZEZA 1Y9GA 3U75A 4MZUA 3WDVA 3WXPA 4E8DA 4PI2A 2W1QA 4MXWB 3ABZA 1UYZA 1SFNA 4Y4YA 1H9PA 5E89A 1J84A 1W2AX 3D5OA 4FPOB 3WF3A 1LOCA 3FUOA 2FDGA 4WVWA 1PM7A 3WP4A 4Q4W3 3JBG1 5FJKA 3NAPC 2DVBA 3HAGA 1JOJA 4JAAA 2RM23 1D7PM 4RQPC 3K77A 4Q4Y3 5E16A 4KU8A 1PMIA 2C0ZA 4CEWC 1AR83 1DQ5A 1SBDA 2XG3A 3AP7A 2XMLA 3GXUA 1O3QA 1AX2A 1GUIA 1UX6A 3SC7X 4BZ4A 4XACA 4NIAA 5K7PA 1MQTA 3WQ7A 1MS4A 3HWJA 1JYIA 3DV8A 2RS33 1SCRA 4WVVA 4JRLA 3WP6A 3MIFA 4O65A 1SLLA 3ZKYA 4CYDA 2WFF3 1TME1 3RYPA 1JOPA 3O7OA 1W8UA 5T5PA 4JHTA 1RUNA 3I7DA 1S0GA 3NWKA 4Q29A 3ZN4A 2VOTA 3KCCA 3JU9A 3ME2A 2DDUA 3POIA 1LEMA 1DQ4A 1RL3A 4UWDA 3O0WA 1W8NA 3LOIA 4TYSA 3ZN6A 2QQPA 1VBD3 2D3RA 2QQJA 1RJ8A 4C1WA 3LDBA 3B69A 1YNAA 4YW3A 2G9ZA 2ZABA 3ZXKA 2GNDA 5DABA 4XJAA 3D3AA 3K2OA 1D2QA 1WW5A 5IVJA 3VD9A 4PQQA 2JDAA 5JMOA 3C2UA 2BBVA 2A6WA 3IMMA 2WT0A 1LODA 4PLNA 2VOWA 4IV3A 2DTYA 3S57A 3M3IA 1QJU2 1XSQA 4CCNA 3VZOA 4FXKB 2YC4A 3HQUA 4Q26A 3ZYHA 4W50A 4YPJA 3GF6A 1F5JA 3E5UA 1RUC3 3OY8B 3PIGA 3C7GA 2NLRA 3LFMA 4IV3C 5EZWA 3TEWA 3KT4A 1DQ6A 2UWBA 4NRQA 4BQ1A 2DFBA 2E31A 2O1QA 2WNVB 1UAIA 1X33A 3ES4A 1A78A 1CONA 1W6MB 1MS0A 2YB7A 1VIWB 3KQ4B 3N9OA 2HJIA 1W3XA 3DGTA 1V9U2 2Q8DA 4QM8A 1J3PA 4JC1A 1U5IA 2SLIA 3AZVA 5HCFA 4Q4X1 1LU1A 3M3EA 3WQ0A 3I3QA 5L9RA 3USUB 3QCWA 1HRV2 1N47A 3CLPA 4XF0A 4XW3A 1W90A 4JZRA 3WINE 1A34A 3AKQA 1SLCA 3IAQA 3HN1A 2UU8A 1P8JA 5FY7A 4Z8BA 1FV2A 4L9BA 4N53B 4PDWB 3H9AA 1DZQA 4LBNA 2WFPA 1PO11 1UD1A 2VCBA 1HV1A 2NMOA 3INAA 1YRZA 2KM2A 5BYNA 5CAZA 2WSUA 2O0OA 4JV4A 3T1LA 1W8OA 4MHRA 5AVAA 2B46X 4IERA 3O1UA 2DVAA 2EAAA 1V6LA 4N7IA 5F3EA 3BTAA 4NWVA 3I59B 4PF1A 4KGQA 1V6IA 1T6BX 4ASLA 4LTAA 4CP2A 1Z7S1 1UYYA 3I4IA 2GAUA 3NV2A 4IEWA 1MEC3 4QXCA 1R082 1PK6A 2ZGKA 4FI9A 1GQHA 2R7EB 1LU2A 2BNOA 3AYDA 3J7NA 5E8AA 3ORJA 1V6KA 4HKOA 2RMU1 5FZ8A 3QLQA 5ABJA 4COZA 4Q8LA 2X8KA 1JZ8A 1SPPA 1VR3A 4KBBA 1YI9A 3DECA 4CU9A 2B5HA 4YVSA 2RS13 2DYCA 3KSCA 5JCTA 1BVVA 1ZA7A 1PGL2 2X5IC 2A3XA 4TWTA 3KLSA 3CBNA 3IT8A 2P5BA 4E4HA 1CAWA 3CIHA 5FMCA 2VOKA 1W6QA 2WABA 2WNUC 2W39A 1OOPC 2ZAAA 3HNMA 4P5YA 4R52A 1IS6A 5IT6A 3UL2A 5HI0A 1KFXL 3H7YA 2GNBA 4UI9L 1L3JA 4QQHA 4ZZ8A 1GU3A 2HH9A 2YFZA 4HKLA 1RUD2 1OPOA 4M3CB 3VBHA 4PLMA 5IATA 4LO6B 1LKNA 4KWKA 4MGSA 4AE2A 2ZEWA 4XF4A 5FYHA 1H2LA 5FZLA 4IE5A 3VHPA 5KXBA 4PIXA 3PUIA 4X8NA 4ATEA 2ZAHA 5C5TA 4AWDA 5A33A 4D7TA 1CGPA 1D0HA 1MVEA 2CHHA 2YPJA 2ZKNA 4JKKA 1F2NA 1AYN3 1XNTA 2NM1A 2VOXA 2ZTNA 3BU7A 3C7FA 4XJUA 3V64A 3WCSA 4COYA 5FOJB 1AR93 1GNHA 4I01A 1FAYA 5JSRA 1AR73 3NNFA 5FPAA 3ZLIA 4C0BA 5HPOA 3ZIXA 2XVKA 3E6DA 2JDHA 4HG6B 4G9SB 4GJYA 3WD5A 4FPJA 5C4WA 2IWGB 3OD0A 4QGNA 3S6PA 1UIKA 2VZ3A 3OEBA 4TN7A 5JSOA 1GZTA 1POV3 1NQJA 4BQ4A 4NOTA 3AP6A 2LUWA 4LA3A 1CAXA 4LO8A 3ZYPA 2WZR1 4EN8B 5KHGA 4WM7A 2AACA 3LFIA 2Z42A 1U5YA 1UZWA 3D4KA 2AR6A 1ND3A 2W47A 1OLME 1IGOA 3VDDB 1XQNA 3R4UA 1V6MA 2GNTA 2QQMA 1HB2A 1TME2 1LHWA 2VQAA 4WM7C 3O1RA 4W6XA 2QDRA 1UY0A 3GCXA 1QQP3 2G4IA 2Y6LA 2VTXA 3LPGA 3UJQA 1JZ7A 4FPHA 1RITA 4DINB 3H8OA 1XE8A 4LT5A 1QJX1 3A21A 1UY3A 4JQRA 3CHXA 2P37A 1KRIA 5CVRA 2DVFA 2PTMA 1Q8PA 1IG0A 2ZGOA 2J1TA 4AEDB 4AVTA 1G9DA 5T52A 4Y5Z0 1C4RA 3IN9A 4OUMA 3J7HA 4QHOA 2R061 5FYZA 3B9CA 5IVCA 4JGZA 1IG3A 5L7OB 3VBUC 4RHV1 1FOD3 1AR81 2VVFA 3HT1A 4LIVA 2DWRA 4AQ6A 4IEYA 2QQVA 3AJZA 3NV4A 5H9QA 2BU9A 1U5ZA 2RS51 4FP3A 4AI3A 4YSFA 3J7LA 2GC2A 4CXWA 2J42A 3AMMA 1JXNA 4FFGA 2A6VA 1VBA2 4XZPA 2AENA 1UXXX 3CJXA 4YW1A 2WBKA 3WF0A 1V0AA 1KXGA 5J36A 2BPA2 1ENRA 4XDQA 5C8CB 1RVF1 3LF7A 3OBTA 4XOGA 3VZJA 4ES8A 3FFZA 3OPWA 4YGDA 5H9SA 3GBWA 1QJU3 1AF9A 1H8TC 4RR3B 2CTVA 4AGVA 4D6QA 1Q3EA 3JXSA 4LKSA 1NCQA 2IVJA 3ZXFA 1K5MA 3JZVA 5HCBA 2P6HA 4XAEA 5T50A 2P17A 3HMYA 3K75B 1W8FA 4WZFA 5DAVA 1A8MA 2XUMA 5EPAA 3R6SA 1SMVA 3TYJA 5ACA1 3WG4A 5JPMB 3H8RA 4M0NA 1VLNA 1U0AA 3LA7A 4ZXEA 1W6OB 3CKHA 1PO12 3DYMA 3I2JA 2GMPA 4NVPA 4Y1ZA 5F6KA 1PVC1 4Y20A 4QPIB 5A6XA 1V9U3 4XETA 2BNNA 4JKMA 2VZTA 1FMD1 1JH5A 5A7SA 3E97A 1KITA 2R16A 1HRV3 3NAPB 4HK8A 4M0HA 4OYUA 3TRSB 5KBFA 5A32B 1HLCA 4QPGA 4NPLA 3GHNA 5JZGC 4XQ4A 4H7LA 4Y5SA 5FXWA 3N7KA 1NY71 5T55A 5K0UC 5G05L 2QQUA 2DUQA 4GQ7A 3EBRA 3SH4A 1D2SA 3F95A 1WA4A 3SLIA 2EF6A 1AR62 3RVHA 4N8MA 4I0BA 1W39A 3BPZA 1DGWA 4CTEA 5B4NA 1JYNA 3VKOA 2YXSA 4QDSA 4AZZA 4EE2A 3MBWA 4XFBA 4MXWA 4PI0A 2C9AA 2VZVA 2Z4FA 1JYCA 3Q9OA 4CCKA 2QQNA 4NRMA 3OGSA 2YPDA 4RYDA 5LBCA 5F3IA 4CCEA 4QKDA 2WLPA 1UXZA 4XQWA 3UETA 1GOHA 1TMF2 2CV6A 4XFCA 4K6BA 3O0VA 5A3UA 1W6NB 1R083 2W3JA 3T2PA 1OFSA 3FUQA 1SQ4A 1F8VA 1DQ1A 2X10A 1FPN1 1H0BA 2BUKA 2YHJA 3T4VA 2VU9A 3WSOA 2A7AA 1RXFA 2RVAA 2PHLA 3I2FA 1EAH1 3KF5A 5FUNA 5IW0A 2G9GA 5F2WA 5FZ3A 2ET1A 1I3HA 1HIXA 2CDOA 3C7OA 2WYFA 4FOVA 1H30A 2D7FA 4BJ0A 2B9UA 2P1BA 5JUVA 1C8M1 4GALA 3BVCA 1HB3A 2VY0A 4A44A 4OMCA 2WQ4A 4FT8A 4L2NA 1HN1A 1YQ5A 5FXZA 2R041 1RUE1 5FQ0B 4DXZA 4GKXA 3SQOA 1NAEA 1JZ2A 3BYWA 3JB4C 4MX3A 4LHKA 4M01A 5JIAA 1O3SA 3K4AA 3PVBB 1VRBA 4M3CF 1W6PB 3IKWA 2BVBA 1QH7A 2ZEXA 2ARXA 3E6CC 1FX5A 2P3KA 5CG8A 3UKTA 3WHTA 4AFMA 4AFBA 3L2YA 4HETA 2JJ6A 4RN5A 5LY1A 1CVNA 1M4WA 3WW3A 5BNQA 2FCVA 4FSJA 1HRI1 3B02A 3RZLA 2ZXQA 2C4XA 1RUD3 3EHKA 3P6BA 4GULA 1VBB1 1JZ3A 1APNA 1YLLA 2ZA9A 2ZOEB 3OOXA 3J4UH 1GYKA 5JOWA 4KWLA 1MS1A 4CP0A 1IKPA 3WNMA 2NN8A 2QDNA 5FZHA 4OI4A 3CL1A 3NV3A 2PHRA 1I9RA 1VBC3 2A3YA 3ILFA 4UFIA 2WQZC 3KWVA 4FAHA 3PTRB 5FYSA 2OVUA 2QBXA 4KNCA 3MEPA 4YM3A 4UT5A 1I1EA 4QU1A 5T5JA 2JIGA 1W9TA 2LW8A 2WZR2 3OY8A 3WG2A 4EWEA 4FPCA 1DU3D 5L73A 4AGGA 5AC92 5F1RA 5GM0A 1LGCA 2WA3A 4TSVA 2I2SA 4V2WA 3V0AB 3JBG3 3VZLA 4IEZA 4CDUA 2WYSA 4IDZA 2C26A 4HXCA 2NPIA 3CDZB 4HVRA 4MG2A 1W6MA 1NX9A 2XWBB 2ZMLA 3P1IA 4FPKA 4XIOA 5JLVA 3O1OA 2EA7A 3AZZA 1REFA 1E5HA 4NHXA 4YGEA 4QGLA 1BQPA 2NZ9A 5F2SA 2Y64A 5GLTA 2WNVC 3NRUA 3S30A 1JYTA 3ZMOA 5C6CA 1OKOA 1HB1A 1QJX2 4XDOA 1RGSA 4B4RA 3USUA 2WIIB 2D6OX 4A4AA 3RZMA 1ZRIA 3I54A 5FPVA 1UYPA 1JZ4A 4OULA 2V4VA 2JKXA 4KL1A 4Q4W2 4YW5A 3WF1A 5JXIA 1TME3 2R062 1HX6A 2XLAA 2BERA 4N7UA 3RZZA 4AEKA 4XFAA 4B8EA 1R091 4YZ5A 1AR82 2J1EA 2QE3A 2R49A 1W04A 4N53C 4PDWC 1UYXA 3AB0A 3T08A 3JB8A 1XRUA 2ZMNA 3EMRA 2HEVF 2AH2A 1F15A 2RS52 2X5IB 4BISA 3GJBA 3MIHA 4KH9A 2F4PA 3MZHA 4RA0A 2FDKA 5LA9A 2O8QA 3FLTA 3I59A 2EXHA 3JUUA 2ORZA 1Y3TA 2IZWA 1K5JA 2RS32 2Z2SB 2QQIA 2EIBA 4YG6A 1LNSA 5I0UA 1WD4A 2LTNA 5EJZB 4N43C 2WFF2 3O1TA 1UZZA 2BYVE 1RVF2 3AZYA 4DO0A 1W0NA 2XXZA 2OX0A 4FBFA 1NQDA 1QQP1 5FP3A 4QXHA 4COUA 1SG3A 4Q2FA 4D69A 3WNLA 4QM9A 1OC1A 3NJVA 2A70A 2UURA 3OCPA 4AGRA 3IDEA 5BNPB 2JDNA 1PIV1 4TLFA 3KVAA 2VBPA 1ODNA 5GZDA 4HFSA 2A71A 1PX3A 2PHXA 1S1AA 5F5QA 5ACA2 2FMYA 3A22A 5ANQA 5FZ6A 4XFHA 5T3NA 5A1AA 3UK9A 4BIOA 1T2XA 2BRTA 1GLHA 2E9QA 1NE6A 4XHBA 4A45A 4A2UA 1XNCA 2RG4A 5KXEA 4A6OA 1FMD2 3AX4A 1OURA 4Q0SA 3VBSB 4Q4X3 4IGPA 1BK1A 1SCSA 1H1AA 2JD4A 5BNNA 4CCDA 3H8XA 4CXYA 2CGNA 1POV0 1RUC2 4M3CA 4BQXA 1NY72 1ENXA 4IUGA 5E88A 3V65A 3LAGA 4CDXA 2ZGQA 4SBVA 2B7YA 4AEJA 3S5QA 2BFUS 1JBCA 4B29A 1U12A 1PO13 3FJSA 5F9TA 3LZZA 1PMJX 4HVQA 4RGAA 5DXDA 2V09A 3H1YA 4MYEA 5FUPA 2I07B 3DN7A 3E5XA 2XQXA 1ENSA 5C5UA 3SKVA 1LECA 1UN1A 1ZZ9A 2JDMA 4C1XA 5G04L 4KWJA 1M06G 3ZXGA 1H1IA 2W2IA 5GKAC 4BM8A 1W05A 5J48A 3KCYA 3AP4A 1BYHA 2JDZA 1Z7S3 4EN6B 5FO8B 2EAKA 3EYPA 2GC3A 2XONA 4ISRA 5F37A 1FPN2 5I0SA 1ZVFA 1VB2A 3I2GA 4N90A 2Q1FA 2CWSA 5IVEA 1A3KA 2WZ8A 3I3DA 3ST7A 3PHMA 2RMU3 5FP9A 2CGPA 1OLQA 5D21A 2XVLA 3QACA 3N3HA 2DCZA 4Y33A 3WQBA 1NYWA 3LIHA 2W1WA 2Y6GA 2KD7A 1C8M2 1LOFA 4Y1XA 1RUF1 1ZZCA 4ES9A 5AFBA 2IXIA 2JG9A 3U11A 2R042 3VDDA 1RUE2 4P9GA 3PTYA 3VZNA 1O7FA 5I8YA 1TEIA 3MPBA 4YM2A 5FWJA 2JECA 4Y26A 1E5IA 2Y38A 5F5IA 1EPZA 2C5DA 