5FZIA

Crystal structure of the catalytic domain of human jarid1b in complex with mc3095
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
462
structure length
461
Chain Sequence
b'SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKLGGGGARDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDGIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with Mc3095
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 147
structure length 461
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fziA01
5FP3A 4BXFA 4HONA 4QXBA 5FZGA 2GP3A 4Y4RA 5FXXA 5FXZA 5A3NA 5FUPA 4CCKA 5FZBA 4DIQA 4AI9A 4CCLA 2OQ7A 5FUNA 4IGPA 5LWBA 4EZ4A 5KR7A 5FP9A 4UF0A 4URAA 2Q8CA 5FJHA 5A3TA 2Q8DA 4IGQA 5FYZA 4QX8A 5FZ3A 5FPBA 5FPVA 5A1FA 5IVVA 5LW9A 5F3EA 4UF0B 5FZCA 4QXCA 4D6RA 4XDPA 3LDBA 3N9PA 5FBJA 5FP8A 2VD7A 3PUQA 2OT7A 5IVJA 2YU2A 4AAPA 5A7QA 4C8DA 5E6HA 4EYUA 5F37A 5FZ0A 5FYMA 5F39A 5F3IA 5FYCA 5F2WA 5LY2A 4IGOA 5FJKA 4ASKA 4LIVA 3KV5A 4Y33A 5F2SA 2P5BA 5FZ8A 3AVSA 2YU1A 1VRBA 5FY9A 3DXUA 4CCJA 3PURA 5FZ9A 4GAZA 5IVBA 2YBKA 3UYJA 5FYSA 5FZ4A 5FYIA 5FYBA 4BISA 4QWNA 2PXJA 5FP7A 3U4SA 4CCOA 5FZIA 3K3NA 4Y3OA 5FYUA 5FZAA 4DO0A 2OS2A 5FZ7A 5F5AA 3OPWA 5IWFA 4LITA 4V2WA 3U78A 3KV4A 4CUGA 4QU1A 5FZFA 5FWJA 5ANQA 3N9NA 5F5IA 5FYVA 5IW0A 2XXZA 5FY5A 5FY7A 4QXHA 5FY0A 5A7NA 4BU2A 4CSWA 3N9LA 5IVFA 5A7WB 3AVRA 5FPLA 2XMLA 3K2OA 2OQ6A 3NJYA 4XDOA 4D6QA 5FZHA 3DXTA 4CCNA 5F32A 3KVAA 5FYYA 3ZLIA 4D6SA 3PDQA 2YBPA 2YPDA 5FP4A 4NUBA 4E4HA 2WWUA 5A80A 4EZHA 4LXLA 5FPAA 3PU8A 4GJYA 5FZ1A 5FZMA 3N9OA 4V2VA 3PTRB 2XDVA 3ZPOA 5F3GA 5K4LA 2XUEA 3AL6A 5A7WA 3N9MA 5LY1A 3KV6A 5FZOA 5A7OA 4TN7A 3LD8A 4GJZA 5A3WA 5FPUA 3K3OA 5FYHA 5FV3A 5F5CA 5FZOB 4GD4A 5FY8A 5FZLA 5A1LA 3PUAA 3AL5A 5IVEA 5A3PA 5FY1A 3N9QA 4CCMA 5FWEA 4HOOA 2Q8EA 4QX7A 5FZKA 5CEHA 5IVCA 4LIUA 3KVBA 5FXVA 5F3CA 5IVYA 2OX0A 5FY4A 2WWJA 5A7SA 5FXWA 3KV9A 3PUSA 5FZ6A 5A7PA 5ISLA 5FYTA 5FZDA 3OPTA 5FZEA 3PU3A 2W2IA 3RVHA 2YBSA 2GP5A
chains in the Genus database with same CATH superfamily
1NY71 1RMU3 4FPOB 5FZGA 3DCQA 2ZGOA 1LCLA 2R062 3VBRC 2FDHA 1HX6A 3J8F1 4CCLA 2R49A 3C7EA 4AI3A 4YZ2A 2XKOA 1OQDA 4JKLA 5FBZA 5EPAA 3URFA 5JUVA 2L9LA 3AZWA 2HKXA 2VCMA 3VZLA 2G4IA 4IGQA 5FZ3A 4QX8A 1HXS1 2FCUA 3I59A 2XGXA 4KQ7A 1NA1C 3WW1A 4Z2WA 4QMAA 3VBFC 3CJIA 5F37A 2QQKA 5A6YA 4QHBA 5FZ0A 4BB3A 2WAOA 1PNGA 2X05A 3RZKA 1LENA 1NKGA 3VBRA 1RMU1 4A45A 3MIDA 3ZXAC 2VTFA 1W2OA 4Q4V3 1ZVFA 4FPCA 1NX9A 1GU3A 4UFHA 2ZAHA 1UU5A 3DPRC 4NO4A 4RR3B 3N35A 3NKGA 1POV0 3SITA 3WW2A 5IYYA 1W6PB 5E89A 1ZA4A 3GNEA 2RJLA 1OVPA 2Q30A 2VR4A 3HNYM 3I3BA 3LSDA 4P9YA 5BNOC 3VBFA 2LTNA 3IPVB 