5FZAA

Crystal structure of the catalytic domain of human jarid1b in complex with 3d fragment 2-piperidin-4-yloxy-5-(trifluoromethyl)pyridine (n10072a) (ligand modelled based on pandda event map)
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
462
structure length
453
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with 3D Fragment 2-Piperidin-4-Yloxy-5-(Trifluoromethyl)Pyridine (N10072A) (Ligand Modelled Based on Pandda Event Map)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
total genus 140
structure length 453
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fzaA01
4DO0A 5FY4A 5FZKA 5FYZA 4D6RA 3RVHA 5IVYA 4V2WA 5IVBA 2VD7A 4QX7A 5F37A 4LXLA 3K2OA 5FP4A 5FYBA 5A7NA 5CEHA 4CCKA 4QWNA 4QXCA 4QU1A 5LY2A 5F5IA 5FXWA 4AI9A 5FWEA 3OPTA 2YU2A 3LD8A 4XDPA 5FYTA 5FJHA 5A1LA 2GP5A 5FP3A 3UYJA 4LIVA 4GAZA 5E6HA 5F3GA 5FJKA 5A3WA 3K3NA 3U78A 2WWJA 5F2SA 4BXFA 3KVAA 5LY1A 4DIQA 4IGPA 5FZFA 5FYVA 5ANQA 5A7SA 2XXZA 3N9NA 5FPVA 2PXJA 5F3CA 5FY0A 4D6QA 5FYIA 5FXXA 5IWFA 5A3PA 3KVBA 3PUSA 3LDBA 4Y4RA 5F2WA 5FY8A 4CCNA 4E4HA 5IVCA 2W2IA 2OQ7A 5FZMA 3N9QA 3DXTA 3U4SA 4Y33A 5FUNA 4NUBA 2OQ6A 4GJYA 5F3IA 5FZ9A 5A7WA 4BU2A 4EZHA 4BISA 5FYMA 2XUEA 3AL6A 5A7QA 2Q8DA 3DXUA 4TN7A 5A80A 5KR7A 5A7PA 5F32A 5F5CA 4EYUA 5A3TA 4CUGA 5IVFA 5FZ8A 2Q8EA 3ZLIA 2GP3A 2YBKA 5FZEA 2YBSA 5FV3A 4CCLA 4QXBA 4CCJA 5A3NA 4Y3OA 2XDVA 5F39A 3ZPOA 5FPAA 2YBPA 3N9LA 5F5AA 5FZ6A 2Q8CA 4CSWA 5FZCA 4AAPA 2YU1A 4HONA 5F3EA 5FP7A 5FZ3A 2XMLA 4UF0B 5FUPA 5FBJA 4LITA 2OT7A 5A7OA 3KV6A 5FY9A 5FZ1A 3PU3A 4UF0A 4EZ4A 3KV4A 5ISLA 2OX0A 5A1FA 3PU8A 5FYCA 3K3OA 3N9OA 5FZ4A 5IVEA 5IW0A 5FZ0A 5FZAA 5FYUA 5A7WB 5IVVA 4XDOA 5FY7A 5FPUA 3OPWA 3PDQA 3PURA 4QX8A 5K4LA 4HOOA 4CCOA 4URAA 1VRBA 2YPDA 5FZIA 2P5BA 4C8DA 5FZDA 3NJYA 3N9MA 5FP9A 4V2VA 3PUAA 3PUQA 3AVSA 2WWUA 5FZHA 3PTRB 4GJZA 3KV9A 3AL5A 4IGOA 4QXHA 5FZLA 5FXZA 5FPLA 5FZOA 5IVJA 4ASKA 3AVRA 5LWBA 5FY1A 5FZGA 3N9PA 2OS2A 4GD4A 3KV5A 5FY5A 5FZBA 5FYYA 5FZOB 4CCMA 5FPBA 5FYSA 5FYHA 4D6SA 5FZ7A 5LW9A 5FXVA 4LIUA 5FP8A 5FWJA 4IGQA
chains in the Genus database with same CATH superfamily
1YCIA 1OF4A 2RS32 1OA2A 3OF1A 5FY4A 1AZDA 2A70A 2UWCA 4D6RA 5IVYA 1AR61 1PGW2 2VQ0A 1ZBA2 3PHMA 4XAAA 5F37A 1NZCA 1XSRA 3WP6A 3T2OA 3AP4A 2A5ZA 3VZLA 2ZGOA 5IAVA 5CFCB 2HWB3 1EUUA 5JI9A 4GWMA 4JKLA 4M3CB 2E32A 4HPKB 4CXWA 1UIJA 1UD1A 4XF9A 3LEMA 3Q8FA 4RGAA 5FWEA 3FLTA 1KGYA 4XDPA 4MG2A 4ZXKA 1GOFA 3IDEA 1QEXA 2VMIA 1IS6A 2P2KA 4QB1A 3ZVXA 2Z4FA 4Y22A 2D3SA 1U0AA 4JAAA 1GSLA 3VL8A 4W65A 5KHGA 1LEMA 3O1MA 1H2LA 3ZYRA 4E9KA 2F6BA 1PGW1 2E7QA 3ZYJB 3VBUC 4FTBA 1EPZA 3FHIB 1WLDA 2ZA9A 3MI8A 1OKQA 1V6OA 3B9IA 3AKRA 4CP9B 4Y4RA 2WZEA 1VBB2 2YFUA 1YFUA 4LMFA 5T3NA 2GN3A 4A41A 1OFNA 1BMV1 3ES1A 3HNMA 3WDWA 5ACA2 2W68A 2RS52 3KCYA 2NZ9A 4A4AA 5FPXA 1AR71 4LHSA 2XONA 1VBC3 4IE4A 4XQWA 4Y5SA 2XKOA 3AB0A 1BK0A 3CEWA 3NKTA 4QGLA 3WQBA 2CWSA 3B69A 3MIDA 1KRIA 1LAJA 1WBFA 1NE4A 4X8PA 5EIYB 1CZTA 1NLQA 3HD8B 1AL0G 3G7DA 4LUKA 5KXBA 4MX3A 3LEIA 4QQ2A 2GNBA 4P08A 1UYPA 5AFBA 1VBB1 2PN5A 1RUG3 3LPGA 5BNPB 4LOTA 1MS0A 4GH4C 4YGDA 1PMHX 1RUE1 3H8RA 1FOD1 2YBPA 1OQ1A 3N9LA 2WFF3 2D6OX 4G3YC 3FFZA 4H14A 4XJZA 4AAPA 2D43A 2P3IA 5FZ3A 5CYYA 1G9AA 2JIJA 3EO6A 3N7MA 2R30A 3VBOA 4Q2FA 5LEJA 1BYHA 1UMHA 2JDAA 3AKTA 3KHCA 2JX9A 3RDIA 1QDCA 4XHXA 4QDRA 1QKQA 4XFGA 4AQSA 5FQ0B 2QKDA 5GZFA 3PLQA 3ZIXA 3C7HA 4WVMB 4YW2A 1C4RA 2GMPA 1GLHA 1VAMA 1Y4WA 3MW2A 4O7XA 5HPOA 3AP5A 3C3VA 4YVWB 4FPHA 3GNEA 4Q4X2 1TE1B 4WM8B 2Y8KA 3N9MA 3NO8A 1RUD3 3NRUA 1A8MA 2DUOA 3I2OA 3I97A 1ULCA 1PZ8A 2RG4A 3WNPA 2FZ2A 2Q1MA 2RS11 2D5FA 2G9FA 3CQOA 3JBG1 4UW3A 2VQTA 3AZYA 3J7MA 4KH9A 3OOXA 1R081 5FZGA 1GQGA 1FATA 1S0GA 4FFGA 4GD4A 4XUNA 4GZ9A 3ACFA 1PGSA 1RC6A 2GC0A 2C9KA 2TUNA 4Q4W3 4UBHA 5LW9A 1UZZA 4HT1T 4NHMA 1VBA2 4CCDA 3DL3A 1VMJA 5LBBA 2Y64A 5J48A 4D69A 2JXAA 4AAXA 1GWKA 4CEWA 1Z0HA 3ZFEA 2FDFA 2J22A 1LJ7A 2PHTA 2IXHA 2ZGMA 5C8CC 1E5RA 2XJTA 4NHLA 4LXLA 4FSJA 5A7NA 4PLOA 1YHFA 2WO3A 4YW5A 3RI9A 1DLLA 2IWGB 4QXCA 5EJ3A 1XU1A 1ZBE1 2XL9A 1RUF1 1MVQA 4IERA 1B35A 1SLLA 1UYYA 2ZS6B 3AP6A 1UY0A 2WZ8A 3UYJA 4AWDA 5A3LA 1B35B 2WNOA 3MPPG 2ET7A 3GALA 1OBNA 3M3OA 5F2SA 3AX4A 3I3QA 3TAYA 2QCSB 4L11A 4DIQA 3N3HA 2VUDA 3AJZA 3DPRC 1XNTA 3HQUA 4IEUA 2YV8A 1Q8SA 4J6GA 3UKTA 4XEZA 2EALA 2F4LA 1PX4A 4Y24A 4BXSV 3POBA 3O0WA 1F9KA 4RFT0 4AG4A 1BVP1 1CWPA 4XILA 2A1XA 3EBRA 5A6ZA 1C8NA 4Q4Y2 5LK7B 3DXTA 1JH5A 4JGZC 1AJKA 1FPN3 1VBD3 2OQ6A 5D8AA 3TN93 2IVJA 3URFA 1V9U3 1YIPA 2BRTA 4RR3B 5JOXA 3ETPA 4JV4A 4CRQA 5DZFA 1TG7A 1UW8A 1C8M3 1QJU1 2W92A 2JDMA 3J4UH 1NQJA 5L19A 1ND3B 2Y38A 3DYPA 2PHDA 3KGZA 2O14A 4CCLA 4P5HA 4ITCA 4NHYA 1PO23 2E6VA 2DCZA 3EMRA 2CDOA 5T5OA 1TQ5A 4DZGA 3OJBA 2W9XA 2JDHA 3OGSA 3A0KA 5CNAA 3VV1A 4NPMA 5KBFA 5T54A 4HKWA 4NWWA 1W39A 1VBC1 2ZGLA 3IKWA 4FFIA 4ARYA 2XJQA 5IK7A 3E5QA 2VL4A 4B7KA 3OB8A 1AR72 1SCRA 1W8WA 2HWD2 2A3XA 1YLLA 1G9BA 2DFCA 2EXKA 3KQRA 3D6EA 2WT0A 3ME2A 2WN3A 3FBMA 3SCGA 4RS5B 4L9BA 4QPIA 5FLJA 1VRBA 4C8DA 1QJY1 2PAEA 2JE7A 1VRH3 3IWZA 2EXHA 4NRPA 3MGUA 4YFZA 4PIZA 4V2VA 4LK6A 2W95A 3MV11 4UT5A 3A23A 4YVWA 5H9PA 2PQSA 2YDEA 2JEMA 5CBLA 1Q8OA 2VBDA 4ES9A 1RUI2 3KV9A 3K48A 1XNCA 4XF4A 1YI9A 5C6CA 2OUHA 4FO9A 5A6QA 2VZPA 1S2EA 3RMYA 2V4AA 4XBQA 1NCRA 3KV5A 4AYUA 3WDUA 3B94A 5SV8A 1H2MA 1EYBA 4QKBA 4AVTA 1DIWA 2RJ2A 3ZKYA 1ZRCA 1KFXL 2YMZA 3VD9A 1JW6A 1XBFA 2RMU3 3OCPA 4QX7A 1VBB3 3MLJA 1EAH2 2RS31 4O61A 2XGXA 2A6VA 1HXS2 3KWVA 4IE5A 3VBSB 4AHWA 5FBZA 3M3QA 2PHXA 4YNIA 4B7EA 1REDA 2K0GA 1RB8G 3WNMA 4CDWB 3DN7A 2GSYA 2ZHNA 1RHI3 3SH5A 1V6KA 2PLV2 2Q30A 5F3GA 1GYKA 1NCRC 1R1A1 1H1MA 1CONA 1UMIA 4NE9A 1AHSA 4XCBA 1LOFA 4RGKA 2RDRA 5FZFA 3QACA 3ZFFB 3N36A 4DFSA 1GICA 5J37A 5JOWA 3GZUC 5IK4A 1WW6A 2PXJA 2B39A 2HEVF 3IIIA 3J7NA 1XYOA 4OI4A 3KVBA 2RJLA 3PUSA 3WXPA 1JBCA 4CCCA 4E4HA 2DVAA 1W6OA 1MEC3 4OI1A 1O3SA 1RINA 4ZONA 1STMA 3PVNA 4JVAA 4MGKE 4FAGA 1MS9A 1DYPA 3GBGA 1UKRA 4LO4B 5A7WA 4XFIA 2D6PA 4BISA 3LPFA 4FPKA 2Y26A 5K9YA 5A7QA 4AF9A 4ZXEA 3MF6A 4ATFA 3NAPA 4ISQA 1WZXA 3VZNA 2OVUA 4JTNA 1YFWA 2YBKA 1M06G 3WY6A 4JGYA 1QJZA 1W9WA 1OC1A 5C8CB 3TEYA 2HYXA 1UYZA 3ATGA 3T0DA 2EICA 2ZBJA 2FCTA 1RUD2 5C8CA 3GXUA 4CSWA 1ND2C 4JZRA 1DYOA 4OYUA 4G9SB 1FXZA 5FP7A 3ZYBA 4ZKTB 4CEWC 1JZ3A 4XF3A 5FKBA 3AKSA 3MBWA 3LGRA 1RUG2 1KITA 1NXD1 4CA9A 2O1QA 4KNCA 3H3LA 4NPRA 1H2KA 5E1RA 3CJXA 2P37A 1UCXA 4Q4W2 2OX0A 1K5MB 1IS4A 2XB6C 4UFIA 4BQWA 4DQAA 4OHZA 5D8AB 3D5OA 4AEDB 1W6PA 1ZBE2 5LBFA 3WSOA 5HV4A 3RI8A 4QX8A 4QM8A 5HCFA 4N7IA 2DU1A 4MVTA 1CAXA 4P9LA 3Q9OA 3AYDA 3FWEA 3WNLA 4AVBA 1ENQA 4FI9A 2QE3A 3AK0A 2PHUA 2PAKA 5HCBA 1JYXA 2WWUA 3UESA 4K20A 5JMCA 3AL5A 3NAPB 4OFGA 3KD4A 3VKFC 2P6CA 1EV11 2AR6A 4XBNA 4YG3A 4LJHA 3SITA 3T0AA 1NCQB 5IVJA 5LWBA 5DAVA 5FRAA 4ASMB 1CVNA 3LIHA 2PMWB 4QDQA 1RMU3 3W59A 1IKPA 1JZ8A 1FMD2 4MH0E 5EHDA 1JI6A 4LHKA 5FDBA 3PUIA 2MNGA 3VBRC 2JDZA 1NE6A 4EWAA 1RUOA 2MHFA 2JG9A 1H6XA 1W9SA 2YUEA 4KWJA 3H8UA 5AC93 1WMDA 1LOEA 2VAUA 4ZU5A 5LA0A 1CGPA 2FDHA 1MVEA 2CL2A 3BIWE 3POWA 4HKOA 3I3DA 1L7RA 4B8EA 3WHUA 3B3QE 1X36A 2WZR3 3D3AA 1U5YA 1LCLA 4BH9A 5IK8A 3BTAA 1O5UA 1KJLA 5DUVA 4EN0A 3DECA 3AYCA 5G04L 5A1LA 5EP9A 1J58A 3AMQA 4M3CF 2R32A 4WVWA 1C5IA 3ALQA 5E6HA 4B1LA 4DUVA 4Y26A 3VBFB 2R0HA 3ZFGB 2Z79A 3QCWA 2D93A 4GULA 3A0NA 1V6JA 4BXFA 3RMXA 5BNOC 3KT4A 2FBEA 4IGPA 5C5UA 4AHXA 2OW4A 2MPFA 1AXZA 2XXZA 2VZ3A 2WUHA 1HRV3 2ORZA 5EQUA 4FT8A 4JC1A 1U12A 2LM3A 3ZXEA 4PLMA 5AC91 1TZOA 2Q4SA 4QKNA 3H9AA 3AFGA 2RS13 2BERA 3JBG3 3W58A 4NMIA 5KHJA 3WNKA 1NXMA 1OOPB 2BBAA 1A78A 2VNRA 4IV1C 2CU5A 4LQRA 4ZU7A 2JE9A 1LTEA 1ZZ8A 1W8TA 3WP4A 4QKDA 5C70A 1EP0A 3BB6A 3RWNA 2XBO3 2JDUA 2VOTA 1U5IA 1YQCA 4S2FA 2PHRA 4LK7A 3VDDC 1GZTA 3WW3A 1XYPA 3S6PA 4GB32 4XXPA 3ZYPA 5HXMA 2W0XA 3VHRA 1REFA 2PA7A 1FPN2 2W1WA 3TN92 3VGIA 4YW1A 1ULGA 3T2QA 1NUKA 3WCRA 1V0AA 1GZ9A 3ZYIB 1CZVA 1UPIA 1JUIA 5F5AA 4LA2A 4F8AA 5JSRA 5FO7B 3WR0A 3J26N 2PHLA 4YW3A 3VHOA 3ZN5A 4Q26A 1WD4A 1S2KA 2D6MA 2Q8OA 3MFCA 4DMIA 4UF0B 2PELA 3O1SA 3KLSA 2XWBB 3E5XA 3A4UA 3O1UA 1GP5A 1WGPA 1KS4A 5CG8A 1RUG1 2GALA 2VC9A 3ACIA 1V6IA 3PU3A 4UF0A 2BP6A 3CO2A 4EZ4A 4LBMA 4Z2WA 3K3OA 5I8TA 3FZ3A 4A7YA 1FYUA 1ZZBA 3BIEA 1RUI3 3VBHB 2I45A 4JQTA 3PVEA 2VOVA 3POIA 2XJPA 2IC1A 3BOWA 3NJYA 4QPYA 5FAXA 4COUA 3PVBB 1AR73 2J7MA 4FCAA 1W2OA 3VBHA 1W2NA 4LT5A 5KXDA 3RJ2X 4PF1A 4ZU4A 2R062 3I49A 1VE0A 2JKXA 1EAH1 4GJZA 5SV5A 4E2SA 2BQPA 4DRRA 1V00A 4FFHA 1RMU1 1O7FA 2VQUA 2NP0A 1F31A 2RV9A 4JKKA 4AEKA 2NM1A 3GJBA 3O0VA 2R041 3N9PA 4DNYA 3N7JA 1IQAA 2ET1A 3IT8A 2E53A 5JLVA 4PDWC 1LU1A 4L99A 4AZZA 1TMF1 1UPSA 3V0BA 2AACA 2LRPA 1NLSA 4XURA 5DXDA 2OA2A 4YYOA 2XPJA 2C6SA 3J8F1 4CTEA 1S2BA 1TVGA 3VBUB 5HV0A 2VCBA 2GC1A 2B8MA 4MSVA 2JD9A 4PT6A 4SLIA 1DFQA 5C9AC 2AEZA 4QGNA 1HLCA 4OMCA 4QPGC 4QX2A 1ZREA 5LY2A 1XPWA 1RUJ2 5C33A 4PI0A 3UGGA 1Y9GA 1NX9A 1DQ0A 3BVCA 3I59A 4XQDA 4I01A 4UW4A 2RR11 1AL21 2AH2A 4D7YA 3I3MA 4DS0A 5BV6A 1VPHA 1FT9A 5IATA 1FNZA 5F5QA 5A3WA 3T2PA 1S0CA 2Y6KA 2AGSA 2DUQA 2WWJA 4CE8A 4OHYA 3K46A 5FTTC 3CBNA 4YLZA 4XFBA 2ZGUA 3FLPA 5AVAA 1SMVA 5BPXA 5I0RA 4QQLA 1HJFA 3PUHA 1WLTA 1ZZCA 3AYAA 3K4AA 4QQPA 4XUOA 3T1MA 2G1MA 4TTGA 1QJX3 2O8OA 3OGVA 4LE3A 4LLFA 5B4NA 2RE9A 