1C1LA 1QXJA 1X36A 5E6HA 2G9FA 1X9TA 2A73B 3OUJA 4FOYA 4LHLA 5IVBA 1NA1A 4UFLA 3ACFA 1OF3A 1RUG1 2HYKA 3PU8A 4IE7A 2VULA 3RYRA 1UX7A 1W2NA 2OZJA 4MXVA 2EXJA 4P9WA 4CU8A 3D0SA 4AEDA 1VBB2 2DF7A 4MGKE 4OZXA 1H8TB 2RS12 3IDBB 4LKFA 3VKFC 3KT1A 5D2AA 5L19A 2CYFA 1PGW1 1BEV1 5LBEA 3ZYGA 4AVAA 5L7OA 2DUOA 4AHWA 1ULOA 1DQ0A 2G19A 2GMEA 5A70A 1LB2A 3D8CA 4AEDC 3MPPG 5EXOA 3ZFFA 1JS9A 3B93A 1WUVA 1ONAA 5FAXA 2K0GA 3B01A 5IK7A 5LEJA 2RDSA 5FBJA 2GNMA 2VAUA 4NIGA 3VD4A 1SLAA 2FCTA 4XJ8A 5LZ6A 1J58A 2VW2A 5SV5A 4NJ4A 4R9AA 1GWMA 1AJOA 1QF3A 5A6QA 2P34A 4ZU7A 1OXCA 3K4ZA 4AI9A 1OT5A 3KV6A 2ENRA 4AQ2A 4XC9A 5C8CA 1VBE1 4A42A 2FDHA 1Z78A 1ZZ6A 5JZGB 2ET7A 4MH0E 2PLV1 4LUMA 2ADEA 5FPUA 2VUAA 2NYYA 4NROA 1HV0A 4FQ4A 4ZU5A 4Z2AA 1I5ZA 1AR92 5C8CC 3UT0A 2XJSA 4M4RA 1XNAA 2D93A 2Y33A 4NPMA 4D7SA 5DPNA 3NW4A 2P3YA 5FY0A 2ZHMA 4COVA 4RR3C 1YCIA 2HBTA 1PGSA 2BWAA 3MGUA 5FZOB 1UU4A 5I0TA 5LATA 2WC2A 5EV7A 4K20A 3ES1A 4ZPIA 3LWCA 1W6OA 2RJ2A 3W20A 3LEIA 3POGA 2VTXJ 1RUH1 4QPIA 5D1IA 3ACIA 2D97A 4U2AA 1R092 2OUJA 3W5MA 3TNPB 3BTXA 2DFCA 1QJX3 4FFFA 3NAPA 3VZMA 5A32A 2RV9A 1W9YA 3O1SA 3OUIA 4RQPA 4QPIC 2FD8A 2FDIA 3THPA 4CEWA 1LTEA 3OF1A 2VGDA 3FHQA 1OVPA 3T09A 3BN6A 5CG9A 5I8TA 2YROA 1XU1A 2R063 3T4HB 3E1F1 3H3LA 1Y9MA 3KMHA 1RHI1 4RHV3 4CVUA 3HBZA 3ETPA 1HB4A 1GR3A 1QQP2 1SDDB 2YZ4A 1RC6A 1CQ9A 3WDUA 2PQSA 5FUIA 3VUOA 2RS53 4YNIA 3IAPA 2CWMA 3ZPYA 2Y6JA 2VBDA 5HCHA 2BNMA 5C3RA 2VD7A 1PM4A 1WBLA 1OUXA 1PIV2 2C6SA 2VR4A 4JDNA 4XUOA 5C8WA 3D82A 4DEQA 3AYCA 5IFPA 1WBFA 1RVF3 2R0HA 3H7JA 2BTVC 1NCRC 2TEPA 3AYEA 4S2GA 3W21A 1FOD2 1OBNA 2GH8A 2E6VA 1UMHA 4PIYA 4RFRB 4RD7A 1HN0A 4BMBA 1XSRA 1ZBA1 4LE3A 5FZ0A 5I0RA 2ERFA 1D4VB 3PVEA 1X8EA 3DXTA 4XXPA 3ETQA 3ZXEA 1YQ6A 2MNGA 2VCCA 3RWNA 5ACA3 1GV9A 2RHPA 5AFEA 4BLIA 5FQ0A 1CAVB 4DUVA 2CAVA 1PO21 1O8SA 3I2HA 1V6JA 2OW4A 3RNSA 3J8F1 4NE9A 3POSA 3OBAA 5FPLA 1AL0G 1QHDA 4XBQA 3KGLA 1PVC3 3J9SA 4HN0A 4ZS3A 5GLVA 5LCWL 5FXXA 2ZCWA 3O12A 1FMD3 1Y7BA 2K9ZA 3SXWA 1STMA 2A75A 2VZQA 3B00A 4I3PA 3CMGA 4ZU4A 1HDKA 1DGLA 5DG1A 4ISQA 1ZRFA 4GWJA 4OHVA 1XNBA 3Q8AA 3ZSJA 2VW0A 1AJKA 3HD8B 2VZ1A 4R4ZA 2R30A 4LE4A 4EROA 3MW3A 1YO8A 1HXS1 1MACA 2YG0A 5CNAA 2Q8OA 5FYIA 5FO9B 5KHKA 2XGXA 4WV8A 2W46A 3OGRA 3KCXA 1S0EA 4LBKA 4WVMB 4A3XA 5FP8A 2H0BA 1XJAA 3MW2A 1Q8OA 2YYOA 5JSPA 2Q30A 2J22A 2VNGA 5IAXA 1UIJA 4YGBA 1OPMA 1YHFA 4IGQA 4NIIA 2PHUA 5DAQA 5K9YA 1FPN3 1DLCA 1F35A 3CO2A 2CU5A 4BHPA 1PZ9A 5JWPA 4E2GA 3U0ZA 3BU0A 1C1FA 1EAH3 1CR7A 4HSLA 1B35C 4W4ZA 2AUYA 4IW3A 2XVGA 5I0DA 1HQWA 3MFCA 4D94A 1BLZA 3PVOA 4N43B 3RGBA 1LRHA 1BXHA 3X29B 3O14A 3ZR5A 2P3IA 4IEXA 1C8M3 3PL0A 3WDYA 1COV1 1AXKA 2W9XA 4M3CE 2YC2A 5L36A 2ZZJA 1L7RA 2R043 5DAPA 1RUE3 4LBQD 5ERLA 4BXSV 4YVWB 1W8ZA 4F3JA 1N1VA 4BK5A 4PCRA 4UOJA 2DVGA 4FQZA 5FZGA 1PGW2 1BEV2 1WW7A 4ZS2A 3WHUA 4FP2A 4FPGA 3H3UA 2XR4A 1GKBA 4WM8B 3GDBA 2Z79A 1OQ1A 5EYXA 1DYKA 1ZX5A 2MEV1 2QVSB 2X5IA 2YMZA 4FCAA 4LOTA 3PMSA 4XJ9A 5DDJ1 5CFDC 2FCUA 5A7NA 1HRI3 3SH5A 3GZUC 5LA0A 1VBB3 1YJKA 3LB9A 5M0TA 2WNUA 1O5LA 1OOPA 2V5DA 4YW7A 2ZGSA 4B4PA 5H9RA 5C7GA 1W9FA 4FPLA 4HK9A 2HKXA 3ATGA 4QAWA 1ZM1A 2QUOA 5FTTC 1MR5A 3NKGA 4HL0A 5CADA 2EIDA 4QWNA 2WL1A 4UFKA 3WUCA 1W8HA 2BVVA 2ZMKA 3Q8FA 4AR2A 2PLV2 4X6RB 1ASJ1 2XDVA 2LRPA 3USSA 1N3PA 3TN91 5BNPA 1LENA 3P5BA 4BB3A 2VG9A 5BNOB 4QT6A 1LHOA 4XTMA 3ALQA 2P3JA 1ZBE1 4EN7B 2HWF1 3ZOIA 5BNPC 3IPVB 2DURA 4HVOA 1ZZ7A 3WR0A 3VL8A 1EV11 2DBIA 3QD6A 4YM1A 1V00A 3MUY1 4RFT0 5FLJA 2K2SA 1VALA 4JVAA 1OFNA 3V56A 4BLJA 1DGRA 1NG0A 1TQ5A 2GMMA 1PNFA 4QDRA 1VBC2 4H3WA 5A7OA 2OIIA 4ZXKA 2HLEA 4OMDA 1NLRA 3KZ4C 2JE9A 4IEVA 4OHXA 3NJZA 2WNOA 5IYYA 2VMIA 1SLBA 3ASIA 3GYDA 4FVVA 1TE1B 3T2OA 3ZXDA 4ASMB 1OLRA 3SKJE 1AXZA 1LOEA 2BGCA 4ORFA 4YM0A 5C33A 2PHDA 4XURA 5BPXA 3VBSC 4DXSA 4AI2A 1QMJA 4C8DA 3JBG2 4NO4A 2NQYA 1GNZA 1UO9A 2OQ7A 1EP0A 1IQAA 4CP1A 5A3TA 2VL4A 5JPNB 1RHI2 1N1YA 1R093 3ZYBA 2OT7A 3GZEA 2QKDA 1EUUA 3N9QA 3UYJA 3ZSKA 1Y4WA 2E7TA 1CZSA 3K3NA 1GQPA 3N7LA 2A6ZA 2OZ6A 4V2VA 2JE7A 3VBRC 4XF1A 3UNPA 1WKYA 2EVXA 1ND2C 3MLLA 3BB6A 2ETEA 1UOBA 3TEZA 5FPZA 3ZX7A 3PUQA 2Y34A 1YYNA 2PA7A 3DPRC 2JICA 4LBMA 4P5HA 4XEZA 1QKQA 5B4XA 3WNXA 4YYOA 4O9EA 1SLIA 3A7QA 5EJ1B 1WWYA 4XUNA 4E27A 3KF3A 3RYKA 4AHZA 4RS5B 4S2HA 1LGBA 1RINA 1ZBA2 4IV1B 1KS4A 1VE0A 2LS6A 1XNDA 4L8QA 1ULDA 3ZVXA 2WQ8A 2WO2A 3AP5A 4MUVA 4OZOA 2ZHLA 1PIV3 3FLRA 5F3GA 3VBUA 2AZ5A 2DBNA 4EJRA 5LA1A 4LBOA 4OI1A 2K46A 4Y1VA 3BOPA 3ZXAC 1D4M1 2VMDA 1Z0HA 3VGIA 2XHKA 3U78A 4LKDA 1PO22 1UZ0A 5GLUA 3J8F2 2IXHA 2WAOA 1B09A 1MS3A 1NOVA 2ZGRA 4MGZE 1OI6A 3OTFA 5DMYA 5F5AA 4O61A 2F6BA 3THCA 2VXRA 3WP3A 1DCSA 1QJEA 1VPHA 4NHLA 5BUVA 4EN0A 4LBLA 1WCSA 5L9BA 1UY2A 2DU1A 3IDAA 3M8LA 2Q1MA 2FMDA 1CJPA 2D43A 3LGRA 4YG0A 3RDIA 4AHXA 4HBNA 4AFCA 4AOCA 1H8TA 2YC0A 3NKTA 3C3VA 4DZGA 2A3WA 3I3EA 1DLLA 2JDUA 3U37A 1LHNA 1HXS2 1N3QA 1WW4A 1H4HA 4IE0A 5D8AC 2ZKLA 4B7KA 4KBZA 2Y60A 2JENA 3OGVA 2EIEA 2E32A 4Q4X2 3U4XA 4COWA 3PUHA 4CDWB 1S0DA 4CDQB 3QBQA 1FNYA 3LIGA 2BEOA 1Q56A 2RE9A 3NNLA 4LLFA 1GBGA 2VQTA 2B39A 4JGYB 1MZ6A 2BGPA 5LBBA 4IETA 5DAXA 4PJYA 3T0AA 2IXJA 4J25A 1J3QA 1FATA 1XU2A 5JZGA 1W06A 1JYXA 5K0UA 1ULPA 4NR1A 2XBO1 4I0WB 1UL9A 4AAPA 1AYM1 1UKRA 2IUWA 5CU1A 4CZSA 1TG7A 2PXJA 1MVQA 3VBFB 1JMUB 2R071 2DCJA 3R05A 4AVSA 4GZ9A 4GXLA 1RUF3 4XE9A 1COV2 2D6NA 1RUJ1 3AK0A 4PQ9A 3NL1A 1RMU3 5FOBB 1G9AA 3ILRA 1Z7S2 1S0JA 2W0XA 1WLDA 3EB7A 5FPBA 5A7WB 4GMP1 4AFDA 1AL23 3ZXLA 3URFA 4MADA 5CB7A 2WSVA 4AI8A 4AAXA 4MO3M 2F4LA 1G6NA 4RGKA 5FZIA 4QXBA 1OKQA 2RMU2 3B94A 3N36A 5A3PA 1R64A 3O1PA 1YFXA 1X7NA 2MEV2 1R1ZA 2OA2A 1RUG3 3HQXA 1GQGA 4MV2A 4Q27A 3HN3A 1NCRB 2ATFA 4URTA 5CFCB 3RWKX 5CIRA 4DS0A 1GWKA 4CPBD 3AMHA 1G86A 2WZEA 1OMIA 4Z07A 2Q8CA 3BUCA 2ZGTA 1JODA 3RJ2X 3WG3A 4Y5TA 4D6SA 1BEV3 3GALA 5HV0A 3W58A 5C9AB 2OPWA 4LQRA 5JXGA 2ZGPA 1CZVA 2C24A 2WN3A 3LDKA 2WLQA 4QB6A 5BXXA 4ET7A 1REDA 2RR11 2XJQA 4G4FA 4OI0A 4XYXA 4BE3A 2ZBJA 4KMQA 4DRVA 4Q1PA 2YU2A 1H8VA 1MQTB 3WVJA 1T6GC 1W2UA 2Y26A 2XJPA 4GH4B 1YC61 3NJXA 4YG3A 1VJ2A 1ZBE2 1G9BA 2C1FA 1IPSA 2XL9A 1UPIA 3WG1A 3CF6E 4E9KA 1K12A 1VBE3 4NRPA 1W8TA 3SEPA 2PLV3 3O1VA 2B45X 2BGOA 2B9VA 5FK8A 4ARYA 5JAXA 4UBGA 2VCAA 4NN0A 1S0IA 2OQ6A 3BPSA 3M1HA 4CEYC 4LO4B 4N9HA 1JYWA 4PLOA 3PJYA 5JOZA 4MGTA 1BCXA 4JDOA 1LJ7A 4RSUA 4AQTA 3GNEA 4Q0PA 3ZFEC 1W9WA 4XF9A 5FIXA 3RS6A 1IHMA 4HOOA 1CAVA 3KB5A 4P9YA 5FWEA 5JXHA 4MLOA 3LE0A 3VD3A 1BBT1 2D6LX 4EYUA 1PX4A 1RUH3 3O5SA 2HWB1 2YV8A 2W5FA 3MDPA 3PUSA 5FY9A 1DZRA 3CZUA 1W2OA 4BU2A 3MFAA 2ZX0A 1CESA 1QJZA 3MIGA 4B1MA 2W1SA 2KA3A 1ZZ8A 3KS7A 3AJYA 1MPXA 4XUPA 2IFWA 4QGMA 1MZ5A 4Y1UA 3GBGA 3K4DA 4INDA 1B35B 4GJZA 5T5OA 3ZPOA 5KC6A 1GWLA 2WNVA 2VVEA 2ZPXA 5DUXA 5FK7A 3NV1A 3WV6A 5T54A 2JE8A 2WAAA 1Q43A 1UPSA 3I2DA 1RHI3 4HT1T 2WS91 2IVIB 3IMNA 4CCLA 2YUEA 1VRH1 5FV3A 1PMHX 2HWC1 5GZGA 3LCPA 2WKKA 1UY1A 4R9CA 4FO9A 5FMDA 4TTGA 3H0OA 3ZSMA 4CUBA 2DV9A 4K1YA 1BHGA 4N53A 4PDWA 5DAWA 1UY4A 3AC0A 5JMCA 1W28A 1D4M2 1DGRN 1G7YA 1GZWB 1XOYA 2BQPA 3OPZA 3U07A 4E4ZA 2D6PA 2KR2A 4QX3A 5CFDB 4ITCA 4Y4RA 1K3IA 1NZIA 3P3NA 1IOAA 5E1RA 4RHV2 2PAKA 3ZN5A 4IESA 1ZBA3 4OVEA 3VB9A 4CCMA 4M00A 3ZYRA 1WLCA 4N43A 2XLFA 4LK6A 1WCDJ 5GZEA 1C5IA 3NMBA 4LJHA 1QJY1 4QQOA 1YUDA 1WW6A 3IZOA 4LEJA 3E6BA 2PELA 1QOOA 2I45A 2JDYA 3BALA 4YVWA 5HXVA 1OD3A 5J37A 3KHCA 1PO23 4QB1A 4OQ9A 3IIIA 3J8F3 1C28A 4H2AA 2ORXA 3PURA 4OUSA 4W6YA 4BDVB 3HEIA 5FZFA 5DZEA 1JTZX 4HLTA 4WM8A 4B4QA 4YVWC 4QKFA 1UOGA 3UJOA 1E57A 3JQWA 2ARAA 2VMGA 1XNKA 2WT2A 4R9BA 4WBBA 3PNAA 4WM8C 1WMDA 1JHJA 2FZ1A 3J26N 1XYPA 4P02B 5EHDA 2EXIA 2RJLA 5HV4A 1HXS3 3LA2A 2BDRA 5FYYA 2XPJA 1S4CA 2P2KA 1YXWA 3THTA 1W2TA 2LROA 1PVC2 4ATFA 1LCLA 3AFKA 4JTOA 3BTYA 3RMXA 1IKQA 3VKNA 4P9LA 1AYM2 4A41A 5J3UA 5I93A 4HPKB 4YRDA 5BNOA 4XMAA 4EQVA 3AXDA 3TOJA 4EV0A 5J09A 2FQPA 1BK0A 2RJKA 3IPVA 5LA2A 1RUJ2 5FZMA 4DOUA 3G6JB 1CIWA 4K7JA 5BNOC 2EICA 3NO8A 2FHRA 1S0FA 1KD7A 5JI7A 3VBRB 3EXUA 4MGQA 1S0CA 2CSGA 1ND2B 1UOFA 4XFGA 4LOSA 3I8TA 4KGGA 3AKTA 1YIFA