3RFRA 4MGIE 4AGGA 3W21A 3P5BA 3R4UA 5T52A 5FKBA 2CYFA 3WDWA 1B35C 5FO9B 4DXTA 5JXIA 4LBMA 1CIWA 2HWF2 5A7WB 4JDMA 4ZZ8A 2WWSA 2P6HA 2JDUA 2K9ZA 1BEV3 3K2OA 4BCUA 4CXWA 4Q4V1 3WSOA 5F32A 5FYYA 1AJKA 4JRLA 1W90A 3LOIA 1EUUA 1U12A 4Y22B 4CDXC 1LEDA 1FATA 3WVJA 1C1LA 1Y9MA 2EAKA 2XDVA 3I4IA 3WHUA 3RZHA 4L11A 5JZGA 3WXPA 1VMFA 1ND3A 1O4YA 4XFCA 1B35A 1HRI3 1MS0A 2RM23 5AVPA 5GJ6A 3ZXEA 3KB5A 5J37A 1RL3A 3HNMA 4DQAA 4TN7A 3RJRA 4FPEA 1KJLA 4GWMA 2PHWA 4LBJA 5FYHA 3CEWA 3RWKX 4C91A 4HZFA 4QPIC 2ES3A 5L9BA 1S2EA 1BEV1 3NNFA 3T30A 2ZGKA 4AI1A 4B4QA 2XOMA 4RHV2 1UOGA 2PTMA 2CV6A 4OHZA 2GZWA 1PO12 1ZZ7A 4X6RB 5C7GA 5IVEA 1CVNA 3LB9A 1V0AA 3N9QA 2WJSA 1UO9A 4CDXA 1SACA 4XFBA 1UWWA 2VBBA 2ZMLA 3HPNA 3IDEA 1SFPA 2E51A 3FFZA 4MGZE 4AGRA 2PMWB 2C6SA 1MZEA 3TEWA 2W1WA 2PHDA 3KV9A 1HRI1 2RM21 1TMF3 4FT8A 1GICA 2GNMA 1RVF3 3I2IA 1OA3A 4B1LA 1J1TA 1OPOA 1X33A 1X9PA 2IFRA 4ARYA 5A6QA 4KBZA 3PU3A 4ORFA 4DNYA 2OZ6A 2O8QA 2HEWF 2WINB 1GUIA 5C3QA 4KL1A 4B4RA 1W8TA 3RG0A 4FPLA 4N53B 4CU6A 5APAA 3FL7A 3T0DA 2YUEA 4PIZA 5FZBA 3M2MA 4Q29A 4OHYA 1C5IA 5HCAA 1AXZA 4EZ4A 1BMV2 2D97A 1ZYBA 3ZPYA 3ABZA 4Q0SA 4F3JA 2ZEXA 4Q4W2 4Q4X2 4BYYA 3OB8A 2Q8DA 1RUI3 3BGAA 5DUXA 4CCCA 2VNGA 5F3EA 1ZBA2 4BWOA 3WQ1A 4XDPA 5FBJA 2VD7A 1TMF1 2BNNA 3MUY1 1RVF1 4D8MA 3EBRA 2AUYA 2AC1A 5F2WA 1OF4A 1AR92 1UY4A 4H55A 5B2GB 1OT5A 3QH6A 3S57A 1DF0A 2P5BA 2VZPA 1YIPA 3O0WA 4XBQA 5CBLA 2WQZC 3O1VA 4YGDA 2XWBB 2VZ3A 3AJZA 4M4RA 1AR73 1ZZCA 3LA2A 1CPNA 3MFCA 4LK7A 1GQPA 4MZUA 5EHDA 3ZN6A 5CFCC 1X8MA 3I2KA 2WZEA 1A8DA 1QJU3 5H9PA 4CP0A 1A3KA 4Y3OA 3VBOC 2J1AA 1RUI1 1N1YA 4XCAA 5F7UA 4Z92B 5BPXA 1NCRC 1OLQA 2ZEZA 2Z5WA 3OPWA 4IEOA 1LU1A 4L0PA 4YGBA 4COUA 4V2WA 5ACA3 5IATA 1UMZA 1H6YA 2ZX0A 3IAPA 2ID4A 2WZR3 1F4HA 3MO4A 5CISA 4BU2A 3LAGA 3O1PA 1JS9A 1XNTA 3IN9A 4DMIA 1CONA 1SFYA 3WQBA 5DPNA 4FAGA 2CAVA 1GKBA 1ND2A 4DRRA 2OQ6A 3E6CC 1MVQA 2BQPA 2XONA 4JKKA 2WDBA 4QQ2A 1AR71 1R1ZA 4HPKB 2D40A 3HQRA 1G8WA 5DZFA 2JE9A 2BEOA 3APBA 3CLPA 4WVZA 1QJU1 2VCCA 1NCRA 2G9GA 4FO9A 1GWMA 2VCBA 2XJUA 3FBMA 3N9OA 1UAIA 3H8UA 1C3HA 2CDOA 2RE9A 2W0XA 1FXZA 3HQUA 3N7MA 5GLUA 3ZPOA 5ACA1 3FHQA 1W6NB 3VKFC 1G9AA 5K4LA 3WF4A 2WZR1 4JQTA 1CX1A 2ADDA 4OFGA 3IKWA 2E6VA 1NY72 3LD8A 5A7OA 3LIGA 1IG3A 2X5IB 3J8F2 3VKOA 5E16A 2Y26A 2WQ8A 3CNAA 4DFSA 2WIIB 3E97A 2C5DA 5C5UA 2RS13 4AVAA 4CP9B 5A3PA 4DUWA 5T3NA 2QKDA 1SBEA 1HXS2 1XE0A 3HT1A 4HOOA 4UFMA 1PNFA 1JN2P 3O1RA 2ZJCA 4O9GA 4IUGA 5IVYA 3IDAA 4QAWA 5C8CC 2ZMKA 1HB2A 1LOAA 1H1MA 3DKWA 3DYOA 3ZYHA 4IEZA 3SC7X 2ZHKA 4YW3A 3GGLA 5FZ6A 4E8CA 2W1SA 4BLIA 1RMU2 1XNKA 5LRRA 3ZYBA 2LW8A 4XTPA 1E57A 2A6XA 5LCWL 2B4KA 5F6LB 