5FZAA

Crystal structure of the catalytic domain of human jarid1b in complex with 3d fragment 2-piperidin-4-yloxy-5-(trifluoromethyl)pyridine (n10072a) (ligand modelled based on pandda event map)
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
462
structure length
453
Chain Sequence
b'SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with 3D Fragment 2-Piperidin-4-Yloxy-5-(Trifluoromethyl)Pyridine (N10072A) (Ligand Modelled Based on Pandda Event Map)
rcsb
total genus 140
structure length 453
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fzaA01
5FY7A 2YBSA 5FZ9A 5F3GA 5FYZA 5A3TA 5CEHA 4E4HA 5FY4A 5FY0A 5FYMA 3ZPOA 4CCLA 4Y33A 5FPAA 3RVHA 4D6SA 4AI9A 4TN7A 5A7WB 4URAA 3KV6A 3AVRA 5E6HA 2XMLA 4GAZA 5FZEA 5A7SA 5IVCA 3N9QA 3PURA 3OPTA 5A3PA 4ASKA 5IVEA 4CCOA 5FZGA 5FP3A 2YU2A 5LY1A 5A7WA 5KR7A 2P5BA 3N9OA 4NUBA 2XXZA 5FZ6A 5A7QA 4BXFA 4IGPA 5LY2A 3PUAA 4AAPA 4CCJA 5A7OA 2GP3A 2OS2A 5FZ8A 5LWBA 5FZCA 4LXLA 4V2WA 5FP4A 5IVVA 2WWUA 5FYCA 3N9NA 5FPVA 5FZBA 4DIQA 4BISA 5IVJA 5FXWA 4GJZA 5FJHA 3ZLIA 2YPDA 5F5IA 5FXZA 3OPWA 2XDVA 5FPLA 4LIUA 5FXVA 4HOOA 4QU1A 5A3WA 3AVSA 5A1FA 2XUEA 4EYUA 4GD4A 4Y4RA 5F3IA 5F39A 5FP8A 5FWEA 3PTRB 2YBPA 2OT7A 2GP5A 4QXCA 4QXHA 5F3CA 5FZAA 5FZDA 4HONA 5F37A 5FYVA 5FZFA 4DO0A 4LIVA 5F5AA 5FYIA 2YU1A 5F2SA 1VRBA 5FZLA 5A80A 5IVFA 3U4SA 5FV3A 3N9PA 5FY5A 3AL6A 3KV9A 4QWNA 4EZHA 4GJYA 5A1LA 5FZ7A 5A7PA 2VD7A 5FBJA 5FZ1A 4EZ4A 3LD8A 5FY1A 3DXTA 4D6QA 5K4LA 2WWJA 4CCNA 5FYBA 5FUPA 5FZHA 5FZIA 4C8DA 3PU3A 3PUSA 3PU8A 2OQ7A 2OQ6A 4Y3OA 4XDPA 3KV4A 2OX0A 2Q8EA 3LDBA 5IVBA 4D6RA 4V2VA 3K3OA 3KVAA 4QXBA 5FP7A 5FXXA 5LW9A 4BU2A 4CCKA 5FYYA 5FZ3A 4LITA 5A7NA 3PUQA 5F32A 5F5CA 3NJYA 4IGOA 3KV5A 4CCMA 5F3EA 5FYUA 5FZKA 4CSWA 2Q8DA 5A3NA 5IWFA 4XDOA 3N9MA 3KVBA 4QX7A 2PXJA 3PDQA 3UYJA 5FZOB 3AL5A 5FZ4A 2Q8CA 5FYSA 5F2WA 5FZ0A 5IW0A 4CUGA 5FWJA 5FY8A 5ISLA 5FYTA 3N9LA 5FJKA 5FY9A 4UF0A 5IVYA 5FPBA 2W2IA 5FPUA 5FUNA 3U78A 5ANQA 4UF0B 4QX8A 5FP9A 5FZOA 5FZMA 2YBKA 3DXUA 4IGQA 5FYHA 3K3NA 3K2OA
chains in the Genus database with same CATH superfamily
3UETA 3FLPA 3JD71 1O4TA 4MV2A 4CDXA 1WLCA 3LDRA 1SMVA 1OC1A 3H7YA 4Z2AA 1FMD1 3MF6A 4ZU5A 2FHRA 4DZGA 2W1SA 4EN8B 1OH4A 4CXYA 3GGLA 1PIV2 3ZXKA 2ZKLA 1M4WA 1OVSA 1RUD2 2BERA 1OA3A 1Q8PA 4GB32 1VP6A 3I2IA 4IV3A 1PK6A 1ZYBA 3I54A 4URTA 1TME1 1UQXA 3UESA 4IV3B 3WY6A 3N9QA 1W9SA 5C8CB 1DGWX 4AF9A 3POBA 1MZFA 1T2XA 4OYUA 5GLVA 2YU2A 3PHMA 1R083 2WQ4A 1JU3A 3B01A 2JG9A 4MGZE 3VDAA 4CP9A 3MIBA 4LNVA 3HBKA 2ZGQA 2WN2A 5LWBA 4LXLA 1FXZA 4JDNA 1SBEA 3MLKA 3CQOA 4FOYA 1YUDA 2O8OA 5A6QA 4AGVA 3ZXFA 5BV6A 1HXS3 3VD4A 3ME2A 5CZKA 3POEA 5A1AA 2A75A 3MPBA 3NKTA 4QU1A 3VZOA 4X8PA 4QQ2A 1PMHX 4B4PA 1XE0A 3J26N 3NV4A 5F3IA 4BK4A 4XHXA 1UXXX 3BOPA 4BJ0A 5JMCA 4M0HA 4QT6A 2PLV1 4LKSA 4AK3A 2BPA2 5AFEA 3ZVXA 1ZRIA 3SCFA 3B5LB 3P3NA 4IL7A 2BGCA 4YM2A 1XBFA 1IPKA 1K3IA 1VPHA 3N36A 4XIOA 4DPNA 2GNDA 4XF1A 2R043 4P9JA 4Q0UA 1LU2A 1Z7S2 1UY2A 2BNNA 4W50A 2E9QA 3R4DB 3OBZA 2YV8A 1H9PA 2YROA 2F4PA 4CZSA 3H8OA 2OZJA 2UWBA 3ZN4A 5C33A 3ZXLA 3FMGA 2X5IC 3EMRA 1ENSA 1LCLA 4OI4A 1U0AA 4XYXA 2B5HA 2ZBJA 4UXAA 4YGBA 5IAVA 1R092 4RQPC 1AVBA 1WMXA 1O8SA 1W2TA 1Q56A 3KV4A 4IEOA 5E16A 4K1ZA 3AMHA 2IVJA 5CAZA 3BYWA 1KDKA 4HSJA 5FP7A 1AX2A 5BNQA 2B39A 3T0AA 5GKAC 5FMBA 5HV4A 4NE9A 4PBOA 4UFHA 5EJ3A 4LITA 4FCAA 3MV01 3ZO0B 4N7UA 3OEBA 5CYYA 3DECA 5F5CA 3VBRC 5CFCA 1YRZA 3AYEA 2ZHNA 3H50A 5JIAA 1DYPA 3N9MA 4CA9A 1SBFA 5EFUA 4AI3A 1AJOA 4E2GA 3H8XA 3SLIA 1DF0A 2ZMNA 1UIJA 1ONAA 3ZR5A 4EN6B 4YZ5A 3WNKA 4XMAA 4XABA 4FT8A 4Y24A 2HJIA 3Q8BA 4H14A 1EY2A 3VBUB 4EN9B 5KHIA 1W3XA 2N7GA 3LOIA 4CCCA 1CAXA 4RHV1 4GWIA 1NY71 2W9XA 4IV1B 5FUNA 3U78A 4HANA 1RXGA 2QQPA 5FZ9A 4AW7A 4H55A 3O1SA 1U5ZA 1ZNPA 2IXHA 1DYKA 4A7KA 3U4XA 2NP0A 2RDRA 1EV11 2R49A 2Y64A 4IEUA 4JGYB 5L7OA 1JZ3A 2BWCA 3GBGA 2C24A 4QAWA 3LQCA 2B46X 1ZBE1 4URAA 4MZUA 1XU2A 5IK5A 4M00A 1RTVA 4NRPA 4YVSB 3VKMA 2JDYA 4WVWA 3IPVA 1BEV2 3DGTA 3I2DA 3AKQA 4DXTA 1W0PA 3HOBA 3D82A 4IQPA 4MGKE 4L8QA 1JOBA 2ZACA 3B7MA 2OVUA 1VAKA 4YM1A 2W91A 1C8M2 5JR7B 2BBVA 1NZIA 2TEPA 1QDCA 2J1SA 3LE0A 1WCSA 5A7WA 4EWEA 1CAWA 1SQ4A 5A7QA 1OPOA 1HLCA 3PUAA 4CCJA 2VCMA 1MQTA 3NNMA 3POWA 3B3QE 4JKKA 3VDDC 2WWUA 3SEEA 3MGUA 1OI6A 3S5AA 3MLJA 4FPGA 4CU9A 3NJXA 1K5JA 1HDKA 4AZZA 2WINB 1YI7A 3WG4A 1NYWA 3VD7A 4N43C 1VRH3 4RGKA 3LCPA 1VAMA 1HRV2 4BWOA 3ZYIB 4MXVA 4AWDA 2QZ2A 2J42A 1VBB3 3E6DA 5FK7A 2D3SA 1GICA 1NCRB 5KXCA 1IS4A 4KWLA 3PVBB 4XF9A 3ZIXA 1AXKA 1X50A 4QPGA 5JMOA 4M3CE 1NCRA 4LIVA 4CYDA 1QNWA 4MHUA 4OQ8A 5F2SA 2EAKA 2I74A 3HVDA 1W2UA 1V6OA 2VW1A 4BE3A 4C0HA 3I3EA 1BEV1 4GJYA 4GWMA 5FZ7A 3VV1A 4BQYA 1COV3 2VD7A 4HMZA 5C7GA 2H0BA 1B35B 1W6OA 2SLIA 4OZXA 1P8JA 3DXTA 4D6QA 3MO4A 2D6MA 3UKTA 5JOZA 1NCQA 1ZX5A 1CR7A 3H0OA 4NAMA 3WUDA 3WNNA 1H8TB 3KQ4B 3VHPA 4M0NA 3PUSA 2OQ6A 4A3XA 1S2KA 1DZRA 2PQQA 4HSLA 4V2VA 2ZZQA 1FPN2 5CBLA 2LUWA 5FXXA 3UKVA 3FHIB 5LW9A 3C7EA 1GWKA 4CCKA 5AFBA 5FREA 3AMNA 5FZ3A 5LK5A 3L2YA 4JRAA 1HRV3 2D7FA 4DNYA 1JU4A 2Q1ZB 4A2UA 4M3CA 3VZKA 1JYNA 4RS5A 2F6BA 3O1TA 2JDKA 4K3UA 1PIV3 2DCJA 4QQHA 1S0GA 3JCIA 1HRI1 3L9JT 3VBFB 3E6CC 1W8OA 1RVF3 1VBC3 3EQEA 5DG1A 2DCZA 3THCA 4AHZA 4EWAA 5APAA 2YGLA 4LK7A 1Z0HA 1UMZA 1UOBA 2VZTA 3W5MA 1NCRC 5IVYA 4DINB 3ENRA 2EXJA 3RGBA 2GMMA 1HXS1 1R082 2PHLA 3AC0A 3M3IA 3PIGA 1VBC1 1JUIA 2VQAA 3LOBA 1RMU1 4MYEA 3ZN5A 4UYBA 1NA1C 3WDTA 1LEDA 4E4HA 3VKLA 3O1VA 5F7UA 3H7JA 4XTMA 4LKEA 3N7JA 3ZFGA 3OB8A 1AL23 1Y9QA 3TRSB 1A78A 5ABJB 1RUH3 1V70A 3BODA 1HQWA 4DY3A 4WM8C 4IE0A 4AFCA 5IJRA 2BWAA 1UF2C 3ON7A 3CBNA 1RUC1 2PHTA 3OPTA 1JHNA 3BIEA 4ASKA 1ALYA 2RM23 2BUKA 4UFLA 3VHOA 2CHHA 2XHKA 2FCTA 2HYXA 4NOTA 1A6CA 3TN92 5ACA2 4QPIA 5JXJA 3KGZA 3Q9OA 1AR63 2WA4A 4K6BA 4MADA 4ZY9A 5A6YA 4NRQA 2R0HA 2R6QA 2GP3A 4NPLA 2GC1A 3ZFFB 5CA6A 3VBOB 4ZXEA 4MOAA 3UGFA 3VKOA 3J4UH 3ZX7A 5FJHA 1OH3A 4MGYE 3POGA 2JDPA 2V4AA 2DUOA 2QBXA 3BU7A 4YW7A 4JRLA 3P6BA 5FUIA 3HD8B 3N3HA 4JGZB 5BYNA 2ERFA 4KL1A 2JEMA 3TN93 5ACA3 1V00A 4NIAA 1ST8A 4S2FA 4FI9A 2AGSA 1A3KA 1FV2A 2JDMA 3RWKX 1QJX1 1IS3A 2E31A 2XONA 4OHWA 3T2TA 2FDFA 3T1MA 4EV0A 5FZLA 3LEMA 1VBA1 1ZA4A 2QNKA 2MEV2 2VPVA 2X05A 5LA1A 5CFDA 3J9SA 2WWSA 2BGPA 5JZGC 2JIGA 4FP3A 5FZ1A 2AEYA 2GAUA 4YFZA 1OKQA 5FKBA 1RUG1 1WLWA 2XBO2 2YB7A 2CAUA 3MIFA 4X6QB 1QH7A 1WCKA 2BOIA 2BOJA 2J1TA 3BIWE 5LASA 1XYNA 3T2PA 2XVKA 5JPNB 3NAPB 1NG0A 2DUPA 4FFFA 4Q0SA 4TSVA 2ZGRA 3AKRA 3F95A 3FUOA 1GMMA 2K46A 3ZYGA 1XRUA 3KHCA 2NLRA 2VQUA 1SCRA 2ZX1A 4M3CF 2VU9A 2ET7A 4RGGA 2IC1A 5EP9A 3OPZA 1OVPA 2TBVA 5BNOA 4CCMA 3KS7A 2ZX0A 4UAPA 4AVVA 4XOGA 2Q8DA 4K7JA 4NR1A 5BNOB 4OHYA 1SFNA 4YG6A 2D98A 2I2SA 5DAXA 1AHSA 2PXJA 5ERLA 4AQ2A 4OUEA 4CCEA 5C70A 1XPWA 4CXXA 1OURA 1EV12 1J3RA 2VZ1A 1AL22 1MR5A 1XOYA 1HQLA 3VKFC 5FIXA 3I59B 3DEMA 2OA2A 1PNFA 2Z69A 3P1IA 4CU7A 4M3CB 1U5XA 4IE4A 2W2IA 3RPQA 2DVDA 4PIYA 4AG4A 3SNMA 3HJRA 4BH9A 4GMP3 1AZDA 1COV2 1RINA 1W2NA 1RC6A 1W9WA 5E88A 2AZ5A 1VAVA 2Q4SA 5FYZA 3RYRA 5BNPA 1STMA 4BIOA 4LO5B 2HEYF 3KMHA 1RUI2 3VKNA 4Y1YA 2VQ0A 4LUMA 3IMNA 1RUG2 4UW3A 2Y6FA 1V0AA 4N8MA 4LBKA 3KGLA 3QD6A 2HWD2 3VD5A 2GU9A 4Q0QA 2VCAA 3NQHA 3AFKA 4Q4X2 4EZHA 1D0HA 5A7SA 4CDUA 1J83A 1QJU3 2LROA 1BZWA 2GN7A 4HVOA 5LA2A 1W6NA 3TWIA 1LRHA 1V6LA 1AR72 1UX6A 2BYVE 1BBT3 1S0CA 1HW5A 5KR7A 3AYCA 3LF7A 1YQ5A 4NHMA 1LU1A 2GNMA 4A7YA 1BKZA 4EN7B 4BMEA 4AFMA 4MGQA 5IFTA 5IVVA 1RXFA 5LA9A 4LKDA 3K75B 5HPOA 5IVJA 1ULOA 2JKXA 4LHKA 4LO6B 1FATA 3MW3A 5LATA 1O4ZA 3CJXA 1WMEA 1AJKA 4GQ7A 3M70A 1LHNA 3AKTA 1UOFA 5HV0A 2ZABA 2PA7A 1R091 3WDYA 4O61A 5F39A 5JZGA 1YFYA 1OPMA 1AL21 5EIYB 1JZ8A 2CNAA 3GDBA 4LUKA 3WVJA 4XETA 5E89A 5KXDA 1AR83 4UW6A 2BVVA 3D5OA 1YI9A 2VZUA 5CB7A 4XXAA 1L3JA 3VBHC 1TME3 4C91A 5DDJ2 1TEIA 1G8WA 4KG8A 3USSA 1G9CA 4GULA 4LBJA 1ZRDA 4Q4Y3 2AREA 3WDWA 3WQ1A 1BHGA 1RUNA 2VBDA 1H6XA 4I2OA 4FPHA 3U37A 4XAEA 4CRQA 3BALA 3QCWA 3I2HA 3THTA 1WWYA 1YFUA 3R0RA 2FDJA 2W92A 2ZX3A 4ISRA 2NMOA 1H1IA 1D7PM 1UYXA 1EUTA 4Q2FA 2WZPP 3TN91 4CUBA 4XHBA 5ACA1 5KXEA 1JBCA 2DTYA 1QQP1 5GALA 2D43A 1WCUA 2GMEA 3BKZA 1RB8G 2V72A 2QQUA 3DPRA 3FFQA 4XC9A 4LBNA 5I8SA 1K42A 4NJ4A 4UOJA 1G7YA 3C7OA 3LSDA 1W6MA 3IAPA 2WNVA 2HWB1 1V9U1 1G9BA 3IBMA 1I3HA 1PVC3 2PFWA 5H9PA 3CJIC 4XUOA 3GHMA 4AVCA 4CP9B 4WM8A 3UYJA 5FZOB 2Z2SB 5T50A 3CZUA 2ZGLA 3E5UA 3GALA 3WNPA 4BZ4A 5FZ0A 3VZLA 2DFBA 2DFCA 2XJSA 4WVMA 4XJZA 4A3ZA 3OOXA 2B7YA 2RM21 1VRH2 4XJWA 1QQP3 3GXUA 3FBMA 3X29B 4XILA 4N43B 1W6OB 2ENRA 1OFSA 5J37A 4N9HA 2YBSA 1F8VA 3LGRA 1MEC1 1IPSA 3I49A 2BNOA 1RUF3 3KT7A 3S7IA 4U2AA 3J7HA 4AEMA 2B9VA 2VXRA 4CCLA 4BQ2A 1ENRA 3N7KA 1CZSA 2HWC2 4IW3A 5JPMB 1XC6A 1YHFA 4HT1T 5E6HA 1UKGA 2XLFA 4BA6A 1JYWA 3ACGA 5D8AA 5B4XA 5KHHA 4RS5C 5JWPA 4J25A 3RRDA 4RFT0 4KWJA 2Y33A 2JB4A 2WNOA 2ZMLA 3MFAA 1KFXL 4FPLA 1CGPA 3OYWA 4JKLA 3VUOA 4AAPA 4R9CA 4FXGB 5KHJA 5DN2A 3KM5A 3E5XA 4HVQA 2P37A 1H2MA 1LOBA 5LBCA 3VZMA 4QX2A 1NXD1 1W6NB 4Y5TA 5FZBA 4AVTA 4AVBA 3GZAA 1YIPA 2YDEA 5FXWA 1O5UA 4QDSA 4AYUA 2D6PA 4NPMA 4P9GA 5BXXA 5FFOC 2D5FA 5FXVA 4Y22B 3AVSA 5CVRA 3ACLA 4A41A 1CIWA 5A1FA 1FMD2 4KNCA 4P9XA 3T4VA 5FQ0B 3SCGA 1KFUL 1UY1A 4OUSA 1JYXA 4QXCA 2XL9A 2K2SA 3KCYA 1L7QA 2JECA 3POSA 4DXZA 1SCSA 3DUIA 1N1TA 3RZGA 