4B4RA 4CCNA 1DGWX 3VBSC 5IVCA 3PMEA 4ZZ8A 4XFCA 5L73A 4BIFA 1NA1C 5K0UC 4AVVA 1JMUB 2GN7A 4M0HA 4CEYC 1TME2 1HN0A 4GXLA 5CKNA 1ZBA1 4UFMA 4COYA 1OA3A 3DXUA 2P17A 5A70A 4IL7A 4OCTA 2GNTA 2A71A 2IFWA 1WA4A 4R9BA 4UAPA 3WINE 1HIXA 1ZBE3 5K8SA 1LHWA 1QQP1 3USUA 2WQ8A 4XTPA 4M00A 2B9UA 1YQ6A 4OLLA 5BNNA 2X5IA 3HAGA 1WMXA 4IE6A 1S0DA 5C4WB 5E89A 1IS5A 2E9QA 1VAVA 1JZ7A 3S7EA 1X82A 1OXCA 4UFHA 1C1LA 1XU2A 1D4M1 1W0NA 3ZFEB 1CN1A 4PQQA 3VBRA 3OEAA 3TEWA 4TLFA 4XCAA 3VZKA 1RUC2 3SEPA 1I6XA 3BKZA 5H9RA 5DUUA 1OPOA 4P00B 1GNYA 3WV6A 2JD4A 1DF0A 3RJRA 1LOBA 3K77A 2HH9A 2H6CA 4OHXA 5FZ1A 3R4SA 5CA6A 3H7JA 1ZRDA 4I3GA 1ODMA 2XJRA 4I2OA 2OPKA 1PNGA 2PLV1 5FUIA 4J1WA 5FY7A 3ROUA 1CAWA 2ZCWA 4YVSA 3AKPA 5CFCA 1XJAA 2YPDA 1J84A 3PVOA 2A6YA 4ZPIA 4P9WA 1W90A 3NL1A 3ILRA 3BTXA 2VO5A 1CAWB 1LEDA 2RMU1 3MIHA 5JI7A 4QPGB 4YZ2A 1CIYA 4O9EA 5C3PA 2CDPA 3S0MA 2JG9C 1RTVA 5JR7B 1MR5A 4DY5A 2ZXQA 1GOGA 2JG8B 4BQYA 2DFBA 2A75A 1BK1A 1LNSA 2R043 2WNUB 1JXNA 4KL1A 1AYN3 1KJRA 4P5YA 3CJIC 2EIBA 3ZSEA 1JYCA 2WSVA 4CP1A 1MPXA 3K75B 4Z8BA 5FZBA 5FZOB 5FPBA 1RL3A 1ND3C 2A7AA 3J7HA 4X8NA 3VDDA 4QQOA 2OPWA 1RUI1 2DTYA 2J1VA 5ANNA 3FLRA 4IE7A 4QX5A 2BJSA 2DCTA 4FPLA 4NPLA 1F4HA 4D0QA 4E2QA 4LO8A 4CDQA 4HVQA 1Q43A 3L9JT 5J98B 1DGRN 2VOWA 1UO9A 3O14A 3ILNA 3SC7X 1JYVA 5FP4A 4LBJA 3UJQA 3CF6E 1YQ2A 4FPCA 4AQTA 4IEPA 4YG6A 5F5IA 3O0XA 3QBQA 3I3EA 1VRH1 5IK5A 1OVPA 2WO1A 4AEDA 2BNMA 1CAVA 1S0JA 1QXRA 2WAAA 3BPZA 1O5LA 3NMBA 3V56A 3THCA 4BCUA 1POQA 4ARXA 2VNVA 4GALA 4KG0A 4LIVA 1RYYA 4HETA 4LKSA 1JU4A 2P3JA 2RS12 3JBG2 1CX1A 3KVAA 1GWLA 3U14A 4QB6A 2W94A 4UYBA 2Q1ZB 3N7LA 4P14A 5CU1A 4P9JA 3KT7A 1BEV2 5A7SA 5JAXA 2JG8A 1PZ9A 1Q8PA 1YO8A 1AYM3 1UX6A 3DPRB 3CU7A 5IYYA 4XF0A 5A3PA 3U37A 2CTVA 3JQXA 2W2IA 4CYDA 3GJAA 4GB33 3HT1A 4KWUA 3AMPA 4Y33A 4B29A 1PZ7A 1W8OA 2QQIA 2RVAA 3T08A 2DDUA 2WS93 1UY1A 3KZ4C 2LS6A 2I07B 2EIGA 5L9BA 3WNNA 5I0UA 3X29B 5A3TA 4XQ4A 1US3A 4M4RA 4AFAA 5GZCA 1OQDA 2Q8EA 3TNPB 3HQRA 3HBZA 4QQHA 5BNQA 4MXWA 3ZN4A 4AQ2A 4Q4X1 4ISRA 1FNYA 4N43A 1GBGA 3KSCA 1WCQA 3ZX7A 3I2HA 1H0BA 2HBTA 3MFAA 3Q8CA 2VMHA 2VG9A 5DMYA 4N43B 2XL7A 4R9CA 3ZPYA 3JB4C 1RIRA 3RZZA 5I0SA 5IHRA 4RYDA 2IXCA 4BQ4A 1IG3A 4LBLA 3R4UA 3F2ZA 3MYXA 1HB1A 3DV8A 4R4XA 3I2JA 4BQ3A 2ZPXA 1OT5A 1UN1A 4RHV3 5FMOS 3IPVA 2RDQA 1NY72 5A3OA 2XVGA 4Q4V3 4NWVA 1V6LA 1N1SA 2QBXA 3B93A 3KB5A 3L2YA 3PU8A 3BYWA 5IVVA 3I3BA 5EFUA 1E5HA 1JOBA 2VW2A 3C7EA 1YC61 4HOOA 3U10A 1SACA 2V5YA 4AI8A 3VDCA 4URAA 1UIKA 2WLPA 4PHZA 5LA9A 4S2GA 3H3ZA 4TZDA 1BHGA 2W87A 5FIXA 4E4ZA 4RS5A 3ZFFA 3UNPA 5G05L 5FZHA 1PIV3 2BUKA 2XBO1 1D7PM 2VECA 5FXZA 2EAKA 2B7YA 5CADA 5F1RA 4NIDA 3MIEA 3LA7A 3U11A 3CIHA 4OQ9A 1RMU2 4D6SA 4IEZA 2SBAA 5LBCA 4QKFA 4LA3A 5BUVA 1NCQC 2X53S 3OBZA 2A3WA 2QQMA 3OBTA 2UY8A 3BUCA 4C0HA 5BXXA 1QQP3 3WF4A 4DO0A 2XH6A 4JRLA 2X8KA 4XFFA 3FC0A 2UY9A 3BN6A 5IUQA 3JD72 3THTA 3UJOA 4K8RB 5GALA 5DAQA 2BW8A 4HVOA 4N53C 5BNNC 3TOJA 1RJ7A 2Z5WA 2OZJA 3O5SA 2ZX1A 2NYYA 2NLRA 1AYM1 4NO4A 2P6HA 1SZBA 3M4FA 3QH6A 1NA1A 2GP5A 2RM21 5LZ6A 2HWB1 1KDKA 1LULA 2BGCA 4LO7A 1QJX2 3SCFA 4NJ4A 4BWOA 4L97A 4LE4A 4WVZA 1CX4A 1NA1B 3OGJA 1PK6B 4UW5A 3RNSA 1BZWA 5K0UA 2K46A 1KQRA 2WYSA 4K7JA 1AXKA 3AP9A 4R9DA 1R091 3N9NA 1DGWA 1PK6C 2YZ4A 2VPVA 3BCWA 3NV3A 5JVVA 5FY0A 4A2UA 1L7LA 3NNMA 5D21A 1OLRA 4IETA 2FMYA 2ZHMA 4IV3B 3Q8EA 1F5JA 5FUNA 3T09A 4AI0A 4AI1A 4YWAA 3WOGA 2G9ZA 2ZEXA 1PNFA 4QPIC 2DCYA 2O8QA 2BVBA 2BZDA 4QMAA 1RGSA 1QHDA 3LOIA 1VLNA 4BYYA 3BALA 2XBO2 5A6XA 3GZTB 3LE0A 3GCWA 3MICA 1HXS1 4EYUA 4CDUC 1TME1 4EE2A 4IEOA 4RR3A 2ADDA 4JDNA 3LIGA 3ZLIA 2VZQA 4QDSA 2W08A 1DG6A 2WJSA 3QH7A 1XNDA 4LTAA 2JG8C 2VMFA 2DVBA 3ZOIA 1O3QA 4AR2A 4QB2A 4OZXA 2DV9A 2WR9A 3J8F2 5EWSA 1R082 2ZGQA 2Q8CA 2WSUA 2X05A 3W21A 4A7ZA 2Y0IA 1ND2B 1J1TA 2W52A 2BWCA 3DKWA 4BA6A 1R1ZA 4W4ZA 4Y1XA 5FK7A 5CFCC 2OT7A 1YFXA 2GZWA 2X09A 1ASJ3 1W9TA 3PL0A 3POFA 1OLQA 3VBOB 2ZMKA 5JZGC 2QNKA 3WP5A 2BOIA 4UBGA 4TLGA 4MGTA 2VXJA 3N9OA 5IVEA 2Y6FA 1N3PA 2PYTA 2ARCA 1HN1A 1RUC3 2V73A 3HOBA 2D6NA 4C91A 3OPWA 2HWB2 2HWE3 3NQHA 4QPWA 2BVVA 3MEPA 3EXUA 1EUTA 2NQYA 2GAUA 1C8M2 2OIIA 5EZWA 1J3QA 1XE7A 1ND3A 1PX3A 3AVSA 1UQXA 4IEXA 4XETA 1XE0A 2CAVA 4OMDA 4FTEA 2R063 4Z92B 1R1A3 1TMF2 3ZXDA 4QXHA 1OD5A 1GU3A 1RITA 2HWC3 1LHOA 1WUVA 4CP2A 5BNOA 2FD8A 5FYYA 3NVCA 4QX1A 2YG0A 5FXVA 2ZX3A 5LB6A 1MZ5A 1O91A 2CGNA 4GIQA 4YFWA 3RWKX 1O3RA 4J25A 1AYN2 4A44A 1SBDA 2VZOA 1ZA4A 1QJY3 1W2UA 3AP7A 5CB7A 3MIFA 2RS33 4LOSA 2WFPA 2FMDA 3CZJA 4QX0A 4RA0A 4C1XA 2VD7A 1APNA 1ZZ9A 2WINB 3U75A 2CSGA 1DQ1A 1QJU2 1PIV1 2WA4A 1WCDJ 4YW6A 4UI9L 3T4HB 4QWNA 1ULFA 2ZMNA 1CQ9A 3BGAA 5FMOL 4JGYC 1OUSA 3AKQA 4K40A 4PBPA 3V0AA 2PHWA 1PMJX 2AC1A 3MV01 1O4TA 3OYWA 2B9VA 2I2SA 1DLCA 1QOTA 2D44A 1TNRA 4HPKA 4BPZA 1Q3EA 3D82A 5KXCA 1E5IA 2ZTNA 1C1FA 3EQEA 4FBFA 2W47A 3JB8A 3FHQA 5FCCA 1TNFA 1QOOA 5T50A 3UKNA 3KS7A 1VB2A 4ZS3A 4FQ4A 2HWF2 1V6MA 2WQ4A 2WS92 1AL22 2B42B 2EIEA 3POGA 5FXXA 1WD3A 4QHBA 1WKYA 1PO13 5FY8A 3I2KA 4N8MA 4BK4A 1H1IA 5LA2A 5L9VA 1RUF2 2YY1A 2OQ7A 1RVF3 3L2HA 4EQVA 4QXKA 4Q0QA 4OULA 2WZR1 4DXZA 1L7QA 4HVRA 3J9SA 3SKJE 3IZOA 4PDWB 3A22A 2D40A 2XUEA 4LHLA 2BBVA 4CDXB 1XE8A 5LK5A 3VBSA 3H1MA 4CUGA 3NV4A 2OKXA 1NAEA 1YQ8A 3H50A 1Z78A 4LBQD 3ZXFA 2AYHA 1MQTA 4Q0SA 4H7MA 3HWJA 5E8AA 5F8PA 4ET7A 5I0DA 3NV2A 3DYOA 3OUJA 2ADEA 4OHWA 2PHFA 4RHV2 1FAYA 1W6QA 2BGPA 4FPYA 4JGYB 1I5ZA 4UXAA 1VAKA 1XOYA 3LAGA 4WBBA 3V0BB 1UF2C 1AX0A 3JXSA 4NHKA 2ARBA 2WFF2 2YU1A 1CAVB 4AGRA 1KD7A 2JECA 3QLQA 4KWKA 2WRAA 4MOAA 2XMLA 4JDOA 2GMEA 3VUOA 1QIQA 1VBA3 4MHUA 4PBOA 3R0RA 1LU2A 4OUSA 1VMHA 3E97A 1DQ6A 1K3IA 1ULDA 1JOJA 1QNWA 4YZ5A 1QJFA 2ZX4A 5A1FA 4CCEA 2BFUL 1PVC1 2CNAA 1PGL2 1SFPA 1DU3D 2WLQA 2PTMA 1ACCA 1XYNA 3DPRA 3HR9A 4KWLA 1OFSA 1OHFA 4Q29A 4FVVA 4CDXC 2P5BA 3IMMA 1S0FA 4PCRA 4GA9A 1ULEA 4GH4B 2XHNA 5JXGA 5C8WA 1HV1A 3TBDA 2D5HA 4YSFA 3ACGA 4GMP3 1AR62 1XB9A 1NCQA 3NNJA 2DCKA 4LLOA 4NOTA 2X5IC 3KF3A 3RQ0A 4HXCA 4ASKA 2OZ6A 3PIGA 1RUH2 1JZ2A 2XVKA 1GANA 3FBYA 1HQNA 3CMGA 3V65A 3ZSMA 3JD73 3WCSA 3GHMA 3ACHA 1PO11 3OGRA 4MGZE 5JCTA 1H1AA 3TB0A 1IGOA 3VKNA 3WG3A 4AFBA 2DBNA 4MYEA 5FZKA 3ZXLA 3E6BA 1HRI2 1W3VA 1V9U2 3H1WA 2R071 4JQRA 3CLPA 1B09A 1K45A 4FPGA 4L8QA 3C7FA 4L92A 3ZSLA 2AZ5A 3I2IA 4A3ZA 4WM7A 2B4KA 1DBNA 1T2XA 4WM7C 3HN1A 3WF3A 5HI0A 4AXOA 3ZFGC 4XPVA 1CJPA 1R64A 2WNUC 2ZHLA 3BTZA 5J09A 5ACA1 2EXJA 2XJSA 3T3YA 4DXTA 5C71A 5JXIA 3U0ZA 1NY71 3VKMA 4CUBA 1IHMA 2XG3A 1DZQA 3K3NA 3GCXA 1UZWA 3MO4A 4FFFA 3MLLA 4XMAA 3RSJA 1OH4A 4GH4A 2R1BA 4D3WA 3D0SA 1HQWA 5ANQA 3VL9A 4RQPC 3MPBA 2DBIA 2C5DA 2WABA 1BEV3 2D6LX 4MZUA 2YC2A 1D2SA 1OMIA 2J42A 3F95A 4M4PA 2R16A 4MO3M 4CDUA 3ZKUA 3J7LA 2Q5TA 1NCRB 3FMGA 2KXLA 4N90A 1Q5OA 5BNPC 3MUZ1 5LA1A 4WM8C 4EZHA 5F3IA 1UXXX 1F15A 2ZACA 3U07A 2NPIA 1POV0 5C9AB 3JQWA 1U5ZA 1YQ5A 5F5CA 1VP6A 2KA3A 2WNUA 4HK8A 1GP4A 5I8SA 1GV9A 5F6LB 4COZA 5C5TA 5CFDB 1VBE2 3M8LA 2NN8A 4UWDA 4GMP1 5A33B 3GZAA 4Y3OA 3LZZA 3MW3A 1POV3 1ASJ2 1W06A 4FOQA 3H7YA 2QTWB 3PNAA 3ON7A 4IV3C 4PLNA 3WEZA 4CDQB 3LOBA 4JRAA 1GUIA 3ZO0B 1J3PA 2WA3A 3LB9A 4AI2A 2VTXA 4TSVA 3ZR6A 4E27A 2Y6LA 4BQ5A 3J8F3 4IUGA 3AJYA 2HWC2 4E8CA 3W9AA 5B2GB 1UU6A 1VMFA 1GNHA 2RMU2 2VZSA 2WT2A 4GKYA 3U4XA 2Z42A 3BOPA 3AXDA 2WNEA 1UZYA 3VZOA 5ISLA 2R0FA 4XW3A 5FYCA 2LTNA 1D4M2 1IZ3A 2HWD3 4Y1UA 4NN0A 3W20A 4FOWA 3ENRA 3PURA 1RUE2 3P3PA 1LOAA 1ENXA 1PVC2 1QJY2 1QU0A 2TEPA 2VBBA 2ZGRA 4Y20B 2QQVA 5AVPA 1G9FA 3RGBA 5AC92 4EN8B 3OPZA 1PM7A 1W03A 4WVVA 3ZXGA 2VZ1A 1VBD1 4QPIB 2Y33A 1B35C 2ZKNA 4E4DX 1Z7S3 3KCCA 4IGOA 4UFJA 3IIAA 3SKVA 1BBT2 3FN9A 1UL9A 4P9YA 2ERFA 5C7GA 4YM2A 1AVBA 5FY1A 2K2SA 2OXBA 2OS2A 2XUMA 3SQOA 4A6SA 3WG2A 2H0VA 4AFMA 4BDVB 3JZVA 4HN1A 2JG9B 2R49A 2ZEYA 5FP8A 3VBFC 4NRMA 1W99A 3HMYA 2HWF3 5GLWA 5L7OC 5CG9A 2W39A 4NIIA 2BPA2 1SEFA 4Y4YA 5BYNA 1DZRA 2H6BA 1S4CA 2W1UA 5GLVA 4FOYA 4AGGA 4NAMA 1RVF2 1NQDA 1EAH3 2B5HA 2QFEA 2ZEZA 3MLKA 2UYAA 3LFIA 3USSA 4B4QA 2EIDA 1SLBA 4IDZA 2ZX0A 1OD3A 3R4DB 4ORFA 2P3KA 3USUB 3OPTA 5JXJA 2AEYA 2VZRA 3VDAA 2VNOA 3POJA 5FO8B 3I59B 5CFDC 4TXWA 1YXWA 2A73B 2HKXA 4J1XA 5LBEA 1SBFA 4CXXA 5FR3A 1GOHA 5A32B 1NKGA 2WNVC 2Y0OA 2QQPA 3RZHA 2F4PA 2XKPA 4LPLA 4YPJA 2QQOA 2RM22 3BU0A 5FYIA 4XC9A 1CZSA 3LDBA 2D3RA 2VE1A 4YRDA 1SLIA 2VCAA 5J36A 2DYCA 1JHNA 3FJSA 1GP6A 3GYDA 3LFMA 4OUEA 3H8OA 1I9RA 1OUXA 2C4XA 1F35A 2BYVE 1BCXA 3HBKA 4XF1A 5F6KA 3DCQA 1HV0A 4ZY9A 1WCSA 1YRZA 5EJ1B 2IZWA 3H42B 3I54A 4OUMA 2GP3A 3NV1A 2UURA 3AFKA 3DEMA 3Q8AA 1DGRA 2YBSA 3RZMA 4CCJA 5E16A 2XJVA 4HLTA 3MUY1 4INDA 1YIFA 4HL0A 4QGMA 4QHOA 5GKAC 2QJVA 4FXKB 4F83A 1R083 2Y6HA 3SH3A 5FZCA 4F7ZA 2YROA 1AR63 1GZCA 1LESA 3B5LB 2OYZA 5FOJB 1Y9QA 1W2TA 2ZZQA 3M2MA 4L2NA 1JTZX 3CZUA 2E31A 3QOPA 1IS3A 4LBNA 3ZFGA 3ZXKA 5DZEA 2BFUS 1QH7A 2VUAA 4NRQA 1W6OB 2EXIA 4FTSA 2G19A 3B00A 3NNGA 3S5QA 3P1IA 2DTWA 5E88A 1ULPA 1Z7S1 5KHKA 5A7WB 2WBKA 4U36A 1CR7A 4XXAA 2QQJA 1GWMA 2RS53 5IAXA 3NWKA 5D1IA 5K4LA 4CCOA 2E33A 4COVA 2GC2A 1LGNA 3D0JA 3HJRA 4Q4X3 3KHBA 1K5MC 4IEWA 4DPNA 4DY3A 1HB4A 1O8PA 1YWKA 2VY0A 3AMNA 5APAA 3WNOA 4E2GA 1CAXB 5JSOA 3TYJA 2B46X 3M3IA 2VUJA 1O4ZA 4GWJA 1AYN1 1HKDA 1D2QA 2VTFA 4BJ0A 4M3CE 2FZ1A 4IV1A 3POSA 4IESA 3VHPA 3HPNA 3SH4A 5JWPA 5FZOA 4YZ1A 1OPMA 