1KEXA 2BGCA 3FLTA 4PIXA 4AEMA 3RMYA 3O14A 4AQ2A 2ZHNA 4BJ0A 2Q5TA 2LM3A 1R083 2RS11 3WNLA 2WRAA 2YC2A 3TOJA 4E8DA 2ZX3A 2WO3A 5LWBA 3V0BA 2RVAA 1WLTA 2P6CA 4XF9A 2VH9A 4RQPB 5FLJA 5T5LA 3INAA 3VHPA 2RR13 2A3WA 3PVNA 2AR6A 2WO2A 3T0AA 2WFPA 2W39A 2Z69A 2BTVC 4MX3A 1MPXA 2VZOA 1UZZA 4N90A 5LBEA 1H4HA 2R1DA 4C0BA 5LA2A 3M3QA 3AP7A 1MQTB 5ABJB 1RB8G 3POBA 3RZMA 2DBIA 3WY6A 4PF5A 4XJWA 4ASKA 5D8AA 5HV0A 3RZGA 4JDOA 1EUTA 4Q4V2 4FPJA 1TEIA 2KM2A 3I2HA 3VHOA 4ISRA 4J1XA 1SPPB 1I5ZA 5T50A 3SH5A 1YJLA 1H2NA 1VMJA 1R081 2IC1A 1W06A 2O1QA 4QX3A 4YVWB 3WP3A 2YBKA 4RR3C 1JZ4A 4LBNA 1OXCA 3O0VA 3RNSA 4QWNA 2PXJA 5LK7B 1HN1A 2RR11 1H6XA 3VBHB 3K3NA 3H3ZA 4FQ4A 1GYKA 5FZAA 1ZRDA 5FZ7A 4M3CF 2YXSA 5JR7B 1H1AA 5SV8A 4CCEA 2QZ2A 3GZEA 1UX6A 5LBBA 1C8NA 2XG3A 4WVVA 4XUQA 2QQJA 5T54A 4CUGA 4DUXA 1O8SA 2VOTA 2PHFA 1DYKA 3M3OA 2DFCA 4HANA 1BEV2 3AB0A 2E32A 1ODMA 4E2GA 1Y4WA 3GBGA 4CP2A 3T09A 4ZXKA 5E8AA 3K51A 3FE5A 5JPMB 4R9AA 2GU9A 3I3DA 1RJ7A 4CP1A 3R05A 1O91A 5FZHA 2HWD3 1FNZA 1CAWB 4XE9A 1K3IA 3UKNA 1C57A 4LO8A 3RMXA 2PHXA 2YPDA 4LXLA 2WR9A 4W65A 5FPAA 1W3VA 2VOVA 3U75A 2DVGA 2JKXA 1HRI2 2RM22 3IPVA 2DVDA 3NQHA 3QACA 1PHMA 5FFOC 4IV3B 4WZCA 5BNNA 3Q8FA 1ULDA 3HIFA 4FP2A 1KFUL 2PLV3 1G9BA 2J1VA 5A7WA 3N9MA 4GMP0 1CAXB 1UYXA 2D43A 2V09A 3I7DA 2EAAA 4XMIA 3VZKA 2XLAA 1NOVA 5C3PA 3I2GA 2YROA 5FZOB 2CGNA 2VQUA 5IFPA 4QB2A 2IXHA 2XR4A 1GNZA 3HBKA 4M0HA 1CJPA 1UZWA 3POFA 2HWD1 3CJXA 3LIHA 5EJZB 4ZXEA 2CHHA 1JYVA 4GWJA 4Y22A 1F5JA 4ES8A 4K21A 2A6WA 3ZN4A 1UPIA 1K5JA 3D4KA 2D5FA 3NO8A 1WCDJ 1NAEA 4PQQA 3I3MA 1TMF2 1RVF2 3VD4A 2OX0A 2XJQA 2FDJA 2KR2A 5FXWA 1F9KA 2N7GA 2PLV1 2UYAA 2WN3A 4TSVA 1QHDA 1PMHX 1N3QA 4AYUA 1EAH3 1OPMA 5FZDA 5FZEA 5AVAA 3TEYA 4IQPA 1UD1A 2Y6HA 2A73B 3ZN5A 2WKKA 1NLQA 3FUOA 3I97A 3T1MA 4DB5A 3VZMA 3PVEA 1O4TA 3WQ7A 1RUI2 2VMCA 5IK4A 3IIIA 1NXMA 2VMIA 3OF1A 3BOWA 4QPGB 1UZVA 3SEEA 5KXBA 1VAKA 1A8MA 2XUMA 1GMMA 4LR4A 2XJPA 4D7TA 3NAPB 1EAH1 3NRUA 4FFGA 4KWJA 3WOGA 2VW1A 3I59B 4K9SA 3H8OA 3WG1A 5BV6A 2WFF3 4ZU7A 3AYDA 2WT0A 2GNDA 1WW6A 3H50A 3CJIB 1AR63 3MICA 4N53A 5H9QA 2V4VA 3GBWA 1HB4A 3Q8BA 1W8WA 1QJZA 4LT5A 2TEPA 1AR72 5GZFA 4LTAA 5FZ9A 1RINA 1UU6A 4BZ4A 4RYDA 1OFSA 1QJU2 2W91A 1FYUA 2OW4A 2WNOA 4WVMB 1SFNA 1ONAA 1Y9QA 2D6NA 2RHPA 2V5YA 4Q1RA 5ACA2 4CDQA 2WS93 2I07B 1Z78A 5FMOL 2WZR2 1AL0G 1REDA 3F2ZA 4HVQA 3JB8A 1DGRN 3KV4A 4A3ZA 1JUIA 2ZEWA 3C2UA 5HV4A 3S5AA 2AEZA 1FI2A 1OHFA 5G04L 2WNUA 4B3NA 4UFJA 3RGBA 2WFF1 2E9QA 4FOYA 4RS5B 1IS3A 3AVRA 1AR61 2GALA 2ZKNA 4A7KA 2DTWA 1RIRA 3ZYRA 3ZR6A 1IS6A 1V9U3 4DY5A 2JDYA 2OZJA 1VB4A 4LKEA 1DGRA 2WLPA 3M4FA 4YG3A 2Y38A 3Q8CA 2X10A 