2R1DA 3WINE 1SBDA 1ZZ7A 1SPPB 4CEYA 2Q1FA 1UMIA 1VRBA 4FO9A 4RN5A 1C5HA 4LJHA 3LKJA 2A73B 1X82A 2CGOA 4Y26A 3AL6A 3CDZB 5C3QA 3IWZA 4PI2A 1Q8SA 1TME2 5JZGB 2OPKA 4W6XA 1LKNA 4NHKA 3VDCA 1QF3A 1W8FA 4FPKA 3ZM8A 3OGVA 3MUY1 2QQVA 1G6NA 1S1AA 3U0ZA 1VBB2 4NHLA 4CDUC 1RL3A 5K8SA 2MHFA 3EJKA 1W3VA 4K9SA 2DVAA 4XUPA 2ZEYA 4NIDA 1DLLA 5GLZA 3VDDA 1CIYA 5HCFA 4Y3OA 2ATFA 4BYYA 2R16A 4GWJA 4LA2A 4A44A 1W9FA 4R9AA 5T55A 4Y20A 1QHDA 1RJ8A 1GOGA 1ZREA 2JDNA 4BU2A 3N7MA 4OI0A 3HR9A 1A8DA 3ZYBA 4DXRA 2RJLA 1WLTA 3D0SA 2Q0AA 5FLIA 3T0DA 2ZMKA 3KV5A 4Y1ZA 2WA3A 2LW8A 1Z78A 3GF6A 3JB4C 2D40A 4LMFA 5IWFA 3KVBA 4A7ZA 5A32A 3WDUA 1QJY2 1BVP1 2MPFA 5GZFA 5TSWA 4R52A 2GNTA 2DBIA 5JXHA 1LOFC 3ETPA 3SQOA 1SLBA 3O0XA 2XJQA 4NO4A 1PO22 3RZHA 3TEYA 4YVWB 3U1XA 1QJU2 2WS93 4JGZC 1US3A 1O59A 1WBLA 1PGW1 2RJKA 4IE5A 2RVAA 1CD3G 3WW1A 2X5IA 2R7EB 3ACIA 5FZOA 3WQ7A 2WNUC 2FDIA 2O0OA 1VBD1 1WZXA 4L9BA 1GLHA 1PM4A 1W90A 2XJVA 5A3TA 4LHSA 3AJYA 1RUJ3 3QACA 2WLPA 2G9FA 4RR3C 3UGHA 3RWNA 2QQWA 1AL0G 1OFNA 2QFEA 1MVEA 3A23A 4GA9A 4ARXA 1AR71 4B8EA 2P1BA 4Q0PA 5DUWA 1SZBA 4EJRA 2XL7A 1RUC2 3LB9A 4NVPA 4SLIA 3NAPA 4YM3A 1ZRRA 4GAZA 3VD9A 3B9CA 2Y38A 2DBNA 1UZWA 2ORZA 2W94A 3OGSA 4QX1A 1YEWA 1HKDA 4YW2A 1WW5A 1UD1A 3AZWA 4QD2A 2RMU2 4OQ9A 2QQNA 5FOBB 5K7PA 4XQWA 2ZX2A 4OUMA 1GNHA 3IAQA 1LULA 1O5LA 3NVCA 5G04L 4IGPA 4MSVA 1AYN2 4UBGA 4CU8A 4HN1A 2QUOA 3ITQA 4Y1VA 1ZRFA 4JTNA 1CAVB 4RQPA 3I59A 4QX3A 4QQLA 1XNKA 3AZYA 3ZFGC 4FQZA 4QDRA 2ZGMA 4Q4W1 5FPLA 1POV1 3KCXA 2VOKA 3LDKA 4LA3A 1PO13 4QB1A 4LBMA 1PO21 4KI5M 2W1WA 4E8CA 1RUF2 3PL0A 1O6UA 1ZA7A 4W4ZA 5FKCA 1RVF2 3ORJA 1AYN3 4G3YC 2OPWA 4QXHA 1T6GC 2YFZA 1XNCA 1OSGA 2WSVA 4IXLA 4DUWA 5LBBA 2D6OX 4N7IA 4FP2A 4DFSA 3NJZA 5JOWA 1PGW2 5LB6A 1MS3A 1Y9GA 4ATFA 4E8DA 5JDBA 2WO3A 1YLLA 3MLLA 3UL2A 4YVWC 4A6OA 4D7YA 3KQRA 1PO12 4INDA 2YPJA 3BTYA 4IETA 3ACHA 4TYSA 3TBDA 3VZNA 2Y0IA 2YFUA 3WXPA 4NHYA 3MIHA 5JI7A 3VBSB 2I07B 2E26A 1YYNA 5FMOS 2PLV2 4HLTA 3UK9A 3EXUA 4LE4A 2Y6JA 3A4UA 2ET1A 2C4XA 2VGDA 4HKOA 4Q4Y1 1GZWA 5CIRA 4IE6A 3ALQA 3PU8A 1Q8OA 3K77A 4AGRA 1JMUB 3RSJA 1F5JA 3POIA 1GZWB 2RMU1 3C7HA 4L99A 4BK5A 2EICA 1O7FA 2IXJA 1JZ2A 3Q8AA 1GZ9A 1ULCA 2VW2A 2BZDA 3MW4A 4RA0A 5T54A 1BCXA 1UY3A 3AJZA 3TAYA 1PVC2 4ET7A 2R041 5F32A 3WSOA 2GC2A 3MIGA 4YSFA 5A6ZA 3VBUA 1IQAA 1ASJ3 1IG0A 2WYFA 4I09A 4XDOA 4Y5SA 4B29A 2JIJA 3KWVA 4CEWC 1IG3A 1ULDA 2IXLA 2WAOA 1UYPA 1KXGA 3ACFA 1UOJA 4UBHA 5FZ4A 4CP2A 2VMDA 3RMYA 4Q1RA 1HRV1 1XE8A 5GLWA 2J1EA 4HXCA 3M8LA 5DDJ3 5FJKA 5T5OA 4JZRA 5FPBA 4KH9A 1PHMA 1QY4A 2RS33 3NNFA 2BV4A 2VXJA 4LHNA 1FPN1 4B4RA 5FP9A 5FYHA 3WNLA 3AZVA 4CPBD 3IPVB 2EIBA 1NKGA 3IN9A 5FY7A 4AL9A 2Q8OA 3LA2A 1C4RA 2Y6HA 3VBHB 3KCCA 3CEWA 1BMV2 2CTVA 2V5DA 1AF9A 1CN1A 1SDDB 3CO2A 4GH4A 4RR3B 2OYZA 2LTNA 2PHDA 3VBHA 1WW4A 2AUYA 1AXYA 5A33A 4YARA 3N4MA 4FTBA 2Q5TA 3H3UA 1OLME 1WA4A 1CAWB 3ZN6B 1PO11 2JDUA 3KV6A 3TEZA 3LZZA 3I2FA 1UY4A 4RGAA 5G05L 4D69A 1NCQC 5CG9A 2DVGA 1BEV3 1UAIA 2WQ8A 4JVAA 1ND2B 3IKWA 2C6SA 5DZFA 5GZEA 5FDBA 5J1XA 4YZ3A 4ZHNA 5C3RA 1ND3C 4DEQA 3FHAA 2WRAA 3N9OA 1ACCA 1H4GA 2W47A 3TOJA 5FO8B 3NAPC 2BDRA 2VMGA 3PVEA 3WF0A 3WQ0A 2VMCA 5FZ8A 2R042 1DGRA 4Q8KA 4DUVA 5I0RA 1ASJ1 1WD3A 1WUVA 3WP4A 1G9DA 2AENA 1EPZA 3VHNA 3M1HA 4QPGB 3S57A 5CKNA 1S0EA 4GMP0 3WP5A 5EV7A 3OPWA 1IGOA 5C3OA 4FOWA 1QU0A 2D44A 1IZ3A 1OA4A 2JJ6A 4CDQA 5H9SA 4L0PA 2EALA 1AYM2 2WZ8A 2GNBA 2JG8C 1SLAA 5FWEA 4EN0A 2BW8A 3RJ2X 1N3OA 1CAVA 4RQPB 4B1MA 1CJDA 3KT1A 5FLJA 3ZYRA 4E2SA 3UNPA 1X8MA 2W0XA 3TEWA 1TQ5A 3ZYJB 2ARXA 5FAXA 3QH6A 4JCKA 5FYVA 1U12A 1RUOA 2EAAA 1UU4A 2E7TA 4D0QA 2QQMA 1S4CA 1JUHA 4Y1XA 1WCQA 1W9YA 4QWNA 2B9UA 3SH5A 5A1LA 5I0TA 3HNBM 3HBZA 3B69A 4Q4V2 1OUXA 4LEJA 2QQLA 1H0BA 1Y7BA 2Y60A 1EAH3 2KR2A 3OUIA 3OSDA 4AI2A 1KS4A 3BB6A 4XFFA 4D8MA 3G6JB 1QOOA 4FOVA 1U5IA 3I2GA 4LO4B 1UPIA 4FFHA 3LEKA 1AYM1 5J3UA 4OCTA 1W99A 1XQNA 2IFWA 4NIHA 3A21A 4GB33 5L36A 4D6RA 2HLEA 1RUD3 3VBFA 3WCRA 4CDUB 3OYWB 2PMWB 2XVLA 1AXZA 4FPJA 2VL4A 4PBPA 4M01A 4Q4W3 4NROA 4XVHA 1UU5A 1LESA 2P3KA 4XUNA 2GH8A 3MW2A 3VGIA 3CZJA 3ZFEC 2W52A 1QJX2 2EF6A 3AZXA 1GZTA 1DU3D 1JYVA 1HN1A 1WLDA 4QM9A 5AVPA 2QJVA 4XFGA 1XSQA 3MEPA 5F2WA 4KBBA 5I93A 3E1F1 1W2OA 1O4YA 2UYBA 2UWAA 3GZEA 1EP0A 4LLFA 4OHZA 2XG3A 4S2GA 3VLBB 2DVBA 4E2QA 2BRTA 1KJLA 4LE3A 3WP3A 2GN3A 1Q43A 3HNYM 4P02B 2A3XA 1GSLA 4GB31 4XIKA 3MF9A 5C5UA 2XJUA 4IEQA 2ZAHA 3UV9A 3VBRA 1CAXB 2FDHA 3THDA 5EJ1B 1LEMA 3SISA 3WF2A 4LBQB 3VBRB 1UNBA 5IYYA 1RMU3 5DABA 5CFDC 2WZEA 3P3PA 3H3LA 3ZPOA 4YW6A 4R4ZA 3RVHA 3EHKA 3K4AA 5C3PA 4UW4A 1C8M1 2YG0A 4BQ5A 1HB3A 2UU8A 2JKBA 3LWCA 4YFWA 3MPPG 3KZ4C 4NPRA 1C1FA 3PMSA 1LNSA 2X8KA 2VZRA 3GYDA 3OUJA 3T2OA 5FZEA 1W8TA 3UGGA 1BK1A 3D3AA 2DYCA 3PNAA 1W28A 3WX5A 3OJBA 1GUIA 2HYKA 2C5DA 2WABA 3BPZA 5FP3A 2VW0A 3SC7X 4AHYA 2NMNA 4CU6A 2WUHA 1RHI1 4BXFA 4J1WA 1VE0A 3VL9A 3AYDA 4YGDA 4NWWA 1PK6C 1PZ9A 2IWGB 1W8UA 2JWPA 4V2WA 4XPVA 5FP4A 1J58A 3POFA 1D4M2 3J7MA 3ST7A 3NV1A 3ZMOA 4GJZA 3H8UA 4AFBA 2A6XA 1X8EA 3I8TA 4M4RA 1UO9A 2RHPA 3C3VA 2X5IB 4K8RB 5A3WA 1KITA 2VVEA 2X10A 4W8JA 2Y6LA 2O8QA 3AXDA 1JZ4A 3W58A 2NPIA 1MS4A 2RDQA 1B09A 1J84A 4IUGA 1PMJX 4BM8A 1HQNA 3JZVA 4QPWA 4JHTA 4FPOB 4ORFA 3OBAA 1YQCA 4Y1UA 3JBG2 4AOCA 5IVFA 2W87A 2BNMA 1XJAA 2XGXA 1KS5A 3ZFFC 2ZGNA 2VUCA 3N35A 4ZXKA 2CAVA 4X8NA 3WEZA 3EYPA 4Q4X3 2ZEWA 4PHZA 4ARYA 4BDVB 1Y43B 4FAGA 2VECA 3K48A 2YXSA 2D5HA 4WV8A 4KU8A 1MS5A 1VBA3 1AR61 2A3YA 5IT6A 3FL7A 3D4KA 3PTYA 2VZSA 2I45A 2B4KA 3QOPA 4LTAA 3ZXGA 4YW1A 4UFKA 2RS52 4P9IA 1MEC3 3FX3A 3KSCA 1KRIA 4JTOA 5IVBA 2WJSA 1W03A 3T08A 1RUE2 2JX9A 5ABJC 5I8YA 3EBRA 2ADDA 5KWRA 3W21A 3NKGA 1R64A 1I9RA 1W6QA 3ZDSA 3LAGA 2VNRA 2HBTA 4UFJA 3MIEA 2D3PA 3I7DA 1QKQA 5FYUA 4LT5A 1REDA 1RHI2 2VOWA 3T0BA 2EXHA 1D2QA 5CKQA 4AR2A 4QKBA 4F8AA 3CL1A 5FPXA 1JTZX 5L19A 2ZGKA 4WVVA 3RI8A 2JDZA 1JXNA 2VUJA 1YQ6A 1JODA 5FCCA 2XHNA 3WT3A 3BI3A 5FY8A 4IEYA 4OMDA 2ORXA 1H4HA 3WF1A 4XZUG 4YG0A 3IIAA 1W04A 3G7DA 2ZS6B 3N7LA 4AFDA 4Y22A 3CJIA 3ZPYA 2VNVA 4LO8A 5JVVA 3OY8B 2WNVC 5HCBA 1S0DA 1BVVA 1OLRA 1DGLA 1PZ7A 1XNBA 5HCAA 4JQTA 3AYAA 5I91A 3K4DA 2EIEA 1PNGA 1GZCA 1CZTA 3BTZA 5GLTA 2CV6A 5JI9A 4CEYB 2OXBA 3ZR6A 4RHV3 1HJGA 1LGNA 2GMPA 2KXLA 4C90A 5C71A 2G9ZA 4AE2A 1G9FA 1KEXA 5BNNB 3AMQA 1DQ4A 1ODMA 4IERA 1IS6A 4BHPA 2W95A 3VBUC 1MS8A 1POV0 4ASMB 5GJ6A 5IVEA 2P2KA 4KWUA 3GNEA 4A42A 1M06G 1APNA 1LOCA 2C26A 2EIDA 2W3JA 1S0FA 1OHFA 4IESA 4FAHA 2RS13 1RUJ2 3BN6A 4BQ1A 4OMCA 1V6IA 3A7QA 5F1RA 2HWB2 3CKHA 2H6BA 4GXLA 4Y20B 4I01A 4BXSV 3RNSA 4PDWC 3DCQA 2DCKA 4XUTA 5I0UA 2HWC1 2VR4A 3VDBA 4QDQA 4UT5A 4YM0A 5HXMA 4LIUA 2VBBA 4PI0A 4Y4RA 1YIFA 3NNLA 1R1A2 1SFYA 2B42B 3HEIA 2YHJA 1HX6A 3HT1A 4HN0A 2OT7A 1CJPA 5F6KA 1H2NA 4CEWB 1QXRA 3DKWA 1TZOA 1O3QA 1LJ7A 1QJY3 4DO0A 1DQ2A 1Q3EA 1URXA 1POV3 2WL1A 1OA2A 4QQPA 3UJOA 1LGBA 3WW3A 4FQ4A 1FYUA 2GC3A 2ID4A 2P6CA 3LPGA 1NOVA 1XE7A 4RR3A 1OOPB 5C8WA 5LBFA 5K0UB 2RJ2A 2VMHA 3PVOA 1BBT2 3WG1A 5K4LA 1RHI3 4XTPA 4YRDA 1EPWA 4Q4Y2 1ZZ6A 1AR81 1ENXA 3ATGA 3HMYA 3A0NA 4KGQA 1LOEA 1S55A 2RR12 1CX4A 1NX9A 3PU3A 2ES3A 4LR4A 1B35C 3JB8A 3V65A 2W08A 4LBQD 2W46A 3IDCB 1LOFA 1ENQA 2JG9B 4LK6A 4PQ9A 5K9YA 2X09A 1D4M3 3H1MA 4TXWA 5SV8A 4ES9A 1Y9MA 1D4M1 2QCSB 1D2SA 3T4HB 3WDVA 1XNAA 1OLMA 5DAPA 1OF3A 4ZZ8A 2K0GA 2ZGPA 4MHRA 4CSWA 3TB0A 4OLLA 4BQWA 1ZZ9A 1UPSA 1H9WA 2XVGA 3APBA 4C0BA 1XU1A 3ETQA 2CDOA 4CUCA 1RUI1 2WDBA 4K8FA 5E8AA 4GWNA 3GJAA 2DVFA 1NZCA 4O7XA 2W5FA 5H9QA 3ELNA 3FLTA 4F83A 1OXCA 3JBG3 2HBUA 3OD4A 3O7OA 2NN8A 4YPJA 4H7LA 2ZGUA 3OGJA 3SKVA 4F3JA 4AI1A 1NE4A 1OF4A 3V0BA 5A7WB 3ZFEA 2PAMA 2WFF1 1OQ1A 4C1WA 2C0ZA 2G9GA 3HPNA 5D1IA 1YQ8A 1ZBA2 1N3PA 4A6SA 4PF5A 1E5IA 4JDOA 1F15A 2D97A 5CEHA 2A6WA 5EYYA 1DZTA 3F2ZA 2RS53 1BMV1 3CIHA 4PLOA 3JD72 3BU0A 3SEPA 3MHZA 1IOAA 2GALA 2ZEZA 1E5SA 2VZOA 4D6SA 4AI9A 2PHXA 5JSRA 2HWD3 1QXJA 2W1UA 1RUG3 1DDLA 1OUSA 4WZFA 1OLQA 3KF3A 4QKDA 1QJU1 2A6ZA 3PURA 3NL1A 4DXSA 5AC93 3FBYA 2J1AA 2ZEXA 4MH0E 3FFZA 5IAXA 2GDFA 3GCWA 4KU7A 1QJX3 4CE8A 5LY1A 1MS1A 1AX0A 3WG2A 1JZ7A 1QJY1 4WBBA 2L9LA 2QZ3A 3AP4A 1R1ZA 3FC0A 3NWKA 1MACA 5BNNA 2X29A 1GR3A 1VBD2 1S2BA 4DIQA 2OZ6A 5LA0A 2Z4FA 1NY72 4YLZA 5L9VA 2E6VA 1MZEA 4AQSA 2ZHKA 3FUQA 3O1OA 4OULA 2A3WA 2CGNA 3OBTA 2XLAA 4KG0A 1GQPA 4Y5Z0 2VMEA 4JQRA 3W59A 1RUH1 4XMIA 1N3QA 4GD4A 2P3YA 3JBG1 1NT0A 3VHRA 4B7EA 3OGRA 2HEWF 5EQUA 2A7AA 3I2OA 1WD4A 5FZAA 2WN3A 4HONA 5F5AA 1K45A 2R072 5DUXA 4PIZA 2ARAA 1O3RA 3J7NA 4Q4V3 4R4XA 1DG6A 1YJLA 2PYTA 3LFIA 5FV3A 4LBQA 4L92A 4N9IA 4PCRA 3AK0A 3BTXA 3ZMNA 4CP1A 1W6PA 4Z1VA 2V09A 4JGYA 2HWF2 3ILRA 1KDMA 4CEWA 4BMBA 1IQDC 1JYCA 3ZYHA 4FTEA 2WWJA 1MVQA 2BFUL 2YY1A 3AXEA 1Y4WA 3MZHA 5EJZB 1SACA 5A33B 1GANA 1RMU2 2E53A 1X9TA 2RV9A 1I5PA 5L73A 4COWA 1RUH2 2JB8A 2R073 4ZS2A 1KJRA 2CWMA 5LZ6A 1MPXA 4TZDA 3K51A 2AACA 1V6MA 2O14A 1YC61 2XQRA 1S0IA 2VNGA 1DBNA 1YCIA 2JG9C 2ZPXA 4G4FA 1HJFA 2VOVA 2P34A 1W8NA 3K46A 2ZTNA 3Q8FA 4ZU7A 1PVXA 2QKDA 1QNYA 1TVGA 4LORA 5A7NA 5LEJA 3AP7A 1N47A 1R1A3 2OUJA 4XFIA 3VBOA 5A3NA 1EAH2 1Q8QA 3CHXA 4QX7A 1H8VA 3PDQA 1VB4A 3H1WA 1VR3A 4JGYC 5GLUA 4DY5A 2Q8CA 4WM8B 3TEXA 1QOSA 2VJXA 4Q29A 4COYA 5AC91 3FWEA 4KQ7A 3ZIWA 2FQPA 4CUGA 5FWJA 5ISLA 1QMJA 1F5FA 3O1MA 1TE1B 4OI1A 