3LEKA 2WWSA 1COV3 1EV13 3MF9A 5DQ0A 5A1AA 1BVVA 3WZ1A 3LCPA 3H8XA 1LHVA 1A3KA 4LIUA 4AVAA 4WV8A 4KGGA 1N47A 2F17A 3APBA 1PMIA 1UX7A 4AOCA 3WDYA 4XABA 1AUYA 2D3PA 1FI2A 1XC6A 3ZSJA 1X33A 4QHZA 4QM9A 4A6OA 3B9CA 5L9RA 2A6XA 1CJDA 1FV3A 4AFCA 3I2GA 1C8M1 1QJU3 4Q0UA 4IEQA 2XQRA 3GF6A 3PJQA 4AI9A 4MHRA 1WLWA 4H2AA 4RQPA 4Y22B 5I91A 5CAZA 1W05A 4OI2A 1N3QA 1NT0A 5FP3A 1O3TA 4M3CA 2QQNA 3C2UA 2GDFA 1N1TA 1CPNA 4K8FA 1VBE3 4XJAA 5GJ6A 1G9CA 3ELNA 3S5AA 5C3RA 4I30A 4I02A 4AGVA 4YARA 1OH3A 2YB7A 3RZKA 3QD6A 2HWC1 4LUMA 3ORJA 2QQWA 2ZJCA 4YW4A 4B4PA 1W6NB 1VR3A 2QDRA 3IDAA 3UL2A 5L36A 2WYFA 1ZBA3 3AXEA 5KWRA 1PO12 3EHKA 3I7DA 1WCKA 4L0PA 4N7UA 3DUIA 1RUD1 4CVUA 5JOYA 1XNKA 2GMMA 4MGIE 5F7UA 2VVDA 5A6YA 1RVF1 1W9YA 4JHZA 5T52A 2ARXA 1QF3A 5GZEA 5JIUA 1X7NA 5IT6A 1HRI1 2O0OA 1SLTA 2EAAA 3M70A 3NNFA 3EJKA 4JTOA 5H9SA 1IPJA 2LUWA 1JYTA 3ASIA 1UU5A 5FZ8A 1BQPA 3M3EA 3ZDSA 4CU7A 4UFLA 3T0BA 5H9QA 2DU0A 2B45X 1S55A 4YGBA 5FV3A 4COWA 1H2NA 3HIFA 1MS1A 2R073 1Y7BA 1ZM1A 3I2FA 2WZPP 3UETA 4CZSA 1W04A 3MIGA 4WZFA 1W8ZA 2GNMA 1Y9MA 1L3JA 2C26A 4A42A 3POEA 2YFZA 5AFEA 4IEVA 1ULOA 3GDBA 1MEC1 5J1XA 2ZABA 2R042 3ZN6A 1HRV1 3DF0A 4NROA 5ACA3 1RUE3 3FFQA 3CL1A 3WHTA 4DINB 1AR83 1R092 1VBC2 4CUAA 3WDXA 3WLUA 3SLIA 4Q4Y3 5I0TA 1YJLA 2K9ZA 4Y1ZA 2C24A 1ZZ7A 4HG6B 1WCUA 3EYPA 5FZAA 2ZEWA 2Y60A 4UOJA 1C28A 1LB2A 3O12A 1Z7S2 4OVEA 1RHI1 2W91A 2AENA 2ZOEB 4I0AA 2VUCA 3LWCA 3WDTA 1VRH2 5FZIA 2VTXJ 4WVMA 3ZFFC 5JDBA 4QD2A 1W2AX 4CEYB 1O8SA 3VD7A 2CGPA 5LASA 5T55A 1QDOA 4MXWB 1ALYA 1OI6A 1RXGA 2L9LA 4XAEA 3NSTA 2BWAA 4X6RB 3O1VA 2C0ZA 3WVJA 1PVC3 4DXRA 1CESA 2VOKA 5JUVA 4KBBA 4CDWC 4ZHNA 1PK6A 4H7LA 5FPLA 4K6BA 1PO22 5EJZB 4GQ7A 2VNGA 4HKLA 1SCSA 1AR81 4FPEA 4R8HA 2WKKA 3LQCA 4LKEA 4BZ4A 3O1OA 5FYSA 1BBT1 1KDMA 1QNYA 2BOJA 2VCMA 1W6MA 2VQAA 5C4WC 1VB4A 1IOAA 3ZSKA 5JIAA 3DKQA 2AUYA 4IGQA 2YPJA 4ATEA 1AR92 3WW1A 4DB5A 2RM23 4BB3A 1TME3 2IVIB 2DURA 4V2WA 5IVBA 1XXNA 3NW4A 1ZX5A 4RR3C 1KFUL 5FYBA 2G9GA 4I0BA 3IB3A 1W8HA 3VD3A 1G86A 3WNXA 4TWTA 3WW2A 5T5PA 1QXJA 2RR12 5FXWA 3LKJA 5GZGA 2VCCA 3R05A 4RFRB 1MS4A 1I1EA 4BQ2A 3BODA 3V0AB 4RQPB 1UMZA 3WUDA 4XJ8A 3HT2A 1WMEA 1J59A 5HCAA 1PIV2 4AW7A 1ENSA 1ZRFA 5CKQA 4YVSC 1GR3A 1IQDC 1OQEA 4K9SA 4Q8LA 3U1XA 5K7PA 5A3UA 1M4WA 4PIXA 4YM0A 3V64A 2QQLA 3AC0A 1QY4A 4YGCA 2WQZC 2UWBA 2OUJA 1EPWA 1RUC1 1UYXA 4XFAA 5IWFA 4QU2A 2WO7A 2YHJA 2YYOA 1HB3A 1JU3A 4JCKA 4AEMA 4XIOA 5GLZA 2Q1FA 2VMCA 1ST8A 1BLZA 1K5MA 5DG2A 4Q8KA 3MDPA 2Z69A 5FZ9A 3VDDB 4IV3A 4CP0A 3LDRA 4DRVA 4N9IA 5EPAA 5A80A 5FLIA 3LA3A 3VZJA 1DDLA 3BU7A 2JWPA 5F32A 3C8XA 3WQ1A 4YG0A 5IVFA 1BJQA 4YZ3A 2ILMA 3KCXA 4WM8A 1SDDB 5BNPA 5D2AA 1JZ4A 1AX1A 1DGLA 1OOPC 2HYKA 1C3HA 4ONUA 5FZEA 4ES8A 4Z07A 3BTYA 4CDQC 1H6YA 1S1AA 2SLIA 3JU9A 3OY8A 4MGYE 5JR2A 4XZPA 5LCWL 5DPNA 4HZFA 2VXRA 4WZCA 1MZEA 5FMDA 5CVRA 4AL9A 4ZS2A 5BNNB 3AM2A 2RHPA 3BPSA 4OHVA 1W8UA 1WMFA 2CV6A 5F3EA 3ZDVA 2VU9A 2MEV2 5C3SA 1WLCA 2JB4A 3FUQA 3GM8A 4XUPA 4AVSA 4EN6B 2VMEA 3FX3A 3GHNA 3IN9A 1LHNA 4O65A 5DZGA 5FBJA 1VBD2 2HBUA 1O4YA 3M3CA 1YI7A 5HBAA 4YVWC 2ENRA 2WFF1 4N43C 1H30A 2QVSB 5FZ0A 4XJ9A 5FPUA 1S0BA 4N53B 2ZGTA 5EYYA 4CU8A 4Q4V1 2HWD1 4K1YA 2TNFA 2W1QA 3T30A 3ZYFA 4BLJA 1ENRA 3TRSB 1PHMA 1LR5A 4BIOA 3PUAA 1JYNA 1YNAA 1ZNPA 2V5DA 2ATFA 1WW7A 2X5IB 1DQ4A 5DAWA 2CWMA 4BQXA 1DHKB 5HXVA 3IBMA 1DYKA 3P3NA 2YGMA 3IMNA 3CHXA 4MV2A 2ES3A 3VBRB 3K51A 4UW6A 3ZMOA 3ZN6B 1BMV2 3NAPC 1BXHA 2XJUA 5FZ7A 5BNOB 4B1MA 5C3QA 5M0TA 4OI0A 2R6QA 2WO2A 2EVXA 4XHBA 1SQ4A 4EJRA 4MGQA 1COV2 1SFNA 1MS8A 4YM1A 1UXZA 3D4KA 4P9IA 3RVHA 5FQ0A 3SNMA 4CEWB 1D4VB 4M0NA 2QDNA 3KF5A 2WZR2 4CCKA 1WW5A 4CDWA 1DZTA 1YUDA 5FLHA 1D0GA 5B4XA 4GMP0 4META 2JJ6A 2CGOA 4K3UA 1SBEA 2BGOA 5A3MA 4LBQB 2DF7A 2GH8A 4DEVA 3INAA 1W9FA 1OVSA 3VLBB 4DUXA 4S2HA 5FYTA 5GLUA 4WM7B 3B02A 4QX3A 4R4ZA 5JMOA 1DQ2A 1UY2A 3H3UA 4LBQA 4Y1YA 1W8NA 2FCUA 3LDKA 5JPMB 1NOVA 4LO5B 5FJKA 4HBNA 1IPSA 4H55A 4XMIA 2VZVA 4KI5M 5FYVA 1W0PA 4RN5A 2A3YA 3W5MA 1GZWA 1UOFA 1LOGA 2EF6A 1JYIA 3PTYA 5F3CA 5DN2A 3LA2A 2WT1A 4NAOA 5I93A 2YGLA 4Q4V2 5CZKA 4NIGA 1ZVFA 2NMNA 3GBFA 2DCJA 4RGGA 3ZYGA 1HXS3 3P5BA 3U4SA 4NUBA 2C9AA 3CJIB 1LKNA 2Y34A 4CDXA 1T6GC 3HN3A 3JUUA 2ZGNA 1I3HA 4DEQA 4RHV1 5L7OA 3ST7A 3VZMA 1SPPA 2KM2A 1X8EA 2R072 4URTA 4BLIA 3N35A 4C0BA 5KC6A 2PLV3 3KGLA 2RDNA 4BQ1A 2HWE2 2J1EA 4N9HA 1REEA 2ID4A 4QXBA 1OA4A 1H4HA 4C1WA 2EA7A 5F39A 4FPOB 1WA6X 1AR82 1V6NA 3D8CA 2CHHA 1J83A 3OY8B 1YFYA 3IM0A 1UNBA 1GQPA 5A33A 3UT0A 3VHNA 4BMBA 2BNNA 4CU9A 1AXYA 2DVGA 3KMHA 4HONA 4Y5Z0 3HNBM 3RZGA 3WG4A 5A7OA 3S30A 5GZDA 5LRRA 2H0BA 4LKDA 2R1DA 3I4IA 2GC3A 5FK8A 5FY9A 3ZXAC 3IPVB 4A45A 1G6NA 4QT6A 5BY5A 1QMJA 4Y5TA 5FZ4A 1X9PA 4I3PA 2VGDA 4AEJA 4CPBD 5FYUA 4KU7A 2X29A 4PJYA 4BE3A 4EV0A 1AR93 5IFPA 2JDKA 5D8AC 2W1SA 5IFTA 2BV4A 2BEOA 3CNAA 1AX2A 4SBVA 5GM0A 2ARAA 3PIJA 3WDVA 1FPN1 3TN91 1W28A 5A32A 4PIYA 3JCIA 3RPQA 2J1SA 2IUWA 3K4ZA 4EN9B 1OSGA 3AMHA 1VBA1 1W6QB 1UWWA 4BK5A 2E51A 1QJX1 2WL1A 4LULA 5FZLA 3O1RA 1FOD2 3T2TA 1W3XA 2TBVA 2VZUA 1A8DA 1GFF2 3LSEA 4LHNA 1E5SA 1QH6A 1OF3A 4MGSA 2P34A 2VBPA 3CKHA 2D97A 2E26A 3FE5A 4JHTA 1EV12 4UFKA 4G4FA 5FYHA 4W8JA 2ETEA 1UOGA 1JN2P 2Z2SB 3ECQA 1UU4A 3FHAA 3RYRA 4CDUB 3THPA 1Y3TA 1RUH1 4BU2A 1LHUA 1ONAA 4W6YA 2RR13 1AL23 1XQNA 3HEIA 4PI2A 4CXYA 3RZLA 1UOBA 4U2AA 4F3JA 3P6BA 2DWRA 3TEXA 1UY3A 2RS51 4D7SA 4LEJA 4LORA 4QU1A 2X10A 2YC4A 3HQXA 1GKBA 1HDKA 3MHZA 2WN2A 2LW8A 3Q8BA 4IQPA 3WQ7A 4C90A 2Y6GA 2YU2A 1UOJA 1A34A 5FJHA 2AREA 1F2NA 4K1ZA 4YZ4A 4I09A 4W50A 3ZM8A 1PGL1 4GAZA 4XUTA 4E8DA 2YXSA 3KT1A 4Q4W1 3TNQA 3SHRA 4QAWA 1ODNA 1S0IA 4XOGA 5FPZA 1OLMA 2BU9A 5DDJ3 5J3UA 3WX5A 5FPVA 2VM9A 3K4DA 3NJZA 4AFDA 4AE2A 5K0UB 4IW3A 3S7IA 1OOPA 4AQ6A 2WNVB 4W6WA 1HQLA 2MEV3 3B7MA 4AI3A 1UKGA 1V70A 3VBHC 2JDPA 2V4VA 3GGLA 3N9QA 2ZGKA 1Q8VA 5CISA 4P9GA 4K21A 3RG0A 1CAUB 4D8MA 2W3JA 3VB9A 3E1F1 1X8MA 2BDRA 4IXLA 1H8TC 2W5FA 5F9TA 2ZAAA 3AL6A 5JZGB 1XNBA 4XBLA 2Q8DA 1N3OA 1CAUA 1MS3A 2FHRA 4JX0A 4XVHA 5A7PA 3R6SA 5JSPA 1SPPB 4JKMA 4YGEA 1WBLA 4PDWA 4Y1VA 2QUOA 5JZGA 2N7GA 2D98A 4HSJA 1JZ6A 2BNOA 4KU8A 2XQXA 1TMF3 4P02B 4R52A 3PMSA 3FUOA 4Q1PA 5CIRA 3ZXJA 3VKLA 1MQTB 4BOWA 5DUWA 1RJ8A 2Q0AA 5FZ6A 4R9AA 4Z82A 2PFWA 4PF5A 3T1LA 3VBOC 2KD7A 5ABJB 1RUNA 4AK3A 1LECA 2R061 4RL7A 5EV7A 3TEZA 1X50A 2HWF1 1AJOA 2RDSA 2ZAHA 1F4AA 1ND2A 4KG8A 2VW0A 5JPNB 2DVFA 1R093 2LALA 2G4IA 3OUIA 4Q27A 2YC0A 3RRDA 2FDKA 4LKFA 4FAHA 3LF7A 2ZKLA 4Q0PA 3WD5A 4XDOA 5L7OB 2FQPA 3PDQA 5ERLA 4Q4Y1 1C57A 2JDYA 5ABJC 1MS5A 1XNAA 1UAIA 2IXJA 2VR4A 2Y6JA 4DXSA 1OLME 5FZDA 2HEWF 2QZ2A 3DYMA 5CFDA 4NIAA 1Q8QA 4Y20A 1LGCA 2JKBA 4NHXA 1QGLA 2CY6A 1BEV1 2P4EA 1TEIA 3SISA 4Q0VA 1LGBA 1ZRIA 2WIIB 1JOPA 2HLEA 2JICA 3JD71 5DUXA 3S57A 5I8YA 4FP3A 1HW5A 5GLTA 1HRV2 3OD4A 4IV1B 2ORXA 4O9GA 4XYXA 3WF1A 5FY5A 2QQKA 3KQ4B 1ZYBA 2IXIA 1F8VA 1QXPA 2KR2A 2XLFA 3WF2A 1RUF3 4AHZA 3C7OA 1NLRA 2WAOA 3AZWA 5FWJA 4GB31 1OURA 4RD7A 4TN7A 1X9TA 1K5JA 1SLAA 4HN0A 2VOXA 5ABJA 4XE9A 4GKXA 3SXWA 3C7GA 3LSDA 4A3XA 3RS6A 1W6PB 1G7YA 2ZX2A 2ZMLA 5J96B 1VIWB 1WWYA 4Q5OA 4HFSA 1DCSA 1JUHA 2ZHKA 1E57A 4MLOA 1UZ0A 1CIWA 4OQ8A 1HB2A 3LD8A 2VJXA 2HJIA 4HMZA 1US2A 3HNYM 5DAXA 3VBFA 2VW1A 1FX5A 3OYWB 3AYEA 2R7EB 3IAPA 4LBKA 2J1AA 3ES4A 4FP2A 1O59A 3NJXA 3TWIA 2V72A 2JB8A 2WS91 4BM8A 3E5UA 3OUHA 2VMGA 4D7TA 3I8TA 5FFOC 4A7KA 4W6XA 4LNVA 3AZVA 2VMDA 3IDBB 2VVFA 4V1PA 2IXLA 2J1TA 4XFHA 3RFRA 5LEKA 5KHHA 4S2DA 3I2DA 2ZZJA 3IAQA 4JDMA 5FZMA 3WG1A 1D0HA 2FDJA 1BKZA 1GQHA 3OD0A 4AEDC 2P3YA 1RUJ3 1H4GA 2BTVC 4I0WB 4XIKA 4EN7B 1LRHA 1J1LA 3IDCB 3O1PA 3N7KA 3T4VA 3ZIWA 3UK9A 1URXA 4E4SA 2IXKA 5A3NA 3SEEA 5FOBB 2I74A 2XLAA 5IJRA 4AVCA 1RUH3 4FPFA 4BHPA 3ZPOA 3A7QA 1QWRA 2DUPA 3O7OA 3RYKA 1AF9A 3VD5A 2E63A 2A6ZA 2CAUA 1HX6A 3H1YA 1OKOA 1KS5A 2GNDA 2HEYF 1ZA7A 3OTFA 4NR1A 5DABA 2UWAA 3A21A 5FUPA 3ZYHA 2D7FA 5FMBA 3KV6A 4KQ7A 1PM4A 1JS9A 5DAPA 2XOMA 3ACLA 1HRI3 1LOCA 4IE0A 4XTMA 1YEWA 3KV4A 3OEBA 1LODA 1NG0A 1YJKA 5C3OA 5IW0A 4XJUA 4KGQA 4ZZ5A 1IKQA 4B3NA 5KXEA 3VKOA 2W46A 1IPKA 2P1BA 2NMOA 4DOUA 1GMMA 4YVSB 5FP9A 3PUQA 1J3RA 4LBOA 4YW7A 4CU6A 3RYPA 4XJWA 1QJEA 1W8FA 2VVEA 3PTRB 4BMEA 3GBWA 3OSDA 1COV1 1H8VA 5CKMA 3AVRA 3NNLA 1MZ6A 1ASJ1 5KC5A 3ABZA 4FQZA 5JXHA 2PQQA 1RUJ1 1W6NA 5FREA 4XDQA 3OBRA 1JZ5A 2XLGA 5T5LA 1FV2A 1CPMA 1QOSA 3MW4A 4M01A 1FOD3 3ZMNA 4CCMA 4Z2AA 5FYZA 1XRUA 2IFRA 3DGTA 1HJGA 1U5XA 1SDWA 3HVDA 2JIGA 1UY4A 1SLCA 3POYA 3WT3A 3K2OA 5CEHA 2XR4A 3WW4A 3OG2A 5TSWA 1EY2A 4KBZA 2FDGA 3AMMA 3SMHA 4EROA 1N1YA 2A6WA 4NIHA 2JENA 1MZFA 4XUQA 3E6CC 5DDJ2 3UKVA 3AZXA 1H9PA 1VALA 1LOFC 2RJKA 1K12A 1RHI2 4GWIA 4IEYA 4KMQA 1JYWA 2UU8A 4MUVA 4Z1VA 1H9WA 1Q56A 1H8TA 1CD3G 3ETQA 4RSUA 3U78A 4X6QB 5LY1A 2MEV1 2QQUA 3B01A 4CP9A 3WF0A 1IG0A 1SG3A 1N1VA 2D6KA 3VN4A 4D6QA 2ZGPA 3UGHA 4N53A 1MACA 4FXGB 5F2WA 1MEC2 4EWDA 4DUWA 1T6BX 5DDJ1 1G9DA 4H3WA 1F5FA 3WP3A 3NKGA 4RS5C 4OZOA 5HCHA 5JOZA 1FMD1 1D4M3 2WDBA 1QQP2 3VDBA 3KM5A 2J1RA 4GJYA 2WC2A 2ZGSA 1NZIA 3M7AA 4CPBA 5FYMA 5J7MA 4MADA 1O6UA 4HK9A 2V09A 5KR7A 3BI3A 1VBE1 3N4MA 2JE8A 4FPJA 4TYSA 2JDNA 5C9AA 1A6CA 2VZTA 1YYNA 2PAMA 1V9U1 1MQTC 2LROA 4ASLA 5T5JA 3ZFEC 1S0EA 2XHKA 3M1HA 3NJVA 3SCHA 2XDVA 3UGFA 1BBT3 5LATA 3O1TA 2VULA 5FPAA 4P9XA 2XWJB 5C4WA 3THDA 3ZR5A 1DQ5A 2HWE1 4HSLA 3WUCA 2CYFA 4XZUG 3EB7A 1H8TB 4LITA 1RXFA 1NYWA 3G6JB 3OBAA 4AHYA 5LRSA 1ZRRA 2UYBA 3FL7A 3WQ0A 5KHIA 3E6DA 2C1FA 2E7TA 3OGGA 2WNVA 2E7AA 1GNZA 3RZJA 3GZEA 1SFYA 2VH9A 1SHWB 2GU9A 4GWNA 4CEYA 4QPGA 5FO9B 1JODA 4Q1RA 3UV9A 3W5NA 1G8WA 4LO6B 4CUCA 3ILFA 5EYXA 2QZ3A 1WW4A 2DVDA 1ZZ6A 1GZWB 3H0OA 3ITQA 4LR4A 4MXVA 3AZZA 5FMCA 1R1A2 1I5PA 4JGZA 4PQ9A 2FDIA 1Y43B 5EXOA 1XSQA 1JHJA 1AR91 1C5HA 1POV1 5FKCA 4EWEA 4YM3A 1K42A 3LEGA 1DP0A 1KXGA 2J1UA 4JGZB 1W6MB 3PJYA 4NVPA 4D94A 3MZHA 1FMD3 1AYM2 1P8JA 3CDZB 3CJIA 1PVXA 1W0OA 5DG1A 2GH2A 1KEXA 4HANA 1LENA 3VBUA 3VD4A 2FCVA 4FOVA 3MIBA 1UZVA 4XACA 1VJ2A 2XVLA 1PO21