2YBPA 2JDAA 2DUPA 3VKMA 3OEAA 4BIFA 5GZCA 3U10A 4FQZA 2WS91 1QJY3 4IE0A 1STMA 1KD7A 1TG7A 3KD4A 3VHNA 4YZ1A 2WYFA 4QPYA 1UW8A 1PGL1 1H2KA 1VBA3 1VE0A 4LA3A 3AYEA 2P34A 4QQOA 1DIWA 1ND3B 1MEC3 2VMDA 2X5IC 1XRUA 1JYNA 1MS8A 1V9U1 2RS12 4QKNA 2J22A 4HPKA 2ZX2A 2EXIA 3NNJA 1RTVA 1TNFA 1W8OA 2LALA 3J7MA 5J7MA 2PHRA 2VVFA 3FZ3A 4INDA 1BVP1 1CAVB 1NE4A 3IAQA 3ACGA 1QJY1 3SKJE 1UYPA 4NHLA 3MW4A 1DLLA 4AI8A 1YQCA 2ZA9A 3PUSA 2D98A 3EMRA 3OGSA 1ULGA 1VBA1 4IERA 3VZJA 1WBLA 1QJFA 2X5IA 4CYDA 1MEC1 1IPSA 4UW4A 2BNOA 3AP4A 1R082 5EWSA 4DOUA 4CP9A 2GP3A 5FXZA 4EN7B 1WMFA 1GP4A 1LESA 1YI9A 3FBYA 2D6OX 4P14A 4XURA 4RSUA 1WUVA 3QD6A 2JDKA 1KS5A 1OQ1A 4RQPC 2VUJA 4DY3A 3L2YA 2JG9B 2IVJA 4GIQA 5IFTA 4LBOA 4KWLA 3UKTA 1JYTA 1LGBA 5CAZA 3PLQA 3WX5A 4YG6A 1LTEA 3POJA 2Y6FA 3AZXA 3J7NA 4NIHA 1NZCA 4TYSA 5IVJA 1DCSA 1S0IA 2P37A 4LE4A 1MQTC 1QQP3 3LPGA 4HSLA 4FPYA 4M00A 5FYMA 4AFBA 5ABJC 4YM3A 4YW5A 1DGLA 4M0NA 1OD3A 2EXJA 1V6IA 3ZXJA 5ABJA 3WNXA 4YVWC 5AFEA 3PVOA 2ZXQA 5LA1A 1I9RA 1AX2A 3RWNA 1DZRA 2VW2A 5FDBA 2GC3A 5CG9A 1UY1A 3R4DB 4RFT0 4PQ9A 3VBHC 5IK5A 1RUF3 4I3PA 4AF9A 3DL3A 1UZ0A 4D7SA 4IV1A 3ZN6B 2Q1MA 1PZ7A 4OHXA 1D2QA 2WQ4A 2RDQA 2RDSA 3ACFA 2ZACA 3VD7A 4META 2A7AA 2B8MA 3MF9A 1QQP1 4LO6B 4UT5A 5FZFA 5FWJA 3MIEA 1O3TA 5FY0A 4FTSA 2VL4A 2ET1A 4ZS3A 4CSWA 1ENSA 2ZOEB 2B46X 2CL2A 2Y0IA 1QOSA 3EJKA 2HWD2 2XH6A 2A3YA 2A6ZA 3UV9A 3CU7A 2WUHA 4A7ZA 3DN7A 4F8AA 3DXTA 1H1IA 4CCNA 5IAVA 4KG0A 1DYOA 4XTMA 1ND2B 3VBHA 3AX4A 1NE6A 2VUAA 2XHNA 2XVKA 3AMHA 1WWYA 1RUF1 4P9IA 3THTA 3ZSKA 4IEYA 5J09A 4GJYA 2PLV2 3NJZA 3O12A 4V2VA 4IV3C 2ATFA 3DV8A 4FXKB 2ARAA 4S2FA 1GZTA 4QM9A 5BNPB 4YW6A 1UIKA 3W20A 1QXRA 4IETA 4AOCA 5HI0A 4HMZA 3I54A 2JXAA 5GALA 2RJ2A 1TQ5A 1GOGA 4OCTA 2GNBA 1CAWA 3CKHA 4A41A 4GD4A 3OYWA 2AACA 5JR2A 3O1TA 3VDDA 2JD4A 3P3NA 4P02B 1JU3A 1KITA 3J7HA 1CQ9A 3MGUA 3WDXA 4DEVA 1NLRA 4GWIA 1LU2A 3MZHA 4MOAA 1UY3A 1AXKA 1GBGA 2RJKA 3L2HA 1U5ZA 4GULA 4JQRA 4YVSB 1YCIA 4COVA 5ANNA 2J1UA 5C9AB 5IK7A 1GZWA 3MV01 2FZ1A 1DBNA 1EAH2 2G9FA 3USUA 4Q1PA 4CEYA 5HBAA 1M06G 1QEXA 1T6GC 5A7PA 5H9SA 1GZ9A 4AHWA 4AVSA 1SLCA 1PZ9A 3RVHA 2LRPA 2E53A 4WM7A 1LULA 1YQ2A 5C3RA 1DQ4A 1JZ6A 4AFMA 5FXXA 5A3NA 2Z4FA 4ARXA 1JYXA 3NKTA 4FVVA 2A75A 5TSWA 2YGLA 1NXD1 3J8F3 2FHRA 1RHI1 2X29A 5I8YA 1XQNA 1ULPA 3QBQA 3WP4A 2C0ZA 4AQSA 5KR7A 1UOJA 1PM4A 4F83A 2WA4A 3HQXA 2BGPA 4YM0A 4AFAA 4AQ6A 3V0BB 5IHRA 1ZRIA 1N3OA 4DZGA 5AC92 1NQDA 5JIAA 1J3PA 3IIAA 4QXCA 3U37A 3GDBA 2WFF2 3NAPC 4AEDA 4G3YC 1QNYA 4BQWA 4C8DA 1X8EA 5J3UA 1AR62 1HDKA 5A3MA 5KWRA 1H0BA 1WLCA 5J1XA 3C7HA 2YV8A 3BTXA 3CJIC 1I6XA 4LIVA 1JHJA 3KV5A 4QXKA 5C3OA 3WNNA 