chains in the Genus database with same CATH topology
4IGOA 4NUBA 3PUSA 3K3OA 5FY9A 5FPVA 5FYTA 5FZBA 4QWNA 5FY1A 5FXWA 5LY2A 4BU2A 4CCNA 4GAZA 5A7PA 5K4LA 5FWJA 5FPAA 2XDVA 3KV9A 3ZLIA 3AVSA 5F5IA 5A7WA 5FZ0A 3RVHA 5E6HA 4GJYA 4GJZA 4QX7A 5FYUA 5FZ4A 3ZPOA 3DXTA 2GP5A 5IVBA 5LWBA 4TN7A 4URAA 3DXUA 3PU8A 4BISA 3N9OA 3PU3A 4UF0A 4QX8A 4CCLA 5FYCA 2Q8DA 2YPDA 5F3IA 4EYUA 5FV3A 2GP3A 4LITA 5IVYA 5FPLA 4AAPA 5A7OA 2PXJA 5FXXA 5LW9A 5FY7A 5FZ1A 3N9PA 2XXZA 4DO0A 2OX0A 5FP3A 4QXHA 5ISLA 5FBJA 5FJHA 5FYMA 5FP4A 4Y3OA 5FUNA 5IW0A 5A3NA 5F2WA 5A7WB 5FZ3A 4CCJA 4Y4RA 5FZEA 4C8DA 5CEHA 4HONA 3KVAA 2YBSA 4BXFA 2OQ7A 3OPTA 4AI9A 5A3TA 5FZ9A 3N9NA 3KV6A 4CCMA 4D6RA 5FZIA 4QXBA 5FXVA 5ANQA 5FZ6A 4UF0B 5A3PA 2OT7A 3LD8A 5FYIA 5FP7A 5F3EA 2OS2A 3AVRA 3N9QA 5FPBA 5FXZA 3UYJA 3AL5A 4V2VA 3K3NA 5FPUA 1VRBA 3N9LA 5FP8A 5FYZA 5KR7A 4GD4A 5IVCA 4QXCA 2Q8CA 5FJKA 4LIVA 4IGPA 4D6SA 3PURA 5LY1A 2YBPA 3KV5A 3KV4A 3PUQA 5A7QA 5F32A 5FYBA 5FZFA 4ASKA 4CSWA 4IGQA 5FY0A 5A80A 5FZ7A 3AL6A 3NJYA 5FZ8A 5FZOA 5FZOB 3U4SA 2XMLA 4LIUA 5IWFA 5FY4A 2YBKA 4EZ4A 2WWUA 5FZAA 4CCOA 4XDPA 2WWJA 2YU2A 3PDQA 4LXLA 5A7SA 5F3GA 5FUPA 5FZHA 2Q8EA 5FZCA 5FZKA 3OPWA 5A1FA 5FYYA 2P5BA 3PTRB 5FYSA 3N9MA 4E4HA 3U78A 4D6QA 4CCKA 4QU1A 2W2IA 5F39A 5FZGA 4DIQA 5IVVA 5FZDA 4EZHA 2XUEA 5FYVA 2OQ6A 3PUAA 4V2WA 5A3WA 5F5AA 5A1LA 5IVFA 5F37A 3KVBA 5FY5A 3LDBA 5F5CA 5IVEA 2YU1A 5FYHA 5FZMA 5FY8A 5FP9A 5FZLA 5A7NA 4HOOA 5F3CA 5FWEA 5F2SA 2VD7A 3K2OA 4Y33A 4CUGA 5IVJA 4XDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IGO A;  4NUB A;  3PUS A;  3K3O A;  5FY9 A;  5FPV A;  5FYT A;  5FZB A;  4QWN A;  5FY1 A;  5FXW A;  5LY2 A;  4BU2 A;  4CCN A;  4GAZ A;  5A7P A;  5K4L A;  5FWJ A;  5FPA A;  2XDV A;  3KV9 A;  3ZLI A;  3AVS A;  5F5I A;  5A7W A;  5FZ0 A;  3RVH A;  5E6H A;  4GJY A;  4GJZ A;  4QX7 A;  5FYU A;  5FZ4 A;  3ZPO A;  3DXT A;  2GP5 A;  5IVB A;  5LWB A;  4TN7 A;  4URA A;  3DXU A;  3PU8 A;  4BIS A;  3N9O A;  3PU3 A;  4UF0 A;  4QX8 A;  4CCL A;  5FYC A;  2Q8D A;  2YPD A;  5F3I A;  4EYU A;  5FV3 A;  2GP3 A;  4LIT A;  5IVY A;  5FPL A;  4AAP A;  5A7O A;  2PXJ A;  5FXX A;  5LW9 A;  5FY7 A;  5FZ1 A;  3N9P A;  2XXZ A;  4DO0 A;  2OX0 A;  5FP3 A;  4QXH A;  5ISL A;  5FBJ A;  5FJH A;  5FYM A;  5FP4 A;  4Y3O A;  5FUN A;  5IW0 A;  5A3N A;  5F2W A;  5A7W B;  5FZ3 A;  4CCJ A;  4Y4R A;  5FZE A;  4C8D A;  5CEH A;  4HON A;  3KVA A;  2YBS A;  4BXF A;  2OQ7 A;  3OPT A;  4AI9 A;  5A3T A;  5FZ9 A;  3N9N A;  3KV6 A;  4CCM A;  4D6R A;  5FZI A;  4QXB A;  5FXV A;  5ANQ A;  5FZ6 A;  4UF0 B;  5A3P A;  2OT7 A;  3LD8 A;  5FYI A;  5FP7 A;  5F3E A;  2OS2 A;  3AVR A;  3N9Q A;  5FPB A;  5FXZ A;  3UYJ A;  3AL5 A;  4V2V A;  3K3N A;  5FPU A;  1VRB A;  3N9L A;  5FP8 A;  5FYZ A;  5KR7 A;  4GD4 A;  5IVC A;  4QXC A;  2Q8C A;  5FJK A;  4LIV A;  4IGP A;  4D6S A;  3PUR A;  5LY1 A;  2YBP A;  3KV5 A;  3KV4 A;  3PUQ A;  5A7Q A;  5F32 A;  5FYB A;  5FZF A;  4ASK A;  4CSW A;  4IGQ A;  5FY0 A;  5A80 A;  5FZ7 A;  3AL6 A;  3NJY A;  5FZ8 A;  5FZO A;  5FZO B;  3U4S A;  2XML A;  4LIU A;  5IWF A;  5FY4 A;  2YBK A;  4EZ4 A;  2WWU A;  5FZA A;  4CCO A;  4XDP A;  2WWJ A;  2YU2 A;  3PDQ A;  4LXL A;  5A7S A;  5F3G A;  5FUP A;  5FZH A;  2Q8E A;  5FZC A;  5FZK A;  3OPW A;  5A1F A;  5FYY A;  2P5B A;  3PTR B;  5FYS A;  3N9M A;  4E4H A;  3U78 A;  4D6Q A;  4CCK A;  4QU1 A;  2W2I A;  5F39 A;  5FZG A;  4DIQ A;  5IVV A;  5FZD A;  4EZH A;  2XUE A;  5FYV A;  2OQ6 A;  3PUA A;  4V2W A;  5A3W A;  5F5A A;  5A1L A;  5IVF A;  5F37 A;  3KVB A;  5FY5 A;  3LDB A;  5F5C A;  5IVE A;  2YU1 A;  5FYH A;  5FZM A;  5FY8 A;  5FP9 A;  5FZL A;  5A7N A;  4HOO A;  5F3C A;  5FWE A;  5F2S A;  2VD7 A;  3K2O A;  4Y33 A;  4CUG A;  5IVJ A;  4XDO A; 
#chains in the Genus database with same CATH topology
 1G8W A;  3JD7 1;  2GN7 A;  3F2Z A;  1RJ7 A;  5FYT A;  3WW2 A;  5APA A;  5EJ3 A;  4BQ5 A;  5LY2 A;  1DZT A;  3T0B A;  3DPR B;  4Z82 A;  4DPN A;  3G7D A;  5GZF A;  3DF0 A;  4XJW A;  1CPN A;  5HXM A;  4GA9 A;  1COV 3;  3AMQ A;  1OH3 A;  4X8P A;  4YZ2 A;  4QPW A;  2VZU A;  5FMO L;  5CKN A;  1YQ2 A;  4XAB A;  4QX7 A;  1GSL A;  3VD7 A;  4AW7 A;  1NXD 1;  2RDR A;  3OB8 A;  3LSD A;  4JX0 A;  1URX A;  5J98 B;  1ULG A;  1EAH 2;  1FYU A;  3PU3 A;  2FDJ A;  5IK5 A;  4IEO A;  4Q0Q A;  1ST8 A;  3RQ0 A;  2RR1 2;  1FT9 A;  1F4A A;  3POW A;  3OG2 A;  2MEV 3;  4LO7 A;  2JIJ A;  5DDJ 3;  1N3O A;  4UW6 A;  1CAX B;  1KEX A;  3M3O A;  3VBO B;  4BWO A;  2HWD 1;  2O8O A;  2XKP A;  5FKB A;  5LEK A;  2UY8 A;  5FRE A;  2JD9 A;  4EWD A;  5BY5 A;  1RMU 1;  5FZ1 A;  1JYV A;  1J1L A;  1RXG A;  3FE5 A;  1QY4 A;  2J1R A;  5GLZ A;  5IFT A;  4L99 A;  1AL2 1;  3IM0 A;  3NVC A;  2H6C A;  5JOY A;  1WGP A;  4UW5 A;  3KM5 A;  1ASJ 3;  5C3P A;  4JDM A;  3PLQ A;  3TN9 3;  1GNY A;  3OSD A;  1ENQ A;  5KXD A;  3WNP A;  3KT7 A;  1X82 A;  3N9N A;  4LKE A;  4QKB A;  5FZ9 A;  4QXK A;  1K42 A;  1ULF A;  3WEZ A;  2PQQ A;  1HRI 2;  5IHR A;  4UF0 B;  1EY2 A;  4U36 A;  4XIK A;  4XCB A;  1ZBE 3;  3H1W A;  2HWF 3;  4RS5 C;  5DN2 A;  5FP7 A;  2E33 A;  4JHZ A;  3DKW A;  4XXA A;  2XOM A;  5D8A B;  1ZNP A;  1QNW A;  4IV1 C;  1KDM A;  1W3V A;  3P3P A;  3I2K A;  1EV1 3;  3MHZ A;  2WA4 A;  5KR7 A;  2Y0O A;  1WLT A;  4H7M A;  5EP9 A;  2ID4 A;  3TWI A;  1BBT 2;  3WNO A;  2ZS6 B;  1YFW A;  4ONU A;  4TLG A;  2BJS A;  4QHB A;  1SZB A;  1DG6 A;  2Q0A A;  3FZ3 A;  3HBK A;  4I3G A;  2IFR A;  5FZ7 A;  4X6Q B;  4LIU A;  2XHN A;  3POY A;  5IWF A;  1W8W A;  3CU7 A;  5GLW A;  1DYO A;  2BP6 A;  4CCO A;  4FOQ A;  1BVP 1;  4JQT A;  3QH6 A;  2VQ0 A;  4XDP A;  1J1T A;  1C3H A;  1XBF A;  1F5F A;  2Q5T A;  4LXL A;  5AVP A;  4AVV A;  4LBJ A;  1N1S A;  4J1W A;  4JCK A;  3H50 A;  3QH7 A;  3AKS A;  5FZC A;  4NWW A;  2V73 A;  5J1X A;  4HZF A;  4L0P A;  1R1A 1;  3CJI C;  4Q4V 1;  5I91 A;  4GB3 1;  2WNE A;  3MF9 A;  4GIQ A;  2WS9 2;  3N9M A;  3MV0 1;  4BH9 A;  2GH2 A;  4RR3 A;  4UAP A;  3T1M A;  1WA6 X;  2CNA A;  2GU9 A;  2HYX A;  4XZU G;  1SFY A;  1VRH 2;  2HWC 2;  4UFM A;  1S2E A;  2Q4S A;  1K5M B;  2UYB A;  3AZX A;  5F39 A;  3GZT B;  5FYV A;  3NNM A;  2HEW F;  3LKJ A;  1O5U A;  4AHY A;  2R32 A;  4I2O A;  4JGY A;  3KVB A;  4NHY A;  3PME A;  2VEC A;  3ZDV A;  4CDW C;  3N7M A;  3BOD A;  3AFG A;  1H2M A;  4CDQ C;  4DY3 A;  5J7M A;  1LHV A;  4Y20 B;  1DFQ A;  3AKR A;  3WUD A;  3AKP A;  3OEA A;  1QXR A;  4JGY C;  4BME A;  2ZX4 A;  1A8D A;  2WWS A;  3OJB A;  1CD3 G;  4G3Y C;  1YJL A;  5JXJ A;  2HWE 1;  2OYZ A;  3VBF A;  3K3O A;  4QPG B;  3ENR A;  5EFU A;  4DNY A;  3WW1 A;  2WRA A;  3VHO A;  1J3R A;  3MV1 1;  1NXM A;  4I0A A;  1ZRE A;  1US3 A;  5A7P A;  5K4L A;  2XH6 A;  1D4M 3;  1PHM A;  5A7W A;  1DHK B;  3VBF C;  3DYO A;  4A7K A;  2XB6 C;  2GN3 A;  4QPY A;  3R4D B;  5EQU A;  2VC9 A;  3V0B B;  1W9S A;  3LEG A;  4YLZ A;  3I3M A;  2R1D A;  4URA A;  3DXU A;  1NE4 A;  3KGZ A;  3FHI B;  4IQP A;  5FO7 B;  4I02 A;  3DUI A;  1KJR A;  5CFC A;  1NCR A;  1GIC A;  3OBZ A;  5FCC A;  4QQ2 A;  1BKZ A;  2XJR A;  5KXC A;  1QH6 A;  1W6N A;  1XPW A;  4NID A;  3MIC A;  1QGL A;  1E5R A;  1BZW A;  3HOB A;  4CEY B;  4D0Q A;  3KQR A;  4LMF A;  2KXL A;  3N35 A;  3T30 A;  2ZHK A;  5C9A A;  5CFC C;  5FJH A;  3ZFE B;  3VLB B;  