chains in the Genus database with same CATH topology
4DO0A 5FY4A 5FZKA 5FYZA 4D6RA 3RVHA 5IVYA 4V2WA 5IVBA 2VD7A 4QX7A 5F37A 4LXLA 3K2OA 5FP4A 5FYBA 5A7NA 5CEHA 4CCKA 4QWNA 4QXCA 4QU1A 5LY2A 5F5IA 5FXWA 4AI9A 5FWEA 3OPTA 2YU2A 3LD8A 4XDPA 5FYTA 5FJHA 5A1LA 2GP5A 5FP3A 3UYJA 4LIVA 4GAZA 5E6HA 5F3GA 5FJKA 5A3WA 3K3NA 3U78A 2WWJA 5F2SA 4BXFA 3KVAA 5LY1A 4DIQA 4IGPA 5FZFA 5FYVA 5ANQA 5A7SA 2XXZA 3N9NA 5FPVA 2PXJA 5F3CA 5FY0A 4D6QA 5FYIA 5FXXA 5IWFA 5A3PA 3KVBA 3PUSA 3LDBA 4Y4RA 5F2WA 5FY8A 4CCNA 4E4HA 5IVCA 2W2IA 2OQ7A 5FZMA 3N9QA 3DXTA 3U4SA 4Y33A 5FUNA 4NUBA 2OQ6A 4GJYA 5F3IA 5FZ9A 5A7WA 4BU2A 4EZHA 4BISA 5FYMA 2XUEA 3AL6A 5A7QA 2Q8DA 3DXUA 4TN7A 5A80A 5KR7A 5A7PA 5F32A 5F5CA 4EYUA 5A3TA 4CUGA 5IVFA 5FZ8A 2Q8EA 3ZLIA 2GP3A 2YBKA 5FZEA 2YBSA 5FV3A 4CCLA 4QXBA 4CCJA 5A3NA 4Y3OA 2XDVA 5F39A 3ZPOA 5FPAA 2YBPA 3N9LA 5F5AA 5FZ6A 2Q8CA 4CSWA 5FZCA 4AAPA 2YU1A 4HONA 5F3EA 5FP7A 5FZ3A 2XMLA 4UF0B 5FUPA 5FBJA 4LITA 2OT7A 5A7OA 3KV6A 5FY9A 5FZ1A 3PU3A 4UF0A 4EZ4A 3KV4A 5ISLA 2OX0A 5A1FA 3PU8A 5FYCA 3K3OA 3N9OA 5FZ4A 5IVEA 5IW0A 5FZ0A 5FZAA 5FYUA 5A7WB 5IVVA 4XDOA 5FY7A 5FPUA 3OPWA 3PDQA 3PURA 4QX8A 5K4LA 4HOOA 4CCOA 4URAA 1VRBA 2YPDA 5FZIA 2P5BA 4C8DA 5FZDA 3NJYA 3N9MA 5FP9A 4V2VA 3PUAA 3PUQA 3AVSA 2WWUA 5FZHA 3PTRB 4GJZA 3KV9A 3AL5A 4IGOA 4QXHA 5FZLA 5FXZA 5FPLA 5FZOA 5IVJA 4ASKA 3AVRA 5LWBA 5FY1A 5FZGA 3N9PA 2OS2A 4GD4A 3KV5A 5FY5A 5FZBA 5FYYA 5FZOB 4CCMA 5FPBA 5FYSA 5FYHA 4D6SA 5FZ7A 5LW9A 5FXVA 4LIUA 5FP8A 5FWJA 4IGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DO0 A;  5FY4 A;  5FZK A;  5FYZ A;  4D6R A;  3RVH A;  5IVY A;  4V2W A;  5IVB A;  2VD7 A;  4QX7 A;  5F37 A;  4LXL A;  3K2O A;  5FP4 A;  5FYB A;  5A7N A;  5CEH A;  4CCK A;  4QWN A;  4QXC A;  4QU1 A;  5LY2 A;  5F5I A;  5FXW A;  4AI9 A;  5FWE A;  3OPT A;  2YU2 A;  3LD8 A;  4XDP A;  5FYT A;  5FJH A;  5A1L A;  2GP5 A;  5FP3 A;  3UYJ A;  4LIV A;  4GAZ A;  5E6H A;  5F3G A;  5FJK A;  5A3W A;  3K3N A;  3U78 A;  2WWJ A;  5F2S A;  4BXF A;  3KVA A;  5LY1 A;  4DIQ A;  4IGP A;  5FZF A;  5FYV A;  5ANQ A;  5A7S A;  2XXZ A;  3N9N A;  5FPV A;  2PXJ A;  5F3C A;  5FY0 A;  4D6Q A;  5FYI A;  5FXX A;  5IWF A;  5A3P A;  3KVB A;  3PUS A;  3LDB A;  4Y4R A;  5F2W A;  5FY8 A;  4CCN A;  4E4H A;  5IVC A;  2W2I A;  2OQ7 A;  5FZM A;  3N9Q A;  3DXT A;  3U4S A;  4Y33 A;  5FUN A;  4NUB A;  2OQ6 A;  4GJY A;  5F3I A;  5FZ9 A;  5A7W A;  4BU2 A;  4EZH A;  4BIS A;  5FYM A;  2XUE A;  3AL6 A;  5A7Q A;  2Q8D A;  3DXU A;  4TN7 A;  5A80 A;  5KR7 A;  5A7P A;  5F32 A;  5F5C A;  4EYU A;  5A3T A;  4CUG A;  5IVF A;  5FZ8 A;  2Q8E A;  3ZLI A;  2GP3 A;  2YBK A;  5FZE A;  2YBS A;  5FV3 A;  4CCL A;  4QXB A;  4CCJ A;  5A3N A;  4Y3O A;  2XDV A;  5F39 A;  3ZPO A;  5FPA A;  2YBP A;  3N9L A;  5F5A A;  5FZ6 A;  2Q8C A;  4CSW A;  5FZC A;  4AAP A;  2YU1 A;  4HON A;  5F3E A;  5FP7 A;  5FZ3 A;  2XML A;  4UF0 B;  5FUP A;  5FBJ A;  4LIT A;  2OT7 A;  5A7O A;  3KV6 A;  5FY9 A;  5FZ1 A;  3PU3 A;  4UF0 A;  4EZ4 A;  3KV4 A;  5ISL A;  2OX0 A;  5A1F A;  3PU8 A;  5FYC A;  3K3O A;  3N9O A;  5FZ4 A;  5IVE A;  5IW0 A;  5FZ0 A;  5FZA A;  5FYU A;  5A7W B;  5IVV A;  4XDO A;  5FY7 A;  5FPU A;  3OPW A;  3PDQ A;  3PUR A;  4QX8 A;  5K4L A;  4HOO A;  4CCO A;  4URA A;  1VRB A;  2YPD A;  5FZI A;  2P5B A;  4C8D A;  5FZD A;  3NJY A;  3N9M A;  5FP9 A;  4V2V A;  3PUA A;  3PUQ A;  3AVS A;  2WWU A;  5FZH A;  3PTR B;  4GJZ A;  3KV9 A;  3AL5 A;  4IGO A;  4QXH A;  5FZL A;  5FXZ A;  5FPL A;  5FZO A;  5IVJ A;  4ASK A;  3AVR A;  5LWB A;  5FY1 A;  5FZG A;  3N9P A;  2OS2 A;  4GD4 A;  3KV5 A;  5FY5 A;  5FZB A;  5FYY A;  5FZO B;  4CCM A;  5FPB A;  5FYS A;  5FYH A;  4D6S A;  5FZ7 A;  5LW9 A;  5FXV A;  4LIU A;  5FP8 A;  5FWJ A;  4IGQ A; 
#chains in the Genus database with same CATH topology
 1YCI A;  1OF4 A;  2RS3 2;  1OA2 A;  3OF1 A;  5FY4 A;  1AZD A;  2A70 A;  2UWC A;  4D6R A;  5IVY A;  1AR6 1;  1PGW 2;  2VQ0 A;  1ZBA 2;  3PHM A;  4XAA A;  5F37 A;  1NZC A;  1XSR A;  3WP6 A;  3T2O A;  3AP4 A;  2A5Z A;  3VZL A;  2ZGO A;  5IAV A;  5CFC B;  2HWB 3;  1EUU A;  5JI9 A;  4GWM A;  4JKL A;  4M3C B;  2E32 A;  4HPK B;  4CXW A;  1UIJ A;  1UD1 A;  4XF9 A;  3LEM A;  3Q8F A;  4RGA A;  5FWE A;  3FLT A;  1KGY A;  4XDP A;  4MG2 A;  4ZXK A;  1GOF A;  3IDE A;  1QEX A;  2VMI A;  1IS6 A;  2P2K A;  4QB1 A;  3ZVX A;  2Z4F A;  4Y22 A;  2D3S A;  1U0A A;  4JAA A;  1GSL A;  3VL8 A;  4W65 A;  5KHG A;  1LEM A;  3O1M A;  1H2L A;  3ZYR A;  4E9K A;  2F6B A;  1PGW 1;  2E7Q A;  3ZYJ B;  3VBU C;  4FTB A;  1EPZ A;  3FHI B;  1WLD A;  2ZA9 A;  3MI8 A;  1OKQ A;  1V6O A;  3B9I A;  3AKR A;  4CP9 B;  4Y4R A;  2WZE A;  1VBB 2;  2YFU A;  1YFU A;  4LMF A;  5T3N A;  2GN3 A;  4A41 A;  1OFN A;  1BMV 1;  3ES1 A;  3HNM A;  3WDW A;  5ACA 2;  2W68 A;  2RS5 2;  3KCY A;  2NZ9 A;  4A4A A;  5FPX A;  1AR7 1;  4LHS A;  2XON A;  1VBC 3;  4IE4 A;  4XQW A;  4Y5S A;  2XKO A;  3AB0 A;  1BK0 A;  3CEW A;  3NKT A;  4QGL A;  3WQB A;  2CWS A;  3B69 A;  3MID A;  1KRI A;  1LAJ A;  1WBF A;  1NE4 A;  4X8P A;  5EIY B;  1CZT A;  1NLQ A;  3HD8 B;  1AL0 G;  3G7D A;  4LUK A;  5KXB A;  4MX3 A;  3LEI A;  4QQ2 A;  2GNB A;  4P08 A;  1UYP A;  5AFB A;  1VBB 1;  2PN5 A;  1RUG 3;  3LPG A;  5BNP B;  4LOT A;  1MS0 A;  4GH4 C;  4YGD A;  1PMH X;  1RUE 1;  3H8R A;  1FOD 1;  2YBP A;  1OQ1 A;  3N9L A;  2WFF 3;  2D6O X;  4G3Y C;  3FFZ A;  4H14 A;  4XJZ A;  4AAP A;  2D43 A;  2P3I A;  5FZ3 A;  5CYY A;  1G9A A;  2JIJ A;  3EO6 A;  3N7M A;  2R30 A;  3VBO A;  4Q2F A;  5LEJ A;  1BYH A;  1UMH A;  2JDA A;  3AKT A;  3KHC A;  2JX9 A;  3RDI A;  1QDC A;  4XHX A;  4QDR A;  1QKQ A;  4XFG A;  4AQS A;  5FQ0 B;  2QKD A;  5GZF A;  3PLQ A;  3ZIX A;  3C7H A;  4WVM B;  4YW2 A;  1C4R A;  2GMP A;  1GLH A;  1VAM A;  1Y4W A;  3MW2 A;  4O7X A;  5HPO A;  3AP5 A;  3C3V A;  4YVW B;  4FPH A;  3GNE A;  4Q4X 2;  1TE1 B;  4WM8 B;  2Y8K A;  3N9M A;  3NO8 A;  1RUD 3;  3NRU A;  1A8M A;  2DUO A;  3I2O A;  3I97 A;  1ULC A;  1PZ8 A;  2RG4 A;  3WNP A;  2FZ2 A;  2Q1M A;  2RS1 1;  2D5F A;  2G9F A;  3CQO A;  3JBG 1;  4UW3 A;  2VQT A;  3AZY A;  3J7M A;  4KH9 A;  3OOX A;  1R08 1;  5FZG A;  1GQG A;  1FAT A;  1S0G A;  4FFG A;  4GD4 A;  4XUN A;  4GZ9 A;  3ACF A;  1PGS A;  1RC6 A;  2GC0 A;  2C9K A;  2TUN A;  4Q4W 3;  4UBH A;  5LW9 A;  1UZZ A;  4HT1 T;  4NHM A;  1VBA 2;  4CCD A;  3DL3 A;  1VMJ A;  5LBB A;  2Y64 A;  5J48 A;  4D69 A;  2JXA A;  4AAX A;  1GWK A;  4CEW A;  1Z0H A;  3ZFE A;  2FDF A;  2J22 A;  1LJ7 A;  2PHT A;  2IXH A;  2ZGM A;  5C8C C;  1E5R A;  2XJT A;  4NHL A;  4LXL A;  4FSJ A;  5A7N A;  4PLO A;  1YHF A;  2WO3 A;  4YW5 A;  3RI9 A;  1DLL A;  2IWG B;  4QXC A;  5EJ3 A;  1XU1 A;  1ZBE 1;  2XL9 A;  1RUF 1;  1MVQ A;  4IER A;  1B35 A;  1SLL A;  1UYY A;  2ZS6 B;  3AP6 A;  1UY0 A;  2WZ8 A;  3UYJ A;  4AWD A;  5A3L A;  1B35 B;  2WNO A;  3MPP G;  2ET7 A;  3GAL A;  1OBN A;  3M3O A;  5F2S A;  3AX4 A;  3I3Q A;  3TAY A;  2QCS B;  4L11 A;  4DIQ A;  3N3H A;  2VUD A;  3AJZ A;  3DPR C;  1XNT A;  3HQU A;  4IEU A;  2YV8 A;  1Q8S A;  4J6G A;  3UKT A;  4XEZ A;  2EAL A;  2F4L A;  1PX4 A;  4Y24 A;  4BXS V;  3POB A;  3O0W A;  1F9K A;  4RFT 0;  4AG4 A;  1BVP 1;  1CWP A;  4XIL A;  2A1X A;  3EBR A;  5A6Z A;  1C8N A;  4Q4Y 2;  5LK7 B;  3DXT A;  1JH5 A;  4JGZ C;  1AJK A;  1FPN 3;  1VBD 3;  2OQ6 A;  5D8A A;  3TN9 3;  2IVJ A;  3URF A;  1V9U 3;  1YIP A;  2BRT A;  4RR3 B;  5JOX A;  3ETP A;  4JV4 A;  4CRQ A;  5DZF A;  1TG7 A;  1UW8 A;  1C8M 3;  1QJU 1;  2W92 A;  2JDM A;  3J4U H;  1NQJ A;  5L19 A;  1ND3 B;  2Y38 A;  3DYP A;  2PHD A;  3KGZ A;  2O14 A;  4CCL A;  4P5H A;  4ITC A;  4NHY A;  1PO2 3;  2E6V A;  2DCZ A;  3EMR A;  2CDO A;  5T5O A;  1TQ5 A;  4DZG A;  3OJB A;  2W9X A;  2JDH A;  3OGS A;  3A0K A;  5CNA A;  3VV1 A;  4NPM A;  5KBF A;  5T54 A;  4HKW A;  4NWW A;  1W39 A;  1VBC 1;  2ZGL A;  3IKW A;  4FFI A;  4ARY A;  2XJQ A;  5IK7 A;  3E5Q A;  2VL4 A;  4B7K A;  3OB8 A;  1AR7 2;  1SCR A;  1W8W A;  2HWD 2;  2A3X A;  1YLL A;  1G9B A;  2DFC A;  2EXK A;  3KQR A;  3D6E A;  2WT0 A;  3ME2 A;  2WN3 A;  3FBM A;  3SCG A;  4RS5 B;  4L9B A;  4QPI A;  5FLJ A;  1VRB A;  4C8D A;  1QJY 1;  2PAE A;  2JE7 A;  1VRH 3;  3IWZ A;  2EXH A;  4NRP A;  3MGU A;  4YFZ A;  4PIZ A;  4V2V A;  4LK6 A;  2W95 A;  3MV1 1;  4UT5 A;  3A23 A;  4YVW A;  5H9P A;  2PQS A;  2YDE A;  2JEM A;  5CBL A;  1Q8O A;  2VBD A;  4ES9 A;  1RUI 2;  3KV9 A;  3K48 A;  1XNC A;  4XF4 A;  1YI9 A;  5C6C A;  2OUH A;  4FO9 A;  5A6Q A;  2VZP A;  1S2E A;  3RMY A;  2V4A A;  4XBQ A;  1NCR A;  3KV5 A;  4AYU