5FZ8A 4I0BA 1ENQA 5HCHA 5D8AB 1WA6X 2ZAAA 2ZGMA 4MADA 1RUE3 4C90A 4WZFA 3THDA 2B39A 1RUG3 1U5IA 2UY8A 4Y24A 3SCFA 3SH4A 2WS92 4GKYA 4QPGA 4MYEA 5FYIA 4JTNA 1QH6A 3ZXGA 1JOPA 2VULA 1CD3G 2XJVA 3AKSA 3MHZA 2PHLA 4KH9A 2J42A 1Q5OA 2JICA 5LBCA 3OEBA 4L97A 5FYUA 1WMDA 2LS6A 4DUVA 4X8PA 3OUHA 5IWFA 5C6CA 1PGW1 3LEIA 2QQOA 2JENA 3IMMA 3NAPA 3GHNA 1PGL2 2CNAA 3P3PA 1ZNPA 1Y7BA 2OPWA 3JQXA 3MPPG 4YSFA 2J7MA 4QDRA 4RS5C 1IQDC 1V9U2 2WA3A 1Q8SA 1W2UA 1W03A 3E6DA 4JCKA 2ARBA 2C4XA 3S7EA 4QGNA 3GXUA 5ERLA 4RGGA 2EALA 3K77A 3A0KA 3R0RA 3IDCB 4WVMA 5JAXA 3I3EA 1RUE1 4XC9A 1RUG1 2ZTNA 1C4RA 3VZOA 2WT1A 2DUQA 3FLPA 3BOPA 4DXZA 1QJY2 4OZOA 4ASMB 2ZGPA 1SHWB 4BLJA 5A1AA 2JX9A 4A7YA 5JMCA 5FZMA 1KS4A 4FOQA 2W68A 2BDRA 1VBA2 4LO4B 4R9CA 5EYYA 2OUJA 1JYCA 4KU8A 3ATGA 4KBBA 4S2DA 1ST8A 1JHNA 1UN1A 4RS5A 1FOD3 1MEC2 1WBFA 1WKYA 3H42B 5JZGC 3TRSB 3CZJA 3K75B 1LNSA 1ND3C 5BNNB 3ZYGA 2VGDA 4Z8BA 5FPUA 1MS3A 4NHYA 3OJBA 4JRAA 1ZBE3 2ZS6B 2VZUA 4KGQA 2JDMA 1C5HA 3EB7A 5A3UA 5A1LA 5GLTA 1SQ4A 3ECQA 3AL5A 1VBC3 1BKZA 1OC1A 2DCZA 2PAMA 1UKRA 4NAOA 4NMIA 4CCMA 5C8WA 2JDZA 4K3UA 5IVCA 4N43B 4AL9A 1ULEA 2J1RA 1W8ZA 1QU0A 2ZX1A 3MLKA 5DZGA 3QH7A 1L7QA 1FOD1 5FQ0B 2V73A 4XZPA 2BV4A 3AMPA 3HBZA 3PHMA 2GP5A 1LHWA 1ZBE1 5T5JA 4CEWA 4DRVA 5FP3A 2UWAA 1UCXA 2IXJA 5DUWA 3QOPA 1H9PA 2C9AA 4DIQA 4P9XA 1YFXA 2OQ7A 1VBC1 5DMYA 2ZCWA 1CAVA 4AI0A 4MLOA 1RUOA 4NE9A 4UF0A 4LEJA 3DF0A 4QHOA 5LATA 1J83A 4URAA 4PLOA 5L9VA 2UURA 1L3JA 5A1FA 5LW9A 1QQP2 4CRQA 3LDKA 1VR3A 3H7JA 4NOTA 4XF1A 5FZCA 3H1YA 4J1WA 3U14A 2LUWA 4JGZB 2YU2A 4ITCA 2GN3A 2QCSB 4LKSA 4RA0A 4XAEA 5DN2A 5T5PA 1QF3A 5FJKA 1LR5A 1QOTA 4Q26A 4MXVA 3MI8A 5IK8A 3OBTA 5F5QA 4R52A 2GNTA 2J1TA 4XQ4A 1VBE3 5I0TA 4TZDA 3POWA 3GJBA 2A3XA 2JG9A 2ZEYA 3J9SA 3T4HB 3OPZA 1RUF2 3LPFA 1PMIA 2DYCA 3BN6A 3UL2A 1IS4A 3DEMA 1WCSA 4ATEA 4PBPA 5F6KA 3NV3A 4A6SA 1GV9A 4I3GA 4TXWA 5JMOA 2DURA 4LITA 4CDQB 5IT6A 3WR0A 1U5XA 2JG8B 2P17A 4WV8A 1ULFA 2UWBA 5F5IA 4AW7A 3D6EA 3MLLA 4OUEA 4UW3A 4E9KA 2VTXJ 2OPKA 3KLSA 4Y1ZA 1ZRFA 2C26A 1J59A 2VPVA 2WNUB 3KZ4C 2VG9A 1DGWX 2DTYA 2ET7A 1BZWA 2BFUL 1K12A 1VBE1 5A32A 1MS5A 3ILNA 4LK6A 2E7TA 1ND2C 3M3IA 4IEXA 3D3AA 3ZLIA 1R1A1 3O1UA 1PK6A 4AG4A 1EY2A 2RDNA 4XEZA 5FP4A 1QNWA 2BBAA 2WWUA 4YWAA 4H14A 4UFIA 2ZX4A 4Y1VA 5BNPC 4LA2A 2VOXA 5LK5A 3U11A 2YYOA 3AKRA 2ZGNA 3V0AA 4UXAA 3JXSA 3PTYA 2FCTA 1FAYA 4YW4A 3B9CA 4BQ5A 1H8TA 2BWAA 1OOPA 2CGOA 4COWA 4I09A 3GHMA 4YZ4A 1G9CA 4K20A 2BW8A 3WUCA 4PLNA 3SH3A 2R073 1ZA7A 1RHI2 3ACHA 4P9WA 2AGSA 2CTVA 1ZRRA 3OBZA 4LQRA 1V6LA 4YPJA 2MNGA 2DU1A 4FSJA 3LEKA 2JIGA 4YVSC 1WW7A 2BYVE 3EYPA 5C9AC 1N1VA 5BNPA 2VQAA 1GP5A 