3O5SA 5FY9A 4E4DX 2DURA 4Q4X1 4QPGC 3ZYPA 4D94A 4WM7A 5FPUA 2XB6C 4P9LA 5DG2A 2PTMA 2HWD1 4CDQB 2FMDA 1S0JA 4LBOA 3IMMA 3K3NA 1OD5A 3K2OA 3BTAA 4QGLA 2P4EA 4NMIA 4FPFA 4Q5OA 3OBRA 2R30A 1H2KA 2BGOA 1YFXA 4N43A 4DQAA 3WLUA 4EROA 5CFDB 3RJRA 2ADEA 2BEOA 1W0NA 2JG8B 1X36A 4OHXA 4R8HA 1UN1A 5FYMA 5CU1A 1FX5A 3NJVA 4RSUA 1FAYA 5J7MA 3C7FA 1NE6A 1CAUA 3MICA 4KMQA 2X53S 4QM8A 3V0BB 2J22A 4XURA 3JD73 4RHV2 5T5PA 3RS6A 1DGWA 3SH3A 1RITA 5A3OA 2OKXA 5BNNC 2BQPA 4ONUA 4WZCA 2XMLA 2R062 1FNYA 3KHBA 4Q1PA 4DRVA 1H1MA 3USUA 5D8AB 2WZR3 3VZJA 5C4WC 4K40A 1RUJ1 3I3DA 3LEGA 1IS5A 4L97A 3DPRC 3T30A 2YC0A 3B94A 5T3NA 2RDNA 2HWE1 1GNZA 2QTWB 2XKOA 1E5RA 1TMF2 4QXKA 1O3SA 3E6BA 2Z79A 5C3SA 3QBQA 5FYCA 1UW8A 1ULGA 3ZXDA 4JDMA 1C3HA 3FN9A 1LECA 2YPDA 1GFF2 2RS31 2J1UA 2Y6KA 4U36A 5FMDA 1XSRA 4S2HA 4HOOA 1LOAA 2IFRA 5DQ0A 2XJRA 1N1YA 2XUEA 5T52A 4EYUA 4DRRA 3J8F2 1DFQA 2E32A 2P17A 1I5ZA 1VMHA 2WNEA 1LTEA 1CX1A 3RI9A 4G9SB 3HAGA 4ZU4A 1PGSA 2VZ3A 5EPAA 5FZFA 3M3QA 3RMXA 4QX0A 1S0BA 1BBT1 4I02A 5D2AA 3T09A 1E5HA 3O1RA 1J1TA 2XJTA 3DV8A 1V9U2 2BP6A 1BYHA 4CDWA 5BNPB 1OOPC 1NLSA 4COZA 5BNPC 1GV9A 3R4UA 2BVBA 4AEDB 2WIIB 1O8PA 1ASJ2 4Z92B 3NNGA 2HEVF 3NSTA 3POYA 4HPKB 3HQRA 3RYKA 3BOWA 3ZXJA 4AVSA 4CPBA 4HZFA 4FVVA 4B4QA 4HPKA 4NAOA 3WQBA 4D7TA 3CMGA 4Q0VA 2OQ7A 5C9AB 3O1UA 2Q8EA 3A22A 1RIRA 3HQUA 4FFIA 4NIIA 4QGMA 1VBE1 4P00B 3PUHA 1RUE1 3FLRA 4LPLA 4O9GA 4QPIB 2XKPA 3VL8A 3ZSJA 5A3UA 4D7SA 1OQEA 5FYYA 3MI8A 3GCXA 3U07A 1ZZBA 2VZPA 4AFAA 1AR93 3C2UA 4Z82A 3ES4A 4OHVA 5FR3A 2TUNA 3KLSA 1WCDJ 1UOGA 2H0VA 3PLQA 2YYOA 1A34A 1H1AA 4YYOA 3AP9A 4BQ4A 4IE7A 4BQXA 1WBFA 5JAXA 1LB2A 1JOJA 5FYSA 3DYPA 4MGIE 1GQHA 4BLIA 4LULA 1GBGA 1JHJA 3POJA 5FYTA 2A6VA 4UF0A 2D93A 3CF6E 3BCWA 2W1QA 1ZZ8A 1X7NA 4UF0B 5FZMA 4LKFA 2DDUA 3WUCA 4LOSA 1RUI3 1UL9A 2ZJCA 2PAEA 4QHOA 3S0MA 2QVSB 1ZVFA 2EIGA 1LENA 3O0WA 1OOPA 1LR5A 4BLJA 1ND2A 2VTXA 5A3MA 3THPA 4FTSA 4SBVA 4PDWA 2PLV3 5CADA 1DCSA 1JI6A 3W20A 4DMIA 3NRUA 4UW5A 2UY8A 4EWDA 1O3TA 1K12A 3Q8CA 2Q1MA 4Z2WA 3M7AA 2QQKA 1V6KA 2R061 2ZCWA 3WF3A 5M0TA 4W6YA 4Z07A 1WGPA 5A3PA 2R063 1F4HA 1UZ0A 2JG8A 3R4SA 4QU2A 4LBLA 2IXKA 2TNFA 5J36A 1ULFA 1L7LA 3R05A 4XF4A 1G9AA 3VBFC 3HWJA 2HWE3 3RFRA 1R1A1 2J7MA 3B9IA 4XFHA 1V9U3 1W6MB 4XCBA 5FZCA 1OD3A 3IB3A 4IDZA 4FOQA 3PVNA 2PN5A 4MO3M 2BU9A 5F8PA 5L9BA 1C5IA 4I0WB 1HB2A 1D0GA 1DQ0A 2UYAA 4J1XA 1UWWA 5LBEA 2JE9A 2QDRA 1FI2A 4B1LA 2XDVA 1RGSA 1Z7S3 3DKQA 1GOHA 2ZKNA 4JC1A 1UZVA 1FT9A 1CESA 2WS91 4TLGA 5C4WA 4I30A 1ZZCA 1PGL1 1VMFA 4L11A 4XACA 3ZFEB 4LLOA 2XQXA 2JD9A 3IDEA 2F4LA 2HWF1 2NM1A 5GZGA 3N9PA 3KV9A 4YWAA 5JOYA 5A7PA 1VBA2 2YC4A 3CJIB 2MEV1 3TNQA 2ZXQA 4P5YA 5JOXA 4COUA 5GZDA 4WVZA 3RZMA 2WZR2 5FYBA 3A0KA 1W05A 4NHXA 2G1MA 3C8XA 1FMD3 2WYSA 4DB5A 2GC0A 5JIUA 1VMJA 4JKMA 1GNYA 3E5QA 4AXOA 4XFAA 1RUC3 1FNZA 4XDPA 5FOJB 1V6JA 2LRPA 4AEDA 2WFF2 4M4PA 3K4ZA 2VUAA 4QPIC 2VTFA 3WR0A 1JN2P 4K20A 5E1RA 4DS0A 4MG2A 4CTEA 3VD3A 4ZKTB 1D4VB 5DDJ1 1WA6X 2FBEA 5AC92 5F3EA 4XZPA 4OVEA 4HL0A 2V73A 4YGCA 1GYKA 1HN0A 3OD0A 5JLVA 2VVDA 2QDNA 3WHTA 1J3PA 1PIV1 3JUUA 2JENA 3AFGA 3AKPA 3Q8EA 3AL5A 1QGLA 2C9KA 2CDPA 5J98B 3S30A 3IT8A 2B8MA 3MV11 4XDQA 5A70A 4DUXA 5I0DA 4E27A 1H8TC 1C8NA 2WS92 1TNFA 3RZLA 3U75A 5BUVA 4AAXA 2VBPA 1UX7A 3GZUC 2ZGSA 1IKPA 1UY0A 2XR4A 1YQ2A 2FD8A 5F6LB 4QX8A 4XCAA 2D6NA 3DXUA 4RD7A 1SG3A 2ZAAA 1HRI3 1K5MA 2RS51 4WM7C 1SLLA 4MGTA 1W6PB 1W9TA 5FY4A 2HWE2 4P5HA 5ABJA 1HRI2 1KQRA 3V56A 2VUDA 3I3BA 4Y33A 4KGGA 3BPSA 4X6RB 5FPAA 5IK4A 3I2JA 2EVXA 4BQ3A 3H42B 2VOXA 4ZONA 1I1EA 5KHGA 4UWDA 2W68A 2WSUA 3HN3A 4E4ZA 4V1PA 3VBOC 4YZ1A 3HT2A 4QKNA 3QH7A 1FV3A 3SHRA 3I3QA 5FZGA 3PJQA 4N53B 5L7OB 2Y8KA 3WW2A 1SHWB 5HCHA 2E51A 1IHMA 2QQOA 2FCUA 2R1BA 3DPRB 3ZSKA 3ZFFA 2VE1A 3RZZA 3AMPA 4UFIA 2E33A 5LY2A 2WNVB 4R9DA 2OS2A 2NYYA 1POQA 2RR13 3L2HA 4XXPA 4RYDA 2BBAA 3W9AA 5A32B 2YGMA 2WT1A 3V64A 1FPN3 5LK7B 5F5IA 2WLQA 3GBFA 3ABZA 4PJYA 3H8RA 2NQYA 2FCVA 4META 4UI9L 1UYZA 2PELA 2A70A 3NW4A 2RDSA 3WCSA 4XBQA 1E57A 2RS12 4YVWA 2KA3A 2GP5A 2R071 4HBNA 3WOGA 2B45X 2LS6A 4ES8A 1GQGA 5EZWA 5FYIA 1BXHA 5KBFA 5FK8A 1LOGA 2XUMA 2PHWA 1VBD3 1CAUB 1PVC1 4XAAA 1MS9A 5JUVA 2WT2A 5DZGA 1PK6B 3KB5A 1HB1A 1HV1A 3NV2A 2VULA 1GOFA 3GBWA 1DGRN 2ZHMA 5JR2A 3WHUA 5FY1A 1H2LA 2Z5WA 1U5YA 1JZ6A 4XFCA 4W6WA 3WDXA 3B02A 5FZHA 3FHQA 4FXKB 2WO2A 4NIGA 3H1YA 2MNGA 2DU0A 3T2QA 3USUB 2ZZJA 3SXWA 3I3MA 1DQ5A 2WR9A 5FRAA 3S6PA 4N53C 1VB2A 4CVUA 1W2AX 3K3OA 1NQJA 4XJ8A 1QIQA 2VZQA 1QJEA 2A6YA 1ZBE3 2G4IA 1NCQB 2VAUA 2DCTA 1NAEA 3HQXA 3D8CA 3PUQA 1AX1A 4IGOA 3FJSA 1DLCA 1PMIA 2VCCA 4YW4A 5CFCC 1IPJA 1ZBE2 2J1RA 5FLHA 4GZ9A 4MXWA 4XBLA 4P9WA 5K0UC 1TNRA 4QKFA 2R0FA 3MUZ1 1BQPA 3VBSC 4IEPA 4I0BA 3T3YA 1MS0A 2E7QA 1PM7A 3ZKYA 4BOWA 5KHKA 1QEXA 3J7LA 3DL3A 4PQQA 2WAAA 4OFGA 1FOD2 1NQDA 5IW0A 5FO7B 3ZYFA 2ZA9A 1DIWA 5FQ0A 5DXDA 2YMZA 1CPNA 4NWVA 2VCBA 4QB6A 4RS5B 1JH5A 1UIKA 3WD5A 1VBE3 4CDWB 3OF1A 1UZYA 2BTVC 3AM2A 2O1QA 3M2MA 5J48A 1H6YA 2YUEA 1GWMA 2OW4A 4IEXA 4Z8BA 1JOPA 1J3QA 1VJ2A 3HIFA 1TMF1 4I0AA 5F3GA 5T5JA 4E9KA 2AH2A 2CL2A 5IUQA 4MLOA 2VTXJ 3OGGA 4LOTA 5FY0A 1ZBA3 1VALA 4FBFA 1W8HA 4Q27A 5BPXA 4OI2A 2WBKA 4AEJA 1AR62 2VH9A 1SLCA 1F31A 4XE9A 3FZ3A 5I8TA 5FTTC 4JV4A 3VBSA 2RM22 1K5MB 1ZRCA 4PIXA 5JSOA 4LO7A 2D6LX 5CNAA 3RQ0A 1GP4A 3VDDB 3GJBA 1ND3A 5JXGA 3BUCA 3RZKA 1AR73 1GP6A 2Y6GA 3DYMA 5DUUA 3MFCA 1DP0A 1JZ5A 4AQTA 1YWKA 3RDIA 3IIIA 1GP5A 1WKYA 3UT0A 1EAH1 1UKRA 3H3ZA 4AVAA 5LEKA 2ILMA 2JICA 1MEC2 2AR6A 2QQJA 4QMAA 3N9NA 4DEVA 3UJQA 4BCUA 1ULEA 3UKNA 3EB7A 1UZZA 2XWJB 2ARBA 2EXKA 2FDGA 3ZDVA 5KC6A 3RG0A 3I97A 4ATEA 2QE3A 1N1VA 3OTFA 1J59A 4TTGA 1BLZA 4XBNA 5C5TA 3WV6A 1LGCA 5CKMA 2VM9A 2YZ4A 4IEVA 4TWTA 3KF5A 4ZZ5A 3ZOIA 3W5NA 2ZOEB 1R081 4HVRA 4PDWB 1QJFA 1PGL2 2YU1A 1DYOA 5A80A 3S5QA 2NZ9A 3PMEA 3U4SA 2C1FA 2LM3A 5C6CA 1CZVA 1MZ6A 5FY5A 1SLTA 4JX0A 4GALA 4WM7B 2AEZA 4GH4B 1ULPA 5HXVA 2BFUS 2D6KA 3DYOA 4RFRB 3JU9A 4I3PA 2WO1A 4CCDA 2WFPA 3NMBA 3SH4A 2CU5A 1YFWA 1OT5A 5DAWA 3ASIA 3NNJA 3ZN6A 5EWSA 3WF4A 4ASLA 4CDXB 1LAJA 1F4AA 3ECQA 4H2AA 4FSJA 2VO5A 5FZIA 1NXMA 2JDHA 1XYOA 1RUF1 3J8F3 1KGYA 4P9YA 5C8CC 2LALA 3WG3A 2VY0A 1COV1 3LPFA 2CYFA 3IDAA 1VBC2 2OX0A 1F2NA 1IKQA 2IZWA 4HK9A 4IEWA 4YZ4A 3S7EA 1HXS2 3KVAA 2HWF3 1JYTA 5C8CA 5J09A 2EXIA 3SKJE 2IXCA 1T6BX 2WT0A 4K21A 3AKSA 3PJYA 3PUIA 3D6EA 3WZ1A 3M3EA 5LRSA 2DCYA 4GIQA 1VBB1 2Y0OA 5D8AC 5C4WB 4I3GA 2JE8A 3PIJA 1C57A 1BK0A 1VIWB 4WVMB 3SCHA 4C1XA 2RS11 3B93A 3U10A 1OQDA 3ZXEA 3C7GA 3I4IA 2D3RA 4XQDA 3ZKUA 1F35A 2KD7A 1PX4A 1J1LA 4XJAA 2RMU3 5KC5A 2VQTA 3GHNA 4XF3A 2XJPA 4YVSC 3OCPA 1US2A 3MYXA 3U14A 2EA7A 1JYIA 4IEZA 1Q5OA 2ETEA 5EYXA 1NLRA 1V6NA 2DTWA 2BJSA 3ZSLA 3ILFA 3OY8A 3H9AA 4QPYA 5FMCA 4AHWA 1LHVA 4YG3A 2ZHLA 1F9KA 1H8TA 3WW4A 1YO8A 2XBO1 3GZTB 4TN7A 4A45A 1VLNA 3GM8A 4QX5A 4O9EA 4W65A 5DAQA 4CUAA 1MQTC 4XW3A 5B2GB 2R32A 2CGPA 2YC2A 1DZQA 2VZVA 4QB2A 4XFBA 4AQ6A 3I2KA 5F9TA 4CCOA 2DU1A 5A3LA 4B3NA 4NRMA 3TYJA 2CY6A 1QWRA 4Q26A 2XXZA 1RYYA 5FZ6A 4AHXA 2ARCA 1DHKB 4ZS3A 3P5BA 5IK7A 2WQZC 3FE5A 5CISA 1PO23 1YJKA 5A7OA 5C9AA 3ROUA 5IATA 2KM2A 4RL7A 2RE9A 2CSGA 4YNIA 5CFCB 2GZWA 5A6XA 1C28A 4PLNA 3VB9A 4O65A 4N90A 4BISA 1RUE3 1SDWA 1UXZA 4HFSA 4PF1A 5DPNA 5FXZA 3NO8A 3O12A 3LA3A 3AZZA 4YW5A 4AI0A 2J1VA 3B00A 2VC9A 2WNUB 3BVCA 5AVAA 1CONA 1AR92 2GSYA 2HKXA 2PHFA 2JXAA 2UWCA 4KWKA 3IDBB 2WNUA 5FP8A 1NA1B 1AR82 1O91A 2YBPA 4S2DA 4EQVA 1ZBA1 3D0JA 1I6XA 4MVTA 4XUQA 3QLQA 4A4AA 4IV1A 2FZ1A 5KXBA 2AC1A 1UMHA 2XPJA 2A1XA 3VN4A 2HWB3 3AB0A 3LSEA 1GWLA 4Q4W2 5FMOL 5L9RA 1AYM3 4QQOA 3LIGA 1LODA 3OEAA 3AMMA 1NLQA 2H6CA 1HV0A 3HNMA 3LD8A 5K0UA 2WO7A 4MX3A 1WW6A 4MGSA 2VOTA 3E97A 4LHLA 4ZPIA 1MZ5A 3J8F1 3URFA 5BY5A 2DUQA 4H3WA 1W06A 5HBAA 1EUUA 2FMYA 2Y26A 1XB9A 2WFF3 1CWPA 4N53A 3LDBA 2RS32 1GU3A 4JHZA 2XOMA 5L7OC 3TNPB 5JCTA 3DF0A 4XJUA 1WW7A 3AP6A 1VRH1 3RZJA 1Z7S1 1BJQA 3O0VA 4ITCA 4QGNA 3LFMA 4H7MA 3SITA 3SMHA 1MQTB 1FOD1 3AP5A 3NJYA 5FBZA 1YXWA 1OBNA 3ZSEA 5FZKA 1LHWA 2GH2A 1UYYA 5GM0A 2ZGTA 5I0SA 4NN0A 1XYPA 4JGZA 3O1PA 1PX3A 2Y34A 2SBAA 3M3OA 3MIDA 4FFGA 1SLIA 2XWBB 1AR91 5D21A 1ZM1A 1AUYA 1R093 1CVNA 1FOD3 2P3IA 1ND2C 3CNAA 4BPZA 3N9LA 5B4NA 4J6GA 1RJ7A 5IHRA 3INAA 2IXIA 2JE7A 3IM0A 4P14A 4UFMA 5JXIA 5ANQA 3LEIA 1VBE2 1OMIA 3LA7A 3M4FA 3V0AB 3KD4A 1L7RA 2YBKA 4IGQA 4PT6A 2C9AA 2DF7A 1QJZA 3MDPA 3V0AA 4TLFA 5FO9B 1OKOA 2F17A 1QDOA 1EYBA 4CDWC 1EV13 2WZR1 2AYHA 5IFPA 5EHDA 1SFPA 1B35A 4PLMA 2OIIA 4FPEA 1W0OA 1CPMA 1UCXA 3AVRA 4GKXA 1C1LA 3WNXA 1H30A 2ZGOA 2VMFA 5IVCA 4QHBA 3KT4A 4HG6B 1JS9A 4F7ZA 2Z42A 1HB4A 2QQIA 5BNOC 1YNAA 1QQP2 3ES1A 1SEFA 3EO6A 5SV5A 1C8M3 3JQXA 3LIHA 2P5BA 4NUBA 2HH9A 3CU7A 2FDKA 1Q8VA 1QOTA 4CP0A 4ISQA 1W6QB 1W39A 2XLGA 1TMF3 4CEYC 1LHOA 1X9PA 3OG2A 5DZEA 2RG4A 5FPVA 4B7KA 4MXWB 4XF0A 5C9AC 1HIXA 4HKWA 2WC2A 3BGAA 3ILNA 4GMP1 3WP6A 5GZCA 3ZLIA 2HWC3 2E63A 1CQ9A 1S2EA 3MBWA 3U11A 2FZ2A 1LHUA 1TG7A 3CLPA 4K1YA 4BIFA 5JSPA 2VG9A 1UU6A 2RR11 5LRRA 2PHUA 4E4SA 3DN7A 2IUWA 2Q30A 3PTRB 1KD7A 4AGGA 5F3CA 4L2NA 2VMIA 5DAVA 1XNTA 3M3CA 3HN1A 5FZDA 4QHZA 3ZSMA 5F37A 4P08A 2E7AA 4IV1C 1A8MA 2DV9A 5DUVA 1DQ1A 4FPCA 4YZ2A 5IK8A 4COVA 4XEZA 2P6HA 1Y3TA 2A71A 4HK8A 1DQ6A 1XNDA 4GH4C 4XQ4A 1NA1A 3JXSA 5DMYA 5FBJA 2G19A 4EZ4A 4R9BA 3ZFGB 3T1LA 4CDQC 1G86A 1ODNA 1RUD1 4HKLA 4FPYA 2W39A 1SPPA 1ND3B 2XBO3 4JAAA 2XH6A 4CCNA 5FUPA 5T5LA 1RVF1 4Y4YA 5FPZA 4KBZA 4AI8A 4IV3C 4C8DA 2PQSA 4LQRA 4YW3A 2PHRA 2MEV3 4AEDC 3RYPA 1REEA 1QXPA 4EE2A 1GKBA 1REFA 2K9ZA 2JD4A 5J96B 4QXBA 3AX4A 2JDAA 4Q4V1 3O14A 4CDXC 4HETA 5EXOA 5HI0A 1K5MC 5F5QA 1QH6A 1NUKA 4Q8LA 2P3JA 2DWRA 2OUHA 1WMDA 2IVIB 4D3WA 4YGEA 2A5ZA 1AYN1 4BB3A 1JW6A 3JQWA 4MUVA 1N1SA 3IZOA 2ZX4A 2PAKA 4OZOA 5LCWL 4CXWA 2CWSA 3WNOA 1PZ8A 4GKYA 2WKKA 1WMFA 3WNMA 3OUHA 2V5YA 4DOUA 1W8WA 2UY9A 5H9RA 3NV3A 3ZXAC 2VNOA 2UURA 1W8ZA 1XXNA 4AEKA 2V4VA 4XJ9A 4YVSA 3R6SA 2VVFA 5CG8A 1X33A 5ANNA