2ZZQ A;  4AVC A;  4Y3O A;  3HNY M;  2D40 A;  1JHN A;  2WO1 A;  3OUH A;  4QD2 A;  5BV6 A;  5KHJ A;  1UMI A;  3BIW E;  2YBS A;  5C9A C;  3OPT A;  1JUI A;  1OUS A;  3QOP A;  4Q0U A;  4GH4 A;  2R0F A;  5J96 B;  2X53 S;  4AFA A;  1NLQ A;  4Z92 B;  1DP0 A;  3WDW A;  1CN1 A;  1AXY A;  4QQP A;  3ZYI B;  2VNV A;  3SEE A;  1MQT C;  1ODM A;  1W6P A;  2E51 A;  5C71 A;  5KC5 A;  4GH4 C;  2J1V A;  1OVS A;  3Q8B A;  4QMA A;  3OD4 A;  5DUV A;  4BCU A;  5CA6 A;  4D8M A;  4CUA A;  4A7Z A;  4AEM A;  2XBO 3;  2PHT A;  4P00 B;  1VMH A;  4QX0 A;  4D3W A;  5GAL A;  3ZIW A;  4LHS A;  1AYM 3;  3JD7 2;  3RRD A;  3O1M A;  4LBQ B;  5HBA A;  3BIE A;  3UGG A;  2R07 3;  3U4S A;  3AL6 A;  2GDF A;  4H14 A;  3RJR A;  4EN9 B;  3B5L B;  2FBE A;  5GZC A;  1QXP A;  2GC1 A;  4XJZ A;  3IIA A;  5A3L A;  1K45 A;  1GFF 2;  4BYY A;  1RUJ 3;  2E26 A;  4Q0V A;  3UGH A;  3HR9 A;  3BI3 A;  3PDQ A;  1H2N A;  1KS5 A;  1CZT A;  2W92 A;  4GMP 3;  1XYO A;  2JG8 B;  2CY6 A;  4JTN A;  1YFU A;  2J1U A;  2N7G A;  2VPV A;  3MLJ A;  3RI9 A;  3AMN A;  1X8M A;  4K3U A;  1LAJ A;  1DBN A;  4YFZ A;  4B7E A;  4GWI A;  1VBA 1;  3ACL A;  2ADD A;  3FL7 A;  4Y1Y A;  2HWD 2;  3ZYJ B;  5IVV A;  5CIS A;  1KJL A;  2VE1 A;  3SNM A;  2ZEY A;  3S0M A;  3IB3 A;  3PUA A;  1RUF 2;  5JR2 A;  1B35 A;  1G9F A;  4HSJ A;  3V0A A;  4LR4 A;  5IVF A;  1RMU 2;  1ZYB A;  3NQH A;  4CDU B;  1GOG A;  4W8J A;  5LBF A;  4LO5 B;  4W6W A;  2RDN A;  1XYN A;  1AL2 2;  1S55 A;  2YU1 A;  5CKM A;  2QTW B;  3APB A;  2LAL A;  2W68 A;  2RR1 3;  2W95 A;  5DG2 A;  2JEM A;  1RUI 1;  3FN9 A;  1Q8S A;  4ZON A;  3Q8E A;  2EIG A;  3W59 A;  2VNR A;  4C91 A;  1RUG 2;  4NHM A;  4CP9 B;  3VZK A;  4FTS A;  3A4U A;  1DDL A;  3C7H A;  5CYY A;  1QJF A;  4L97 A;  5F6L B;  3AZW A;  2XLG A;  2H6B A;  1GZW A;  5CFD A;  2XJV A;  3MUZ 1;  2LM3 A;  3LPF A;  1OQE A;  3GJA A;  4TXW A;  4BQ3 A;  2YGM A;  1XE7 A;  4IE6 A;  4PIZ A;  5F7U A;  2VZS A;  5C3Q A;  2GZW A;  4XUT A;  1H4G A;  1LOA A;  3R4S A;  4F83 A;  4JRA A;  3MI8 A;  4J6G A;  4MVT A;  4Y22 B;  1OF4 A;  5CKQ A;  5A3O A;  5FYC A;  3GZA A;  4PT6 A;  2YDE A;  1REE A;  1ULC A;  2VZO A;  2Y6H A;  3MW4 A;  2Z69 A;  1CX4 A;  2PYT A;  4GWN A;  1QEX A;  4LIT A;  1IS4 A;  4LK7 A;  1AR6 1;  2VUJ A;  4OHY A;  5IAV A;  1S2K A;  2R1B A;  1UF2 C;  4XHX A;  4PHZ A;  2P6C A;  4I09 A;  1BBT 3;  1UWW A;  1VBE 2;  1O91 A;  3WF2 A;  4AG4 A;  4Q4V 2;  1R1A 2;  1PZ8 A;  2HWB 3;  4GB3 2;  4IXL A;  4FPF A;  3RI8 A;  2WUH A;  4CU7 A;  4S2F A;  4AK3 A;  1PK6 C;  4CCJ A;  3KD4 A;  4D7Y A;  1O4T A;  5CEH A;  4FTB A;  4BPZ A;  2UY9 A;  1SAC A;  3MO4 A;  1TMF 1;  3DEM A;  3UKV A;  4D6R A;  1ZRR A;  5ABJ C;  3R0R A;  5FLI A;  3LD8 A;  3EJK A;  4ARX A;  1QDC A;  5FR3 A;  1DQ2 A;  3I49 A;  2Y0I A;  3AL5 A;  1SFP A;  2JXA A;  2V72 A;  1UOJ A;  1MS8 A;  2A6Y A;  4BQY A;  1H6X A;  1H9W A;  2WS9 3;  3J7M A;  3N9L A;  1RUH 2;  2PHF A;  3ON7 A;  3DCQ A;  4LNV A;  2DCY A;  4XFF A;  4YVS C;  3VBS A;  2ILM A;  3C8X A;  4CUC A;  1VRH 3;  5FDB A;  2ARB A;  2HWC 3;  4NIH A;  4KG0 A;  1ALY A;  3KV4 A;  3KV5 A;  2Y6F A;  2HWE 2;  4HPK A;  4XVH A;  5BNN B;  3TBD A;  2BW8 A;  2I74 A;  5CZK A;  1ACC A;  3FHA A;  4AYU A;  4CDX B;  1NKG A;  3WQ1 A;  3BOW A;  2WWJ A;  3M70 A;  1AHS A;  2HEY F;  2Z5W A;  4CRQ A;  2Y8K A;  3VBR A;  3N4M A;  1ND2 A;  3VBH C;  3SCG A;  3POF A;  4MHU A;  5JDB A;  2W52 A;  4XUQ A;  5LAS A;  5A1F A;  1YQC A;  4CU6 A;  1KDK A;  4K8F A;  4CA9 A;  3IDC B;  3DPR A;  1L7Q A;  1IPJ A;  2D5H A;  1QJY 3;  4H55 A;  2DTW A;  3BCW A;  3KHB A;  1GZ9 A;  3ACG A;  3LSE A;  5C3S A;  2QZ2 A;  2OXB A;  4EZH A;  2R6Q A;  2XUE A;  3WT3 A;  1WMX A;  3ZXJ A;  4FAG A;  1MS9 A;  3DYP A;  4LOR A;  4QQL A;  1YFY A;  1GAN A;  2XWJ B;  3JCI A;  4UXA A;  1QIQ A;  1CAU B;  2AGS A;  1WCU A;  4WVZ A;  1JU4 A;  5JVV A;  1POQ A;  1HQN A;  4K40 A;  3VKM A;  4BQW A;  1OSG A;  2RDQ A;  5C4W C;  1XE0 A;  2ZGL A;  4MOA A;  3VBO A;  2XJU A;  4AVB A;  2O14 A;  2JX9 A;  5AC9 1;  2YY1 A;  1I6X A;  1BMV 1;  2X05 A;  2SBA A;  2VVD A;  4IGO A;  3TAY A;  3TEX A;  2VO5 A;  4XBL A;  5FZB A;  3U1X A;  1OD5 A;  2JG9 B;  2P4E A;  2QCS B;  4LUK A;  5FY1 A;  5JIU A;  4DMI A;  3U14 A;  3VBO C;  1HW5 A;  4YAR A;  2UWA A;  3OYW B;  4DFS A;  5F8P A;  3WNN A;  4V1P A;  4K1Z A;  1GP4 A;  1ND3 C;  1DIW A;  3VDB A;  1ZZB A;  3WF4 A;  5FZ4 A;  1XC6 A;  1SBF A;  3SIS A;  2GP5 A;  2HBU A;  3E5Q A;  1NA1 B;  3IBM A;  5LWB A;  3A0K A;  1I5P A;  1EPW A;  2D44 A;  1KGY A;  4LPL A;  3VD5 A;  2BWC A;  3ZKU A;  4UF0 A;  3CJI B;  3PVN A;  3ECQ A;  4FFI A;  1IS5 A;  4XFI A;  1UKG A;  2VUC A;  5D8A A;  3HVD A;  4Q4W 1;  2TBV A;  3C7E A;  4HKW A;  5IVY A;  1G9C A;  2PN5 A;  4XAA A;  3ZSL A;  4GWM A;  2RM2 1;  5LK7 B;  1DYP A;  4Q4Y 1;  5T5L A;  2PHW A;  4IEP A;  4Q1R A;  1HQL A;  1JUH A;  5LW9 A;  3LDR A;  2D6M A;  1O8P A;  3N9P A;  3ZFF B;  3FLP A;  3T2Q A;  4AL9 A;  3JD7 3;  4R8H A;  2OKX A;  3ZFG B;  4KWU A;  4B3N A;  4DUX A;  3I3B A;  2UWC A;  4JGZ C;  5LRS A;  3I97 A;  3L2H A;  2J7M A;  3K48 A;  2RS3 1;  5ANN A;  5CBL A;  4YW6 A;  4BK4 A;  2VBB A;  4FXG B;  3VV1 A;  3HPN A;  3ZYF A;  3L9J T;  1LUL A;  3SCF A;  1OH4 A;  2WDB A;  1O4Z A;  2BV4 A;  2WFF 1;  3D6E A;  3H1M A;  3B3Q E;  3GBF A;  5FXV A;  3SIT A;  2ZX2 A;  2OS2 A;  5C3O A;  1L7L A;  5FRA A;  2D5F A;  1IZ3 A;  3AXE A;  2DU0 A;  3RZK A;  1AUY A;  4A7Y A;  3HNB M;  3WX5 A;  1RUI 2;  1AVB A;  2QZ3 A;  3DKQ A;  2HWD 3;  3H3Z A;  1QOS A;  1VBD 1;  4P9J A;  4OQ8 A;  3SHR A;  5FYB A;  3MIE A;  4CSW A;  1W03 A;  3ACH A;  3CQO A;  4ZY9 A;  4YZ4 A;  1RB8 G;  3NJY A;  3I2O A;  5FZO A;  4OHZ A;  1W0P A;  1ZRD A;  4KU7 A;  2FZ2 A;  1NCQ C;  3M7A A;  3H8U A;  1FV3 A;  1K5M C;  4C0H A;  1F4H A;  3SCH A;  4XBN A;  5FPX A;  2AEZ A;  2QFE A;  2XJT A;  2GAL A;  1WMF A;  2AC1 A;  3VDA A;  2E63 A;  2B42 B;  4GKY A;  1JN2 P;  2JDK A;  3LEM A;  1GZC A;  2F17 A;  5FZK A;  3JQX A;  1JZ6 A;  3AYA A;  5DDJ 2;  1KFU L;  1RUC 1;  2DCK A;  4RQP B;  3ZR6 A;  1CWP A;  2AEY A;  5DUU A;  4CEW B;  2VZR A;  5C70 A;  2XL7 A;  1VP6 A;  3H42 B;  4UYB A;  1F31 A;  1Q8V A;  2CAU A;  4J1X A;  4PBP A;  3OGG A;  4N9I A;  2JB8 A;  4P9I A;  4Z1V A;  2XQR A;  4QPG C;  1QWR A;  3THD A;  4E4S A;  2D98 A;  2VMC A;  2VQU A;  5JI9 A;  2H0V A;  2VW1 A;  3V0B A;  2VZP A;  4PBO A;  3TB0 A;  1UNB A;  3S7I A;  5F5C A;  1ASJ 2;  3NNG A;  1NLS A;  3TN9 2;  1VAV A;  2ZHN A;  1AX1 A;  2VNO A;  3EQE A;  4HN1 A;  4E4D X;  4QU2 A;  5EIY B;  2B4K A;  4FPE A;  1GMM A;  2C9K A;  4NMI A;  2HWF 2;  1OA3 A;  1F9K A;  4DB5 A;  1CJD A;  2ZJC A;  1SLT A;  3FFQ A;  4B1L A;  4DQA A;  4MGY E;  4CEY A;  4DXR A;  1OA2 A;  1EV1 2;  1RYY A;  1SBE A;  3AM2 A;  3VKL A;  3AMP A;  4OUE A;  4UFH A;  2W08 A;  1R1A 3;  4Q4V 3;  4XQD A;  3KV9 A;  4GB3 3;  4LLO A;  3ZFE A;  4MET A;  4EWA A;  1UZV A;  2E53 A;  1UCX A;  4C90 A;  2V4A A;  4FOW A;  4BA6 A;  1WME A;  4GMP 0;  4LHN A;  3W9A A;  4AXO A;  4F7Z A;  3ZN6 B;  3HQR A;  4CE8 A;  4LUL A;  4YZ1 A;  4FTE A;  2IXL A;  1C57 A;  2IC1 A;  4YW2 A;  5SV8 A;  1S2B A;  1LHU A;  4OHW A;  4AI0 A;  1AZD A;  1MEC 1;  2EXK A;  1KQR A;  2VMH A;  3POE A;  4OFG A;  2BZD A;  3ILN A;  3K46 A;  4XIL A;  3NNJ A;  2ZAC A;  2VUD A;  2OUH A;  4IV3 B;  3ITQ A;  4LA2 A;  1VMF A;  2YFU A;  3O0X A;  2GC0 A;  3A23 A;  3FBY A;  5A6Y A;  1EUT A;  5K8S A;  4LBQ A;  2HWE 3;  3CZJ A;  5FMB A;  5FYM A;  3FMG A;  4P9X A;  4DRR A;  1D0G A;  1FNZ A;  2IXK A;  1O6U A;  5IUQ A;  3GHM A;  2RS1 1;  1MZE A;  3NST A;  4FFH A;  3SH3 A;  1VAK A;  2W91 A;  2WR9 A;  3WNK