4ATFA 2VMEA 2R7EB 3B9IA 2JIJA 4BQYA 4HK9A 4AGVA 4NVPA 2P4EA 4NRQA 1ACCA 1UZYA 2XVLA 1NT0A 1POQA 5FMDA 4CDUA 1MS1A 2UU8A 5KBFA 1UY2A 3HN3A 4FPGA 4W50A 5EYXA 1HN0A 1US2A 2R071 1FV2A 3ZMNA 4BXFA 1YC61 2QQLA 3GF6A 3MIFA 3VD3A 3WP6A 4QX0A 4O61A 3WUDA 4FAHA 5DG1A 1SBFA 4YVSA 1AF9A 3MUZ1 5C9AA 1NCQA 3HOBA 4NRPA 4FXGB 1PGW2 5L73A 3FHAA 4LUKA 5DQ0A 1Q8PA 3JU9A 2W5FA 1X7NA 2XLFA 1N3PA 2W46A 2BU9A 2CAUA 3H9AA 4CVUA 3VL8A 4D6RA 1K42A 4QU2A 1BK0A 1CJDA 1Q8OA 1X36A 2X53S 5A7QA 1WA4A 3A21A 2ENRA 4K40A 4HSJA 1SDWA 1UMHA 1O3RA 2W1UA 5K0UB 1RUE2 2ZZQA 4FP3A 5JSPA 3ZIWA 1RUG2 2WYSA 2Q1FA 3KT1A 1OA4A 5D8AC 1MVEA 1VRBA 3ENRA 3WNMA 4ES9A 1E5IA 5EQUA 5JVVA 1C8M3 2KXLA 5D1IA 2A5ZA 4JGYB 4LHLA 4BISA 3HEIA 3U4SA 4HXCA 1CR7A 1WMXA 1SG3A 1XNBA 1UXXX 1ZZ9A 4AR2A 3KF5A 4LKFA 1JW6A 2W08A 2GC2A 4IV1B 1LGCA 4QU1A 5I0UA 3MEPA 3ZVXA 4E4SA 5C70A 3UKVA 2R043 5EXOA 4I0AA 3T2OA 4QKDA 1GQHA 3BPSA 3UGHA 4F7ZA 4OHWA 5DUVA 3ALQA 5KC6A 3ILFA 3NJYA 1WMEA 1JU4A 3SLIA 1AX0A 1C8M1 1AR83 2DF7A 1W6QB 3WHTA 4CUAA 4QHZA 4X8NA 1CESA 4D6SA 4D7YA 3BTAA 4OI0A 1SLLA 5K8SA 4BA6A 4NUBA 5DZEA 2D7FA 3X29B 5L19A 4C0HA 4QGLA 1FOD2 3VGIA 2WABA 3B69A 2K0GA 4BQXA 1W2NA 1HQNA 2W1QA 2W52A 3M8LA 4XW3A 4AVVA 2ZGTA 2H6BA 3G7DA 5T5OA 1ZBE2 3NV2A 4UOJA 5BNNC 2R041 4BE3A 2RS53 4GJZA 4K7JA 1W28A 2DDUA 2WN2A 3ROUA 3B5LB 1V00A 3AZYA 4MO3M 3U0ZA 1VBC2 5GLZA 5FCCA 1VIWB 2JJ6A 4I01A 3R6SA 1D4M3 1O4ZA 4Q8LA 5FZLA 3T4VA 2E63A 5A33A 1W6OA 1AR81 2XHKA 3ORJA 2D3RA 2ZZJA 2NMOA 4D3WA 4QX1A 5I93A 5GZGA 3AZVA 1I5PA 1PGSA 1W39A 3OYWB 1KDKA 4OHVA 3USSA 3VDDB 2X09A 4N43C 3MBWA 1QJEA 5CNAA 3THPA 1RUC3 5CEHA 2FMDA 1VAVA 2JB4A 2NM1A 5FXVA 1OQEA 3WNPA 3T2QA 2F6BA 4AFCA 5F3CA 4OYUA 2XB6C 4YYOA 4CU8A 1ZX5A 4Y4YA 3WW4A 3ETPA 4GXLA 1GZWB 1AX1A 2A6YA 4QX5A 5DAXA 4B8EA 3USUB 3OPTA 3A23A 3BKZA 2RS51 4XJ8A 4NHMA 3KQRA 3LA3A 4NJ4A 1PO23 2XBO3 3SMHA 4CEYB 5CG8A 3H7YA 1AUYA 2FD8A 1PX3A 2VXJA 4XZUG 2VMHA 1D4M1 1W9YA 2YZ4A 3V64A 4WM7B 4EE2A 4KGGA 3CDZB 4OMDA 5DUUA 2VZRA 4YW7A 4N43A 2BOIA 1S0JA 2KA3A 3RZZA 4PDWA 1RUC1 3ZFGB 2WSUA 5E1RA 2VNOA 2JDNA 3TEXA 4BQ3A 5IVVA 1TZOA 3CMGA 2E33A 5FQ0A 1XNAA 3RSJA 4PI2A 4JGZC 1A34A 1RITA 2AENA 5CIRA 5HPOA 2JDHA 4AAPA 1W04A 2I74A 4P9JA 4XDQA 1JOBA 4P00B 3RYRA 1SLTA 3S0MA 4AEDB 1PO21 2XBO1 2EVXA 3NNLA 1XU1A 1VBE2 3ACLA 3WD5A 5JWPA 4XACA 5F2SA 5CVRA 3K46A 4UFLA 4N53C 1R1A2 3PURA 1VALA 4AAXA 4Q0VA 4Y1YA 4L99A 4XIOA 1OH3A 3S5QA 5FZ4A 5HCBA 1GSLA 3EXUA 3POGA 3OCPA 1OLME 2AYHA 1GANA 1ULOA 1UXZA 1IQAA 1HW5A 2OXBA 4LHSA 1N1TA 1RUH3 3KGLA 2HH9A 1G9FA 4MV2A 5JXJA 3OD0A 1F8VA 4I30A 2H0VA 2D6KA 3OTFA 4JGZA 4CDQC 3RZJA 2QVSB 1KJRA 2F4PA 3RYKA 4OVEA 5FTTC 2IVIB 