chains in the Genus database with same CATH topology
5FY7A 2YBSA 5FZ9A 5F3GA 5FYZA 5A3TA 5CEHA 4E4HA 5FY4A 5FY0A 5FYMA 3ZPOA 4CCLA 4Y33A 5FPAA 3RVHA 4D6SA 4AI9A 4TN7A 5A7WB 4URAA 3KV6A 3AVRA 5E6HA 2XMLA 4GAZA 5FZEA 5A7SA 5IVCA 3N9QA 3PURA 3OPTA 5A3PA 4ASKA 5IVEA 4CCOA 5FZGA 5FP3A 2YU2A 5LY1A 5A7WA 5KR7A 2P5BA 3N9OA 4NUBA 2XXZA 5FZ6A 5A7QA 4BXFA 4IGPA 5LY2A 3PUAA 4AAPA 4CCJA 5A7OA 2GP3A 2OS2A 5FZ8A 5LWBA 5FZCA 4LXLA 4V2WA 5FP4A 5IVVA 2WWUA 5FYCA 3N9NA 5FPVA 5FZBA 4DIQA 4BISA 5IVJA 5FXWA 4GJZA 5FJHA 3ZLIA 2YPDA 5F5IA 5FXZA 3OPWA 2XDVA 5FPLA 4LIUA 5FXVA 4HOOA 4QU1A 5A3WA 3AVSA 5A1FA 2XUEA 4EYUA 4GD4A 4Y4RA 5F3IA 5F39A 5FP8A 5FWEA 3PTRB 2YBPA 2OT7A 2GP5A 4QXCA 4QXHA 5F3CA 5FZAA 5FZDA 4HONA 5F37A 5FYVA 5FZFA 4DO0A 4LIVA 5F5AA 5FYIA 2YU1A 5F2SA 1VRBA 5FZLA 5A80A 5IVFA 3U4SA 5FV3A 3N9PA 5FY5A 3AL6A 3KV9A 4QWNA 4EZHA 4GJYA 5A1LA 5FZ7A 5A7PA 2VD7A 5FBJA 5FZ1A 4EZ4A 3LD8A 5FY1A 3DXTA 4D6QA 5K4LA 2WWJA 4CCNA 5FYBA 5FUPA 5FZHA 5FZIA 4C8DA 3PU3A 3PUSA 3PU8A 2OQ7A 2OQ6A 4Y3OA 4XDPA 3KV4A 2OX0A 2Q8EA 3LDBA 5IVBA 4D6RA 4V2VA 3K3OA 3KVAA 4QXBA 5FP7A 5FXXA 5LW9A 4BU2A 4CCKA 5FYYA 5FZ3A 4LITA 5A7NA 3PUQA 5F32A 5F5CA 3NJYA 4IGOA 3KV5A 4CCMA 5F3EA 5FYUA 5FZKA 4CSWA 2Q8DA 5A3NA 5IWFA 4XDOA 3N9MA 3KVBA 4QX7A 2PXJA 3PDQA 3UYJA 5FZOB 3AL5A 5FZ4A 2Q8CA 5FYSA 5F2WA 5FZ0A 5IW0A 4CUGA 5FWJA 5FY8A 5ISLA 5FYTA 3N9LA 5FJKA 5FY9A 4UF0A 5IVYA 5FPBA 2W2IA 5FPUA 5FUNA 3U78A 5ANQA 4UF0B 4QX8A 5FP9A 5FZOA 5FZMA 2YBKA 3DXUA 4IGQA 5FYHA 3K3NA 3K2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FY7 A;  2YBS A;  5FZ9 A;  5F3G A;  5FYZ A;  5A3T A;  5CEH A;  4E4H A;  5FY4 A;  5FY0 A;  5FYM A;  3ZPO A;  4CCL A;  4Y33 A;  5FPA A;  3RVH A;  4D6S A;  4AI9 A;  4TN7 A;  5A7W B;  4URA A;  3KV6 A;  3AVR A;  5E6H A;  2XML A;  4GAZ A;  5FZE A;  5A7S A;  5IVC A;  3N9Q A;  3PUR A;  3OPT A;  5A3P A;  4ASK A;  5IVE A;  4CCO A;  5FZG A;  5FP3 A;  2YU2 A;  5LY1 A;  5A7W A;  5KR7 A;  2P5B A;  3N9O A;  4NUB A;  2XXZ A;  5FZ6 A;  5A7Q A;  4BXF A;  4IGP A;  5LY2 A;  3PUA A;  4AAP A;  4CCJ A;  5A7O A;  2GP3 A;  2OS2 A;  5FZ8 A;  5LWB A;  5FZC A;  4LXL A;  4V2W A;  5FP4 A;  5IVV A;  2WWU A;  5FYC A;  3N9N A;  5FPV A;  5FZB A;  4DIQ A;  4BIS A;  5IVJ A;  5FXW A;  4GJZ A;  5FJH A;  3ZLI A;  2YPD A;  5F5I A;  5FXZ A;  3OPW A;  2XDV A;  5FPL A;  4LIU A;  5FXV A;  4HOO A;  4QU1 A;  5A3W A;  3AVS A;  5A1F A;  2XUE A;  4EYU A;  4GD4 A;  4Y4R A;  5F3I A;  5F39 A;  5FP8 A;  5FWE A;  3PTR B;  2YBP A;  2OT7 A;  2GP5 A;  4QXC A;  4QXH A;  5F3C A;  5FZA A;  5FZD A;  4HON A;  5F37 A;  5FYV A;  5FZF A;  4DO0 A;  4LIV A;  5F5A A;  5FYI A;  2YU1 A;  5F2S A;  1VRB A;  5FZL A;  5A80 A;  5IVF A;  3U4S A;  5FV3 A;  3N9P A;  5FY5 A;  3AL6 A;  3KV9 A;  4QWN A;  4EZH A;  4GJY A;  5A1L A;  5FZ7 A;  5A7P A;  2VD7 A;  5FBJ A;  5FZ1 A;  4EZ4 A;  3LD8 A;  5FY1 A;  3DXT A;  4D6Q A;  5K4L A;  2WWJ A;  4CCN A;  5FYB A;  5FUP A;  5FZH A;  5FZI A;  4C8D A;  3PU3 A;  3PUS A;  3PU8 A;  2OQ7 A;  2OQ6 A;  4Y3O A;  4XDP A;  3KV4 A;  2OX0 A;  2Q8E A;  3LDB A;  5IVB A;  4D6R A;  4V2V A;  3K3O A;  3KVA A;  4QXB A;  5FP7 A;  5FXX A;  5LW9 A;  4BU2 A;  4CCK A;  5FYY A;  5FZ3 A;  4LIT A;  5A7N A;  3PUQ A;  5F32 A;  5F5C A;  3NJY A;  4IGO A;  3KV5 A;  4CCM A;  5F3E A;  5FYU A;  5FZK A;  4CSW A;  2Q8D A;  5A3N A;  5IWF A;  4XDO A;  3N9M A;  3KVB A;  4QX7 A;  2PXJ A;  3PDQ A;  3UYJ A;  5FZO B;  3AL5 A;  5FZ4 A;  2Q8C A;  5FYS A;  5F2W A;  5FZ0 A;  5IW0 A;  4CUG A;  5FWJ A;  5FY8 A;  5ISL A;  5FYT A;  3N9L A;  5FJK A;  5FY9 A;  4UF0 A;  5IVY A;  5FPB A;  2W2I A;  5FPU A;  5FUN A;  3U78 A;  5ANQ A;  4UF0 B;  4QX8 A;  5FP9 A;  5FZO A;  5FZM A;  2YBK A;  3DXU A;  4IGQ A;  5FYH A;  3K3N A;  3K2O A; 
#chains in the Genus database with same CATH topology
 3UET A;  3FLP A;  3JD7 1;  1O4T A;  4MV2 A;  4CDX A;  1WLC A;  3LDR A;  1SMV A;  1OC1 A;  3H7Y A;  4Z2A A;  1FMD 1;  3MF6 A;  4ZU5 A;  2FHR A;  4DZG A;  2W1S A;  4EN8 B;  1OH4 A;  4CXY A;  3GGL A;  1PIV 2;  3ZXK A;  2ZKL A;  1M4W A;  1OVS A;  1RUD 2;  2BER A;  1OA3 A;  1Q8P A;  4GB3 2;  1VP6 A;  3I2I A;  4IV3 A;  1PK6 A;  1ZYB A;  3I54 A;  4URT A;  1TME 1;  1UQX A;  3UES A;  4IV3 B;  3WY6 A;  3N9Q A;  1W9S A;  5C8C B;  1DGW X;  4AF9 A;  3POB A;  1MZF A;  1T2X A;  4OYU A;  5GLV A;  2YU2 A;  3PHM A;  1R08 3;  2WQ4 A;  1JU3 A;  3B01 A;  2JG9 A;  4MGZ E;  3VDA A;  4CP9 A;  3MIB A;  4LNV A;  3HBK A;  2ZGQ A;  2WN2 A;  5LWB A;  4LXL A;  1FXZ A;  4JDN A;  1SBE A;  3MLK A;  3CQO A;  4FOY A;  1YUD A;  2O8O A;  5A6Q A;  4AGV A;  3ZXF A;  5BV6 A;  1HXS 3;  3VD4 A;  3ME2 A;  5CZK A;  3POE A;  5A1A A;  2A75 A;  3MPB A;  3NKT A;  4QU1 A;  3VZO A;  4X8P A;  4QQ2 A;  1PMH X;  4B4P A;  1XE0 A;  3J26 N;  3NV4 A;  5F3I A;  4BK4 A;  4XHX A;  1UXX X;  3BOP A;  4BJ0 A;  5JMC A;  4M0H A;  4QT6 A;  2PLV 1;  4LKS A;  4AK3 A;  2BPA 2;  5AFE A;  3ZVX A;  1ZRI A;  3SCF A;  3B5L B;  3P3N A;  4IL7 A;  2BGC A;  4YM2 A;  1XBF A;  1IPK A;  1K3I A;  1VPH A;  3N36 A;  4XIO A;  4DPN A;  2GND A;  4XF1 A;  2R04 3;  4P9J A;  4Q0U A;  1LU2 A;  1Z7S 2;  1UY2 A;  2BNN A;  4W50 A;  2E9Q A;  3R4D B;  3OBZ A;  2YV8 A;  1H9P A;  2YRO A;  2F4P A;  4CZS A;  3H8O A;  2OZJ A;  2UWB A;  3ZN4 A;  5C33 A;  3ZXL A;  3FMG A;  2X5I C;  3EMR A;  1ENS A;  1LCL A;  4OI4 A;  1U0A A;  4XYX A;  2B5H A;  2ZBJ A;  4UXA A;  4YGB A;  5IAV A;  1R09 2;  4RQP C;  1AVB A;  1WMX A;  1O8S A;  1W2T A;  1Q56 A;  3KV4 A;  4IEO A;  5E16 A;  4K1Z A;  3AMH A;  2IVJ A;  5CAZ A;  3BYW A;  1KDK A;  4HSJ A;  5FP7 A;  1AX2 A;  5BNQ A;  2B39 A;  3T0A A;  5GKA C;  5FMB A;  5HV4 A;  4NE9 A;  4PBO A;  4UFH A;  5EJ3 A;  4LIT A;  4FCA A;  3MV0 1;  3ZO0 B;  4N7U A;  3OEB A;  5CYY A;  3DEC A;  5F5C A;  3VBR C;  5CFC A;  1YRZ A;  3AYE A;  2ZHN A;  3H50 A;  5JIA A;  1DYP A;  3N9M A;  4CA9 A;  1SBF A;  5EFU A;  4AI3 A;  1AJO A;  4E2G A;  3H8X A;  3SLI A;  1DF0 A;  2ZMN A;  1UIJ A;  1ONA A;  3ZR5 A;  4EN6 B;  4YZ5 A;  3WNK A;  4XMA A;  4XAB A;  4FT8 A;  4Y24 A;  2HJI A;  3Q8B A;  4H14 A;  1EY2 A;  3VBU B;  4EN9 B;  5KHI A;  1W3X A;  2N7G A;  3LOI A;  4CCC A;  1CAX A;  4RHV 1;  4GWI A;  1NY7 1;  2W9X A;  4IV1 B;  5FUN A;  3U78 A;  4HAN A;  1RXG A;  2QQP A;  5FZ9 A;  4AW7 A;  4H55 A;  3O1S A;  1U5Z A;  1ZNP A;  2IXH A;  1DYK A;  4A7K A;  3U4X A;  2NP0 A;  2RDR A;  1EV1 1;  2R49 A;  2Y64 A;  4IEU A;  4JGY B;  5L7O A;  1JZ3 A;  2BWC A;  3GBG A;  2C24 A;  4QAW A;  3LQC A;  2B46 X;  1ZBE 1;  4URA A;  4MZU A;  1XU2 A;  5IK5 A;  4M00 A;  1RTV A;  4NRP A;  4YVS B;  3VKM A;  2JDY A;  4WVW A;  3IPV A;  1BEV 2;  3DGT A;  3I2D A;  3AKQ A;  4DXT A;  1W0P A;  3HOB A;  3D82 A;  4IQP A;  4MGK E;  4L8Q A;  1JOB A;  2ZAC A;  3B7M A;  2OVU A;  1VAK A;  4YM1 A;  2W91 A;  1C8M 2;  5JR7 B;  2BBV A;  1NZI A;  2TEP A;  1QDC A;  2J1S A;  3LE0 A;  1WCS A;  5A7W A;  4EWE A;  1CAW A;  1SQ4 A;  5A7Q A;  1OPO A;  1HLC A;  3PUA A;  4CCJ A;  2VCM A;  1MQT A;  3NNM A;  3POW A;  3B3Q E;  4JKK A;  3VDD C;  2WWU A;  3SEE A;  3MGU A;  1OI6 A;  3S5A A;  3MLJ A;  4FPG A;  4CU9 A;  3NJX A;  1K5J A;  1HDK A;  4AZZ A;  2WIN B;  1YI7 A;  3WG4 A;  1NYW A;  3VD7 A;  4N43 C;  1VRH 3;  4RGK A;  3LCP A;  1VAM A;  1HRV 2;  4BWO A;  3ZYI B;  4MXV A;  4AWD A;  2QZ2 A;  2J42 A;  1VBB 3;  3E6D A;  5FK7 A;  2D3S A;  1GIC A;  1NCR B;  5KXC A;  1IS4 A;  4KWL A;  3PVB B;  4XF9 A;  3ZIX A;  1AXK A;  1X50 A;  4QPG A;  5JMO A;  4M3C E;  1NCR A;  4LIV A;  4CYD A;  1QNW A;  4MHU A;  4OQ8 A;  5F2S A;  2EAK A;  2I74 A;  3HVD A;  1W2U A;  1V6O A;  2VW1 A;  4BE3 A;  4C0H A;  3I3E A;  1BEV 1;  4GJY A;  4GWM A;  5FZ7 A;  3VV1 A;  4BQY A;  1COV 3;  2VD7 A;  4HMZ A;  5C7G A;  2H0B A;  1B35 B;  1W6O A;  2SLI A;  4OZX A;  1P8J A;  3DXT A;  4D6Q A;  3MO4 A;  2D6M A;  3UKT A;  5JOZ A;  1NCQ A;  1ZX5 A;  1CR7 A;  3H0O A;  4NAM A;  3WUD A;  3WNN A;  1H8T B;  3KQ4 B;  3VHP A;  4M0N A;  3PUS A;  2OQ6 A;  4A3X A;  1S2K A;  1DZR A;  2PQQ A;  4HSL A;  4V2V A;  2ZZQ A;  1FPN 2;  5CBL A;  2LUW A;  5FXX A;  3UKV A;  3FHI B;  5LW9 A;  3C7E A;  1GWK A;  4CCK A;  5AFB A;  5FRE A;  3AMN A;  5FZ3 A;  5LK5 A;  3L2Y A;  4JRA A;  1HRV 3;  2D7F A;  4DNY A;  1JU4 A;  2Q1Z B;  4A2U A;  4M3C A;  3VZK A;  1JYN A;  4RS5 A;  2F6B A;  3O1T A;  2JDK A;  4K3U A;  1PIV 3;  2DCJ A;  4QQH A;  1S0G A;  3JCI A;  1HRI 1;  3L9J T;  3VBF B;  3E6C C;  1W8O A;  1RVF 3;  1VBC 3;  3EQE A;  5DG1 A;  2DCZ A;  3THC A;  4AHZ A;  4EWA A;  5APA A;  2YGL A;  4LK7 A;  1Z0H A;  1UMZ A;  1UOB A;  2VZT A;  3W5M A;  1NCR