A;  4R9D A;  2D6K A;  1JOB A;  2JG8 A;  1QDO A;  3T2T A;  1TVG A;  5FBZ A;  3N7J A;  2WO7 A;  4WVM A;  2BOI A;  1MZF A;  2DVD A;  2JG8 C;  3M3C A;  3ELN A;  3PJQ A;  2BFU L;  2WO3 A;  4QB2 A;  2DCT A;  1BMV 2;  2TNF A;  4ZZ5 A;  1IS3 A;  2X09 A;  5F32 A;  4PF5 A;  5A80 A;  4KI5 M;  1SEF A;  4QX5 A;  1WCQ A;  1Y9Q A;  5L9V A;  3LQC A;  3I2I A;  5FY4 A;  3EO6 A;  4EZ4 A;  2WWU A;  1NZC A;  1PNG A;  3K51 A;  1NT0 A;  1AYN 1;  4UFJ A;  2W94 A;  2UYA A;  5H9P A;  5IK8 A;  1AR9 1;  4UW3 A;  4CDU C;  4YW4 A;  1LOB A;  1AR7 1;  1ULE A;  1VB4 A;  4OLL A;  3UES A;  4CP9 A;  1H1M A;  1CX1 A;  4IL7 A;  3WCR A;  2DUP A;  4Y24 A;  4I30 A;  5FKC A;  1UW8 A;  1UZY A;  1JI6 A;  1UQX A;  1NUK A;  1PK6 B;  2WZP P;  4AF9 A;  1EYB A;  3FX3 A;  4JKL A;  4OCT A;  3VHR A;  5FZD A;  4P08 A;  2RM2 2;  3WW4 A;  1H2K A;  4DY5 A;  1CPM A;  5EWS A;  3SMH A;  2VMF A;  4IEU A;  1POV 1;  1UU6 A;  4Q4Y 2;  5A3W A;  2CDP A;  5ABJ B;  3Q8C A;  5TSW A;  1J59 A;  1OQD A;  4K9S A;  2QQL A;  4QX2 A;  5FFO C;  4Y22 A;  3WY6 A;  5F3C A;  3MF6 A;  1SPP B;  2J1S A;  4S2D A;  3RMY A;  2MPF A;  3UV9 A;  1O3T A;  1QOT A;  4DEV A;  1V70 A;  4YVS B;  1CIY A;  2WNU B;  4K8R B;  3ROU A;  1LES A;  1LOG A;  1OOP B;  2PMW B;  4CUG A;  2NP0 A;  2WN2 A;  2GSY A;  3M4F A;  2PAM A;  2VJX A;  2V5Y A;  1VAM A;  1CAW B;  4CXX A;  2E7A A;  1W6Q B;  2VCM A;  2ARC A;  4QHZ A;  3RSJ A;  2B8M A;  2BBA A;  2ZX1 A;  4Q5O A;  1FXZ A;  1V6O A;  2XBO 2;  4XF3 A;  5A3M A;  5IK4 A;  1O4Y A;  1QNY A;  4M4P A;  3LOB A;  1JU3 A;  3D0J A;  3HT2 A;  1E5S A;  2WIN B;  2R07 2;  3MID A;  1VBA 3;  4NAM A;  5FYU A;  4AQS A;  3WDT A;  4HAN A;  3T3Y A;  1VBD 2;  3VBH B;  3WP5 A;  1YQ8 A;  4L92 A;  1Q5O A;  1U5X A;  3S5A A;  1WZX A;  1HJG A;  3MIB A;  3RPQ A;  5JOX A;  2ZGM A;  4IE4 A;  1O59 A;  2MHF A;  1FOD 1;  1S0B A;  2W1U A;  5KHH A;  5A33 B;  2GP3 A;  4YZ3 A;  4CCC A;  1Q8Q A;  4QKN A;  1JW6 A;  4YWA A;  4TZD A;  3BTZ A;  4ZHN A;  1RUI 3;  2L9L A;  1OHF A;  2XKO A;  4A3Z A;  1RIR A;  4HMZ A;  5LB6 A;  4NHK A;  3BGA A;  4E8C A;  4R4X A;  3FC0 A;  5ISL A;  2W87 A;  4MGI E;  1FI2 A;  4A6S A;  1IPK A;  2JDP A;  5FLH A;  3ZMN A;  5A3N A;  4FPY A;  5GJ6 A;  2VME A;  3M2M A;  5FZE A;  4F8A A;  2VTF A;  4HON A;  5DZF A;  3RG0 A;  1C8N A;  2QQK A;  3TNQ A;  5C4W B;  1RTV A;  5BNN C;  2G1M A;  3RZJ A;  3VL9 A;  4IEQ A;  4O9G A;  1RUO A;  3LA3 A;  4QDQ A;  1QJU 1;  2ARE A;  4QX1 A;  3ZDS A;  3UGF A;  4CDX C;  1LR5 A;  1GP6 A;  2CL2 A;  3AVR A;  3LEK A;  3T0D A;  1YWK A;  3RZG A;  3POJ A;  1YEW A;  4BIF A;  3HIF A;  4WM7 B;  4XMI A;  1YIP A;  5HCA A;  3B9I A;  4KQ7 A;  3WZ1 A;  4GD4 A;  1GOF A;  4Z2W A;  1ND3 B;  3W5N A;  2JB4 A;  3IWZ A;  4UBH A;  5IJR A;  3HJR A;  3OGJ A;  2YBP A;  1AR6 3;  5A7Q A;  2AYH A;  4ASK A;  3MYX A;  4WZC A;  2ZGU A;  4E2S A;  1A6C A;  1J83 A;  1TNF A;  1CAU A;  2ZX3 A;  1HKD A;  1V9U 1;  1W99 A;  1XB9 A;  2YBK A;  4RS5 A;  4YFW A;  5DZG A;  5FZA A;  1DGW X;  5KHI A;  4SLI A;  2X29 A;  1HRV 1;  3MLK A;  4IV1 A;  4XCA A;  5JR7 B;  3ZO0 B;  1VMJ A;  2Q8E A;  3A0N A;  3VBU B;  3BKZ A;  1GP5 A;  1DF0 A;  1TMF 3;  1SHW B;  4RGG A;  1V6N A;  5DQ0 A;  2VOV A;  2VXJ A;  3WDX A;  1MEC 2;  4NPR A;  2NMN A;  3CEW A;  4JGZ B;  2QJV A;  3OYW A;  3WOG A;  1N1T A;  1H6Y A;  1YI7 A;  4OI2 A;  1LOF C;  4DIQ A;  2J1A A;  1PVX A;  2ES3 A;  2HWB 2;  5A1L A;  1JZ5 A;  2JG9 C;  4K21 A;  3VDD C;  2OPK A;  3GM8 A;  1US2 A;  3OBR A;  2CGO A;  2IXC A;  4RL7 A;  2Q1Z B;  1X50 A;  2A1X A;  5FY5 A;  3CNA A;  5FY8 A;  3CJI A;  1AX0 A;  2E7Q A;  2QNK A;  3TEY A;  3VHN A;  2TUN A;  4NAO A;  1R08 1;  1WLW A;  4YGC A;  1HJF A;  1NA1 C;  3DL3 A;  4DUW A;  4BOW A;  1ZA4 A;  1TNR A;  1X9P A;  1LGN A;  2EAL A;  4NUB A;  5KWR A;  4XPV A;  3ZSE A;  3FWE A;  5LK5 A;  3AP9 A;  4O7X A;  3POB A;  5LRR A;  4Q8K A;  3RZH A;  4GAZ A;  4CPB A;  3ZFG A;  5I8S A;  1NCQ B;  3PIJ A;  3AVS A;  4CDW A;  4CDQ A;  5L7O C;  2A5Z A;  3S7E A;  1WCK A;  3WLU A;  3B7M A;  1XXN A;  3ZFF C;  1ZRC A;  2WJS A;  1O3R A;  1OLM A;  1PGL 1;  3ZFG C;  2WT1 A;  4P14 A;  4ZKT B;  4MSV A;  1LED A;  5DUW A;  4DXT A;  1PZ7 A;  1UU5 A;  1WD3 A;  4QX8 A;  4BQ2 A;  2JWP A;  2D3S A;  1Y43 B;  3VDC A;  2Y6K A;  2VH9 A;  4XTP A;  2PAE A;  2D3P A;  3FBM A;  5FMO S;  5K0U B;  1IQD C;  1BJQ A;  2A6X A;  2VM9 A;  1SDW A;  1OA4 A;  1AYN 2;  2QQW A;  4L11 A;  3VN4 A;  4UW4 A;  4E2Q A;  1W0O A;  4KG8 A;  5A6Z A;  1QU0 A;  2WZR 3;  1AR7 2;  1RUD 1;  2PFW A;  1QJY 2;  5AC9 3;  2JKB A;  3GGL A;  5B2G B;  2QQO A;  5FP4 A;  3U10 A;  1C5H A;  2ZGN A;  3GCW A;  1TZO A;  3M3Q A;  5EYY A;  3UKN A;  3ZM8 A;  2BOJ A;  3RFR A;  2FDF A;  4W65 A;  4AI1 A;  4BXF A;  1UMZ A;  1VBC 1;  2YGL A;  1MS5 A;  2ZEZ A;  1Y9G A;  3U75 A;  4MZU A;  3WDV A;  3WXP A;  4E8D A;  4PI2 A;  2W1Q A;  4MXW B;  3ABZ A;  1UYZ A;  1SFN A;  4Y4Y A;  1H9P A;  5E89 A;  1J84 A;  1W2A X;  3D5O A;  4FPO B;  3WF3 A;  1LOC A;  3FUO A;  2FDG A;  4WVW A;  1PM7 A;  3WP4 A;  4Q4W 3;  3JBG 1;  5FJK A;  3NAP C;  2DVB A;  3HAG A;  1JOJ A;  4JAA A;  2RM2 3;  1D7P M;  4RQP C;  3K77 A;  4Q4Y 3;  5E16 A;  4KU8 A;  1PMI A;  2C0Z A;  4CEW C;  1AR8 3;  1DQ5 A;  1SBD A;  2XG3 A;  3AP7 A;  2XML A;  3GXU A;  1O3Q A;  1AX2 A;  1GUI A;  1UX6 A;  3SC7 X;  4BZ4 A;  4XAC A;  4NIA A;  5K7P A;  1MQT A;  3WQ7 A;  1MS4 A;  3HWJ A;  1JYI A;  3DV8 A;  2RS3 3;  1SCR A;  4WVV A;  4JRL A;  3WP6 A;  3MIF A;  4O65 A;  1SLL A;  3ZKY A;  4CYD A;  2WFF 3;  1TME 1;  3RYP A;  1JOP A;  3O7O A;  1W8U A;  5T5P A;  4JHT A;  1RUN A;  3I7D A;  1S0G A;  3NWK A;  4Q29 A;  3ZN4 A;  2VOT A;  3KCC A;  3JU9 A;  3ME2 A;  2DDU A;  3POI A;  1LEM A;  1DQ4 A;  1RL3 A;  4UWD A;  3O0W A;  1W8N A;  3LOI A;  4TYS A;  3ZN6 A;  2QQP A;  1VBD 3;  2D3R A;  2QQJ A;  1RJ8 A;  4C1W A;  3LDB A;  3B69 A;  1YNA A;  4YW3 A;  2G9Z A;  2ZAB A;  3ZXK A;  2GND A;  5DAB A;  4XJA A;  3D3A A;  3K2O A;  1D2Q A;  1WW5 A;  5IVJ A;  3VD9 A;  4PQQ A;  2JDA A;  5JMO A;  3C2U A;  2BBV A;  2A6W A;  3IMM A;  2WT0 A;  1LOD A;  4PLN A;  2VOW A;  4IV3 A;  2DTY A;  3S57 A;  3M3I A;  1QJU 2;  1XSQ A;  4CCN A;  3VZO A;  4FXK B;  2YC4 A;  3HQU A;  4Q26 A;  3ZYH A;  4W50 A;  4YPJ A;  3GF6 A;  1F5J A;  3E5U A;  1RUC 3;  3OY8 B;  3PIG A;  3C7G A;  2NLR A;  3LFM A;  4IV3 C;  5EZW A;  3TEW A;  3KT4 A;  1DQ6 A;  2UWB A;  4NRQ A;  4BQ1 A;  2DFB A;  2E31 A;  2O1Q A;  2WNV B;  1UAI A;  1X33 A;  3ES4 A;  1A78 A;  1CON A;  1W6M B;  1MS0 A;  2YB7 A;  1VIW B;  3KQ4 B;  3N9O A;  2HJI A;  1W3X A;  3DGT A;  1V9U 2;  2Q8D A;  4QM8 A;  1J3P A;  4JC1 A;  1U5I A;  2SLI A;  3AZV A;  5HCF A;  4Q4X 1;  1LU1 A;  3M3E A;  3WQ0 A;  3I3Q A;  5L9R A;  3USU B;  3QCW A;  1HRV 2;  1N47 A;  3CLP A;  4XF0 A;  4XW3 A;  1W90 A;  4JZR A;  3WIN E;  1A34 A;  3AKQ A;  1SLC A;  3IAQ A;  3HN1 A;  2UU8 A;  1P8J A;  5FY7 A;  4Z8B A;  1FV2 A;  4L9B A;  4N53 B;  4PDW B;  3H9A A;  1DZQ A;  4LBN A;  2WFP A;  1PO1 1;  1UD1 A;  2VCB A;  1HV1 A;  2NMO A;  3INA A;  1YRZ A;  2KM2 A;  5BYN A;  5CAZ A;  2WSU A;  2O0O A;  4JV4 A;  3T1L A;  1W8O A;  4MHR A;  5AVA A;  2B46 X;  4IER A;  3O1U A;  2DVA A;  2EAA A;  1V6L A;  4N7I A;  5F3E A;  3BTA A;  4NWV A;  3I59 B;  4PF1 A;  4KGQ A;  1V6I A;  1T6B X;  4ASL A;  4LTA A;  4CP2 A;  1Z7S 1;  1UYY A;  3I4I A;  2GAU A;  3NV2 A;  4IEW A;  1MEC 3;  4QXC A;  1R08 2;  1PK6 A;  2ZGK A;  4FI9 A;  1GQH A;  2R7E B;  1LU2 A;  2BNO A;  3AYD A;  3J7N A;  5E8A A;  3ORJ A;  1V6K A;  4HKO A;  2RMU 1;  5FZ8 A;  3QLQ A;  5ABJ A;  4COZ A;  4Q8L A;  2X8K A;  1JZ8 A;  1SPP A;  1VR3 A;  4KBB A;  1YI9 A;  3DEC