A;  3WDU A;  3B94 A;  5SV8 A;  1H2M A;  1EYB A;  4QKB A;  4AVT A;  1DIW A;  2RJ2 A;  3ZKY A;  1ZRC A;  1KFX L;  2YMZ A;  3VD9 A;  1JW6 A;  1XBF A;  2RMU 3;  3OCP A;  4QX7 A;  1VBB 3;  3MLJ A;  1EAH 2;  2RS3 1;  4O61 A;  2XGX A;  2A6V A;  1HXS 2;  3KWV A;  4IE5 A;  3VBS B;  4AHW A;  5FBZ A;  3M3Q A;  2PHX A;  4YNI A;  4B7E A;  1RED A;  2K0G A;  1RB8 G;  3WNM A;  4CDW B;  3DN7 A;  2GSY A;  2ZHN A;  1RHI 3;  3SH5 A;  1V6K A;  2PLV 2;  2Q30 A;  5F3G A;  1GYK A;  1NCR C;  1R1A 1;  1H1M A;  1CON A;  1UMI A;  4NE9 A;  1AHS A;  4XCB A;  1LOF A;  4RGK A;  2RDR A;  5FZF A;  3QAC A;  3ZFF B;  3N36 A;  4DFS A;  1GIC A;  5J37 A;  5JOW A;  3GZU C;  5IK4 A;  1WW6 A;  2PXJ A;  2B39 A;  2HEV F;  3III A;  3J7N A;  1XYO A;  4OI4 A;  3KVB A;  2RJL A;  3PUS A;  3WXP A;  1JBC A;  4CCC A;  4E4H A;  2DVA A;  1W6O A;  1MEC 3;  4OI1 A;  1O3S A;  1RIN A;  4ZON A;  1STM A;  3PVN A;  4JVA A;  4MGK E;  4FAG A;  1MS9 A;  1DYP A;  3GBG A;  1UKR A;  4LO4 B;  5A7W A;  4XFI A;  2D6P A;  4BIS A;  3LPF A;  4FPK A;  2Y26 A;  5K9Y A;  5A7Q A;  4AF9 A;  4ZXE A;  3MF6 A;  4ATF A;  3NAP A;  4ISQ A;  1WZX A;  3VZN A;  2OVU A;  4JTN A;  1YFW A;  2YBK A;  1M06 G;  3WY6 A;  4JGY A;  1QJZ A;  1W9W A;  1OC1 A;  5C8C B;  3TEY A;  2HYX A;  1UYZ A;  3ATG A;  3T0D A;  2EIC A;  2ZBJ A;  2FCT A;  1RUD 2;  5C8C A;  3GXU A;  4CSW A;  1ND2 C;  4JZR A;  1DYO A;  4OYU A;  4G9S B;  1FXZ A;  5FP7 A;  3ZYB A;  4ZKT B;  4CEW C;  1JZ3 A;  4XF3 A;  5FKB A;  3AKS A;  3MBW A;  3LGR A;  1RUG 2;  1KIT A;  1NXD 1;  4CA9 A;  2O1Q A;  4KNC A;  3H3L A;  4NPR A;  1H2K A;  5E1R A;  3CJX A;  2P37 A;  1UCX A;  4Q4W 2;  2OX0 A;  1K5M B;  1IS4 A;  2XB6 C;  4UFI A;  4BQW A;  4DQA A;  4OHZ A;  5D8A B;  3D5O A;  4AED B;  1W6P A;  1ZBE 2;  5LBF A;  3WSO A;  5HV4 A;  3RI8 A;  4QX8 A;  4QM8 A;  5HCF A;  4N7I A;  2DU1 A;  4MVT A;  1CAX A;  4P9L A;  3Q9O A;  3AYD A;  3FWE A;  3WNL A;  4AVB A;  1ENQ A;  4FI9 A;  2QE3 A;  3AK0 A;  2PHU A;  2PAK A;  5HCB A;  1JYX A;  2WWU A;  3UES A;  4K20 A;  5JMC A;  3AL5 A;  3NAP B;  4OFG A;  3KD4 A;  3VKF C;  2P6C A;  1EV1 1;  2AR6 A;  4XBN A;  4YG3 A;  4LJH A;  3SIT A;  3T0A A;  1NCQ B;  5IVJ A;  5LWB A;  5DAV A;  5FRA A;  4ASM B;  1CVN A;  3LIH A;  2PMW B;  4QDQ A;  1RMU 3;  3W59 A;  1IKP A;  1JZ8 A;  1FMD 2;  4MH0 E;  5EHD A;  1JI6 A;  4LHK A;  5FDB A;  3PUI A;  2MNG A;  3VBR C;  2JDZ A;  1NE6 A;  4EWA A;  1RUO A;  2MHF A;  2JG9 A;  1H6X A;  1W9S A;  2YUE A;  4KWJ A;  3H8U A;  5AC9 3;  1WMD A;  1LOE A;  2VAU A;  4ZU5 A;  5LA0 A;  1CGP A;  2FDH A;  1MVE A;  2CL2 A;  3BIW E;  3POW A;  4HKO A;  3I3D A;  1L7R A;  4B8E A;  3WHU A;  3B3Q E;  1X36 A;  2WZR 3;  3D3A A;  1U5Y A;  1LCL A;  4BH9 A;  5IK8 A;  3BTA A;  1O5U A;  1KJL A;  5DUV A;  4EN0 A;  3DEC A;  3AYC A;  5G04 L;  5A1L A;  5EP9 A;  1J58 A;  3AMQ A;  4M3C F;  2R32 A;  4WVW A;  1C5I A;  3ALQ A;  5E6H A;  4B1L A;  4DUV A;  4Y26 A;  3VBF B;  2R0H A;  3ZFG B;  2Z79 A;  3QCW A;  2D93 A;  4GUL A;  3A0N A;  1V6J A;  4BXF A;  3RMX A;  5BNO C;  3KT4 A;  2FBE A;  4IGP A;  5C5U A;  4AHX A;  2OW4 A;  2MPF A;  1AXZ A;  2XXZ A;  2VZ3 A;  2WUH A;  1HRV 3;  2ORZ A;  5EQU A;  4FT8 A;  4JC1 A;  1U12 A;  2LM3 A;  3ZXE A;  4PLM A;  5AC9 1;  1TZO A;  2Q4S A;  4QKN A;  3H9A A;  3AFG A;  2RS1 3;  2BER A;  3JBG 3;  3W58 A;  4NMI A;  5KHJ A;  3WNK A;  1NXM A;  1OOP B;  2BBA A;  1A78 A;  2VNR A;  4IV1 C;  2CU5 A;  4LQR A;  4ZU7 A;  2JE9 A;  1LTE A;  1ZZ8 A;  1W8T A;  3WP4 A;  4QKD A;  5C70 A;  1EP0 A;  3BB6 A;  3RWN A;  2XBO 3;  2JDU A;  2VOT A;  1U5I A;  1YQC A;  4S2F A;  2PHR A;  4LK7 A;  3VDD C;  1GZT A;  3WW3 A;  1XYP A;  3S6P A;  4GB3 2;  4XXP A;  3ZYP A;  5HXM A;  2W0X A;  3VHR A;  1REF A;  2PA7 A;  1FPN 2;  2W1W A;  3TN9 2;  3VGI A;  4YW1 A;  1ULG A;  3T2Q A;  1NUK A;  3WCR A;  1V0A A;  1GZ9 A;  3ZYI B;  1CZV A;  1UPI A;  1JUI A;  5F5A A;  4LA2 A;  4F8A A;  5JSR A;  5FO7 B;  3WR0 A;  3J26 N;  2PHL A;  4YW3 A;  3VHO A;  3ZN5 A;  4Q26 A;  1WD4 A;  1S2K A;  2D6M A;  2Q8O A;  3MFC A;  4DMI A;  4UF0 B;  2PEL A;  3O1S A;  3KLS A;  2XWB B;  3E5X A;  3A4U A;  3O1U A;  1GP5 A;  1WGP A;  1KS4 A;  5CG8 A;  1RUG 1;  2GAL A;  2VC9 A;  3ACI A;  1V6I A;  3PU3 A;  4UF0 A;  2BP6 A;  3CO2 A;  4EZ4 A;  4LBM A;  4Z2W A;  3K3O A;  5I8T A;  3FZ3 A;  4A7Y A;  1FYU A;  1ZZB A;  3BIE A;  1RUI 3;  3VBH B;  2I45 A;  4JQT A;  3PVE A;  2VOV A;  3POI A;  2XJP A;  2IC1 A;  3BOW A;  3NJY A;  4QPY A;  5FAX A;  4COU A;  3PVB B;  1AR7 3;  2J7M A;  4FCA A;  1W2O A;  3VBH A;  1W2N A;  4LT5 A;  5KXD A;  3RJ2 X;  4PF1 A;  4ZU4 A;  2R06 2;  3I49 A;  1VE0 A;  2JKX A;  1EAH 1;  4GJZ A;  5SV5 A;  4E2S A;  2BQP A;  4DRR A;  1V00 A;  4FFH A;  1RMU 1;  1O7F A;  2VQU A;  2NP0 A;  1F31 A;  2RV9 A;  4JKK A;  4AEK A;  2NM1 A;  3GJB A;  3O0V A;  2R04 1;  3N9P A;  4DNY A;  3N7J A;  1IQA A;  2ET1 A;  3IT8 A;  2E53 A;  5JLV A;  4PDW C;  1LU1 A;  4L99 A;  4AZZ A;  1TMF 1;  1UPS A;  3V0B A;  2AAC A;  2LRP A;  1NLS A;  4XUR A;  5DXD A;  2OA2 A;  4YYO A;  2XPJ A;  2C6S A;  3J8F 1;  4CTE A;  1S2B A;  1TVG A;  3VBU B;  5HV0 A;  2VCB A;  2GC1 A;  2B8M A;  4MSV A;  2JD9 A;  4PT6 A;  4SLI A;  1DFQ A;  5C9A C;  2AEZ A;  4QGN A;  1HLC A;  4OMC A;  4QPG C;  4QX2 A;  1ZRE A;  5LY2 A;  1XPW A;  1RUJ 2;  5C33 A;  4PI0 A;  3UGG A;  1Y9G A;  1NX9 A;  1DQ0 A;  3BVC A;  3I59 A;  4XQD A;  4I01 A;  4UW4 A;  2RR1 1;  1AL2 1;  2AH2 A;  4D7Y A;  3I3M A;  4DS0 A;  5BV6 A;  1VPH A;  1FT9 A;  5IAT A;  1FNZ A;  5F5Q A;  5A3W A;  3T2P A;  1S0C A;  2Y6K A;  2AGS A;  2DUQ A;  2WWJ A;  4CE8 A;  4OHY A;  3K46 A;  5FTT C;  3CBN A;  4YLZ A;  4XFB A;  2ZGU A;  3FLP A;  5AVA A;  1SMV A;  5BPX A;  5I0R A;  4QQL A;  1HJF A;  3PUH A;  1WLT A;  1ZZC A;  3AYA A;  3K4A A;  4QQP A;  4XUO A;  3T1M A;  2G1M A;  4TTG A;  1QJX 3;  2O8O A;  3OGV A;  4LE3 A;  4LLF A;  5B4N A;  2RE9 A;  4B4R A;  4CCN A;  1DGW X;  3VBS C;  5IVC A;  3PME A;  4ZZ8 A;  4XFC A;  5L73 A;  4BIF A;  1NA1 C;  5K0U C;  4AVV A;  1JMU B;  2GN7 A;  4M0H A;  4CEY C;  1TME 2;  1HN0 A;  4GXL A;  5CKN A;  1ZBA 1;  4UFM A;  4COY A;  1OA3 A;  3DXU A;  2P17 A;  5A70 A;  4IL7 A;  4OCT A;  2GNT A;  2A71 A;  2IFW A;  1WA4 A;  4R9B A;  4UAP A;  3WIN E;  1HIX A;  1ZBE 3;  5K8S A;  1LHW A;  1QQP 1;  3USU A;  2WQ8 A;  4XTP A;  4M00 A;  2B9U A;  1YQ6 A;  4OLL A;  5BNN A;  2X5I A;  3HAG A;  1WMX A;  4IE6 A;  1S0D A;  5C4W B;  5E89 A;  1IS5 A;  2E9Q A;  1VAV A;  1JZ7 A;  3S7E A;  1X82 A;  1OXC A;  4UFH A;  1C1L A;  1XU2 A;  1D4M 1;  1W0N A;  3ZFE B;  1CN1 A;  4PQQ A;  3VBR A;  3OEA A;  3TEW A;  4TLF A;  4XCA A;  3VZK A;  1RUC 2;  3SEP A;  1I6X A;  3BKZ A;  5H9R A;  5DUU A;  1OPO A;  4P00 B;  1GNY A;  3WV6 A;  2JD4 A;  1DF0 A;  3RJR A;  1LOB A;  3K77 A;  2HH9 A;  2H6C A;  4OHX A;  5FZ1 A;  3R4S A;  5CA6 A;  3H7J A;  1ZRD A;  4I3G A;  1ODM A;  2XJR A;  4I2O A;  2OPK A;  1PNG A;  2PLV 1;  5FUI A;  4J1W A;  5FY7 A;  3ROU A;  1CAW A;  2ZCW A;  4YVS A;  3AKP A;  5CFC A;  1XJA A;  2YPD A;  1J84 A;  3PVO A;  2A6Y A;  4ZPI A;  4P9W A;  1W90 A;  3NL1 A;  3ILR A;  3BTX A;  2VO5 A;  1CAW B;  1LED A;  2RMU 1;  3MIH A;  5JI7 A;  4QPG B;  4YZ2 A;  1CIY A;  4O9E A;  5C3P A;  2CDP A;  3S0M A;  2JG9 C;  1RTV A;  5JR7 B;  1MR5 A;  4DY5 A;  2ZXQ A;  1GOG A;  2JG8 B;  4BQY A;  2DFB A;  2A75 A;  1BK1 A;  1LNS A;  2R04 3;  2WNU B;  1JXN A;  4KL1 A;  1AYN 3;  1KJR A;  4P5Y A;  3CJI C;  2EIB A;  3ZSE A;  1JYC A;  2WSV A;  4CP1 A;  1MPX A;  3K75 B;  4Z8B A;  5FZB A;  5FZO B;  5FPB A;  1RL3 A;  1ND3 C;  2A7A A;  3J7H A;  4X8N A;  3VDD A;  4QQO A;  2OPW A;  1RUI 1;  2DTY A;  2J1V A;  5ANN A;  3FLR A;  4IE7 A;  4QX5 A;  2BJS A;  2DCT A;  4FPL A;  4NPL A;  1F4H A;  4D0Q A;  4E2Q A;  4LO8 A;  4CDQ A;  4HVQ A;  1Q43 A;  3L9J T;  5J98 B;  1DGR N;  2VOW A;  1UO9 A;  3O14 A;  3ILN A;  3SC7 X;  1JYV A;  5FP4 A;  4LBJ A;  3UJQ A;  3CF6 E;  1YQ2 A;  4FPC A;  4AQT A;  4IEP A;  4YG6 A;  5F5I A;  3O0X A;  3QBQ A;  3I3E A;  1VRH 1;  5IK5 A;  1OVP A;  2WO1 A;  4AED A;  2BNM A;  1CAV A;  1S0J A;  1QXR A;  2WAA A;  3BPZ A;  1O5L A;  3NMB A;  3V56 A;  3THC A;  4BCU A;  1POQ A;  4ARX A;  2VNV A;  4GAL A;  4KG0 A;  4LIV A;  1RYY A;  4HET A;  4LKS A;  1JU4 A;  2P3J A;  2RS1 2;  3JBG 2;  1CX1 A;  3KVA A;  1GWL A;  3U14 A;  4QB6 A;  2W94 A;  4UYB A;  2Q1Z B;  3N7L A;  4P14 A;  5CU1 A;  4P9J A;  3KT7 A;  1BEV 2;  5A7S A;  5JAX A;  2JG8 A;  1PZ9 A;  1Q8P A;  1YO8 A;  1AYM 3;  1UX6 A;  3DPR B;  3CU7 A;  5IYY A;  4XF0 A;  5A3P A;  3U37 A;  2CTV A;  3JQX A;  2W2I A;  4CYD A;  3GJA A;  4GB3 3;  3HT1 A;  4KWU A;  3AMP A;  4Y33 A;  4B29 A;  1PZ7 A;  1W8O A;  2QQI A;  2RVA A;  3T08 A;  2DDU A;  2WS9 3;  1UY1 A;  3KZ4 C;  2LS6 A;  2I07 B;  2EIG A;  5L9B A;  3WNN A;  5I0U A;  3X29 B;  5A3T A;  4XQ4 A;  1US3 A;  4M4R A;  4AFA A;  5GZC A;  1OQD A;  2Q8E A;  3TNP B;  3HQR A;  3HBZ A;  4QQH A;  5BNQ A;  4MXW A;  3ZN4 A;  4AQ2 A;  4Q4X 1;  4ISR A;  1FNY A;  4N43 A;  1GBG A;  3KSC A;  1WCQ A;  3ZX7 A;  3I2H A;  1H0B A;  2HBT A;  3MFA A;  3Q8C A;  2VMH A;  2VG9 A;  5DMY A;  4N43 B;  2XL7 A;  4R9C A;  3ZPY A;  3JB4 C;  1RIR A;  3RZZ A;  5I0S A;  5IHR A;  4RYD A;  2IXC A;  4BQ4 A;  1IG3 A;  4LBL