C;  5IVY A;  4DIN B;  3ENR A;  2EXJ A;  3RGB A;  2GMM A;  1HXS 1;  1R08 2;  2PHL A;  3AC0 A;  3M3I A;  3PIG A;  1VBC 1;  1JUI A;  2VQA A;  3LOB A;  1RMU 1;  4MYE A;  3ZN5 A;  4UYB A;  1NA1 C;  3WDT A;  1LED A;  4E4H A;  3VKL A;  3O1V A;  5F7U A;  3H7J A;  4XTM A;  4LKE A;  3N7J A;  3ZFG A;  3OB8 A;  1AL2 3;  1Y9Q A;  3TRS B;  1A78 A;  5ABJ B;  1RUH 3;  1V70 A;  3BOD A;  1HQW A;  4DY3 A;  4WM8 C;  4IE0 A;  4AFC A;  5IJR A;  2BWA A;  1UF2 C;  3ON7 A;  3CBN A;  1RUC 1;  2PHT A;  3OPT A;  1JHN A;  3BIE A;  4ASK A;  1ALY A;  2RM2 3;  2BUK A;  4UFL A;  3VHO A;  2CHH A;  2XHK A;  2FCT A;  2HYX A;  4NOT A;  1A6C A;  3TN9 2;  5ACA 2;  4QPI A;  5JXJ A;  3KGZ A;  3Q9O A;  1AR6 3;  2WA4 A;  4K6B A;  4MAD A;  4ZY9 A;  5A6Y A;  4NRQ A;  2R0H A;  2R6Q A;  2GP3 A;  4NPL A;  2GC1 A;  3ZFF B;  5CA6 A;  3VBO B;  4ZXE A;  4MOA A;  3UGF A;  3VKO A;  3J4U H;  3ZX7 A;  5FJH A;  1OH3 A;  4MGY E;  3POG A;  2JDP A;  2V4A A;  2DUO A;  2QBX A;  3BU7 A;  4YW7 A;  4JRL A;  3P6B A;  5FUI A;  3HD8 B;  3N3H A;  4JGZ B;  5BYN A;  2ERF A;  4KL1 A;  2JEM A;  3TN9 3;  5ACA 3;  1V00 A;  4NIA A;  1ST8 A;  4S2F A;  4FI9 A;  2AGS A;  1A3K A;  1FV2 A;  2JDM A;  3RWK X;  1QJX 1;  1IS3 A;  2E31 A;  2XON A;  4OHW A;  3T2T A;  2FDF A;  3T1M A;  4EV0 A;  5FZL A;  3LEM A;  1VBA 1;  1ZA4 A;  2QNK A;  2MEV 2;  2VPV A;  2X05 A;  5LA1 A;  5CFD A;  3J9S A;  2WWS A;  2BGP A;  5JZG C;  2JIG A;  4FP3 A;  5FZ1 A;  2AEY A;  2GAU A;  4YFZ A;  1OKQ A;  5FKB A;  1RUG 1;  1WLW A;  2XBO 2;  2YB7 A;  2CAU A;  3MIF A;  4X6Q B;  1QH7 A;  1WCK A;  2BOI A;  2BOJ A;  2J1T A;  3BIW E;  5LAS A;  1XYN A;  3T2P A;  2XVK A;  5JPN B;  3NAP B;  1NG0 A;  2DUP A;  4FFF A;  4Q0S A;  4TSV A;  2ZGR A;  3AKR A;  3F95 A;  3FUO A;  1GMM A;  2K46 A;  3ZYG A;  1XRU A;  3KHC A;  2NLR A;  2VQU A;  1SCR A;  2ZX1 A;  4M3C F;  2VU9 A;  2ET7 A;  4RGG A;  2IC1 A;  5EP9 A;  3OPZ A;  1OVP A;  2TBV A;  5BNO A;  4CCM A;  3KS7 A;  2ZX0 A;  4UAP A;  4AVV A;  4XOG A;  2Q8D A;  4K7J A;  4NR1 A;  5BNO B;  4OHY A;  1SFN A;  4YG6 A;  2D98 A;  2I2S A;  5DAX A;  1AHS A;  2PXJ A;  5ERL A;  4AQ2 A;  4OUE A;  4CCE A;  5C70 A;  1XPW A;  4CXX A;  1OUR A;  1EV1 2;  1J3R A;  2VZ1 A;  1AL2 2;  1MR5 A;  1XOY A;  1HQL A;  3VKF C;  5FIX A;  3I59 B;  3DEM A;  2OA2 A;  1PNF A;  2Z69 A;  3P1I A;  4CU7 A;  4M3C B;  1U5X A;  4IE4 A;  2W2I A;  3RPQ A;  2DVD A;  4PIY A;  4AG4 A;  3SNM A;  3HJR A;  4BH9 A;  4GMP 3;  1AZD A;  1COV 2;  1RIN A;  1W2N A;  1RC6 A;  1W9W A;  5E88 A;  2AZ5 A;  1VAV A;  2Q4S A;  5FYZ A;  3RYR A;  5BNP A;  1STM A;  4BIO A;  4LO5 B;  2HEY F;  3KMH A;  1RUI 2;  3VKN A;  4Y1Y A;  2VQ0 A;  4LUM A;  3IMN A;  1RUG 2;  4UW3 A;  2Y6F A;  1V0A A;  4N8M A;  4LBK A;  3KGL A;  3QD6 A;  2HWD 2;  3VD5 A;  2GU9 A;  4Q0Q A;  2VCA A;  3NQH A;  3AFK A;  4Q4X 2;  4EZH A;  1D0H A;  5A7S A;  4CDU A;  1J83 A;  1QJU 3;  2LRO A;  1BZW A;  2GN7 A;  4HVO A;  5LA2 A;  1W6N A;  3TWI A;  1LRH A;  1V6L A;  1AR7 2;  1UX6 A;  2BYV E;  1BBT 3;  1S0C A;  1HW5 A;  5KR7 A;  3AYC A;  3LF7 A;  1YQ5 A;  4NHM A;  1LU1 A;  2GNM A;  4A7Y A;  1BKZ A;  4EN7 B;  4BME A;  4AFM A;  4MGQ A;  5IFT A;  5IVV A;  1RXF A;  5LA9 A;  4LKD A;  3K75 B;  5HPO A;  5IVJ A;  1ULO A;  2JKX A;  4LHK A;  4LO6 B;  1FAT A;  3MW3 A;  5LAT A;  1O4Z A;  3CJX A;  1WME A;  1AJK A;  4GQ7 A;  3M70 A;  1LHN A;  3AKT A;  1UOF A;  5HV0 A;  2ZAB A;  2PA7 A;  1R09 1;  3WDY A;  4O61 A;  5F39 A;  5JZG A;  1YFY A;  1OPM A;  1AL2 1;  5EIY B;  1JZ8 A;  2CNA A;  3GDB A;  4LUK A;  3WVJ A;  4XET A;  5E89 A;  5KXD A;  1AR8 3;  4UW6 A;  2BVV A;  3D5O A;  1YI9 A;  2VZU A;  5CB7 A;  4XXA A;  1L3J A;  3VBH C;  1TME 3;  4C91 A;  5DDJ 2;  1TEI A;  1G8W A;  4KG8 A;  3USS A;  1G9C A;  4GUL A;  4LBJ A;  1ZRD A;  4Q4Y 3;  2ARE A;  3WDW A;  3WQ1 A;  1BHG A;  1RUN A;  2VBD A;  1H6X A;  4I2O A;  4FPH A;  3U37 A;  4XAE A;  4CRQ A;  3BAL A;  3QCW A;  3I2H A;  3THT A;  1WWY A;  1YFU A;  3R0R A;  2FDJ A;  2W92 A;  2ZX3 A;  4ISR A;  2NMO A;  1H1I A;  1D7P M;  1UYX A;  1EUT A;  4Q2F A;  2WZP P;  3TN9 1;  4CUB A;  4XHB A;  5ACA 1;  5KXE A;  1JBC A;  2DTY A;  1QQP 1;  5GAL A;  2D43 A;  1WCU A;  2GME A;  3BKZ A;  1RB8 G;  2V72 A;  2QQU A;  3DPR A;  3FFQ A;  4XC9 A;  4LBN A;  5I8S A;  1K42 A;  4NJ4 A;  4UOJ A;  1G7Y A;  3C7O A;  3LSD A;  1W6M A;  3IAP A;  2WNV A;  2HWB 1;  1V9U 1;  1G9B A;  3IBM A;  1I3H A;  1PVC 3;  2PFW A;  5H9P A;  3CJI C;  4XUO A;  3GHM A;  4AVC A;  4CP9 B;  4WM8 A;  3UYJ A;  5FZO B;  2Z2S B;  5T50 A;  3CZU A;  2ZGL A;  3E5U A;  3GAL A;  3WNP A;  4BZ4 A;  5FZ0 A;  3VZL A;  2DFB A;  2DFC A;  2XJS A;  4WVM A;  4XJZ A;  4A3Z A;  3OOX A;  2B7Y A;  2RM2 1;  1VRH 2;  4XJW A;  1QQP 3;  3GXU A;  3FBM A;  3X29 B;  4XIL A;  4N43 B;  1W6O B;  2ENR A;  1OFS A;  5J37 A;  4N9H A;  2YBS A;  1F8V A;  3LGR A;  1MEC 1;  1IPS A;  3I49 A;  2BNO A;  1RUF 3;  3KT7 A;  3S7I A;  4U2A A;  3J7H A;  4AEM A;  2B9V A;  2VXR A;  4CCL A;  4BQ2 A;  1ENR A;  3N7K A;  1CZS A;  2HWC 2;  4IW3 A;  5JPM B;  1XC6 A;  1YHF A;  4HT1 T;  5E6H A;  1UKG A;  2XLF A;  4BA6 A;  1JYW A;  3ACG A;  5D8A A;  5B4X A;  5KHH A;  4RS5 C;  5JWP A;  4J25 A;  3RRD A;  4RFT 0;  4KWJ A;  2Y33 A;  2JB4 A;  2WNO A;  2ZML A;  3MFA A;  1KFX L;  4FPL A;  1CGP A;  3OYW A;  4JKL A;  3VUO A;  4AAP A;  4R9C A;  4FXG B;  5KHJ A;  5DN2 A;  3KM5 A;  3E5X A;  4HVQ A;  2P37 A;  1H2M A;  1LOB A;  5LBC A;  3VZM A;  4QX2 A;  1NXD 1;  1W6N B;  4Y5T A;  5FZB A;  4AVT A;  4AVB A;  3GZA A;  1YIP A;  2YDE A;  5FXW A;  1O5U A;  4QDS A;  4AYU A;  2D6P A;  4NPM A;  4P9G A;  5BXX A;  5FFO C;  2D5F A;  5FXV A;  4Y22 B;  3AVS A;  5CVR A;  3ACL A;  4A41 A;  1CIW A;  5A1F A;  1FMD 2;  4KNC A;  4P9X A;  3T4V A;  5FQ0 B;  3SCG A;  1KFU L;  1UY1 A;  4OUS A;  1JYX A;  4QXC A;  2XL9 A;  2K2S A;  3KCY A;  1L7Q A;  2JEC A;  3POS A;  4DXZ A;  1SCS A;  3DUI A;  1N1T A;  3RZG A;  2R1D A;  3WIN E;  1SBD A;  1ZZ7 A;  1SPP B;  4CEY A;  2Q1F A;  1UMI A;  1VRB A;  4FO9 A;  4RN5 A;  1C5H A;  4LJH A;  3LKJ A;  2A73 B;  1X82 A;  2CGO A;  4Y26 A;  3AL6 A;  3CDZ B;  5C3Q A;  3IWZ A;  4PI2 A;  1Q8S A;  1TME 2;  5JZG B;  2OPK A;  4W6X A;  1LKN A;  4NHK A;  3VDC A;  1QF3 A;  1W8F A;  4FPK A;  3ZM8 A;  3OGV A;  3MUY 1;  2QQV A;  1G6N A;  1S1A A;  3U0Z A;  1VBB 2;  4NHL A;  4CDU C;  1RL3 A;  5K8S A;  2MHF A;  3EJK A;  1W3V A;  4K9S A;  2DVA A;  4XUP A;  2ZEY A;  4NID A;  1DLL A;  5GLZ A;  3VDD A;  1CIY A;  5HCF A;  4Y3O A;  2ATF A;  4BYY A;  2R16 A;  4GWJ A;  4LA2 A;  4A44 A;  1W9F A;  4R9A A;  5T55 A;  4Y20 A;  1QHD A;  1RJ8 A;  1GOG A;  1ZRE A;  2JDN A;  4BU2 A;  3N7M A;  4OI0 A;  3HR9 A;  1A8D A;  3ZYB A;  4DXR A;  2RJL A;  1WLT A;  3D0S A;  2Q0A A;  5FLI A;  3T0D A;  2ZMK A;  3KV5 A;  4Y1Z A;  2WA3 A;  2LW8 A;  1Z78 A;  3GF6 A;  3JB4 C;  2D40 A;  4LMF A;  5IWF A;  3KVB A;  4A7Z A;  5A32 A;  3WDU A;  1QJY 2;  1BVP 1;  2MPF A;  5GZF A;  5TSW A;  4R52 A;  2GNT A;  2DBI A;  5JXH A;  1LOF C;  3ETP A;  3SQO A;  1SLB A;  3O0X A;  2XJQ A;  4NO4 A;  1PO2 2;  3RZH A;  3TEY A;  4YVW B;  3U1X A;  1QJU 2;  2WS9 3;  4JGZ C;  1US3 A;  1O59 A;  1WBL A;  1PGW 1;  2RJK A;  4IE5 A;  2RVA A;  1CD3 G;  3WW1 A;  2X5I A;  2R7E B;  3ACI A;  5FZO A;  3WQ7 A;  2WNU C;  2FDI A;  2O0O A;  1VBD 1;  1WZX A;  4L9B A;  1GLH A;  1PM4 A;  1W90 A;  2XJV A;  5A3T A;  4LHS A;  3AJY A;  1RUJ 3;  3QAC A;  2WLP A;  2G9F A;  4RR3 C;  3UGH A;  3RWN A;  2QQW A;  1AL0 G;  1OFN A;  2QFE A;  1MVE A;  3A23 A;  4GA9 A;  4ARX A;  1AR7 1;  4B8E A;  2P1B A;  4Q0P A;  5DUW A;  1SZB A;  4EJR A;  2XL7 A;  1RUC 2;  3LB9 A;  4NVP A;  4SLI A;  3NAP A;  4YM3 A;  1ZRR A;  4GAZ A;  3VD9 A;  3B9C A;  2Y38 A;  2DBN A;  1UZW A;  2ORZ A;  2W94 A;  3OGS A;  4QX1 A;  1YEW A;  1HKD A;  4YW2 A;  1WW5 A;  1UD1 A;  3AZW A;  4QD2 A;  2RMU 2;  4OQ9 A;  2QQN A;  5FOB B;  5K7P A;  4XQW A;  2ZX2 A;  4OUM A;  1GNH A;  3IAQ A;  1LUL A;  1O5L A;  3NVC A;  5G04 L;  4IGP A;  4MSV A;  1AYN 2;  4UBG A;  4CU8 A;  4HN1 A;  2QUO A;  3ITQ A;  4Y1V A;  1ZRF A;  4JTN A;  1CAV B;  4RQP A;  3I59 A;  4QX3 A;  4QQL A;  1XNK A;  3AZY A;  3ZFG C;  4FQZ A;  4QDR A;  2ZGM A;  4Q4W 1;  5FPL A;  1POV 1;  3KCX A;  2VOK A;  3LDK A;  4LA3 A;  1PO1 3;  4QB1 A;  4LBM A;  1PO2 1;  4KI5 M;  2W1W A;  4E8C A;  1RUF 2;  3PL0 A;  1O6U A;  1ZA7 A;  4W4Z A;  5FKC A;  1RVF 2;  3ORJ A;  1AYN 3;  4G3Y C;  2OPW A;  4QXH A;  1T6G C;  2YFZ A;  1XNC A;  1OSG A;  2WSV A;  4IXL A;  4DUW A;  5LBB A;  2D6O X;  4N7I A;  4FP2 A;  4DFS A;  3NJZ A;  5JOW A;  1PGW 2;  5LB6 A;  1MS3 A;  1Y9G A;  4ATF A;  4E8D A;  5JDB A;  2WO3 A;  1YLL A;  3MLL A;  3UL2 A;  4YVW C;  4A6O A;  4D7Y A;  3KQR A;  1PO1 2;  4IND A;  2YPJ A;  3BTY A;  4IET A;  3ACH A;  4TYS A;  3TBD A;  3VZN A;  2Y0I A;  2YFU A;  3WXP A;  4NHY A;  3MIH A;  5JI7 A;  3VBS B;  2I07 B;  2E26 A;  1YYN A;  5FMO S;  2PLV 2;  4HLT A;  3UK9 A;  3EXU A;  4LE4 A;  2Y6J A;  3A4U A;  2ET1 A;  2C4X A;  2VGD A;  4HKO A;  4Q4Y 1;  1GZW A;  5CIR A;  4IE6 A;  3ALQ A;  3PU8 A;  1Q8O A;  3K77 A;  4AGR A;  1JMU B;  3RSJ A;  1F5J A;  3POI A;  1GZW B;  2RMU 1;  3C7H A;  4L99 A;  4BK5 A;  2EIC A;  1O7F A;  2IXJ A;  1JZ2 A;  3Q8A A;  1GZ9 A;  