2VNVA 1LOFA 1SBDA 4CUBA 5EFUA 4D69A 1CX4A 2RV9A 5EZWA 5AC93 3O1OA 2GC0A 4UYBA 2WNUC 2ZKLA 2QQVA 3L9JT 2WZPP 4XDOA 3ELNA 1BXHA 1SMVA 4HG6B 1MS9A 2EIBA 4XUTA 1UOBA 4XFHA 4A3XA 2Y6KA 2Z2SB 1OFNA 1JZ7A 1BLZA 4NWWA 5FMOS 2R0HA 5FPXA 4E4HA 2IXIA 2C1FA 2D6LX 2W87A 5A80A 4A6OA 1RUH1 2VZSA 4Z2AA 2OVUA 2JG8A 2W92A 3ZFEB 5E88A 3HVDA 4KG8A 1AXYA 4XFIA 2RG4A 3A22A 3AJYA 1HQLA 5CKNA 3FMGA 2YC0A 5I0DA 4N8MA 3ZYFA 2EIDA 1YWKA 1G7YA 2P3IA 1J1LA 5AC91 4HVOA 2R072 3Q8AA 3NSTA 2O0OA 4QDQA 4XOGA 4QGMA 1Q8VA 1YHFA 2BP6A 3B94A 3HN1A 3TB0A 5KHGA 1I1EA 1HRV3 3MFAA 4FPKA 4MGKE 4UAPA 5IJRA 3WLUA 1NG0A 2Y64A 3BYWA 3O7OA 2HLEA 3MIBA 3DYMA 4MHUA 3RYPA 5LA9A 1KXGA 3BU7A 3ZDVA 1CAUA 4QPWA 2VECA 3OUJA 4JHZA 1W8NA 4E4ZA 3SQOA 2BERA 4Y20B 1JUHA 4AK3A 1GP6A 3OBAA 4LBQA 1O5UA 2YC4A 1GR3A 3UNPA 3VD9A 3WG2A 4XVHA 3WINE 5HCFA 2QQNA 1AYM3 1W9TA 3LFIA 2D6MA 1SZBA 4IL7A 1Q8QA 1WZXA 1W9FA 3IDBB 4Z1VA 1IZ3A 1DQ1A 5JI7A 2DVAA 1XOYA 5DG2A 4OI2A 3HWJA 5C4WA 1HLCA 1Q43A 1HRV1 1GFF2 1L7RA 1IOAA 5FUPA 5FK7A 5LB6A 1FNYA 3KWVA 4CEWB 2WAAA 4NIGA 2WZ8A 5J36A 1S0DA 2F17A 5JPNB 2ILMA 3VKLA 3WF2A 3LGRA 2Q8CA 1DQ6A 2ETEA 5DAQA 3FX3A 1P8JA 3LEGA 3IBMA 2QQUA 4UF0B 5KXEA 1O5LA 5BXXA 4DINB 2XJRA 1AYM1 3D5OA 5F39A 5FYCA 4Y1XA 5JSOA 4FFFA 4WM8B 2VAUA 3KQ4B 2ZMNA 4NPLA 3KM5A 3GCWA 4CDWB 1C8M2 3MIHA 1GOHA 3DXUA 3M3CA 2ADEA 4CU9A 1QGLA 2GC1A 3BIWE 5IAXA 1F4AA 2YDEA 4B7KA 3KCXA 1TME3 3AKTA 1LHOA 3MW3A 5FYSA 4YW1A 3PUIA 1S55A 3U07A 2NMNA 1XE7A 2YHJA 3P6BA 5B4XA 3BU0A 1XBFA 2V5DA 4CCDA 4FTEA 2A1XA 2YGMA 2GAUA 4IE7A 4YW2A 1FPN3 1DHKB 1LGNA 2IXCA 5FR3A 2R042 4IV1C 2MHFA 5D21A 5ANQA 5K0UA 5LRSA 1W2TA 2GH8A 2IXKA 2NZ9A 5FY7A 2QZ3A 3ZO0B 5M0TA 3N9LA 5IVFA 4W6YA 2XMLA 4QPIB 1AR82 1QY4A 3AZZA 5CFDA 3JD73 1US3A 1OF3A 2BVBA 4JGYA 3W5MA 4YM2A 5DAVA 1TME1 1JH5A 3POYA 2Y34A 4OMCA 4LO7A 5A32B 1JZ8A 1AJOA 2HEVF 2FDIA 1AL22 1A6CA 1W6MA 4UFKA 4XBNA 4OZXA 1PK6B 1XNCA 4OLLA 5L7OA 1FPN1 2B7YA 1YJKA 2VY0A 1HB1A 1VJ2A 3CQOA 4AWDA 4HT1T 4ZU5A 2RS52 1CPMA 1COV3 4JKMA 3MV11 4ZY9A 5B4NA 5DABA 1DP0A 4LBQD 4CUCA 5FKCA 2VNRA 4S2GA 4BOWA 3ZX7A 3V0AB 1BJQA 5A3WA 3CO2A 1D4M2 1XC6A 3OY8A 1SCRA 4HBNA 4LO5B 3TYJA 3W5NA 3VBUA 4COYA 3DKQA 3NW4A 3R4SA 1H8TB 2BGOA 4GKXA 2A70A 1W0OA 2HWB3 1OOPB 2R0FA 3JD71 1W6QA 1JODA 3GZTB 3H3UA 4IEQA 4YG0A 4O7XA 4NWVA 1RUC2 2OYZA 1DZQA 3WDVA 3O1MA 3VDDC 1N47A 1VAMA 3AMMA 5L36A 3ZIXA 4M3CE 2WL1A 2G9ZA 5FZKA 4AEKA 2I45A 1FMD3 3HR9A 3POIA 2ERFA 1RUNA 3E5QA 1ODNA 4MG2A 2PFWA 4MXWA 1LAJA 3FJSA 4IE6A 1W05A 3KCYA 3AMQA 4C1WA 4DEQA 1COV1 1UMIA 1PO22 1UL9A 2XBO2 2VVEA 5C71A 2HWE3 4AHZA 4CEYC 4AZZA 4L8QA 2R6QA 3ITQA 2VO5A 2CU5A 1V6JA 3ZSLA 4BQ2A 1H2MA 4ET7A 