A;  3R4U A;  3F2Z A;  3MYX A;  1HB1 A;  3DV8 A;  4R4X A;  3I2J A;  4BQ3 A;  2ZPX A;  1OT5 A;  1UN1 A;  4RHV 3;  5FMO S;  3IPV A;  2RDQ A;  1NY7 2;  5A3O A;  2XVG A;  4Q4V 3;  4NWV A;  1V6L A;  1N1S A;  2QBX A;  3B93 A;  3KB5 A;  3L2Y A;  3PU8 A;  3BYW A;  5IVV A;  3I3B A;  5EFU A;  1E5H A;  1JOB A;  2VW2 A;  3C7E A;  1YC6 1;  4HOO A;  3U10 A;  1SAC A;  2V5Y A;  4AI8 A;  3VDC A;  4URA A;  1UIK A;  2WLP A;  4PHZ A;  5LA9 A;  4S2G A;  3H3Z A;  4TZD A;  1BHG A;  2W87 A;  5FIX A;  4E4Z A;  4RS5 A;  3ZFF A;  3UNP A;  5G05 L;  5FZH A;  1PIV 3;  2BUK A;  2XBO 1;  1D7P M;  2VEC A;  5FXZ A;  2EAK A;  2B7Y A;  5CAD A;  5F1R A;  4NID A;  3MIE A;  3LA7 A;  3U11 A;  3CIH A;  4OQ9 A;  1RMU 2;  4D6S A;  4IEZ A;  2SBA A;  5LBC A;  4QKF A;  4LA3 A;  5BUV A;  1NCQ C;  2X53 S;  3OBZ A;  2A3W A;  2QQM A;  3OBT A;  2UY8 A;  3BUC A;  4C0H A;  5BXX A;  1QQP 3;  3WF4 A;  4DO0 A;  2XH6 A;  4JRL A;  2X8K A;  4XFF A;  3FC0 A;  2UY9 A;  3BN6 A;  5IUQ A;  3JD7 2;  3THT A;  3UJO A;  4K8R B;  5GAL A;  5DAQ A;  2BW8 A;  4HVO A;  4N53 C;  5BNN C;  3TOJ A;  1RJ7 A;  2Z5W A;  2OZJ A;  3O5S A;  2ZX1 A;  2NYY A;  2NLR A;  1AYM 1;  4NO4 A;  2P6H A;  1SZB A;  3M4F A;  3QH6 A;  1NA1 A;  2GP5 A;  2RM2 1;  5LZ6 A;  2HWB 1;  1KDK A;  1LUL A;  2BGC A;  4LO7 A;  1QJX 2;  3SCF A;  4NJ4 A;  4BWO A;  4L97 A;  4LE4 A;  4WVZ A;  1CX4 A;  1NA1 B;  3OGJ A;  1PK6 B;  4UW5 A;  3RNS A;  1BZW A;  5K0U A;  2K46 A;  1KQR A;  2WYS A;  4K7J A;  1AXK A;  3AP9 A;  4R9D A;  1R09 1;  3N9N A;  1DGW A;  1PK6 C;  2YZ4 A;  2VPV A;  3BCW A;  3NV3 A;  5JVV A;  5FY0 A;  4A2U A;  1L7L A;  3NNM A;  5D21 A;  1OLR A;  4IET A;  2FMY A;  2ZHM A;  4IV3 B;  3Q8E A;  1F5J A;  5FUN A;  3T09 A;  4AI0 A;  4AI1 A;  4YWA A;  3WOG A;  2G9Z A;  2ZEX A;  1PNF A;  4QPI C;  2DCY A;  2O8Q A;  2BVB A;  2BZD A;  4QMA A;  1RGS A;  1QHD A;  3LOI A;  1VLN A;  4BYY A;  3BAL A;  2XBO 2;  5A6X A;  3GZT B;  3LE0 A;  3GCW A;  3MIC A;  1HXS 1;  4EYU A;  4CDU C;  1TME 1;  4EE2 A;  4IEO A;  4RR3 A;  2ADD A;  4JDN A;  3LIG A;  3ZLI A;  2VZQ A;  4QDS A;  2W08 A;  1DG6 A;  2WJS A;  3QH7 A;  1XND A;  4LTA A;  2JG8 C;  2VMF A;  2DVB A;  3ZOI A;  1O3Q A;  4AR2 A;  4QB2 A;  4OZX A;  2DV9 A;  2WR9 A;  3J8F 2;  5EWS A;  1R08 2;  2ZGQ A;  2Q8C A;  2WSU A;  2X05 A;  3W21 A;  4A7Z A;  2Y0I A;  1ND2 B;  1J1T A;  2W52 A;  2BWC A;  3DKW A;  4BA6 A;  1R1Z A;  4W4Z A;  4Y1X A;  5FK7 A;  5CFC C;  2OT7 A;  1YFX A;  2GZW A;  2X09 A;  1ASJ 3;  1W9T A;  3PL0 A;  3POF A;  1OLQ A;  3VBO B;  2ZMK A;  5JZG C;  2QNK A;  3WP5 A;  2BOI A;  4UBG A;  4TLG A;  4MGT A;  2VXJ A;  3N9O A;  5IVE A;  2Y6F A;  1N3P A;  2PYT A;  2ARC A;  1HN1 A;  1RUC 3;  2V73 A;  3HOB A;  2D6N A;  4C91 A;  3OPW A;  2HWB 2;  2HWE 3;  3NQH A;  4QPW A;  2BVV A;  3MEP A;  3EXU A;  1EUT A;  2NQY A;  2GAU A;  1C8M 2;  2OII A;  5EZW A;  1J3Q A;  1XE7 A;  1ND3 A;  1PX3 A;  3AVS A;  1UQX A;  4IEX A;  4XET A;  1XE0 A;  2CAV A;  4OMD A;  4FTE A;  2R06 3;  4Z92 B;  1R1A 3;  1TMF 2;  3ZXD A;  4QXH A;  1OD5 A;  1GU3 A;  1RIT A;  2HWC 3;  1LHO A;  1WUV A;  4CP2 A;  5BNO A;  2FD8 A;  5FYY A;  3NVC A;  4QX1 A;  2YG0 A;  5FXV A;  2ZX3 A;  5LB6 A;  1MZ5 A;  1O91 A;  2CGN A;  4GIQ A;  4YFW A;  3RWK X;  1O3R A;  4J25 A;  1AYN 2;  4A44 A;  1SBD A;  2VZO A;  1ZA4 A;  1QJY 3;  1W2U A;  3AP7 A;  5CB7 A;  3MIF A;  2RS3 3;  4LOS A;  2WFP A;  2FMD A;  3CZJ A;  4QX0 A;  4RA0 A;  4C1X A;  2VD7 A;  1APN A;  1ZZ9 A;  2WIN B;  3U75 A;  2CSG A;  1DQ1 A;  1QJU 2;  1PIV 1;  2WA4 A;  1WCD J;  4YW6 A;  4UI9 L;  3T4H B;  4QWN A;  1ULF A;  2ZMN A;  1CQ9 A;  3BGA A;  5FMO L;  4JGY C;  1OUS A;  3AKQ A;  4K40 A;  4PBP A;  3V0A A;  2PHW A;  1PMJ X;  2AC1 A;  3MV0 1;  1O4T A;  3OYW A;  2B9V A;  2I2S A;  1DLC A;  1QOT A;  2D44 A;  1TNR A;  4HPK A;  4BPZ A;  1Q3E A;  3D82 A;  5KXC A;  1E5I A;  2ZTN A;  1C1F A;  3EQE A;  4FBF A;  2W47 A;  3JB8 A;  3FHQ A;  5FCC A;  1TNF A;  1QOO A;  5T50 A;  3UKN A;  3KS7 A;  1VB2 A;  4ZS3 A;  4FQ4 A;  2HWF 2;  1V6M A;  2WQ4 A;  2WS9 2;  1AL2 2;  2B42 B;  2EIE A;  3POG A;  5FXX A;  1WD3 A;  4QHB A;  1WKY A;  1PO1 3;  5FY8 A;  3I2K A;  4N8M A;  4BK4 A;  1H1I A;  5LA2 A;  5L9V A;  1RUF 2;  2YY1 A;  2OQ7 A;  1RVF 3;  3L2H A;  4EQV A;  4QXK A;  4Q0Q A;  4OUL A;  2WZR 1;  4DXZ A;  1L7Q A;  4HVR A;  3J9S A;  3SKJ E;  3IZO A;  4PDW B;  3A22 A;  2D40 A;  2XUE A;  4LHL A;  2BBV A;  4CDX B;  1XE8 A;  5LK5 A;  3VBS A;  3H1M A;  4CUG A;  3NV4 A;  2OKX A;  1NAE A;  1YQ8 A;  3H50 A;  1Z78 A;  4LBQ D;  3ZXF A;  2AYH A;  1MQT A;  4Q0S A;  4H7M A;  3HWJ A;  5E8A A;  5F8P A;  4ET7 A;  5I0D A;  3NV2 A;  3DYO A;  3OUJ A;  2ADE A;  4OHW A;  2PHF A;  4RHV 2;  1FAY A;  1W6Q A;  2BGP A;  4FPY A;  4JGY B;  1I5Z A;  4UXA A;  1VAK A;  1XOY A;  3LAG A;  4WBB A;  3V0B B;  1UF2 C;  1AX0 A;  3JXS A;  4NHK A;  2ARB A;  2WFF 2;  2YU1 A;  1CAV B;  4AGR A;  1KD7 A;  2JEC A;  3QLQ A;  4KWK A;  2WRA A;  4MOA A;  2XML A;  4JDO A;  2GME A;  3VUO A;  1QIQ A;  1VBA 3;  4MHU A;  4PBO A;  3R0R A;  1LU2 A;  4OUS A;  1VMH A;  3E97 A;  1DQ6 A;  1K3I A;  1ULD A;  1JOJ A;  1QNW A;  4YZ5 A;  1QJF A;  2ZX4 A;  5A1F A;  4CCE A;  2BFU L;  1PVC 1;  2CNA A;  1PGL 2;  1SFP A;  1DU3 D;  2WLQ A;  2PTM A;  1ACC A;  1XYN A;  3DPR A;  3HR9 A;  4KWL A;  1OFS A;  1OHF A;  4Q29 A;  4FVV A;  4CDX C;  2P5B A;  3IMM A;  1S0F A;  4PCR A;  4GA9 A;  1ULE A;  4GH4 B;  2XHN A;  5JXG A;  5C8W A;  1HV1 A;  3TBD A;  2D5H A;  4YSF A;  3ACG A;  4GMP 3;  1AR6 2;  1XB9 A;  1NCQ A;  3NNJ A;  2DCK A;  4LLO A;  4NOT A;  2X5I C;  3KF3 A;  3RQ0 A;  4HXC A;  4ASK A;  2OZ6 A;  3PIG A;  1RUH 2;  1JZ2 A;  2XVK A;  1GAN A;  3FBY A;  1HQN A;  3CMG A;  3V65 A;  3ZSM A;  3JD7 3;  3WCS A;  3GHM A;  3ACH A;  1PO1 1;  3OGR A;  4MGZ E;  5JCT A;  1H1A A;  3TB0 A;  1IGO A;  3VKN A;  3WG3 A;  4AFB A;  2DBN A;  4MYE A;  5FZK A;  3ZXL A;  3E6B A;  1HRI 2;  1W3V A;  1V9U 2;  3H1W A;  2R07 1;  4JQR A;  3CLP A;  1B09 A;  1K45 A;  4FPG A;  4L8Q A;  3C7F A;  4L92 A;  3ZSL A;  2AZ5 A;  3I2I A;  4A3Z A;  4WM7 A;  2B4K A;  1DBN A;  1T2X A;  4WM7 C;  3HN1 A;  3WF3 A;  5HI0 A;  4AXO A;  3ZFG C;  4XPV A;  1CJP A;  1R64 A;  2WNU C;  2ZHL A;  3BTZ A;  5J09 A;  5ACA 1;  2EXJ A;  2XJS A;  3T3Y A;  4DXT A;  5C71 A;  5JXI A;  3U0Z A;  1NY7 1;  3VKM A;  4CUB A;  1IHM A;  2XG3 A;  1DZQ A;  3K3N A;  3GCX A;  1UZW A;  3MO4 A;  4FFF A;  3MLL A;  4XMA A;  3RSJ A;  1OH4 A;  4GH4 A;  2R1B A;  4D3W A;  3D0S A;  1HQW A;  5ANQ A;  3VL9 A;  4RQP C;  3MPB A;  2DBI A;  2C5D A;  2WAB A;  1BEV 3;  2D6L X;  4MZU A;  2YC2 A;  1D2S A;  1OMI A;  2J42 A;  3F95 A;  4M4P A;  2R16 A;  4MO3 M;  4CDU A;  3ZKU A;  3J7L A;  2Q5T A;  1NCR B;  3FMG A;  2KXL A;  4N90 A;  1Q5O A;  5BNP C;  3MUZ 1;  5LA1 A;  4WM8 C;  4EZH A;  5F3I A;  1UXX X;  1F15 A;  2ZAC A;  3U07 A;  2NPI A;  1POV 0;  5C9A B;  3JQW A;  1U5Z A;  1YQ5 A;  5F5C A;  1VP6 A;  2KA3 A;  2WNU A;  4HK8 A;  1GP4 A;  5I8S A;  1GV9 A;  5F6L B;  4COZ A;  5C5T A;  5CFD B;  1VBE 2;  3M8L A;  2NN8 A;  4UWD A;  4GMP 1;  5A33 B;  3GZA A;  4Y3O A;  3LZZ A;  3MW3 A;  1POV 3;  1ASJ 2;  1W06 A;  4FOQ A;  3H7Y A;  2QTW B;  3PNA A;  3ON7 A;  4IV3 C;  4PLN A;  3WEZ A;  4CDQ B;  3LOB A;  4JRA A;  1GUI A;  3ZO0 B;  1J3P A;  2WA3 A;  3LB9 A;  4AI2 A;  2VTX A;  4TSV A;  3ZR6 A;  4E27 A;  2Y6L A;  4BQ5 A;  3J8F 3;  4IUG A;  3AJY A;  2HWC 2;  4E8C A;  3W9A A;  5B2G B;  1UU6 A;  1VMF A;  1GNH A;  2RMU 2;  2VZS A;  2WT2 A;  4GKY A;  3U4X A;  2Z42 A;  3BOP A;  3AXD A;  2WNE A;  1UZY A;  3VZO A;  5ISL A;  2R0F A;  4XW3 A;  5FYC A;  2LTN A;  1D4M 2;  1IZ3 A;  2HWD 3;  4Y1U A;  4NN0 A;  3W20 A;  4FOW A;  3ENR A;  3PUR A;  1RUE 2;  3P3P A;  1LOA A;  1ENX A;  1PVC 2;  1QJY 2;  1QU0 A;  2TEP A;  2VBB A;  2ZGR A;  4Y20 B;  2QQV A;  5AVP A;  1G9F A;  3RGB A;  5AC9 2;  4EN8 B;  3OPZ A;  1PM7 A;  1W03 A;  4WVV A;  3ZXG A;  2VZ1 A;  1VBD 1;  4QPI B;  2Y33 A;  1B35 C;  2ZKN A;  4E4D X;  1Z7S 3;  3KCC A;  4IGO A;  4UFJ A;  3IIA A;  3SKV A;  1BBT 2;  3FN9 A;  1UL9 A;  4P9Y A;  2ERF A;  5C7G A;  4YM2 A;  1AVB A;  5FY1 A;  2K2S A;  2OXB A;  2OS2 A;  2XUM A;  3SQO A;  4A6S A;  3WG2 A;  2H0V A;  4AFM A;  4BDV B;  3JZV A;  4HN1 A;  2JG9 B;  2R49 A;  2ZEY A;  5FP8 A;  3VBF C;  4NRM A;  1W99 A;  3HMY A;  2HWF 3;  5GLW A;  5L7O C;  5CG9 A;  2W39 A;  4NII A;  2BPA 2;  1SEF A;  4Y4Y A;  5BYN A;  1DZR A;  2H6B A;  1S4C A;  2W1U A;  5GLV A;  4FOY A;  4AGG A;  4NAM A;  1RVF 2;  1NQD A;  1EAH 3;  2B5H A;  2QFE A;  2ZEZ A;  3MLK A;  2UYA A;  3LFI A;  3USS A;  4B4Q A;  2EID A;  1SLB A;  4IDZ A;  2ZX0 A;  1OD3 A;  3R4D B;  4ORF A;  2P3K A;  3USU B;  3OPT A;  5JXJ A;  2AEY A;  2VZR A;  3VDA A;  2VNO A;  3POJ A;  5FO8 B;  3I59 B;  5CFD C;  4TXW A;  1YXW A;  2A73 B;  2HKX A;  4J1X A;  5LBE A;  1SBF A;  4CXX A;  5FR3 A;  1GOH A;  5A32 B;  1NKG A;  2WNV C;  2Y0O A;  2QQP A;  3RZH A;  2F4P A;  2XKP A;  4LPL A;  4YPJ A;  2QQO A;  2RM2 2;  3BU0 A;  5FYI A;  4XC9 A;  1CZS A;  3LDB A;  2D3R A;  2VE1 A;  4YRD A;  1SLI A;  2VCA A;  5J36 A;  2DYC A;  1JHN A;  3FJS A;  1GP6 A;  3GYD A;  3LFM A;  4OUE A;  3H8O A;  1I9R A;  1OUX A;  2C4X A;  1F35 A;  2BYV E;  1BCX A;  3HBK A;  4XF1 A;  5F6K