1ULC A;  2VW2 A;  2BZD A;  3MW4 A;  4RA0 A;  5T54 A;  1BCX A;  1UY3 A;  3AJZ A;  3TAY A;  1PVC 2;  4ET7 A;  2R04 1;  5F32 A;  3WSO A;  2GC2 A;  3MIG A;  4YSF A;  5A6Z A;  3VBU A;  1IQA A;  1ASJ 3;  1IG0 A;  2WYF A;  4I09 A;  4XDO A;  4Y5S A;  4B29 A;  2JIJ A;  3KWV A;  4CEW C;  1IG3 A;  1ULD A;  2IXL A;  2WAO A;  1UYP A;  1KXG A;  3ACF A;  1UOJ A;  4UBH A;  5FZ4 A;  4CP2 A;  2VMD A;  3RMY A;  4Q1R A;  1HRV 1;  1XE8 A;  5GLW A;  2J1E A;  4HXC A;  3M8L A;  5DDJ 3;  5FJK A;  5T5O A;  4JZR A;  5FPB A;  4KH9 A;  1PHM A;  1QY4 A;  2RS3 3;  3NNF A;  2BV4 A;  2VXJ A;  4LHN A;  1FPN 1;  4B4R A;  5FP9 A;  5FYH A;  3WNL A;  3AZV A;  4CPB D;  3IPV B;  2EIB A;  1NKG A;  3IN9 A;  5FY7 A;  4AL9 A;  2Q8O A;  3LA2 A;  1C4R A;  2Y6H A;  3VBH B;  3KCC A;  3CEW A;  1BMV 2;  2CTV A;  2V5D A;  1AF9 A;  1CN1 A;  1SDD B;  3CO2 A;  4GH4 A;  4RR3 B;  2OYZ A;  2LTN A;  2PHD A;  3VBH A;  1WW4 A;  2AUY A;  1AXY A;  5A33 A;  4YAR A;  3N4M A;  4FTB A;  2Q5T A;  3H3U A;  1OLM E;  1WA4 A;  1CAW B;  3ZN6 B;  1PO1 1;  2JDU A;  3KV6 A;  3TEZ A;  3LZZ A;  3I2F A;  1UY4 A;  4RGA A;  5G05 L;  4D69 A;  1NCQ C;  5CG9 A;  2DVG A;  1BEV 3;  1UAI A;  2WQ8 A;  4JVA A;  1ND2 B;  3IKW A;  2C6S A;  5DZF A;  5GZE A;  5FDB A;  5J1X A;  4YZ3 A;  4ZHN A;  5C3R A;  1ND3 C;  4DEQ A;  3FHA A;  2WRA A;  3N9O A;  1ACC A;  1H4G A;  2W47 A;  3TOJ A;  5FO8 B;  3NAP C;  2BDR A;  2VMG A;  3PVE A;  3WF0 A;  3WQ0 A;  2VMC A;  5FZ8 A;  2R04 2;  1DGR A;  4Q8K A;  4DUV A;  5I0R A;  1ASJ 1;  1WD3 A;  1WUV A;  3WP4 A;  1G9D A;  2AEN A;  1EPZ A;  3VHN A;  3M1H A;  4QPG B;  3S57 A;  5CKN A;  1S0E A;  4GMP 0;  3WP5 A;  5EV7 A;  3OPW A;  1IGO A;  5C3O A;  4FOW A;  1QU0 A;  2D44 A;  1IZ3 A;  1OA4 A;  2JJ6 A;  4CDQ A;  5H9S A;  4L0P A;  2EAL A;  1AYM 2;  2WZ8 A;  2GNB A;  2JG8 C;  1SLA A;  5FWE A;  4EN0 A;  2BW8 A;  3RJ2 X;  1N3O A;  1CAV A;  4RQP B;  4B1M A;  1CJD A;  3KT1 A;  5FLJ A;  3ZYR A;  4E2S A;  3UNP A;  1X8M A;  2W0X A;  3TEW A;  1TQ5 A;  3ZYJ B;  2ARX A;  5FAX A;  3QH6 A;  4JCK A;  5FYV A;  1U12 A;  1RUO A;  2EAA A;  1UU4 A;  2E7T A;  4D0Q A;  2QQM A;  1S4C A;  1JUH A;  4Y1X A;  1WCQ A;  1W9Y A;  4QWN A;  2B9U A;  3SH5 A;  5A1L A;  5I0T A;  3HNB M;  3HBZ A;  3B69 A;  4Q4V 2;  1OUX A;  4LEJ A;  2QQL A;  1H0B A;  1Y7B A;  2Y60 A;  1EAH 3;  2KR2 A;  3OUI A;  3OSD A;  4AI2 A;  1KS4 A;  3BB6 A;  4XFF A;  4D8M A;  3G6J B;  1QOO A;  4FOV A;  1U5I A;  3I2G A;  4LO4 B;  1UPI A;  4FFH A;  3LEK A;  1AYM 1;  5J3U A;  4OCT A;  1W99 A;  1XQN A;  2IFW A;  4NIH A;  3A21 A;  4GB3 3;  5L36 A;  4D6R A;  2HLE A;  1RUD 3;  3VBF A;  3WCR A;  4CDU B;  3OYW B;  2PMW B;  2XVL A;  1AXZ A;  4FPJ A;  2VL4 A;  4PBP A;  4M01 A;  4Q4W 3;  4NRO A;  4XVH A;  1UU5 A;  1LES A;  2P3K A;  4XUN A;  2GH8 A;  3MW2 A;  3VGI A;  3CZJ A;  3ZFE C;  2W52 A;  1QJX 2;  2EF6 A;  3AZX A;  1GZT A;  1DU3 D;  1JYV A;  1HN1 A;  1WLD A;  4QM9 A;  5AVP A;  2QJV A;  4XFG A;  1XSQ A;  3MEP A;  5F2W A;  4KBB A;  5I93 A;  3E1F 1;  1W2O A;  1O4Y A;  2UYB A;  2UWA A;  3GZE A;  1EP0 A;  4LLF A;  4OHZ A;  2XG3 A;  4S2G A;  3VLB B;  2DVB A;  4E2Q A;  2BRT A;  1KJL A;  4LE3 A;  3WP3 A;  2GN3 A;  1Q43 A;  3HNY M;  4P02 B;  2A3X A;  1GSL A;  4GB3 1;  4XIK A;  3MF9 A;  5C5U A;  2XJU A;  4IEQ A;  2ZAH A;  3UV9 A;  3VBR A;  1CAX B;  2FDH A;  3THD A;  5EJ1 B;  1LEM A;  3SIS A;  3WF2 A;  4LBQ B;  3VBR B;  1UNB A;  5IYY A;  1RMU 3;  5DAB A;  5CFD C;  2WZE A;  3P3P A;  3H3L A;  3ZPO A;  4YW6 A;  4R4Z A;  3RVH A;  3EHK A;  3K4A A;  5C3P A;  4UW4 A;  1C8M 1;  2YG0 A;  4BQ5 A;  1HB3 A;  2UU8 A;  2JKB A;  3LWC A;  4YFW A;  3MPP G;  3KZ4 C;  4NPR A;  1C1F A;  3PMS A;  1LNS A;  2X8K A;  2VZR A;  3GYD A;  3OUJ A;  3T2O A;  5FZE A;  1W8T A;  3UGG A;  1BK1 A;  3D3A A;  2DYC A;  3PNA A;  1W28 A;  3WX5 A;  3OJB A;  1GUI A;  2HYK A;  2C5D A;  2WAB A;  3BPZ A;  5FP3 A;  2VW0 A;  3SC7 X;  4AHY A;  2NMN A;  4CU6 A;  2WUH A;  1RHI 1;  4BXF A;  4J1W A;  1VE0 A;  3VL9 A;  3AYD A;  4YGD A;  4NWW A;  1PK6 C;  1PZ9 A;  2IWG B;  1W8U A;  2JWP A;  4V2W A;  4XPV A;  5FP4 A;  1J58 A;  3POF A;  1D4M 2;  3J7M A;  3ST7 A;  3NV1 A;  3ZMO A;  4GJZ A;  3H8U A;  4AFB A;  2A6X A;  1X8E A;  3I8T A;  4M4R A;  1UO9 A;  2RHP A;  3C3V A;  2X5I B;  4K8R B;  5A3W A;  1KIT A;  2VVE A;  2X10 A;  4W8J A;  2Y6L A;  2O8Q A;  3AXD A;  1JZ4 A;  3W58 A;  2NPI A;  1MS4 A;  2RDQ A;  1B09 A;  1J84 A;  4IUG A;  1PMJ X;  4BM8 A;  1HQN A;  3JZV A;  4QPW A;  4JHT A;  4FPO B;  4ORF A;  3OBA A;  1YQC A;  4Y1U A;  3JBG 2;  4AOC A;  5IVF A;  2W87 A;  2BNM A;  1XJA A;  2XGX A;  1KS5 A;  3ZFF C;  2ZGN A;  2VUC A;  3N35 A;  4ZXK A;  2CAV A;  4X8N A;  3WEZ A;  3EYP A;  4Q4X 3;  2ZEW A;  4PHZ A;  4ARY A;  4BDV B;  1Y43 B;  4FAG A;  2VEC A;  3K48 A;  2YXS A;  2D5H A;  4WV8 A;  4KU8 A;  1MS5 A;  1VBA 3;  1AR6 1;  2A3Y A;  5IT6 A;  3FL7 A;  3D4K A;  3PTY A;  2VZS A;  2I45 A;  2B4K A;  3QOP A;  4LTA A;  3ZXG A;  4YW1 A;  4UFK A;  2RS5 2;  4P9I A;  1MEC 3;  3FX3 A;  3KSC A;  1KRI A;  4JTO A;  5IVB A;  2WJS A;  1W03 A;  3T08 A;  1RUE 2;  2JX9 A;  5ABJ C;  5I8Y A;  3EBR A;  2ADD A;  5KWR A;  3W21 A;  3NKG A;  1R64 A;  1I9R A;  1W6Q A;  3ZDS A;  3LAG A;  2VNR A;  2HBT A;  4UFJ A;  3MIE A;  2D3P A;  3I7D A;  1QKQ A;  5FYU A;  4LT5 A;  1RED A;  1RHI 2;  2VOW A;  3T0B A;  2EXH A;  1D2Q A;  5CKQ A;  4AR2 A;  4QKB A;  4F8A A;  3CL1 A;  5FPX A;  1JTZ X;  5L19 A;  2ZGK A;  4WVV A;  3RI8 A;  2JDZ A;  1JXN A;  2VUJ A;  1YQ6 A;  1JOD A;  5FCC A;  2XHN A;  3WT3 A;  3BI3 A;  5FY8 A;  4IEY A;  4OMD A;  2ORX A;  1H4H A;  3WF1 A;  4XZU G;  4YG0 A;  3IIA A;  1W04 A;  3G7D A;  2ZS6 B;  3N7L A;  4AFD A;  4Y22 A;  3CJI A;  3ZPY A;  2VNV A;  4LO8 A;  5JVV A;  3OY8 B;  2WNV C;  5HCB A;  1S0D A;  1BVV A;  1OLR A;  1DGL A;  1PZ7 A;  1XNB A;  5HCA A;  4JQT A;  3AYA A;  5I91 A;  3K4D A;  2EIE A;  1PNG A;  1GZC A;  1CZT A;  3BTZ A;  5GLT A;  2CV6 A;  5JI9 A;  4CEY B;  2OXB A;  3ZR6 A;  4RHV 3;  1HJG A;  1LGN A;  2GMP A;  2KXL A;  4C90 A;  5C71 A;  2G9Z A;  4AE2 A;  1G9F A;  1KEX A;  5BNN B;  3AMQ A;  1DQ4 A;  1ODM A;  4IER A;  1IS6 A;  4BHP A;  2W95 A;  3VBU C;  1MS8 A;  1POV 0;  4ASM B;  5GJ6 A;  5IVE A;  2P2K A;  4KWU A;  3GNE A;  4A42 A;  1M06 G;  1APN A;  1LOC A;  2C26 A;  2EID A;  2W3J A;  1S0F A;  1OHF A;  4IES A;  4FAH A;  2RS1 3;  1RUJ 2;  3BN6 A;  4BQ1 A;  4OMC A;  1V6I A;  3A7Q A;  5F1R A;  2HWB 2;  3CKH A;  2H6B A;  4GXL A;  4Y20 B;  4I01 A;  4BXS V;  3RNS A;  4PDW C;  3DCQ A;  2DCK A;  4XUT A;  5I0U A;  2HWC 1;  2VR4 A;  3VDB A;  4QDQ A;  4UT5 A;  4YM0 A;  5HXM A;  4LIU A;  2VBB A;  4PI0 A;  4Y4R A;  1YIF A;  3NNL A;  1R1A 2;  1SFY A;  2B42 B;  3HEI A;  2YHJ A;  1HX6 A;  3HT1 A;  4HN0 A;  2OT7 A;  1CJP A;  5F6K A;  1H2N A;  4CEW B;  1QXR A;  3DKW A;  1TZO A;  1O3Q A;  1LJ7 A;  1QJY 3;  4DO0 A;  1DQ2 A;  1Q3E A;  1URX A;  1POV 3;  2WL1 A;  1OA2 A;  4QQP A;  3UJO A;  1LGB A;  3WW3 A;  4FQ4 A;  1FYU A;  2GC3 A;  2ID4 A;  2P6C A;  3LPG A;  1NOV A;  1XE7 A;  4RR3 A;  1OOP B;  5C8W A;  5LBF A;  5K0U B;  2RJ2 A;  2VMH A;  3PVO A;  1BBT 2;  3WG1 A;  5K4L A;  1RHI 3;  4XTP A;  4YRD A;  1EPW A;  4Q4Y 2;  1ZZ6 A;  1AR8 1;  1ENX A;  3ATG A;  3HMY A;  3A0N A;  4KGQ A;  1LOE A;  1S55 A;  2RR1 2;  1CX4 A;  1NX9 A;  3PU3 A;  2ES3 A;  4LR4 A;  1B35 C;  3JB8 A;  3V65 A;  2W08 A;  4LBQ D;  2W46 A;  3IDC B;  1LOF A;  1ENQ A;  2JG9 B;  4LK6 A;  4PQ9 A;  5K9Y A;  2X09 A;  1D4M 3;  3H1M A;  4TXW A;  5SV8 A;  4ES9 A;  1Y9M A;  1D4M 1;  2QCS B;  1D2S A;  3T4H B;  3WDV A;  1XNA A;  1OLM A;  5DAP A;  1OF3 A;  4ZZ8 A;  2K0G A;  2ZGP A;  4MHR A;  4CSW A;  3TB0 A;  4OLL A;  4BQW A;  1ZZ9 A;  1UPS A;  1H9W A;  2XVG A;  3APB A;  4C0B A;  1XU1 A;  3ETQ A;  2CDO A;  4CUC A;  1RUI 1;  2WDB A;  4K8F A;  5E8A A;  4GWN A;  3GJA A;  2DVF A;  1NZC A;  4O7X A;  2W5F A;  5H9Q A;  3ELN A;  3FLT A;  4F83 A;  1OXC A;  3JBG 3;  2HBU A;  3OD4 A;  3O7O A;  2NN8 A;  4YPJ A;  4H7L A;  2ZGU A;  3OGJ A;  3SKV A;  4F3J A;  4AI1 A;  1NE4 A;  1OF4 A;  3V0B A;  5A7W B;  3ZFE A;  2PAM A;  2WFF 1;  1OQ1 A;  4C1W A;  2C0Z A;  2G9G A;  3HPN A;  5D1I A;  1YQ8 A;  1ZBA 2;  1N3P A;  4A6S A;  4PF5 A;  1E5I A;  4JDO A;  1F15 A;  2D97 A;  5CEH A;  2A6W A;  5EYY A;  1DZT A;  3F2Z A;  2RS5 3;  1BMV 1;  3CIH A;  4PLO A;  3JD7 2;  3BU0 A;  3SEP A;  3MHZ A;  1IOA A;  2GAL A;  2ZEZ A;  1E5S A;  2VZO A;  4D6S A;  4AI9 A;  2PHX A;  5JSR A;  2HWD 3;  1QXJ A;  2W1U A;  1RUG 3;  1DDL A;  1OUS A;  4WZF A;  1OLQ A;  3KF3 A;  4QKD A;  1QJU 1;  2A6Z A;  3PUR A;  3NL1 A;  4DXS A;  5AC9 3;  3FBY A;  2J1A A;  2ZEX A;  4MH0 E;  3FFZ A;  5IAX A;  2GDF A;  3GCW A;  4KU7 A;  1QJX 3;  4CE8 A;  5LY1 A;  1MS1 A;  1AX0 A;  3WG2 A;  1JZ7 A;  1QJY 1;  4WBB A;  2L9L A;  2QZ3 A;  3AP4 A;  1R1Z A;  3FC0 A;  3NWK A;  1MAC A;  5BNN A;  2X29 A;  1GR3 A;  1VBD 2;  1S2B A;  4DIQ A;  2OZ6 A;  5LA0 A;  2Z4F A;  1NY7 2;  4YLZ A;  5L9V A;  2E6V A;  1MZE A;  4AQS A;  2ZHK A;  3FUQ A;  3O1O A;  4OUL A;  2A3W A;  2CGN A;  3OBT A;  2XLA A;  4KG0 A;  1GQP A;  4Y5Z 0;  2VME A;  4JQR A;  3W59 A;  1RUH 1;  4XMI A;  1N3Q A;  4GD4 A;  2P3Y A;  3JBG 1;  1NT0 A;  3VHR A;  4B7E A;  3OGR A;  2HEW