A;  4CU9 A;  2B5H A;  4YVS A;  2RS1 3;  2DYC A;  3KSC A;  5JCT A;  1BVV A;  1ZA7 A;  1PGL 2;  2X5I C;  2A3X A;  4TWT A;  3KLS A;  3CBN A;  3IT8 A;  2P5B A;  4E4H A;  1CAW A;  3CIH A;  5FMC A;  2VOK A;  1W6Q A;  2WAB A;  2WNU C;  2W39 A;  1OOP C;  2ZAA A;  3HNM A;  4P5Y A;  4R52 A;  1IS6 A;  5IT6 A;  3UL2 A;  5HI0 A;  1KFX L;  3H7Y A;  2GNB A;  4UI9 L;  1L3J A;  4QQH A;  4ZZ8 A;  1GU3 A;  2HH9 A;  2YFZ A;  4HKL A;  1RUD 2;  1OPO A;  4M3C B;  3VBH A;  4PLM A;  5IAT A;  4LO6 B;  1LKN A;  4KWK A;  4MGS A;  4AE2 A;  2ZEW A;  4XF4 A;  5FYH A;  1H2L A;  5FZL A;  4IE5 A;  3VHP A;  5KXB A;  4PIX A;  3PUI A;  4X8N A;  4ATE A;  2ZAH A;  5C5T A;  4AWD A;  5A33 A;  4D7T A;  1CGP A;  1D0H A;  1MVE A;  2CHH A;  2YPJ A;  2ZKN A;  4JKK A;  1F2N A;  1AYN 3;  1XNT A;  2NM1 A;  2VOX A;  2ZTN A;  3BU7 A;  3C7F A;  4XJU A;  3V64 A;  3WCS A;  4COY A;  5FOJ B;  1AR9 3;  1GNH A;  4I01 A;  1FAY A;  5JSR A;  1AR7 3;  3NNF A;  5FPA A;  3ZLI A;  4C0B A;  5HPO A;  3ZIX A;  2XVK A;  3E6D A;  2JDH A;  4HG6 B;  4G9S B;  4GJY A;  3WD5 A;  4FPJ A;  5C4W A;  2IWG B;  3OD0 A;  4QGN A;  3S6P A;  1UIK A;  2VZ3 A;  3OEB A;  4TN7 A;  5JSO A;  1GZT A;  1POV 3;  1NQJ A;  4BQ4 A;  4NOT A;  3AP6 A;  2LUW A;  4LA3 A;  1CAX A;  4LO8 A;  3ZYP A;  2WZR 1;  4EN8 B;  5KHG A;  4WM7 A;  2AAC A;  3LFI A;  2Z42 A;  1U5Y A;  1UZW A;  3D4K A;  2AR6 A;  1ND3 A;  2W47 A;  1OLM E;  1IGO A;  3VDD B;  1XQN A;  3R4U A;  1V6M A;  2GNT A;  2QQM A;  1HB2 A;  1TME 2;  1LHW A;  2VQA A;  4WM7 C;  3O1R A;  4W6X A;  2QDR A;  1UY0 A;  3GCX A;  1QQP 3;  2G4I A;  2Y6L A;  2VTX A;  3LPG A;  3UJQ A;  1JZ7 A;  4FPH A;  1RIT A;  4DIN B;  3H8O A;  1XE8 A;  4LT5 A;  1QJX 1;  3A21 A;  1UY3 A;  4JQR A;  3CHX A;  2P37 A;  1KRI A;  5CVR A;  2DVF A;  2PTM A;  1Q8P A;  1IG0 A;  2ZGO A;  2J1T A;  4AED B;  4AVT A;  1G9D A;  5T52 A;  4Y5Z 0;  1C4R A;  3IN9 A;  4OUM A;  3J7H A;  4QHO A;  2R06 1;  5FYZ A;  3B9C A;  5IVC A;  4JGZ A;  1IG3 A;  5L7O B;  3VBU C;  4RHV 1;  1FOD 3;  1AR8 1;  2VVF A;  3HT1 A;  4LIV A;  2DWR A;  4AQ6 A;  4IEY A;  2QQV A;  3AJZ A;  3NV4 A;  5H9Q A;  2BU9 A;  1U5Z A;  2RS5 1;  4FP3 A;  4AI3 A;  4YSF A;  3J7L A;  2GC2 A;  4CXW A;  2J42 A;  3AMM A;  1JXN A;  4FFG A;  2A6V A;  1VBA 2;  4XZP A;  2AEN A;  1UXX X;  3CJX A;  4YW1 A;  2WBK A;  3WF0 A;  1V0A A;  1KXG A;  5J36 A;  2BPA 2;  1ENR A;  4XDQ A;  5C8C B;  1RVF 1;  3LF7 A;  3OBT A;  4XOG A;  3VZJ A;  4ES8 A;  3FFZ A;  3OPW A;  4YGD A;  5H9S A;  3GBW A;  1QJU 3;  1AF9 A;  1H8T C;  4RR3 B;  2CTV A;  4AGV A;  4D6Q A;  1Q3E A;  3JXS A;  4LKS A;  1NCQ A;  2IVJ A;  3ZXF A;  1K5M A;  3JZV A;  5HCB A;  2P6H A;  4XAE A;  5T50 A;  2P17 A;  3HMY A;  3K75 B;  1W8F A;  4WZF A;  5DAV A;  1A8M A;  2XUM A;  5EPA A;  3R6S A;  1SMV A;  3TYJ A;  5ACA 1;  3WG4 A;  5JPM B;  3H8R A;  4M0N A;  1VLN A;  1U0A A;  3LA7 A;  4ZXE A;  1W6O B;  3CKH A;  1PO1 2;  3DYM A;  3I2J A;  2GMP A;  4NVP A;  4Y1Z A;  5F6K A;  1PVC 1;  4Y20 A;  4QPI B;  5A6X A;  1V9U 3;  4XET A;  2BNN A;  4JKM A;  2VZT A;  1FMD 1;  1JH5 A;  5A7S A;  3E97 A;  1KIT A;  2R16 A;  1HRV 3;  3NAP B;  4HK8 A;  4M0H A;  4OYU A;  3TRS B;  5KBF A;  5A32 B;  1HLC A;  4QPG A;  4NPL A;  3GHN A;  5JZG C;  4XQ4 A;  4H7L A;  4Y5S A;  5FXW A;  3N7K A;  1NY7 1;  5T55 A;  5K0U C;  5G05 L;  2QQU A;  2DUQ A;  4GQ7 A;  3EBR A;  3SH4 A;  1D2S A;  3F95 A;  1WA4 A;  3SLI A;  2EF6 A;  1AR6 2;  3RVH A;  4N8M A;  4I0B A;  1W39 A;  3BPZ A;  1DGW A;  4CTE A;  5B4N A;  1JYN A;  3VKO A;  2YXS A;  4QDS A;  4AZZ A;  4EE2 A;  3MBW A;  4XFB A;  4MXW A;  4PI0 A;  2C9A A;  2VZV A;  2Z4F A;  1JYC A;  3Q9O A;  4CCK A;  2QQN A;  4NRM A;  3OGS A;  2YPD A;  4RYD A;  5LBC A;  5F3I A;  4CCE A;  4QKD A;  2WLP A;  1UXZ A;  4XQW A;  3UET A;  1GOH A;  1TMF 2;  2CV6 A;  4XFC A;  4K6B A;  3O0V A;  5A3U A;  1W6N B;  1R08 3;  2W3J A;  3T2P A;  1OFS A;  3FUQ A;  1SQ4 A;  1F8V A;  1DQ1 A;  2X10 A;  1FPN 1;  1H0B A;  2BUK A;  2YHJ A;  3T4V A;  2VU9 A;  3WSO A;  2A7A A;  1RXF A;  2RVA A;  2PHL A;  3I2F A;  1EAH 1;  3KF5 A;  5FUN A;  5IW0 A;  2G9G A;  5F2W A;  5FZ3 A;  2ET1 A;  1I3H A;  1HIX A;  2CDO A;  3C7O A;  2WYF A;  4FOV A;  1H30 A;  2D7F A;  4BJ0 A;  2B9U A;  2P1B A;  5JUV A;  1C8M 1;  4GAL A;  3BVC A;  1HB3 A;  2VY0 A;  4A44 A;  4OMC A;  2WQ4 A;  4FT8 A;  4L2N A;  1HN1 A;  1YQ5 A;  5FXZ A;  2R04 1;  1RUE 1;  5FQ0 B;  4DXZ A;  4GKX A;  3SQO A;  1NAE A;  1JZ2 A;  3BYW A;  3JB4 C;  4MX3 A;  4LHK A;  4M01 A;  5JIA A;  1O3S A;  3K4A A;  3PVB B;  1VRB A;  4M3C F;  1W6P B;  3IKW A;  2BVB A;  1QH7 A;  2ZEX A;  2ARX A;  3E6C C;  1FX5 A;  2P3K A;  5CG8 A;  3UKT A;  3WHT A;  4AFM A;  4AFB A;  3L2Y A;  4HET A;  2JJ6 A;  4RN5 A;  5LY1 A;  1CVN A;  1M4W A;  3WW3 A;  5BNQ A;  2FCV A;  4FSJ A;  1HRI 1;  3B02 A;  3RZL A;  2ZXQ A;  2C4X A;  1RUD 3;  3EHK A;  3P6B A;  4GUL A;  1VBB 1;  1JZ3 A;  1APN A;  1YLL A;  2ZA9 A;  2ZOE B;  3OOX A;  3J4U H;  1GYK A;  5JOW A;  4KWL A;  1MS1 A;  4CP0 A;  1IKP A;  3WNM A;  2NN8 A;  2QDN A;  5FZH A;  4OI4 A;  3CL1 A;  3NV3 A;  2PHR A;  1I9R A;  1VBC 3;  2A3Y A;  3ILF A;  4UFI A;  2WQZ C;  3KWV A;  4FAH A;  3PTR B;  5FYS A;  2OVU A;  2QBX A;  4KNC A;  3MEP A;  4YM3 A;  4UT5 A;  1I1E A;  4QU1 A;  5T5J A;  2JIG A;  1W9T A;  2LW8 A;  2WZR 2;  3OY8 A;  3WG2 A;  4EWE A;  4FPC A;  1DU3 D;  5L73 A;  4AGG A;  5AC9 2;  5F1R A;  5GM0 A;  1LGC A;  2WA3 A;  4TSV A;  2I2S A;  4V2W A;  3V0A B;  3JBG 3;  3VZL A;  4IEZ A;  4CDU A;  2WYS A;  4IDZ A;  2C26 A;  4HXC A;  2NPI A;  3CDZ B;  4HVR A;  4MG2 A;  1W6M A;  1NX9 A;  2XWB B;  2ZML A;  3P1I A;  4FPK A;  4XIO A;  5JLV A;  3O1O A;  2EA7 A;  3AZZ A;  1REF A;  1E5H A;  4NHX A;  4YGE A;  4QGL A;  1BQP A;  2NZ9 A;  5F2S A;  2Y64 A;  5GLT A;  2WNV C;  3NRU A;  3S30 A;  1JYT A;  3ZMO A;  5C6C A;  1OKO A;  1HB1 A;  1QJX 2;  4XDO A;  1RGS A;  4B4R A;  3USU A;  2WII B;  2D6O X;  4A4A A;  3RZM A;  1ZRI A;  3I54 A;  5FPV A;  1UYP A;  1JZ4 A;  4OUL A;  2V4V A;  2JKX A;  4KL1 A;  4Q4W 2;  4YW5 A;  3WF1 A;  5JXI A;  1TME 3;  2R06 2;  1HX6 A;  2XLA A;  2BER A;  4N7U A;  3RZZ A;  4AEK A;  4XFA A;  4B8E A;  1R09 1;  4YZ5 A;  1AR8 2;  2J1E A;  2QE3 A;  2R49 A;  1W04 A;  4N53 C;  4PDW C;  1UYX A;  3AB0 A;  3T08 A;  3JB8 A;  1XRU A;  2ZMN A;  3EMR A;  2HEV F;  2AH2 A;  1F15 A;  2RS5 2;  2X5I B;  4BIS A;  3GJB A;  3MIH A;  4KH9 A;  2F4P A;  3MZH A;  4RA0 A;  2FDK A;  5LA9 A;  2O8Q A;  3FLT A;  3I59 A;  2EXH A;  3JUU A;  2ORZ A;  1Y3T A;  2IZW A;  1K5J A;  2RS3 2;  2Z2S B;  2QQI A;  2EIB A;  4YG6 A;  1LNS A;  5I0U A;  1WD4 A;  2LTN A;  5EJZ B;  4N43 C;  2WFF 2;  3O1T A;  1UZZ A;  2BYV E;  1RVF 2;  3AZY A;  4DO0 A;  1W0N A;  2XXZ A;  2OX0 A;  4FBF A;  1NQD A;  1QQP 1;  5FP3 A;  4QXH A;  4COU A;  1SG3 A;  4Q2F A;  4D69 A;  3WNL A;  4QM9 A;  1OC1 A;  3NJV A;  2A70 A;  2UUR A;  3OCP A;  4AGR A;  3IDE A;  5BNP B;  2JDN A;  1PIV 1;  4TLF A;  3KVA A;  2VBP A;  1ODN A;  5GZD A;  4HFS A;  2A71 A;  1PX3 A;  2PHX A;  1S1A A;  5F5Q A;  5ACA 2;  2FMY A;  3A22 A;  5ANQ A;  5FZ6 A;  4XFH A;  5T3N A;  5A1A A;  3UK9 A;  4BIO A;  1T2X A;  2BRT A;  1GLH A;  2E9Q A;  1NE6 A;  4XHB A;  4A45 A;  4A2U A;  1XNC A;  2RG4 A;  5KXE A;  4A6O A;  1FMD 2;  3AX4 A;  1OUR A;  4Q0S A;  3VBS B;  4Q4X 3;  4IGP A;  1BK1 A;  1SCS A;  1H1A A;  2JD4 A;  5BNN A;  4CCD A;  3H8X A;  4CXY A;  2CGN A;  1POV 0;  1RUC 2;  4M3C A;  4BQX A;  1NY7 2;  1ENX A;  4IUG A;  5E88 A;  3V65 A;  3LAG A;  4CDX A;  2ZGQ A;  4SBV A;  2B7Y A;  4AEJ A;  3S5Q A;  2BFU S;  1JBC A;  4B29 A;  1U12 A;  1PO1 3;  3FJS A;  5F9T A;  3LZZ A;  1PMJ X;  