A;  3DCQ A;  1HV0 A;  4ZY9 A;  1WCS A;  1YRZ A;  5EJ1 B;  2IZW A;  3H42 B;  3I54 A;  4OUM A;  2GP3 A;  3NV1 A;  2UUR A;  3AFK A;  3DEM A;  3Q8A A;  1DGR A;  2YBS A;  3RZM A;  4CCJ A;  5E16 A;  2XJV A;  4HLT A;  3MUY 1;  4IND A;  1YIF A;  4HL0 A;  4QGM A;  4QHO A;  5GKA C;  2QJV A;  4FXK B;  4F83 A;  1R08 3;  2Y6H A;  3SH3 A;  5FZC A;  4F7Z A;  2YRO A;  1AR6 3;  1GZC A;  1LES A;  3B5L B;  2OYZ A;  5FOJ B;  1Y9Q A;  1W2T A;  2ZZQ A;  3M2M A;  4L2N A;  1JTZ X;  3CZU A;  2E31 A;  3QOP A;  1IS3 A;  4LBN A;  3ZFG A;  3ZXK A;  5DZE A;  2BFU S;  1QH7 A;  2VUA A;  4NRQ A;  1W6O B;  2EXI A;  4FTS A;  2G19 A;  3B00 A;  3NNG A;  3S5Q A;  3P1I A;  2DTW A;  5E88 A;  1ULP A;  1Z7S 1;  5KHK A;  5A7W B;  2WBK A;  4U36 A;  1CR7 A;  4XXA A;  2QQJ A;  1GWM A;  2RS5 3;  5IAX A;  3NWK A;  5D1I A;  5K4L A;  4CCO A;  2E33 A;  4COV A;  2GC2 A;  1LGN A;  3D0J A;  3HJR A;  4Q4X 3;  3KHB A;  1K5M C;  4IEW A;  4DPN A;  4DY3 A;  1HB4 A;  1O8P A;  1YWK A;  2VY0 A;  3AMN A;  5APA A;  3WNO A;  4E2G A;  1CAX B;  5JSO A;  3TYJ A;  2B46 X;  3M3I A;  2VUJ A;  1O4Z A;  4GWJ A;  1AYN 1;  1HKD A;  1D2Q A;  2VTF A;  4BJ0 A;  4M3C E;  2FZ1 A;  4IV1 A;  3POS A;  4IES A;  3VHP A;  3HPN A;  3SH4 A;  5JWP A;  5FZO A;  4YZ1 A;  1OPM A;  3LEK A;  2WWS A;  1COV 3;  1EV1 3;  3MF9 A;  5DQ0 A;  5A1A A;  1BVV A;  3WZ1 A;  3LCP A;  3H8X A;  1LHV A;  1A3K A;  4LIU A;  4AVA A;  4WV8 A;  4KGG A;  1N47 A;  2F17 A;  3APB A;  1PMI A;  1UX7 A;  4AOC A;  3WDY A;  4XAB A;  1AUY A;  2D3P A;  1FI2 A;  1XC6 A;  3ZSJ A;  1X33 A;  4QHZ A;  4QM9 A;  4A6O A;  3B9C A;  5L9R A;  2A6X A;  1CJD A;  1FV3 A;  4AFC A;  3I2G A;  1C8M 1;  1QJU 3;  4Q0U A;  4IEQ A;  2XQR A;  3GF6 A;  3PJQ A;  4AI9 A;  4MHR A;  1WLW A;  4H2A A;  4RQP A;  4Y22 B;  5I91 A;  5CAZ A;  1W05 A;  4OI2 A;  1N3Q A;  1NT0 A;  5FP3 A;  1O3T A;  4M3C A;  2QQN A;  3C2U A;  2GDF A;  1N1T A;  1CPN A;  4K8F A;  1VBE 3;  4XJA A;  5GJ6 A;  1G9C A;  3ELN A;  3S5A A;  5C3R A;  4I30 A;  4I02 A;  4AGV A;  4YAR A;  1OH3 A;  2YB7 A;  3RZK A;  3QD6 A;  2HWC 1;  4LUM A;  3ORJ A;  2QQW A;  2ZJC A;  4YW4 A;  4B4P A;  1W6N B;  1VR3 A;  2QDR A;  3IDA A;  3UL2 A;  5L36 A;  2WYF A;  1ZBA 3;  3AXE A;  5KWR A;  1PO1 2;  3EHK A;  3I7D A;  1WCK A;  4L0P A;  4N7U A;  3DUI A;  1RUD 1;  4CVU A;  5JOY A;  1XNK A;  2GMM A;  4MGI E;  5F7U A;  2VVD A;  5A6Y A;  1RVF 1;  1W9Y A;  4JHZ A;  5T52 A;  2ARX A;  1QF3 A;  5GZE A;  5JIU A;  1X7N A;  5IT6 A;  1HRI 1;  2O0O A;  1SLT A;  2EAA A;  3M70 A;  3NNF A;  3EJK A;  4JTO A;  5H9S A;  1IPJ A;  2LUW A;  1JYT A;  3ASI A;  1UU5 A;  5FZ8 A;  1BQP A;  3M3E A;  3ZDS A;  4CU7 A;  4UFL A;  3T0B A;  5H9Q A;  2DU0 A;  2B45 X;  1S55 A;  4YGB A;  5FV3 A;  4COW A;  1H2N A;  3HIF A;  1MS1 A;  2R07 3;  1Y7B A;  1ZM1 A;  3I2F A;  2WZP P;  3UET A;  4CZS A;  1W04 A;  3MIG A;  4WZF A;  1W8Z A;  2GNM A;  1Y9M A;  1L3J A;  2C26 A;  4A42 A;  3POE A;  2YFZ A;  5AFE A;  4IEV A;  1ULO A;  3GDB A;  1MEC 1;  5J1X A;  2ZAB A;  2R04 2;  3ZN6 A;  1HRV 1;  3DF0 A;  4NRO A;  5ACA 3;  1RUE 3;  3FFQ A;  3CL1 A;  3WHT A;  4DIN B;  1AR8 3;  1R09 2;  1VBC 2;  4CUA A;  3WDX A;  3WLU A;  3SLI A;  4Q4Y 3;  5I0T A;  1YJL A;  2K9Z A;  4Y1Z A;  2C24 A;  1ZZ7 A;  4HG6 B;  1WCU A;  3EYP A;  5FZA A;  2ZEW A;  2Y60 A;  4UOJ A;  1C28 A;  1LB2 A;  3O12 A;  1Z7S 2;  4OVE A;  1RHI 1;  2W91 A;  2AEN A;  2ZOE B;  4I0A A;  2VUC A;  3LWC A;  3WDT A;  1VRH 2;  5FZI A;  2VTX J;  4WVM A;  3ZFF C;  5JDB A;  4QD2 A;  1W2A X;  4CEY B;  1O8S A;  3VD7 A;  2CGP A;  5LAS A;  5T55 A;  1QDO A;  4MXW B;  1ALY A;  1OI6 A;  1RXG A;  2L9L A;  4XAE A;  3NST A;  2BWA A;  4X6R B;  3O1V A;  2C0Z A;  3WVJ A;  1PVC 3;  4DXR A;  1CES A;  2VOK A;  5JUV A;  4KBB A;  4CDW C;  4ZHN A;  1PK6 A;  4H7L A;  5FPL A;  4K6B A;  1PO2 2;  5EJZ B;  4GQ7 A;  2VNG A;  4HKL A;  1SCS A;  1AR8 1;  4FPE A;  4R8H A;  2WKK A;  3LQC A;  4LKE A;  4BZ4 A;  3O1O A;  5FYS A;  1BBT 1;  1KDM A;  1QNY A;  2BOJ A;  2VCM A;  1W6M A;  2VQA A;  5C4W C;  1VB4 A;  1IOA A;  3ZSK A;  5JIA A;  3DKQ A;  2AUY A;  4IGQ A;  2YPJ A;  4ATE A;  1AR9 2;  3WW1 A;  4DB5 A;  2RM2 3;  4BB3 A;  1TME 3;  2IVI B;  2DUR A;  4V2W A;  5IVB A;  1XXN A;  3NW4 A;  1ZX5 A;  4RR3 C;  1KFU L;  5FYB A;  2G9G A;  4I0B A;  3IB3 A;  1W8H A;  3VD3 A;  1G86 A;  3WNX A;  4TWT A;  3WW2 A;  5T5P A;  1QXJ A;  2RR1 2;  5FXW A;  3LKJ A;  5GZG A;  2VCC A;  3R05 A;  4RFR B;  1MS4 A;  1I1E A;  4BQ2 A;  3BOD A;  3V0A B;  4RQP B;  1UMZ A;  3WUD A;  4XJ8 A;  3HT2 A;  1WME A;  1J59 A;  5HCA A;  1PIV 2;  4AW7 A;  1ENS A;  1ZRF A;  5CKQ A;  4YVS C;  1GR3 A;  1IQD C;  1OQE A;  4K9S A;  4Q8L A;  3U1X A;  5K7P A;  5A3U A;  1M4W A;  4PIX A;  4YM0 A;  3V64 A;  2QQL A;  3AC0 A;  1QY4 A;  4YGC A;  2WQZ C;  2UWB A;  2OUJ A;  1EPW A;  1RUC 1;  1UYX A;  4XFA A;  5IWF A;  4QU2 A;  2WO7 A;  2YHJ A;  2YYO A;  1HB3 A;  1JU3 A;  4JCK A;  4AEM A;  4XIO A;  5GLZ A;  2Q1F A;  2VMC A;  1ST8 A;  1BLZ A;  1K5M A;  5DG2 A;  4Q8K A;  3MDP A;  2Z69 A;  5FZ9 A;  3VDD B;  4IV3 A;  4CP0 A;  3LDR A;  4DRV A;  4N9I A;  5EPA A;  5A80 A;  5FLI A;  3LA3 A;  3VZJ A;  1DDL A;  3BU7 A;  2JWP A;  5F32 A;  3C8X A;  3WQ1 A;  4YG0 A;  5IVF A;  1BJQ A;  4YZ3 A;  2ILM A;  3KCX A;  4WM8 A;  1SDD B;  5BNP A;  5D2A A;  1JZ4 A;  1AX1 A;  1DGL A;  1OOP C;  2HYK A;  1C3H A;  4ONU A;  5FZE A;  4ES8 A;  4Z07 A;  3BTY A;  4CDQ C;  1H6Y A;  1S1A A;  2SLI A;  3JU9 A;  3OY8 A;  4MGY E;  5JR2 A;  4XZP A;  5LCW L;  5DPN A;  4HZF A;  2VXR A;  4WZC A;  1MZE A;  5FMD A;  5CVR A;  4AL9 A;  4ZS2 A;  5BNN B;  3AM2 A;  2RHP A;  3BPS A;  4OHV A;  1W8U A;  1WMF A;  2CV6 A;  5F3E A;  3ZDV A;  2VU9 A;  2MEV 2;  5C3S A;  1WLC A;  2JB4 A;  3FUQ A;  3GM8 A;  4XUP A;  4AVS A;  4EN6 B;  2VME A;  3FX3 A;  3GHN A;  3IN9 A;  1LHN A;  4O65 A;  5DZG A;  5FBJ A;  1VBD 2;  2HBU A;  1O4Y A;  3M3C A;  1YI7 A;  5HBA A;  4YVW C;  2ENR A;  2WFF 1;  4N43 C;  1H30 A;  2QVS B;  5FZ0 A;  4XJ9 A;  5FPU A;  1S0B A;  4N53 B;  2ZGT A;  5EYY A;  4CU8 A;  4Q4V 1;  2HWD 1;  4K1Y A;  2TNF A;  2W1Q A;  3T30 A;  3ZYF A;  4BLJ A;  1ENR A;  3TRS B;  1PHM A;  1LR5 A;  4BIO A;  3PUA A;  1JYN A;  1YNA A;  1ZNP A;  2V5D A;  2ATF A;  1WW7 A;  2X5I B;  1DQ4 A;  5DAW A;  2CWM A;  4BQX A;  1DHK B;  5HXV A;  3IBM A;  1DYK A;  3P3N A;  2YGM A;  3IMN A;  3CHX A;  4MV2 A;  2ES3 A;  3VBR B;  3K51 A;  4UW6 A;  3ZMO A;  3ZN6 B;  1BMV 2;  3NAP C;  1BXH A;  2XJU A;  5FZ7 A;  5BNO B;  4B1M A;  5C3Q A;  5M0T A;  4OI0 A;  2R6Q A;  2WO2 A;  2EVX A;  4XHB A;  1SQ4 A;  4EJR A;  4MGQ A;  1COV 2;  1SFN A;  1MS8 A;  4YM1 A;  1UXZ A;  3D4K A;  4P9I A;  3RVH A;  5FQ0 A;  3SNM A;  4CEW B;  1D4V B;  4M0N A;  2QDN A;  3KF5 A;  2WZR 2;  4CCK A;  1WW5 A;  4CDW A;  1DZT A;  1YUD A;  5FLH A;  1D0G A;  5B4X A;  4GMP 0;  4MET A;  2JJ6 A;  2CGO A;  4K3U A;  1SBE A;  2BGO A;  5A3M A;  4LBQ B;  2DF7 A;  2GH8 A;  4DEV A;  3INA A;  1W9F A;  1OVS A;  3VLB B;  4DUX A;  4S2H A;  5FYT A;  5GLU A;  4WM7 B;  3B02 A;  4QX3 A;  4R4Z A;  5JMO A;  1DQ2 A;  1UY2 A;  3H3U A;  4LBQ A;  4Y1Y A;  1W8N A;  2FCU A;  3LDK A;  5JPM B;  1NOV A;  4LO5 B;  5FJK A;  4HBN A;  1IPS A;  4H55 A;  4XMI A;  2VZV A;  4KI5 M;  5FYV A;  1W0P A;  4RN5 A;  2A3Y A;  3W5M A;  1GZW A;  1UOF A;  1LOG A;  2EF6 A;  1JYI A;  3PTY A;  5F3C A;  5DN2 A;  3LA2 A;  2WT1 A;  4NAO A;  5I93 A;  2YGL A;  4Q4V 2;  5CZK A;  4NIG A;  1ZVF A;  2NMN A;  3GBF A;  2DCJ A;  4RGG A;  3ZYG A;  1HXS 3;  3P5B A;  3U4S A;  4NUB A;  2C9A A;  3CJI B;  1LKN A;  2Y34 A;  4CDX A;  1T6G C;  3HN3 A;  3JUU A;  2ZGN A;  1I3H A;  4DEQ A;  4RHV 1;  5L7O A;  3ST7 A;  3VZM A;  1SPP A;  2KM2 A;  1X8E A;  2R07 2;  4URT A;  4BLI A;  3N35 A;  4C0B A;  5KC6 A;  2PLV 3;  3KGL A;  2RDN A;  4BQ1 A;  2HWE 2;  2J1E A;  4N9H A;  1REE A;  2ID4 A;  4QXB A;  1OA4 A;  1H4H A;  4C1W A;  2EA7 A;  5F39 A;  4FPO B;  1WA6 X;  1AR8 2;  1V6N A;  3D8C A;  2CHH A;  1J83 A;  3OY8 B;  1YFY A;  3IM0 A;  1UNB A;  1GQP A;  5A33 A;  3UT0 A;  3VHN A;  4BMB A;  2BNN A;  4CU9 A;  1AXY A;  2DVG A;  3KMH A;  4HON A;  4Y5Z 0;  3HNB M;  3RZG A;  3WG4 A;  5A7O A;  3S30 A;  5GZD A;  5LRR A;  2H0B A;  4LKD A;  2R1D A;  3I4I A;  2GC3 A;  5FK8 A;  5FY9 A;  3ZXA C;  3IPV B;  4A45 A;  1G6N A;  4QT6 A;  5BY5 A;  1QMJ A;  4Y5T A;  5FZ4 A;  1X9P A;  4I3P A;  2VGD A;  4AEJ A;  4CPB D;  5FYU A;  4KU7 A;  2X29 A;  4PJY A;  4BE3 A;  4EV0 A;  1AR9 3;  5IFP A;  2JDK A;  5D8A C;  2W1S A;  5IFT A;  2BV4 A;  2BEO A;  3CNA A;  1AX2 A;  4SBV A;  5GM0 A;  2ARA A;  3PIJ A;  3WDV A;  1FPN 1;  3TN9 1;  1W28 A;  5A32 A;  4PIY A;  3JCI A;  3RPQ A;  2J1S A;  2IUW A;  3K4Z A;  4EN9 B;  1OSG A;  3AMH A;  1VBA 1;  1W6Q B;  1UWW A;  4BK5 A;  2E51 A;  1QJX 1;  2WL1 A;  4LUL A;  5FZL A;  3O1R A;  1FOD 2;  3T2T A;  1W3X A;  2TBV A;  2VZU A;  1A8D A;  1GFF 2;  3LSE A;  4LHN A;  1E5S A;  1QH6 A;  1OF3 A;  4MGS A;  2P34 A;  2VBP A;  3CKH A;  2D97 A;  2E26 A;  3FE5 A;  4JHT A;  1EV1 2;  4UFK A;  4G4F A;  5FYH A;  4W8J A;  2ETE A;  1UOG A;  1JN2 P;  2Z2S B;  3ECQ A;  1UU4 A;  3FHA A;  3RYR A;  4CDU B;  3THP A;  1Y3T A;  1RUH 1;  4BU2 A;  1LHU A;  1ONA A;  4W6Y A;  2RR1 3;  1AL2 3;  1XQN A;  3HEI A;  4PI2 