F;  5EQU A;  2A7A A;  3I2O A;  1WD4 A;  5FZA A;  2WN3 A;  4HON A;  5F5A A;  1K45 A;  2R07 2;  5DUX A;  4PIZ A;  2ARA A;  1O3R A;  3J7N A;  4Q4V 3;  4R4X A;  1DG6 A;  1YJL A;  2PYT A;  3LFI A;  5FV3 A;  4LBQ A;  4L92 A;  4N9I A;  4PCR A;  3AK0 A;  3BTX A;  3ZMN A;  4CP1 A;  1W6P A;  4Z1V A;  2V09 A;  4JGY A;  2HWF 2;  3ILR A;  1KDM A;  4CEW A;  4BMB A;  1IQD C;  1JYC A;  3ZYH A;  4FTE A;  2WWJ A;  1MVQ A;  2BFU L;  2YY1 A;  3AXE A;  1Y4W A;  3MZH A;  5EJZ B;  1SAC A;  5A33 B;  1GAN A;  1RMU 2;  2E53 A;  1X9T A;  2RV9 A;  1I5P A;  5L73 A;  4COW A;  1RUH 2;  2JB8 A;  2R07 3;  4ZS2 A;  1KJR A;  2CWM A;  5LZ6 A;  1MPX A;  4TZD A;  3K51 A;  2AAC A;  1V6M A;  2O14 A;  1YC6 1;  2XQR A;  1S0I A;  2VNG A;  1DBN A;  1YCI A;  2JG9 C;  2ZPX A;  4G4F A;  1HJF A;  2VOV A;  2P34 A;  1W8N A;  3K46 A;  2ZTN A;  3Q8F A;  4ZU7 A;  1PVX A;  2QKD A;  1QNY A;  1TVG A;  4LOR A;  5A7N A;  5LEJ A;  3AP7 A;  1N47 A;  1R1A 3;  2OUJ A;  4XFI A;  3VBO A;  5A3N A;  1EAH 2;  1Q8Q A;  3CHX A;  4QX7 A;  1H8V A;  3PDQ A;  1VB4 A;  3H1W A;  1VR3 A;  4JGY C;  5GLU A;  4DY5 A;  2Q8C A;  4WM8 B;  3TEX A;  1QOS A;  2VJX A;  4Q29 A;  4COY A;  5AC9 1;  3FWE A;  4KQ7 A;  3ZIW A;  2FQP A;  4CUG A;  5FWJ A;  5ISL A;  1QMJ A;  1F5F A;  3O1M A;  1TE1 B;  4OI1 A;  3O5S A;  5FY9 A;  4E4D X;  2DUR A;  4Q4X 1;  4QPG C;  3ZYP A;  4D94 A;  4WM7 A;  5FPU A;  2XB6 C;  4P9L A;  5DG2 A;  2PTM A;  2HWD 1;  4CDQ B;  2FMD A;  1S0J A;  4LBO A;  3IMM A;  3K3N A;  1OD5 A;  3K2O A;  3BTA A;  4QGL A;  2P4E A;  4NMI A;  4FPF A;  4Q5O A;  3OBR A;  2R30 A;  1H2K A;  2BGO A;  1YFX A;  4N43 A;  4DQA A;  3WLU A;  4ERO A;  5CFD B;  3RJR A;  2ADE A;  2BEO A;  1W0N A;  2JG8 B;  1X36 A;  4OHX A;  4R8H A;  1UN1 A;  5FYM A;  5CU1 A;  1FX5 A;  3NJV A;  4RSU A;  1FAY A;  5J7M A;  3C7F A;  1NE6 A;  1CAU A;  3MIC A;  4KMQ A;  2X53 S;  4QM8 A;  3V0B B;  2J22 A;  4XUR A;  3JD7 3;  4RHV 2;  5T5P A;  3RS6 A;  1DGW A;  3SH3 A;  1RIT A;  5A3O A;  2OKX A;  5BNN C;  2BQP A;  4ONU A;  4WZC A;  2XML A;  2R06 2;  1FNY A;  3KHB A;  4Q1P A;  4DRV A;  1H1M A;  3USU A;  5D8A B;  2WZR 3;  3VZJ A;  5C4W C;  4K40 A;  1RUJ 1;  3I3D A;  3LEG A;  1IS5 A;  4L97 A;  3DPR C;  3T30 A;  2YC0 A;  3B94 A;  5T3N A;  2RDN A;  2HWE 1;  1GNZ A;  2QTW B;  2XKO A;  1E5R A;  1TMF 2;  4QXK A;  1O3S A;  3E6B A;  2Z79 A;  5C3S A;  3QBQ A;  5FYC A;  1UW8 A;  1ULG A;  3ZXD A;  4JDM A;  1C3H A;  3FN9 A;  1LEC A;  2YPD A;  1GFF 2;  2RS3 1;  2J1U A;  2Y6K A;  4U36 A;  5FMD A;  1XSR A;  4S2H A;  4HOO A;  1LOA A;  2IFR A;  5DQ0 A;  2XJR A;  1N1Y A;  2XUE A;  5T52 A;  4EYU A;  4DRR A;  3J8F 2;  1DFQ A;  2E32 A;  2P17 A;  1I5Z A;  1VMH A;  2WNE A;  1LTE A;  1CX1 A;  3RI9 A;  4G9S B;  3HAG A;  4ZU4 A;  1PGS A;  2VZ3 A;  5EPA A;  5FZF A;  3M3Q A;  3RMX A;  4QX0 A;  1S0B A;  1BBT 1;  4I02 A;  5D2A A;  3T09 A;  1E5H A;  3O1R A;  1J1T A;  2XJT A;  3DV8 A;  1V9U 2;  2BP6 A;  1BYH A;  4CDW A;  5BNP B;  1OOP C;  1NLS A;  4COZ A;  5BNP C;  1GV9 A;  3R4U A;  2BVB A;  4AED B;  2WII B;  1O8P A;  1ASJ 2;  4Z92 B;  3NNG A;  2HEV F;  3NST A;  3POY A;  4HPK B;  3HQR A;  3RYK A;  3BOW A;  3ZXJ A;  4AVS A;  4CPB A;  4HZF A;  4FVV A;  4B4Q A;  4HPK A;  4NAO A;  3WQB A;  4D7T A;  3CMG A;  4Q0V A;  2OQ7 A;  5C9A B;  3O1U A;  2Q8E A;  3A22 A;  1RIR A;  3HQU A;  4FFI A;  4NII A;  4QGM A;  1VBE 1;  4P00 B;  3PUH A;  1RUE 1;  3FLR A;  4LPL A;  4O9G A;  4QPI B;  2XKP A;  3VL8 A;  3ZSJ A;  5A3U A;  4D7S A;  1OQE A;  5FYY A;  3MI8 A;  3GCX A;  3U07 A;  1ZZB A;  2VZP A;  4AFA A;  1AR9 3;  3C2U A;  4Z82 A;  3ES4 A;  4OHV A;  5FR3 A;  2TUN A;  3KLS A;  1WCD J;  1UOG A;  2H0V A;  3PLQ A;  2YYO A;  1A34 A;  1H1A A;  4YYO A;  3AP9 A;  4BQ4 A;  4IE7 A;  4BQX A;  1WBF A;  5JAX A;  1LB2 A;  1JOJ A;  5FYS A;  3DYP A;  4MGI E;  1GQH A;  4BLI A;  4LUL A;  1GBG A;  1JHJ A;  3POJ A;  5FYT A;  2A6V A;  4UF0 A;  2D93 A;  3CF6 E;  3BCW A;  2W1Q A;  1ZZ8 A;  1X7N A;  4UF0 B;  5FZM A;  4LKF A;  2DDU A;  3WUC A;  4LOS A;  1RUI 3;  1UL9 A;  2ZJC A;  2PAE A;  4QHO A;  3S0M A;  2QVS B;  1ZVF A;  2EIG A;  1LEN A;  3O0W A;  1OOP A;  1LR5 A;  4BLJ A;  1ND2 A;  2VTX A;  5A3M A;  3THP A;  4FTS A;  4SBV A;  4PDW A;  2PLV 3;  5CAD A;  1DCS A;  1JI6 A;  3W20 A;  4DMI A;  3NRU A;  4UW5 A;  2UY8 A;  4EWD A;  1O3T A;  1K12 A;  3Q8C A;  2Q1M A;  4Z2W A;  3M7A A;  2QQK A;  1V6K A;  2R06 1;  2ZCW A;  3WF3 A;  5M0T A;  4W6Y A;  4Z07 A;  1WGP A;  5A3P A;  2R06 3;  1F4H A;  1UZ0 A;  2JG8 A;  3R4S A;  4QU2 A;  4LBL A;  2IXK A;  2TNF A;  5J36 A;  1ULF A;  1L7L A;  3R05 A;  4XF4 A;  1G9A A;  3VBF C;  3HWJ A;  2HWE 3;  3RFR A;  1R1A 1;  2J7M A;  3B9I A;  4XFH A;  1V9U 3;  1W6M B;  4XCB A;  5FZC A;  1OD3 A;  3IB3 A;  4IDZ A;  4FOQ A;  3PVN A;  2PN5 A;  4MO3 M;  2BU9 A;  5F8P A;  5L9B A;  1C5I A;  4I0W B;  1HB2 A;  1D0G A;  1DQ0 A;  2UYA A;  4J1X A;  1UWW A;  5LBE A;  2JE9 A;  2QDR A;  1FI2 A;  4B1L A;  2XDV A;  1RGS A;  1Z7S 3;  3DKQ A;  1GOH A;  2ZKN A;  4JC1 A;  1UZV A;  1FT9 A;  1CES A;  2WS9 1;  4TLG A;  5C4W A;  4I30 A;  1ZZC A;  1PGL 1;  1VMF A;  4L11 A;  4XAC A;  3ZFE B;  4LLO A;  2XQX A;  2JD9 A;  3IDE A;  2F4L A;  2HWF 1;  2NM1 A;  5GZG A;  3N9P A;  3KV9 A;  4YWA A;  5JOY A;  5A7P A;  1VBA 2;  2YC4 A;  3CJI B;  2MEV 1;  3TNQ A;  2ZXQ A;  4P5Y A;  5JOX A;  4COU A;  5GZD A;  4WVZ A;  3RZM A;  2WZR 2;  5FYB A;  3A0K A;  1W05 A;  4NHX A;  2G1M A;  3C8X A;  1FMD 3;  2WYS A;  4DB5 A;  2GC0 A;  5JIU A;  1VMJ A;  4JKM A;  1GNY A;  3E5Q A;  4AXO A;  4XFA A;  1RUC 3;  1FNZ A;  4XDP A;  5FOJ B;  1V6J A;  2LRP A;  4AED A;  2WFF 2;  4M4P A;  3K4Z A;  2VUA A;  4QPI C;  2VTF A;  3WR0 A;  1JN2 P;  4K20 A;  5E1R A;  4DS0 A;  4MG2 A;  4CTE A;  3VD3 A;  4ZKT B;  1D4V B;  5DDJ 1;  1WA6 X;  2FBE A;  5AC9 2;  5F3E A;  4XZP A;  4OVE A;  4HL0 A;  2V73 A;  4YGC A;  1GYK A;  1HN0 A;  3OD0 A;  5JLV A;  2VVD A;  2QDN A;  3WHT A;  1J3P A;  1PIV 1;  3JUU A;  2JEN A;  3AFG A;  3AKP A;  3Q8E A;  3AL5 A;  1QGL A;  2C9K A;  2CDP A;  5J98 B;  3S30 A;  3IT8 A;  2B8M A;  3MV1 1;  4XDQ A;  5A70 A;  4DUX A;  5I0D A;  4E27 A;  1H8T C;  1C8N A;  2WS9 2;  1TNF A;  3RZL A;  3U75 A;  5BUV A;  4AAX A;  2VBP A;  1UX7 A;  3GZU C;  2ZGS A;  1IKP A;  1UY0 A;  2XR4 A;  1YQ2 A;  2FD8 A;  5F6L B;  4QX8 A;  4XCA A;  2D6N A;  3DXU A;  4RD7 A;  1SG3 A;  2ZAA A;  1HRI 3;  1K5M A;  2RS5 1;  4WM7 C;  1SLL A;  4MGT A;  1W6P B;  1W9T A;  5FY4 A;  2HWE 2;  4P5H A;  5ABJ A;  1HRI 2;  1KQR A;  3V56 A;  2VUD A;  3I3B A;  4Y33 A;  4KGG A;  3BPS A;  4X6R B;  5FPA A;  5IK4 A;  3I2J A;  2EVX A;  4BQ3 A;  3H42 B;  2VOX A;  4ZON A;  1I1E A;  5KHG A;  4UWD A;  2W68 A;  2WSU A;  3HN3 A;  4E4Z A;  4V1P A;  3VBO C;  4YZ1 A;  3HT2 A;  4QKN A;  3QH7 A;  1FV3 A;  3SHR A;  3I3Q A;  5FZG A;  3PJQ A;  4N53 B;  5L7O B;  2Y8K A;  3WW2 A;  1SHW B;  5HCH A;  2E51 A;  1IHM A;  2QQO A;  2FCU A;  2R1B A;  3DPR B;  3ZSK A;  3ZFF A;  2VE1 A;  3RZZ A;  3AMP A;  4UFI A;  2E33 A;  5LY2 A;  2WNV B;  4R9D A;  2OS2 A;  2NYY A;  1POQ A;  2RR1 3;  3L2H A;  4XXP A;  4RYD A;  2BBA A;  3W9A A;  5A32 B;  2YGM A;  2WT1 A;  3V64 A;  1FPN 3;  5LK7 B;  5F5I A;  2WLQ A;  3GBF A;  3ABZ A;  4PJY A;  3H8R A;  2NQY A;  2FCV A;  4MET A;  4UI9 L;  1UYZ A;  2PEL A;  2A70 A;  3NW4 A;  2RDS A;  3WCS A;  4XBQ A;  1E57 A;  2RS1 2;  4YVW A;  2KA3 A;  2GP5 A;  2R07 1;  4HBN A;  3WOG A;  2B45 X;  2LS6 A;  4ES8 A;  1GQG A;  5EZW A;  5FYI A;  1BXH A;  5KBF A;  5FK8 A;  1LOG A;  2XUM A;  2PHW A;  1VBD 3;  1CAU B;  1PVC 1;  4XAA A;  1MS9 A;  5JUV A;  2WT2 A;  5DZG A;  1PK6 B;  3KB5 A;  1HB1 A;  1HV1 A;  3NV2 A;  2VUL A;  1GOF A;  3GBW A;  1DGR N;  2ZHM A;  5JR2 A;  3WHU A;  5FY1 A;  1H2L A;  2Z5W A;  1U5Y A;  1JZ6 A;  4XFC A;  4W6W A;  3WDX A;  3B02 A;  5FZH A;  3FHQ A;  4FXK B;  2WO2 A;  4NIG A;  3H1Y A;  2MNG A;  2DU0 A;  3T2Q A;  3USU B;  2ZZJ A;  3SXW A;  3I3M A;  1DQ5 A;  2WR9 A;  5FRA A;  3S6P A;  4N53 C;  1VB2 A;  4CVU A;  1W2A X;  3K3O A;  1NQJ A;  4XJ8 A;  1QIQ A;  2VZQ A;  1QJE A;  2A6Y A;  1ZBE 3;  2G4I A;  1NCQ B;  2VAU A;  2DCT A;  1NAE A;  3HQX A;  3D8C A;  3PUQ A;  1AX1 A;  4IGO A;  3FJS A;  1DLC A;  1PMI A;  2VCC A;  4YW4 A;  5CFC C;  1IPJ A;  1ZBE 2;  2J1R A;  5FLH A;  4GZ9 A;  4MXW A;  4XBL A;  4P9W A;  5K0U C;  1TNR A;  4QKF A;  2R0F A;  3MUZ 1;  1BQP A;  3VBS C;  4IEP A;  4I0B A;  3T3Y A;  1MS0 A;  2E7Q A;  1PM7 A;  3ZKY A;  4BOW A;  5KHK A;  1QEX A;  3J7L A;  3DL3 A;  4PQQ A;  2WAA A;  4OFG A;  1FOD 2;  1NQD A;  5IW0 A;  5FO7 B;  3ZYF A;  2ZA9 A;  1DIW A;  5FQ0 A;  5DXD A;  2YMZ A;  1CPN A;  4NWV A;  2VCB A;  4QB6 A;  4RS5 B;  1JH5 A;  1UIK A;  3WD5 A;  1VBE 3;  4CDW B;  3OF1 A;  1UZY A;  2BTV C;  3AM2 A;  2O1Q A;  3M2M A;  5J48 A;  1H6Y A;  2YUE A;  1GWM A;  2OW4 A;  4IEX A;  4Z8B A;  1JOP A;  1J3Q A;  1VJ2 A;  3HIF A;  1TMF 1;  4I0A A;  5F3G A;  5T5J A;  4E9K A;  2AH2 A;  2CL2 A;  5IUQ A;  4MLO A;  2VTX J;  3OGG A;  4LOT A;  5FY0 A;  1ZBA 3;  1VAL A;  4FBF A;  1W8H A;  4Q27 A;  5BPX A;  4OI2 A;  2WBK A;  4AEJ A;  1AR6 2;  2VH9 A;  1SLC A;  1F31 A;  4XE9 A;  3FZ3 A;  5I8T A;  5FTT C;  4JV4 A;  3VBS A;  2RM2 2;  1K5M B;  1ZRC A;  4PIX A;  5JSO A;  