4HVQ A;  4RGA A;  5DXD A;  2V09 A;  3H1Y A;  4MYE A;  5FUP A;  2I07 B;  3DN7 A;  3E5X A;  2XQX A;  1ENS A;  5C5U A;  3SKV A;  1LEC A;  1UN1 A;  1ZZ9 A;  2JDM A;  4C1X A;  5G04 L;  4KWJ A;  1M06 G;  3ZXG A;  1H1I A;  2W2I A;  5GKA C;  4BM8 A;  1W05 A;  5J48 A;  3KCY A;  3AP4 A;  1BYH A;  2JDZ A;  1Z7S 3;  4EN6 B;  5FO8 B;  2EAK A;  3EYP A;  2GC3 A;  2XON A;  4ISR A;  5F37 A;  1FPN 2;  5I0S A;  1ZVF A;  1VB2 A;  3I2G A;  4N90 A;  2Q1F A;  2CWS A;  5IVE A;  1A3K A;  2WZ8 A;  3I3D A;  3ST7 A;  3PHM A;  2RMU 3;  5FP9 A;  2CGP A;  1OLQ A;  5D21 A;  2XVL A;  3QAC A;  3N3H A;  2DCZ A;  4Y33 A;  3WQB A;  1NYW A;  3LIH A;  2W1W A;  2Y6G A;  2KD7 A;  1C8M 2;  1LOF A;  4Y1X A;  1RUF 1;  1ZZC A;  4ES9 A;  5AFB A;  2IXI A;  2JG9 A;  3U11 A;  2R04 2;  3VDD A;  1RUE 2;  4P9G A;  3PTY A;  3VZN A;  1O7F A;  5I8Y A;  1TEI A;  3MPB A;  4YM2 A;  5FWJ A;  2JEC A;  4Y26 A;  1E5I A;  2Y38 A;  5F5I A;  1EPZ A;  2C5D A;  1C1L A;  1QXJ A;  1X36 A;  5E6H A;  2G9F A;  1X9T A;  2A73 B;  3OUJ A;  4FOY A;  4LHL A;  5IVB A;  1NA1 A;  4UFL A;  3ACF A;  1OF3 A;  1RUG 1;  2HYK A;  3PU8 A;  4IE7 A;  2VUL A;  3RYR A;  1UX7 A;  1W2N A;  2OZJ A;  4MXV A;  2EXJ A;  4P9W A;  4CU8 A;  3D0S A;  4AED A;  1VBB 2;  2DF7 A;  4MGK E;  4OZX A;  1H8T B;  2RS1 2;  3IDB B;  4LKF A;  3VKF C;  3KT1 A;  5D2A A;  5L19 A;  2CYF A;  1PGW 1;  1BEV 1;  5LBE A;  3ZYG A;  4AVA A;  5L7O A;  2DUO A;  4AHW A;  1ULO A;  1DQ0 A;  2G19 A;  2GME A;  5A70 A;  1LB2 A;  3D8C A;  4AED C;  3MPP G;  5EXO A;  3ZFF A;  1JS9 A;  3B93 A;  1WUV A;  1ONA A;  5FAX A;  2K0G A;  3B01 A;  5IK7 A;  5LEJ A;  2RDS A;  5FBJ A;  2GNM A;  2VAU A;  4NIG A;  3VD4 A;  1SLA A;  2FCT A;  4XJ8 A;  5LZ6 A;  1J58 A;  2VW2 A;  5SV5 A;  4NJ4 A;  4R9A A;  1GWM A;  1AJO A;  1QF3 A;  5A6Q A;  2P34 A;  4ZU7 A;  1OXC A;  3K4Z A;  4AI9 A;  1OT5 A;  3KV6 A;  2ENR A;  4AQ2 A;  4XC9 A;  5C8C A;  1VBE 1;  4A42 A;  2FDH A;  1Z78 A;  1ZZ6 A;  5JZG B;  2ET7 A;  4MH0 E;  2PLV 1;  4LUM A;  2ADE A;  5FPU A;  2VUA A;  2NYY A;  4NRO A;  1HV0 A;  4FQ4 A;  4ZU5 A;  4Z2A A;  1I5Z A;  1AR9 2;  5C8C C;  3UT0 A;  2XJS A;  4M4R A;  1XNA A;  2D93 A;  2Y33 A;  4NPM A;  4D7S A;  5DPN A;  3NW4 A;  2P3Y A;  5FY0 A;  2ZHM A;  4COV A;  4RR3 C;  1YCI A;  2HBT A;  1PGS A;  2BWA A;  3MGU A;  5FZO B;  1UU4 A;  5I0T A;  5LAT A;  2WC2 A;  5EV7 A;  4K20 A;  3ES1 A;  4ZPI A;  3LWC A;  1W6O A;  2RJ2 A;  3W20 A;  3LEI A;  3POG A;  2VTX J;  1RUH 1;  4QPI A;  5D1I A;  3ACI A;  2D97 A;  4U2A A;  1R09 2;  2OUJ A;  3W5M A;  3TNP B;  3BTX A;  2DFC A;  1QJX 3;  4FFF A;  3NAP A;  3VZM A;  5A32 A;  2RV9 A;  1W9Y A;  3O1S A;  3OUI A;  4RQP A;  4QPI C;  2FD8 A;  2FDI A;  3THP A;  4CEW A;  1LTE A;  3OF1 A;  2VGD A;  3FHQ A;  1OVP A;  3T09 A;  3BN6 A;  5CG9 A;  5I8T A;  2YRO A;  1XU1 A;  2R06 3;  3T4H B;  3E1F 1;  3H3L A;  1Y9M A;  3KMH A;  1RHI 1;  4RHV 3;  4CVU A;  3HBZ A;  3ETP A;  1HB4 A;  1GR3 A;  1QQP 2;  1SDD B;  2YZ4 A;  1RC6 A;  1CQ9 A;  3WDU A;  2PQS A;  5FUI A;  3VUO A;  2RS5 3;  4YNI A;  3IAP A;  2CWM A;  3ZPY A;  2Y6J A;  2VBD A;  5HCH A;  2BNM A;  5C3R A;  2VD7 A;  1PM4 A;  1WBL A;  1OUX A;  1PIV 2;  2C6S A;  2VR4 A;  4JDN A;  4XUO A;  5C8W A;  3D82 A;  4DEQ A;  3AYC A;  5IFP A;  1WBF A;  1RVF 3;  2R0H A;  3H7J A;  2BTV C;  1NCR C;  2TEP A;  3AYE A;  4S2G A;  3W21 A;  1FOD 2;  1OBN A;  2GH8 A;  2E6V A;  1UMH A;  4PIY A;  4RFR B;  4RD7 A;  1HN0 A;  4BMB A;  1XSR A;  1ZBA 1;  4LE3 A;  5FZ0 A;  5I0R A;  2ERF A;  1D4V B;  3PVE A;  1X8E A;  3DXT A;  4XXP A;  3ETQ A;  3ZXE A;  1YQ6 A;  2MNG A;  2VCC A;  3RWN A;  5ACA 3;  1GV9 A;  2RHP A;  5AFE A;  4BLI A;  5FQ0 A;  1CAV B;  4DUV A;  2CAV A;  1PO2 1;  1O8S A;  3I2H A;  1V6J A;  2OW4 A;  3RNS A;  3J8F 1;  4NE9 A;  3POS A;  3OBA A;  5FPL A;  1AL0 G;  1QHD A;  4XBQ A;  3KGL A;  1PVC 3;  3J9S A;  4HN0 A;  4ZS3 A;  5GLV A;  5LCW L;  5FXX A;  2ZCW A;  3O12 A;  1FMD 3;  1Y7B A;  2K9Z A;  3SXW A;  1STM A;  2A75 A;  2VZQ A;  3B00 A;  4I3P A;  3CMG A;  4ZU4 A;  1HDK A;  1DGL A;  5DG1 A;  4ISQ A;  1ZRF A;  4GWJ A;  4OHV A;  1XNB A;  3Q8A A;  3ZSJ A;  2VW0 A;  1AJK A;  3HD8 B;  2VZ1 A;  4R4Z A;  2R30 A;  4LE4 A;  4ERO A;  3MW3 A;  1YO8 A;  1HXS 1;  1MAC A;  2YG0 A;  5CNA A;  2Q8O A;  5FYI A;  5FO9 B;  5KHK A;  2XGX A;  4WV8 A;  2W46 A;  3OGR A;  3KCX A;  1S0E A;  4LBK A;  4WVM B;  4A3X A;  5FP8 A;  2H0B A;  1XJA A;  3MW2 A;  1Q8O A;  2YYO A;  5JSP A;  2Q30 A;  2J22 A;  2VNG A;  5IAX A;  1UIJ A;  4YGB A;  1OPM A;  1YHF A;  4IGQ A;  4NII A;  2PHU A;  5DAQ A;  5K9Y A;  1FPN 3;  1DLC A;  1F35 A;  3CO2 A;  2CU5 A;  4BHP A;  1PZ9 A;  5JWP A;  4E2G A;  3U0Z A;  3BU0 A;  1C1F A;  1EAH 3;  1CR7 A;  4HSL A;  1B35 C;  4W4Z A;  2AUY A;  4IW3 A;  2XVG A;  5I0D A;  1HQW A;  3MFC A;  4D94 A;  1BLZ A;  3PVO A;  4N43 B;  3RGB A;  1LRH A;  1BXH A;  3X29 B;  3O14 A;  3ZR5 A;  2P3I A;  4IEX A;  1C8M 3;  3PL0 A;  3WDY A;  1COV 1;  1AXK A;  2W9X A;  4M3C E;  2YC2 A;  5L36 A;  2ZZJ A;  1L7R A;  2R04 3;  5DAP A;  1RUE 3;  4LBQ D;  5ERL A;  4BXS V;  4YVW B;  1W8Z A;  4F3J A;  1N1V A;  4BK5 A;  4PCR A;  4UOJ A;  2DVG A;  4FQZ A;  5FZG A;  1PGW 2;  1BEV 2;  1WW7 A;  4ZS2 A;  3WHU A;  4FP2 A;  4FPG A;  3H3U A;  2XR4 A;  1GKB A;  4WM8 B;  3GDB A;  2Z79 A;  1OQ1 A;  5EYX A;  1DYK A;  1ZX5 A;  2MEV 1;  2QVS B;  2X5I A;  2YMZ A;  4FCA A;  4LOT A;  3PMS A;  4XJ9 A;  5DDJ 1;  5CFD C;  2FCU A;  5A7N A;  1HRI 3;  3SH5 A;  3GZU C;  5LA0 A;  1VBB 3;  1YJK A;  3LB9 A;  5M0T A;  2WNU A;  1O5L A;  1OOP A;  2V5D A;  4YW7 A;  2ZGS A;  4B4P A;  5H9R A;  5C7G A;  1W9F A;  4FPL A;  4HK9 A;  2HKX A;  3ATG A;  4QAW A;  1ZM1 A;  2QUO A;  5FTT C;  1MR5 A;  3NKG A;  4HL0 A;  5CAD A;  2EID A;  4QWN A;  2WL1 A;  4UFK A;  3WUC A;  1W8H A;  2BVV A;  2ZMK A;  3Q8F A;  4AR2 A;  2PLV 2;  4X6R B;  1ASJ 1;  2XDV A;  2LRP A;  3USS A;  1N3P A;  3TN9 1;  5BNP A;  1LEN A;  3P5B A;  4BB3 A;  2VG9 A;  5BNO B;  4QT6 A;  1LHO A;  4XTM A;  3ALQ A;  2P3J A;  1ZBE 1;  4EN7 B;  2HWF 1;  3ZOI A;  5BNP C;  3IPV B;  2DUR A;  4HVO A;  1ZZ7 A;  3WR0 A;  3VL8 A;  1EV1 1;  2DBI A;  3QD6 A;  4YM1 A;  1V00 A;  3MUY 1;  4RFT 0;  5FLJ A;  2K2S A;  1VAL A;  4JVA A;  1OFN A;  3V56 A;  4BLJ A;  1DGR A;  1NG0 A;  1TQ5 A;  2GMM A;  1PNF A;  4QDR A;  1VBC 2;  4H3W A;  5A7O A;  2OII A;  4ZXK A;  2HLE A;  4OMD A;  1NLR A;  3KZ4 C;  2JE9 A;  4IEV A;  4OHX A;  3NJZ A;  2WNO A;  5IYY A;  2VMI A;  1SLB A;  3ASI A;  3GYD A;  4FVV A;  1TE1 B;  3T2O A;  3ZXD A;  4ASM B;  1OLR A;  3SKJ E;  1AXZ A;  1LOE A;  2BGC A;  4ORF A;  4YM0 A;  5C33 A;  2PHD A;  4XUR A;  5BPX A;  3VBS C;  4DXS A;  4AI2 A;  1QMJ A;  4C8D A;  3JBG 2;  4NO4 A;  2NQY A;  1GNZ A;  1UO9 A;  2OQ7 A;  1EP0 A;  1IQA A;  4CP1 A;  5A3T A;  2VL4 A;  5JPN B;  1RHI 2;  1N1Y A;  1R09 3;  3ZYB A;  2OT7 A;  3GZE A;  2QKD A;  1EUU A;  3N9Q A;  3UYJ A;  3ZSK A;  1Y4W A;  2E7T A;  1CZS A;  3K3N A;  1GQP A;  3N7L A;  2A6Z A;  2OZ6 A;  4V2V A;  2JE7 A;  3VBR C;  4XF1 A;  3UNP A;  1WKY A;  2EVX A;  1ND2 C;  3MLL A;  3BB6 A;  2ETE A;  1UOB A;  3TEZ A;  5FPZ A;  3ZX7 A;  3PUQ A;  2Y34 A;  1YYN A;  2PA7 A;  3DPR C;  2JIC A;  4LBM A;  4P5H A;  4XEZ A;  1QKQ A;  5B4X A;  3WNX A;  4YYO A;  4O9E A;  1SLI A;  3A7Q A;  5EJ1 B;  1WWY A;  4XUN A;  4E27 A;  3KF3 A;  3RYK A;  4AHZ A;  4RS5 B;  4S2H A;  1LGB A;  1RIN A;  1ZBA 2;  4IV1 B;  1KS4 A;  1VE0 A;  2LS6 A;  1XND A;  4L8Q A;  1ULD A;  3ZVX A;  2WQ8 A;  2WO2 A;  3AP5 A;  4MUV A;  4OZO A;  2ZHL A;  1PIV 3;  3FLR A;  5F3G A;  3VBU A;  2AZ5 A;  2DBN A;  4EJR A;  5LA1 A;  4LBO A;  4OI1 A;  2K46 A;  4Y1V A;  