A;  4CXY A;  3RZL A;  1UOB A;  4U2A A;  4F3J A;  3P6B A;  2DWR A;  3TEX A;  1UY3 A;  2RS5 1;  4D7S A;  4LEJ A;  4LOR A;  4QU1 A;  2X10 A;  2YC4 A;  3HQX A;  1GKB A;  1HDK A;  3MHZ A;  2WN2 A;  2LW8 A;  3Q8B A;  4IQP A;  3WQ7 A;  4C90 A;  2Y6G A;  2YU2 A;  1UOJ A;  1A34 A;  5FJH A;  2ARE A;  1F2N A;  4K1Z A;  4YZ4 A;  4I09 A;  4W50 A;  3ZM8 A;  1PGL 1;  4GAZ A;  4XUT A;  4E8D A;  2YXS A;  3KT1 A;  4Q4W 1;  3TNQ A;  3SHR A;  4QAW A;  1ODN A;  1S0I A;  4XOG A;  5FPZ A;  1OLM A;  2BU9 A;  5DDJ 3;  5J3U A;  3WX5 A;  5FPV A;  2VM9 A;  3K4D A;  3NJZ A;  4AFD A;  4AE2 A;  5K0U B;  4IW3 A;  3S7I A;  1OOP A;  4AQ6 A;  2WNV B;  4W6W A;  1HQL A;  2MEV 3;  3B7M A;  4AI3 A;  1UKG A;  1V70 A;  3VBH C;  2JDP A;  2V4V A;  3GGL A;  3N9Q A;  2ZGK A;  1Q8V A;  5CIS A;  4P9G A;  4K21 A;  3RG0 A;  1CAU B;  4D8M A;  2W3J A;  3VB9 A;  3E1F 1;  1X8M A;  2BDR A;  4IXL A;  1H8T C;  2W5F A;  5F9T A;  2ZAA A;  3AL6 A;  5JZG B;  1XNB A;  4XBL A;  2Q8D A;  1N3O A;  1CAU A;  1MS3 A;  2FHR A;  4JX0 A;  4XVH A;  5A7P A;  3R6S A;  5JSP A;  1SPP B;  4JKM A;  4YGE A;  1WBL A;  4PDW A;  4Y1V A;  2QUO A;  5JZG A;  2N7G A;  2D98 A;  4HSJ A;  1JZ6 A;  2BNO A;  4KU8 A;  2XQX A;  1TMF 3;  4P02 B;  4R52 A;  3PMS A;  3FUO A;  4Q1P A;  5CIR A;  3ZXJ A;  3VKL A;  1MQT B;  4BOW A;  5DUW A;  1RJ8 A;  2Q0A A;  5FZ6 A;  4R9A A;  4Z82 A;  2PFW A;  4PF5 A;  3T1L A;  3VBO C;  2KD7 A;  5ABJ B;  1RUN A;  4AK3 A;  1LEC A;  2R06 1;  4RL7 A;  5EV7 A;  3TEZ A;  1X50 A;  2HWF 1;  1AJO A;  2RDS A;  2ZAH A;  1F4A A;  1ND2 A;  4KG8 A;  2VW0 A;  5JPN B;  2DVF A;  1R09 3;  2LAL A;  2G4I A;  3OUI A;  4Q27 A;  2YC0 A;  3RRD A;  2FDK A;  4LKF A;  4FAH A;  3LF7 A;  2ZKL A;  4Q0P A;  3WD5 A;  4XDO A;  5L7O B;  2FQP A;  3PDQ A;  5ERL A;  4Q4Y 1;  1C57 A;  2JDY A;  5ABJ C;  1MS5 A;  1XNA A;  1UAI A;  2IXJ A;  2VR4 A;  2Y6J A;  4DXS A;  1OLM E;  5FZD A;  2HEW F;  2QZ2 A;  3DYM A;  5CFD A;  4NIA A;  1Q8Q A;  4Y20 A;  1LGC A;  2JKB A;  4NHX A;  1QGL A;  2CY6 A;  1BEV 1;  2P4E A;  1TEI A;  3SIS A;  4Q0V A;  1LGB A;  1ZRI A;  2WII B;  1JOP A;  2HLE A;  2JIC A;  3JD7 1;  5DUX A;  3S57 A;  5I8Y A;  4FP3 A;  1HW5 A;  5GLT A;  1HRV 2;  3OD4 A;  4IV1 B;  2ORX A;  4O9G A;  4XYX A;  3WF1 A;  5FY5 A;  2QQK A;  3KQ4 B;  1ZYB A;  2IXI A;  1F8V A;  1QXP A;  2KR2 A;  2XLF A;  3WF2 A;  1RUF 3;  4AHZ A;  3C7O A;  1NLR A;  2WAO A;  3AZW A;  5FWJ A;  4GB3 1;  1OUR A;  4RD7 A;  4TN7 A;  1X9T A;  1K5J A;  1SLA A;  4HN0 A;  2VOX A;  5ABJ A;  4XE9 A;  4GKX A;  3SXW A;  3C7G A;  3LSD A;  4A3X A;  3RS6 A;  1W6P B;  1G7Y A;  2ZX2 A;  2ZML A;  5J96 B;  1VIW B;  1WWY A;  4Q5O A;  4HFS A;  1DCS A;  1JUH A;  2ZHK A;  1E57 A;  4MLO A;  1UZ0 A;  1CIW A;  4OQ8 A;  1HB2 A;  3LD8 A;  2VJX A;  2HJI A;  4HMZ A;  1US2 A;  3HNY M;  5DAX A;  3VBF A;  2VW1 A;  1FX5 A;  3OYW B;  3AYE A;  2R7E B;  3IAP A;  4LBK A;  2J1A A;  3ES4 A;  4FP2 A;  1O59 A;  3NJX A;  3TWI A;  2V72 A;  2JB8 A;  2WS9 1;  4BM8 A;  3E5U A;  3OUH A;  2VMG A;  4D7T A;  3I8T A;  5FFO C;  4A7K A;  4W6X A;  4LNV A;  3AZV A;  2VMD A;  3IDB B;  2VVF A;  4V1P A;  2IXL A;  2J1T A;  4XFH A;  3RFR A;  5LEK A;  5KHH A;  4S2D A;  3I2D A;  2ZZJ A;  3IAQ A;  4JDM A;  5FZM A;  3WG1 A;  1D0H A;  2FDJ A;  1BKZ A;  1GQH A;  3OD0 A;  4AED C;  2P3Y A;  1RUJ 3;  1H4G A;  2BTV C;  4I0W B;  4XIK A;  4EN7 B;  1LRH A;  1J1L A;  3IDC B;  3O1P A;  3N7K A;  3T4V A;  3ZIW A;  3UK9 A;  1URX A;  4E4S A;  2IXK A;  5A3N A;  3SEE A;  5FOB B;  2I74 A;  2XLA A;  5IJR A;  4AVC A;  1RUH 3;  4FPF A;  4BHP A;  3ZPO A;  3A7Q A;  1QWR A;  2DUP A;  3O7O A;  3RYK A;  1AF9 A;  3VD5 A;  2E63 A;  2A6Z A;  2CAU A;  1HX6 A;  3H1Y A;  1OKO A;  1KS5 A;  2GND A;  2HEY F;  1ZA7 A;  3OTF A;  4NR1 A;  5DAB A;  2UWA A;  3A21 A;  5FUP A;  3ZYH A;  2D7F A;  5FMB A;  3KV6 A;  4KQ7 A;  1PM4 A;  1JS9 A;  5DAP A;  2XOM A;  3ACL A;  1HRI 3;  1LOC A;  4IE0 A;  4XTM A;  1YEW A;  3KV4 A;  3OEB A;  1LOD A;  1NG0 A;  1YJK A;  5C3O A;  5IW0 A;  4XJU A;  4KGQ A;  4ZZ5 A;  1IKQ A;  4B3N A;  5KXE A;  3VKO A;  2W46 A;  1IPK A;  2P1B A;  2NMO A;  4DOU A;  1GMM A;  4YVS B;  5FP9 A;  3PUQ A;  1J3R A;  4LBO A;  4YW7 A;  4CU6 A;  3RYP A;  4XJW A;  1QJE A;  1W8F A;  2VVE A;  3PTR B;  4BME A;  3GBW A;  3OSD A;  1COV 1;  1H8V A;  5CKM A;  3AVR A;  3NNL A;  1MZ6 A;  1ASJ 1;  5KC5 A;  3ABZ A;  4FQZ A;  5JXH A;  2PQQ A;  1RUJ 1;  1W6N A;  5FRE A;  4XDQ A;  3OBR A;  1JZ5 A;  2XLG A;  5T5L A;  1FV2 A;  1CPM A;  1QOS A;  3MW4 A;  4M01 A;  1FOD 3;  3ZMN A;  4CCM A;  4Z2A A;  5FYZ A;  1XRU A;  2IFR A;  3DGT A;  1HJG A;  1U5X A;  1SDW A;  3HVD A;  2JIG A;  1UY4 A;  1SLC A;  3POY A;  3WT3 A;  3K2O A;  5CEH A;  2XR4 A;  3WW4 A;  3OG2 A;  5TSW A;  1EY2 A;  4KBZ A;  2FDG A;  3AMM A;  3SMH A;  4ERO A;  1N1Y A;  2A6W A;  4NIH A;  2JEN A;  1MZF A;  4XUQ A;  3E6C C;  5DDJ 2;  3UKV A;  3AZX A;  1H9P A;  1VAL A;  1LOF C;  2RJK A;  1K12 A;  1RHI 2;  4GWI A;  4IEY A;  4KMQ A;  1JYW A;  2UU8 A;  4MUV A;  4Z1V A;  1H9W A;  1Q56 A;  1H8T A;  1CD3 G;  3ETQ A;  4RSU A;  3U78 A;  4X6Q B;  5LY1 A;  2MEV 1;  2QQU A;  3B01 A;  4CP9 A;  3WF0 A;  1IG0 A;  1SG3 A;  1N1V A;  2D6K A;  3VN4 A;  4D6Q A;  2ZGP A;  3UGH A;  4N53 A;  1MAC A;  4FXG B;  5F2W A;  1MEC 2;  4EWD A;  4DUW A;  1T6B X;  5DDJ 1;  1G9D A;  4H3W A;  1F5F A;  3WP3 A;  3NKG A;  4RS5 C;  4OZO A;  5HCH A;  5JOZ A;  1FMD 1;  1D4M 3;  2WDB A;  1QQP 2;  3VDB A;  3KM5 A;  2J1R A;  4GJY A;  2WC2 A;  2ZGS A;  1NZI A;  3M7A A;  4CPB A;  5FYM A;  5J7M A;  4MAD A;  1O6U A;  4HK9 A;  2V09 A;  5KR7 A;  3BI3 A;  1VBE 1;  3N4M A;  2JE8 A;  4FPJ A;  4TYS A;  2JDN A;  5C9A A;  1A6C A;  2VZT A;  1YYN A;  2PAM A;  1V9U 1;  1MQT C;  2LRO A;  4ASL A;  5T5J A;  3ZFE C;  1S0E A;  2XHK A;  3M1H A;  3NJV A;  3SCH A;  2XDV A;  3UGF A;  1BBT 3;  5LAT A;  3O1T A;  2VUL A;  5FPA A;  4P9X A;  2XWJ B;  5C4W A;  3THD A;  3ZR5 A;  1DQ5 A;  2HWE 1;  4HSL A;  3WUC A;  2CYF A;  4XZU G;  3EB7 A;  1H8T B;  4LIT A;  1RXF A;  1NYW A;  3G6J B;  3OBA A;  4AHY A;  5LRS A;  1ZRR A;  2UYB A;  3FL7 A;  3WQ0 A;  5KHI A;  3E6D A;  2C1F A;  2E7T A;  3OGG A;  2WNV A;  2E7A A;  1GNZ A;  3RZJ A;  3GZE A;  1SFY A;  2VH9 A;  1SHW B;  2GU9 A;  4GWN A;  4CEY A;  4QPG A;  5FO9 B;  1JOD A;  4Q1R A;  3UV9 A;  3W5N A;  1G8W A;  4LO6 B;  4CUC A;  3ILF A;  5EYX A;  2QZ3 A;  1WW4 A;  2DVD A;  1ZZ6 A;  1GZW B;  3H0O A;  3ITQ A;  4LR4 A;  4MXV A;  3AZZ A;  5FMC A;  1R1A 2;  1I5P A;  4JGZ A;  4PQ9 A;  2FDI A;  1Y43 B;  5EXO A;  1XSQ A;  1JHJ A;  1AR9 1;  1C5H A;  1POV 1;  5FKC A;  4EWE A;  4YM3 A;  1K42 A;  3LEG A;  1DP0 A;  1KXG A;  2J1U A;  4JGZ B;  1W6M B;  3PJY A;  4NVP A;  4D94 A;  3MZH A;  1FMD 3;  1AYM 2;  1P8J A;  3CDZ B;  3CJI A;  1PVX A;  1W0O A;  5DG1 A;  2GH2 A;  1KEX A;  4HAN A;  1LEN A;  3VBU A;  3VD4 A;  2FCV A;  4FOV A;  3MIB A;  1UZV A;  4XAC A;  1VJ2 A;  2XVL A;  1PO2 1; 
#chains in the Genus database with same CATH homology
 4DO0 A;  5FY4 A;  5FZK A;  5FYZ A;  4D6R A;  3RVH A;  5IVY A;  4V2W A;  5IVB A;  2VD7 A;  4QX7 A;  5F37 A;  4LXL A;  3K2O A;  5FP4 A;  5FYB A;  5A7N A;  5CEH A;  4CCK A;  4QWN A;  4QXC A;  4QU1 A;  5LY2 A;  5F5I A;  5FXW A;  4AI9 A;  5FWE A;  3OPT A;  2YU2 A;  3LD8 A;  4XDP A;  5FYT A;  5FJH A;  5A1L A;  2GP5 A;  5FP3 A;  3UYJ A;  4LIV A;  4GAZ A;  5E6H A;  5F3G A;  5FJK A;  5A3W A;  3K3N A;  3U78 A;  2WWJ A;  5F2S A;  4BXF A;  3KVA A;  5LY1 A;  4DIQ A;  4IGP A;  5FZF A;  5FYV A;  5ANQ A;  5A7S A;  2XXZ A;  3N9N A;  5FPV A;  2PXJ A;  5F3C A;  5FY0 A;  4D6Q A;  5FYI A;  5FXX A;  5IWF A;  5A3P A;  3KVB A;  3PUS A;  3LDB A;  4Y4R A;  5F2W A;  5FY8 A;  4CCN A;  4E4H A;  5IVC A;  2W2I A;  2OQ7 A;  5FZM A;  3N9Q A;  3DXT A;  3U4S A;  4Y33 A;  5FUN A;  4NUB A;  2OQ6 A;  4GJY A;  5F3I A;  5FZ9 A;  5A7W A;  4BU2 A;  4EZH A;  4BIS A;  5FYM A;  2XUE A;  3AL6 A;  5A7Q A;  2Q8D A;  3DXU A;  4TN7 A;  5A80 A;  5KR7 A;  5A7P A;  5F32 A;  5F5C A;  4EYU A;  5A3T A;  4CUG A;  5IVF A;  5FZ8 A;  2Q8E A;  3ZLI A;  2GP3 A;  2YBK A;  5FZE A;  2YBS A;  5FV3 A;  4CCL A;  4QXB A;  4CCJ A;  5A3N A;  4Y3O A;  2XDV A;  5F39 A;  3ZPO A;  5FPA A;  2YBP A;  3N9L A;  5F5A A;  5FZ6 A;  2Q8C A;  4CSW A;  5FZC A;  4AAP A;  2YU1 A;  4HON A;  5F3E A;  5FP7 A;  5FZ3 A;  2XML A;  4UF0 B;  5FUP A;  5FBJ A;  4LIT A;  2OT7 A;  5A7O A;  3KV6 A;  5FY9 A;  5FZ1 A;  3PU3 A;  4UF0 A;  4EZ4 A;  3KV4 A;  5ISL A;  2OX0 A;  5A1F A;  3PU8 A;  5FYC A;  3K3O A;  3N9O A;  5FZ4 A;  5IVE A;  5IW0 A;  5FZ0 A;  5FZA A;  5FYU A;  5A7W B;  5IVV A;  4XDO A;  5FY7 A;  5FPU A;  3OPW A;  3PDQ A;  3PUR A;  4QX8 A;  5K4L A;  4HOO A;  4CCO A;  4URA A;  1VRB A;  2YPD A;  5FZI A;  2P5B A;  4C8D A;  5FZD A;  3NJY A;  3N9M A;  5FP9 A;  4V2V A;  3PUA A;  3PUQ A;  3AVS A;  2WWU A;  5FZH A;  3PTR B;  4GJZ A;  3KV9 A;  3AL5 A;  4IGO A;  4QXH A;  5FZL A;  5FXZ A;  5FPL A;  5FZO A;  5IVJ A;  4ASK A;  3AVR A;  5LWB A;  5FY1 A;  5FZG A;  3N9P A;  2OS2 A;  4GD4 A;  3KV5 A;  5FY5 A;  5FZB A;  5FYY A;  5FZO B;  4CCM A;  5FPB A;  5FYS A;  5FYH A;  4D6S A;  5FZ7 A;  5LW9 A;  5FXV A;  4LIU A;  5FP8 A;  5FWJ A;  4IGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...