4LO7 A;  2D6L X;  5CNA A;  3RQ0 A;  1GP4 A;  3VDD B;  3GJB A;  1ND3 A;  5JXG A;  3BUC A;  3RZK A;  1AR7 3;  1GP6 A;  2Y6G A;  3DYM A;  5DUU A;  3MFC A;  1DP0 A;  1JZ5 A;  4AQT A;  1YWK A;  3RDI A;  3III A;  1GP5 A;  1WKY A;  3UT0 A;  1EAH 1;  1UKR A;  3H3Z A;  4AVA A;  5LEK A;  2ILM A;  2JIC A;  1MEC 2;  2AR6 A;  2QQJ A;  4QMA A;  3N9N A;  4DEV A;  3UJQ A;  4BCU A;  1ULE A;  3UKN A;  3EB7 A;  1UZZ A;  2XWJ B;  2ARB A;  2EXK A;  2FDG A;  3ZDV A;  5KC6 A;  3RG0 A;  3I97 A;  4ATE A;  2QE3 A;  1N1V A;  3OTF A;  1J59 A;  4TTG A;  1BLZ A;  4XBN A;  5C5T A;  3WV6 A;  1LGC A;  5CKM A;  2VM9 A;  2YZ4 A;  4IEV A;  4TWT A;  3KF5 A;  4ZZ5 A;  3ZOI A;  3W5N A;  2ZOE B;  1R08 1;  4HVR A;  4PDW B;  1QJF A;  1PGL 2;  2YU1 A;  1DYO A;  5A80 A;  3S5Q A;  2NZ9 A;  3PME A;  3U4S A;  2C1F A;  2LM3 A;  5C6C A;  1CZV A;  1MZ6 A;  5FY5 A;  1SLT A;  4JX0 A;  4GAL A;  4WM7 B;  2AEZ A;  4GH4 B;  1ULP A;  5HXV A;  2BFU S;  2D6K A;  3DYO A;  4RFR B;  3JU9 A;  4I3P A;  2WO1 A;  4CCD A;  2WFP A;  3NMB A;  3SH4 A;  2CU5 A;  1YFW A;  1OT5 A;  5DAW A;  3ASI A;  3NNJ A;  3ZN6 A;  5EWS A;  3WF4 A;  4ASL A;  4CDX B;  1LAJ A;  1F4A A;  3ECQ A;  4H2A A;  4FSJ A;  2VO5 A;  5FZI A;  1NXM A;  2JDH A;  1XYO A;  1RUF 1;  3J8F 3;  1KGY A;  4P9Y A;  5C8C C;  2LAL A;  3WG3 A;  2VY0 A;  1COV 1;  3LPF A;  2CYF A;  3IDA A;  1VBC 2;  2OX0 A;  1F2N A;  1IKQ A;  2IZW A;  4HK9 A;  4IEW A;  4YZ4 A;  3S7E A;  1HXS 2;  3KVA A;  2HWF 3;  1JYT A;  5C8C A;  5J09 A;  2EXI A;  3SKJ E;  2IXC A;  1T6B X;  2WT0 A;  4K21 A;  3AKS A;  3PJY A;  3PUI A;  3D6E A;  3WZ1 A;  3M3E A;  5LRS A;  2DCY A;  4GIQ A;  1VBB 1;  2Y0O A;  5D8A C;  5C4W B;  4I3G A;  2JE8 A;  3PIJ A;  1C57 A;  1BK0 A;  1VIW B;  4WVM B;  3SCH A;  4C1X A;  2RS1 1;  3B93 A;  3U10 A;  1OQD A;  3ZXE A;  3C7G A;  3I4I A;  2D3R A;  4XQD A;  3ZKU A;  1F35 A;  2KD7 A;  1PX4 A;  1J1L A;  4XJA A;  2RMU 3;  5KC5 A;  2VQT A;  3GHN A;  4XF3 A;  2XJP A;  4YVS C;  3OCP A;  1US2 A;  3MYX A;  3U14 A;  2EA7 A;  1JYI A;  4IEZ A;  1Q5O A;  2ETE A;  5EYX A;  1NLR A;  1V6N A;  2DTW A;  2BJS A;  3ZSL A;  3ILF A;  3OY8 A;  3H9A A;  4QPY A;  5FMC A;  4AHW A;  1LHV A;  4YG3 A;  2ZHL A;  1F9K A;  1H8T A;  3WW4 A;  1YO8 A;  2XBO 1;  3GZT B;  4TN7 A;  4A45 A;  1VLN A;  3GM8 A;  4QX5 A;  4O9E A;  4W65 A;  5DAQ A;  4CUA A;  1MQT C;  4XW3 A;  5B2G B;  2R32 A;  2CGP A;  2YC2 A;  1DZQ A;  2VZV A;  4QB2 A;  4XFB A;  4AQ6 A;  3I2K A;  5F9T A;  4CCO A;  2DU1 A;  5A3L A;  4B3N A;  4NRM A;  3TYJ A;  2CY6 A;  1QWR A;  4Q26 A;  2XXZ A;  1RYY A;  5FZ6 A;  4AHX A;  2ARC A;  1DHK B;  4ZS3 A;  3P5B A;  5IK7 A;  2WQZ C;  3FE5 A;  5CIS A;  1PO2 3;  1YJK A;  5A7O A;  5C9A A;  3ROU A;  5IAT A;  2KM2 A;  4RL7 A;  2RE9 A;  2CSG A;  4YNI A;  5CFC B;  2GZW A;  5A6X A;  1C28 A;  4PLN A;  3VB9 A;  4O65 A;  4N90 A;  4BIS A;  1RUE 3;  1SDW A;  1UXZ A;  4HFS A;  4PF1 A;  5DPN A;  5FXZ A;  3NO8 A;  3O12 A;  3LA3 A;  3AZZ A;  4YW5 A;  4AI0 A;  2J1V A;  3B00 A;  2VC9 A;  2WNU B;  3BVC A;  5AVA A;  1CON A;  1AR9 2;  2GSY A;  2HKX A;  2PHF A;  2JXA A;  2UWC A;  4KWK A;  3IDB B;  2WNU A;  5FP8 A;  1NA1 B;  1AR8 2;  1O91 A;  2YBP A;  4S2D A;  4EQV A;  1ZBA 1;  3D0J A;  1I6X A;  4MVT A;  4XUQ A;  3QLQ A;  4A4A A;  4IV1 A;  2FZ1 A;  5KXB A;  2AC1 A;  1UMH A;  2XPJ A;  2A1X A;  3VN4 A;  2HWB 3;  3AB0 A;  3LSE A;  1GWL A;  4Q4W 2;  5FMO L;  5L9R A;  1AYM 3;  4QQO A;  3LIG A;  1LOD A;  3OEA A;  3AMM A;  1NLQ A;  2H6C A;  1HV0 A;  3HNM A;  3LD8 A;  5K0U A;  2WO7 A;  4MX3 A;  1WW6 A;  4MGS A;  2VOT A;  3E97 A;  4LHL A;  4ZPI A;  1MZ5 A;  3J8F 1;  3URF A;  5BY5 A;  2DUQ A;  4H3W A;  1W06 A;  5HBA A;  1EUU A;  2FMY A;  2Y26 A;  1XB9 A;  2WFF 3;  1CWP A;  4N53 A;  3LDB A;  2RS3 2;  1GU3 A;  4JHZ A;  2XOM A;  5L7O C;  3TNP B;  5JCT A;  3DF0 A;  4XJU A;  1WW7 A;  3AP6 A;  1VRH 1;  3RZJ A;  1Z7S 1;  1BJQ A;  3O0V A;  4ITC A;  4QGN A;  3LFM A;  4H7M A;  3SIT A;  3SMH A;  1MQT B;  1FOD 1;  3AP5 A;  3NJY A;  5FBZ A;  1YXW A;  1OBN A;  3ZSE A;  5FZK A;  1LHW A;  2GH2 A;  1UYY A;  5GM0 A;  2ZGT A;  5I0S A;  4NN0 A;  1XYP A;  4JGZ A;  3O1P A;  1PX3 A;  2Y34 A;  2SBA A;  3M3O A;  3MID A;  4FFG A;  1SLI A;  2XWB B;  1AR9 1;  5D21 A;  1ZM1 A;  1AUY A;  1R09 3;  1CVN A;  1FOD 3;  2P3I A;  1ND2 C;  3CNA A;  4BPZ A;  3N9L A;  5B4N A;  4J6G A;  1RJ7 A;  5IHR A;  3INA A;  2IXI A;  2JE7 A;  3IM0 A;  4P14 A;  4UFM A;  5JXI A;  5ANQ A;  3LEI A;  1VBE 2;  1OMI A;  3LA7 A;  3M4F A;  3V0A B;  3KD4 A;  1L7R A;  2YBK A;  4IGQ A;  4PT6 A;  2C9A A;  2DF7 A;  1QJZ A;  3MDP A;  3V0A A;  4TLF A;  5FO9 B;  1OKO A;  2F17 A;  1QDO A;  1EYB A;  4CDW C;  1EV1 3;  2WZR 1;  2AYH A;  5IFP A;  5EHD A;  1SFP A;  1B35 A;  4PLM A;  2OII A;  4FPE A;  1W0O A;  1CPM A;  1UCX A;  3AVR A;  4GKX A;  1C1L A;  3WNX A;  1H30 A;  2ZGO A;  2VMF A;  5IVC A;  4QHB A;  3KT4 A;  4HG6 B;  1JS9 A;  4F7Z A;  2Z42 A;  1HB4 A;  2QQI A;  5BNO C;  1YNA A;  1QQP 2;  3ES1 A;  1SEF A;  3EO6 A;  5SV5 A;  1C8M 3;  3JQX A;  3LIH A;  2P5B A;  4NUB A;  2HH9 A;  3CU7 A;  2FDK A;  1Q8V A;  1QOT A;  4CP0 A;  4ISQ A;  1W6Q B;  1W39 A;  2XLG A;  1TMF 3;  4CEY C;  1LHO A;  1X9P A;  3OG2 A;  5DZE A;  2RG4 A;  5FPV A;  4B7K A;  4MXW B;  4XF0 A;  5C9A C;  1HIX A;  4HKW A;  2WC2 A;  3BGA A;  3ILN A;  4GMP 1;  3WP6 A;  5GZC A;  3ZLI A;  2HWC 3;  2E63 A;  1CQ9 A;  1S2E A;  3MBW A;  3U11 A;  2FZ2 A;  1LHU A;  1TG7 A;  3CLP A;  4K1Y A;  4BIF A;  5JSP A;  2VG9 A;  1UU6 A;  2RR1 1;  5LRR A;  2PHU A;  4E4S A;  3DN7 A;  2IUW A;  2Q30 A;  3PTR B;  1KD7 A;  4AGG A;  5F3C A;  4L2N A;  2VMI A;  5DAV A;  1XNT A;  3M3C A;  3HN1 A;  5FZD A;  4QHZ A;  3ZSM A;  5F37 A;  4P08 A;  2E7A A;  4IV1 C;  1A8M A;  2DV9 A;  5DUV A;  1DQ1 A;  4FPC A;  4YZ2 A;  5IK8 A;  4COV A;  4XEZ A;  2P6H A;  1Y3T A;  2A71 A;  4HK8 A;  1DQ6 A;  1XND A;  4GH4 C;  4XQ4 A;  1NA1 A;  3JXS A;  5DMY A;  5FBJ A;  2G19 A;  4EZ4 A;  4R9B A;  3ZFG B;  3T1L A;  4CDQ C;  1G86 A;  1ODN A;  1RUD 1;  4HKL A;  4FPY A;  2W39 A;  1SPP A;  1ND3 B;  2XBO 3;  4JAA A;  2XH6 A;  4CCN A;  5FUP A;  5T5L A;  1RVF 1;  4Y4Y A;  5FPZ A;  4KBZ A;  4AI8 A;  4IV3 C;  4C8D A;  2PQS A;  4LQR A;  4YW3 A;  2PHR A;  2MEV 3;  4AED C;  3RYP A;  1REE A;  1QXP A;  4EE2 A;  1GKB A;  1REF A;  2K9Z A;  2JD4 A;  5J96 B;  4QXB A;  3AX4 A;  2JDA A;  4Q4V 1;  3O14 A;  4CDX C;  4HET A;  5EXO A;  5HI0 A;  1K5M C;  5F5Q A;  1QH6 A;  1NUK A;  4Q8L A;  2P3J A;  2DWR A;  2OUH A;  1WMD A;  2IVI B;  4D3W A;  4YGE A;  2A5Z A;  1AYN 1;  4BB3 A;  1JW6 A;  3JQW A;  4MUV A;  1N1S A;  3IZO A;  2ZX4 A;  2PAK A;  4OZO A;  5LCW L;  4CXW A;  2CWS A;  3WNO A;  1PZ8 A;  4GKY A;  2WKK A;  1WMF A;  3WNM A;  3OUH A;  2V5Y A;  4DOU A;  1W8W A;  2UY9 A;  5H9R A;  3NV3 A;  3ZXA C;  2VNO A;  2UUR A;  1W8Z A;  1XXN A;  4AEK A;  2V4V A;  4XJ9 A;  4YVS A;  3R6S A;  2VVF A;  5CG8 A;  1X33 A;  5ANN A; 
#chains in the Genus database with same CATH homology
 5FY7 A;  2YBS A;  5FZ9 A;  5F3G A;  5FYZ A;  5A3T A;  5CEH A;  4E4H A;  5FY4 A;  5FY0 A;  5FYM A;  3ZPO A;  4CCL A;  4Y33 A;  5FPA A;  3RVH A;  4D6S A;  4AI9 A;  4TN7 A;  5A7W B;  4URA A;  3KV6 A;  3AVR A;  5E6H A;  2XML A;  4GAZ A;  5FZE A;  5A7S A;  5IVC A;  3N9Q A;  3PUR A;  3OPT A;  5A3P A;  4ASK A;  5IVE A;  4CCO A;  5FZG A;  5FP3 A;  2YU2 A;  5LY1 A;  5A7W A;  5KR7 A;  2P5B A;  3N9O A;  4NUB A;  2XXZ A;  5FZ6 A;  5A7Q A;  4BXF A;  4IGP A;  5LY2 A;  3PUA A;  4AAP A;  4CCJ A;  5A7O A;  2GP3 A;  2OS2 A;  5FZ8 A;  5LWB A;  5FZC A;  4LXL A;  4V2W A;  5FP4 A;  5IVV A;  2WWU A;  5FYC A;  3N9N A;  5FPV A;  5FZB A;  4DIQ A;  4BIS A;  5IVJ A;  5FXW A;  4GJZ A;  5FJH A;  3ZLI A;  2YPD A;  5F5I A;  5FXZ A;  3OPW A;  2XDV A;  5FPL A;  4LIU A;  5FXV A;  4HOO A;  4QU1 A;  5A3W A;  3AVS A;  5A1F A;  2XUE A;  4EYU A;  4GD4 A;  4Y4R A;  5F3I A;  5F39 A;  5FP8 A;  5FWE A;  3PTR B;  2YBP A;  2OT7 A;  2GP5 A;  4QXC A;  4QXH A;  5F3C A;  5FZA A;  5FZD A;  4HON A;  5F37 A;  5FYV A;  5FZF A;  4DO0 A;  4LIV A;  5F5A A;  5FYI A;  2YU1 A;  5F2S A;  1VRB A;  5FZL A;  5A80 A;  5IVF A;  3U4S A;  5FV3 A;  3N9P A;  5FY5 A;  3AL6 A;  3KV9 A;  4QWN A;  4EZH A;  4GJY A;  5A1L A;  5FZ7 A;  5A7P A;  2VD7 A;  5FBJ A;  5FZ1 A;  4EZ4 A;  3LD8 A;  5FY1 A;  3DXT A;  4D6Q A;  5K4L A;  2WWJ A;  4CCN A;  5FYB A;  5FUP A;  5FZH A;  5FZI A;  4C8D A;  3PU3 A;  3PUS A;  3PU8 A;  2OQ7 A;  2OQ6 A;  4Y3O A;  4XDP A;  3KV4 A;  2OX0 A;  2Q8E A;  3LDB A;  5IVB A;  4D6R A;  4V2V A;  3K3O A;  3KVA A;  4QXB A;  5FP7 A;  5FXX A;  5LW9 A;  4BU2 A;  4CCK A;  5FYY A;  5FZ3 A;  4LIT A;  5A7N A;  3PUQ A;  5F32 A;  5F5C A;  3NJY A;  4IGO A;  3KV5 A;  4CCM A;  5F3E A;  5FYU A;  5FZK A;  4CSW A;  2Q8D A;  5A3N A;  5IWF A;  4XDO A;  3N9M A;  3KVB A;  4QX7 A;  2PXJ A;  3PDQ A;  3UYJ A;  5FZO B;  3AL5 A;  5FZ4 A;  2Q8C A;  5FYS A;  5F2W A;  5FZ0 A;  5IW0 A;  4CUG A;  5FWJ A;  5FY8 A;  5ISL A;  5FYT A;  3N9L A;  5FJK A;  5FY9 A;  4UF0 A;  5IVY A;  5FPB A;  2W2I A;  5FPU A;  5FUN A;  3U78 A;  5ANQ A;  4UF0 B;  4QX8 A;  5FP9 A;  5FZO A;  5FZM A;  2YBK A;  3DXU A;  4IGQ A;  5FYH A;  3K3N A;  3K2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...