3BOP A;  3ZXA C;  1D4M 1;  2VMD A;  1Z0H A;  3VGI A;  2XHK A;  3U78 A;  4LKD A;  1PO2 2;  1UZ0 A;  5GLU A;  3J8F 2;  2IXH A;  2WAO A;  1B09 A;  1MS3 A;  1NOV A;  2ZGR A;  4MGZ E;  1OI6 A;  3OTF A;  5DMY A;  5F5A A;  4O61 A;  2F6B A;  3THC A;  2VXR A;  3WP3 A;  1DCS A;  1QJE A;  1VPH A;  4NHL A;  5BUV A;  4EN0 A;  4LBL A;  1WCS A;  5L9B A;  1UY2 A;  2DU1 A;  3IDA A;  3M8L A;  2Q1M A;  2FMD A;  1CJP A;  2D43 A;  3LGR A;  4YG0 A;  3RDI A;  4AHX A;  4HBN A;  4AFC A;  4AOC A;  1H8T A;  2YC0 A;  3NKT A;  3C3V A;  4DZG A;  2A3W A;  3I3E A;  1DLL A;  2JDU A;  3U37 A;  1LHN A;  1HXS 2;  1N3Q A;  1WW4 A;  1H4H A;  4IE0 A;  5D8A C;  2ZKL A;  4B7K A;  4KBZ A;  2Y60 A;  2JEN A;  3OGV A;  2EIE A;  2E32 A;  4Q4X 2;  3U4X A;  4COW A;  3PUH A;  4CDW B;  1S0D A;  4CDQ B;  3QBQ A;  1FNY A;  3LIG A;  2BEO A;  1Q56 A;  2RE9 A;  3NNL A;  4LLF A;  1GBG A;  2VQT A;  2B39 A;  4JGY B;  1MZ6 A;  2BGP A;  5LBB A;  4IET A;  5DAX A;  4PJY A;  3T0A A;  2IXJ A;  4J25 A;  1J3Q A;  1FAT A;  1XU2 A;  5JZG A;  1W06 A;  1JYX A;  5K0U A;  1ULP A;  4NR1 A;  2XBO 1;  4I0W B;  1UL9 A;  4AAP A;  1AYM 1;  1UKR A;  2IUW A;  5CU1 A;  4CZS A;  1TG7 A;  2PXJ A;  1MVQ A;  3VBF B;  1JMU B;  2R07 1;  2DCJ A;  3R05 A;  4AVS A;  4GZ9 A;  4GXL A;  1RUF 3;  4XE9 A;  1COV 2;  2D6N A;  1RUJ 1;  3AK0 A;  4PQ9 A;  3NL1 A;  1RMU 3;  5FOB B;  1G9A A;  3ILR A;  1Z7S 2;  1S0J A;  2W0X A;  1WLD A;  3EB7 A;  5FPB A;  5A7W B;  4GMP 1;  4AFD A;  1AL2 3;  3ZXL A;  3URF A;  4MAD A;  5CB7 A;  2WSV A;  4AI8 A;  4AAX A;  4MO3 M;  2F4L A;  1G6N A;  4RGK A;  5FZI A;  4QXB A;  1OKQ A;  2RMU 2;  3B94 A;  3N36 A;  5A3P A;  1R64 A;  3O1P A;  1YFX A;  1X7N A;  2MEV 2;  1R1Z A;  2OA2 A;  1RUG 3;  3HQX A;  1GQG A;  4MV2 A;  4Q27 A;  3HN3 A;  1NCR B;  2ATF A;  4URT A;  5CFC B;  3RWK X;  5CIR A;  4DS0 A;  1GWK A;  4CPB D;  3AMH A;  1G86 A;  2WZE A;  1OMI A;  4Z07 A;  2Q8C A;  3BUC A;  2ZGT A;  1JOD A;  3RJ2 X;  3WG3 A;  4Y5T A;  4D6S A;  1BEV 3;  3GAL A;  5HV0 A;  3W58 A;  5C9A B;  2OPW A;  4LQR A;  5JXG A;  2ZGP A;  1CZV A;  2C24 A;  2WN3 A;  3LDK A;  2WLQ A;  4QB6 A;  5BXX A;  4ET7 A;  1RED A;  2RR1 1;  2XJQ A;  4G4F A;  4OI0 A;  4XYX A;  4BE3 A;  2ZBJ A;  4KMQ A;  4DRV A;  4Q1P A;  2YU2 A;  1H8V A;  1MQT B;  3WVJ A;  1T6G C;  1W2U A;  2Y26 A;  2XJP A;  4GH4 B;  1YC6 1;  3NJX A;  4YG3 A;  1VJ2 A;  1ZBE 2;  1G9B A;  2C1F A;  1IPS A;  2XL9 A;  1UPI A;  3WG1 A;  3CF6 E;  4E9K A;  1K12 A;  1VBE 3;  4NRP A;  1W8T A;  3SEP A;  2PLV 3;  3O1V A;  2B45 X;  2BGO A;  2B9V A;  5FK8 A;  4ARY A;  5JAX A;  4UBG A;  2VCA A;  4NN0 A;  1S0I A;  2OQ6 A;  3BPS A;  3M1H A;  4CEY C;  4LO4 B;  4N9H A;  1JYW A;  4PLO A;  3PJY A;  5JOZ A;  4MGT A;  1BCX A;  4JDO A;  1LJ7 A;  4RSU A;  4AQT A;  3GNE A;  4Q0P A;  3ZFE C;  1W9W A;  4XF9 A;  5FIX A;  3RS6 A;  1IHM A;  4HOO A;  1CAV A;  3KB5 A;  4P9Y A;  5FWE A;  5JXH A;  4MLO A;  3LE0 A;  3VD3 A;  1BBT 1;  2D6L X;  4EYU A;  1PX4 A;  1RUH 3;  3O5S A;  2HWB 1;  2YV8 A;  2W5F A;  3MDP A;  3PUS A;  5FY9 A;  1DZR A;  3CZU A;  1W2O A;  4BU2 A;  3MFA A;  2ZX0 A;  1CES A;  1QJZ A;  3MIG A;  4B1M A;  2W1S A;  2KA3 A;  1ZZ8 A;  3KS7 A;  3AJY A;  1MPX A;  4XUP A;  2IFW A;  4QGM A;  1MZ5 A;  4Y1U A;  3GBG A;  3K4D A;  4IND A;  1B35 B;  4GJZ A;  5T5O A;  3ZPO A;  5KC6 A;  1GWL A;  2WNV A;  2VVE A;  2ZPX A;  5DUX A;  5FK7 A;  3NV1 A;  3WV6 A;  5T54 A;  2JE8 A;  2WAA A;  1Q43 A;  1UPS A;  3I2D A;  1RHI 3;  4HT1 T;  2WS9 1;  2IVI B;  3IMN A;  4CCL A;  2YUE A;  1VRH 1;  5FV3 A;  1PMH X;  2HWC 1;  5GZG A;  3LCP A;  2WKK A;  1UY1 A;  4R9C A;  4FO9 A;  5FMD A;  4TTG A;  3H0O A;  3ZSM A;  4CUB A;  2DV9 A;  4K1Y A;  1BHG A;  4N53 A;  4PDW A;  5DAW A;  1UY4 A;  3AC0 A;  5JMC A;  1W28 A;  1D4M 2;  1DGR N;  1G7Y A;  1GZW B;  1XOY A;  2BQP A;  3OPZ A;  3U07 A;  4E4Z A;  2D6P A;  2KR2 A;  4QX3 A;  5CFD B;  4ITC A;  4Y4R A;  1K3I A;  1NZI A;  3P3N A;  1IOA A;  5E1R A;  4RHV 2;  2PAK A;  3ZN5 A;  4IES A;  1ZBA 3;  4OVE A;  3VB9 A;  4CCM A;  4M00 A;  3ZYR A;  1WLC A;  4N43 A;  2XLF A;  4LK6 A;  1WCD J;  5GZE A;  1C5I A;  3NMB A;  4LJH A;  1QJY 1;  4QQO A;  1YUD A;  1WW6 A;  3IZO A;  4LEJ A;  3E6B A;  2PEL A;  1QOO A;  2I45 A;  2JDY A;  3BAL A;  4YVW A;  5HXV A;  1OD3 A;  5J37 A;  3KHC A;  1PO2 3;  4QB1 A;  4OQ9 A;  3III A;  3J8F 3;  1C28 A;  4H2A A;  2ORX A;  3PUR A;  4OUS A;  4W6Y A;  4BDV B;  3HEI A;  5FZF A;  5DZE A;  1JTZ X;  4HLT A;  4WM8 A;  4B4Q A;  4YVW C;  4QKF A;  1UOG A;  3UJO A;  1E57 A;  3JQW A;  2ARA A;  2VMG A;  1XNK A;  2WT2 A;  4R9B A;  4WBB A;  3PNA A;  4WM8 C;  1WMD A;  1JHJ A;  2FZ1 A;  3J26 N;  1XYP A;  4P02 B;  5EHD A;  2EXI A;  2RJL A;  5HV4 A;  1HXS 3;  3LA2 A;  2BDR A;  5FYY A;  2XPJ A;  1S4C A;  2P2K A;  1YXW A;  3THT A;  1W2T A;  2LRO A;  1PVC 2;  4ATF A;  1LCL A;  3AFK A;  4JTO A;  3BTY A;  3RMX A;  1IKQ A;  3VKN A;  4P9L A;  1AYM 2;  4A41 A;  5J3U A;  5I93 A;  4HPK B;  4YRD A;  5BNO A;  4XMA A;  4EQV A;  3AXD A;  3TOJ A;  4EV0 A;  5J09 A;  2FQP A;  1BK0 A;  2RJK A;  3IPV A;  5LA2 A;  1RUJ 2;  5FZM A;  4DOU A;  3G6J B;  1CIW A;  4K7J A;  5BNO C;  2EIC A;  3NO8 A;  2FHR A;  1S0F A;  1KD7 A;  5JI7 A;  3VBR B;  3EXU A;  4MGQ A;  1S0C A;  2CSG A;  1ND2 B;  1UOF A;  4XFG A;  4LOS A;  3I8T A;  4KGG A;  3AKT A;  1YIF A; 
#chains in the Genus database with same CATH homology
 4IGO A;  4NUB A;  3PUS A;  3K3O A;  5FY9 A;  5FPV A;  5FYT A;  5FZB A;  4QWN A;  5FY1 A;  5FXW A;  5LY2 A;  4BU2 A;  4CCN A;  4GAZ A;  5A7P A;  5K4L A;  5FWJ A;  5FPA A;  2XDV A;  3KV9 A;  3ZLI A;  3AVS A;  5F5I A;  5A7W A;  5FZ0 A;  3RVH A;  5E6H A;  4GJY A;  4GJZ A;  4QX7 A;  5FYU A;  5FZ4 A;  3ZPO A;  3DXT A;  2GP5 A;  5IVB A;  5LWB A;  4TN7 A;  4URA A;  3DXU A;  3PU8 A;  4BIS A;  3N9O A;  3PU3 A;  4UF0 A;  4QX8 A;  4CCL A;  5FYC A;  2Q8D A;  2YPD A;  5F3I A;  4EYU A;  5FV3 A;  2GP3 A;  4LIT A;  5IVY A;  5FPL A;  4AAP A;  5A7O A;  2PXJ A;  5FXX A;  5LW9 A;  5FY7 A;  5FZ1 A;  3N9P A;  2XXZ A;  4DO0 A;  2OX0 A;  5FP3 A;  4QXH A;  5ISL A;  5FBJ A;  5FJH A;  5FYM A;  5FP4 A;  4Y3O A;  5FUN A;  5IW0 A;  5A3N A;  5F2W A;  5A7W B;  5FZ3 A;  4CCJ A;  4Y4R A;  5FZE A;  4C8D A;  5CEH A;  4HON A;  3KVA A;  2YBS A;  4BXF A;  2OQ7 A;  3OPT A;  4AI9 A;  5A3T A;  5FZ9 A;  3N9N A;  3KV6 A;  4CCM A;  4D6R A;  5FZI A;  4QXB A;  5FXV A;  5ANQ A;  5FZ6 A;  4UF0 B;  5A3P A;  2OT7 A;  3LD8 A;  5FYI A;  5FP7 A;  5F3E A;  2OS2 A;  3AVR A;  3N9Q A;  5FPB A;  5FXZ A;  3UYJ A;  3AL5 A;  4V2V A;  3K3N A;  5FPU A;  1VRB A;  3N9L A;  5FP8 A;  5FYZ A;  5KR7 A;  4GD4 A;  5IVC A;  4QXC A;  2Q8C A;  5FJK A;  4LIV A;  4IGP A;  4D6S A;  3PUR A;  5LY1 A;  2YBP A;  3KV5 A;  3KV4 A;  3PUQ A;  5A7Q A;  5F32 A;  5FYB A;  5FZF A;  4ASK A;  4CSW A;  4IGQ A;  5FY0 A;  5A80 A;  5FZ7 A;  3AL6 A;  3NJY A;  5FZ8 A;  5FZO A;  5FZO B;  3U4S A;  2XML A;  4LIU A;  5IWF A;  5FY4 A;  2YBK A;  4EZ4 A;  2WWU A;  5FZA A;  4CCO A;  4XDP A;  2WWJ A;  2YU2 A;  3PDQ A;  4LXL A;  5A7S A;  5F3G A;  5FUP A;  5FZH A;  2Q8E A;  5FZC A;  5FZK A;  3OPW A;  5A1F A;  5FYY A;  2P5B A;  3PTR B;  5FYS A;  3N9M A;  4E4H A;  3U78 A;  4D6Q A;  4CCK A;  4QU1 A;  2W2I A;  5F39 A;  5FZG A;  4DIQ A;  5IVV A;  5FZD A;  4EZH A;  2XUE A;  5FYV A;  2OQ6 A;  3PUA A;  4V2W A;  5A3W A;  5F5A A;  5A1L A;  5IVF A;  5F37 A;  3KVB A;  5FY5 A;  3LDB A;  5F5C A;  5IVE A;  2YU1 A;  5FYH A;  5FZM A;  5FY8 A;  5FP9 A;  5FZL A;  5A7N A;  4HOO A;  5F3C A;  5FWE A;  5F2S A;  2VD7 A;  3K2O A;  4Y33 A;  4CUG A;  5IVJ A;  4XDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...