1YNAA 1OH4A 1QKQA 2HWB1 4QXBA 4WM7C 3T0BA 4CDUB 4RGAA 1CN1A 1WGPA 2V4AA 4OQ8A 2B45X 1B09A 3VUOA 1RHI3 3ZFGC 2FDFA 5FP9A 5J48A 1FMD1 4G9SB 4KWUA 2WNEA 5FYZA 1XXNA 2K46A 1NCQB 4GH4B 1UIJA 2VU9A 3KF3A 3AKPA 1RJ8A 1E5SA 3O1SA 1DU3D 2HWE1 3H8XA 1WW5A 5JOXA 4AEDC 3CIHA 3O5SA 4IEUA 1XYOA 4NRMA 1FT9A 3H1WA 5DDJ3 3AFGA 1ASJ1 4XBLA 4YRDA 2IWGB 1CWPA 4Y5Z0 4K6BA 3CL1A 2GH2A 3OGRA 3AVSA 4KMQA 2CSGA 2VQ0A 4P9GA 4ZPIA 3ZFGA 1RUH2 1GWKA 4JTOA 4XXPA 1QXPA 5FMCA 1F35A 1U0AA 3RI8A 4QPGC 5FZIA 5KHJA 2PAKA 3K4DA 3KMHA 4DO0A 5IUQA 1W0PA 2XPJA 1O3QA 3OOXA 3OGJA 1REEA 4R4XA 4ZHNA 3ETQA 4OUSA 1YQ6A 1IKQA 3TN93 5FYVA 2PQSA 3BODA 1KGYA 3LWCA 5DDJ1 3JUUA 3VZNA 1V6KA 3OD4A 1AHSA 3UESA 4N9IA 4QQHA 2D3SA 3ZFFA 4CZSA 2H6CA 3AP5A 1JOJA 3M1HA 5LBFA 2ZABA 2VMFA 1LHUA 1VP6A 3KHCA 3K48A 2VBDA 3C3VA 3SISA 1ALYA 1S0GA 2A71A 5FUIA 3ZFEC 1POV3 1JMUB 1G86A 3QCWA 2CWMA 4QD2A 3A0NA 3B00A 4UW6A 5F3GA 1YXWA 3CF6E 4XJAA 4OUMA 3TN91 1PVC3 2IUWA 4JC1A 4XHBA 4YNIA 1T6BX 4E2QA 4W4ZA 3KV6A 2OKXA 2JD9A 1HRV2 1PMJX 1UF2C 3NL1A 1QOOA 3PMSA 4H7MA 1MACA 5FV3A 5CKMA 5K9YA 1CIYA 2DWRA 3ES4A 5DAWA 2Y8KA 2JKBA 4AVTA 1ENRA 5FIXA 4GB33 5FY1A 1BK1A 4QDSA 3AP9A 1BYHA 2HJIA 4HKOA 2Q8EA 5A33B 1W6OB 1VRH3 3ZFEA 4UI9L 4Q8KA 4XYXA 1POV1 1Y3TA 4NAMA 1HV0A 2Y6GA 4L2NA 5FO8B 1VBB3 1AYM2 2WWJA 3FC0A 3DGTA 3J7LA 4G4FA 4CTEA 3ZDSA 1PVC1 2OA2A 2R16A 3H0OA 5CU1A 4Q4Y3 1H2LA 1FV3A 2DCJA 1UNBA 2ORZA 4FOWA 2Y6JA 4ZKTB 3KHBA 5KXCA 1APNA 1IS5A 4FPHA 3D0SA 2DFBA 3EO6A 4IW3A 4HONA 1UQXA 4AHYA 2TUNA 1QWRA 1BBT3 3LDRA 1LOEA 2DVFA 4GB31 4CCKA 4CEWC 4AI9A 1QMJA 4UBGA 1G6NA 1W8FA 4LHKA 2W3JA 4H2AA 4Y20A 1O8PA 1PVXA 3NVCA 3BPZA 3VB9A 1VRH1 2QJVA 1UY0A 4XIKA 1U5YA 3ES1A 3FHIB 3AKQA 4H3WA 4OULA 1NA1A 1VBB1 1YFYA 4PDWB 1NYWA 3PUQA 2FDKA 2OT7A 1PM7A 3WV6A 4Q4Y1 5EIYB 4WM8C 4Q0PA 1XU2A 3GM8A 3GBFA 4HLTA 2VOKA 3WQ0A 4CDWC 3D0JA 2Y6LA 4MGTA 5FLIA 1TME2 1ZRCA 1BBT1 4XJZA 3RS6A 2O14A 2C9KA 3DPRA 2R1BA 4GAZA 4Q27A 1TNRA 1T2XA 3NV4A 1JZ3A 1ULCA 4RN5A 1O7FA 2JG9C 3WDTA 1FPN2 4IEVA 5BNOA 5I0RA 2OS2A 2ZGSA 4IXLA 1LKNA 5I8SA 1Z7S3 4CPBD 1Y9GA 2YB7A 3U78A 4Y26A 4WM8A 1GZCA 2XXZA 5FY5A 4XILA 1VBD2 4HK8A 4CDWA 3WZ1A 3JD72 2IFWA 3D82A 4Q0QA 3WEZA 4CE8A 2VMGA 1H8VA 5LZ6A 4WBBA 4XF3A 3SNMA 1R1A3 3LF7A 4NPMA 1LODA 1PK6C 2QQWA 2HWC3 3JBG2 1COV2 3PTRB 4Z82A 5FO7B 5L9RA 1LRHA 1PZ8A 3K4ZA 2VOWA 1Z7S1 3BVCA 4HKLA 2FZ2A 3HAGA 2SLIA 3AL6A 3B01A 1V6MA 2BOJA 1WLWA 3RPQA 4CXXA 4QPIA 2HWB2 2BFUS 3RZLA 1H8TC 1TE1B 3O0XA 2GMMA 1OOPC 2D44A 2R32A 5A6XA 4NHKA 4LORA 2W9XA 1XSRA 4Y5TA 4XUNA 5FY8A 3AP6A 3GZUC 1WW4A 1W8HA 2UYBA 1DLCA 1FMD2 3J4UH 1DQ2A 4KU7A 4XQWA 3N7LA 3RJ2X 2H0BA 3WNKA 2A6VA 1S0BA 1J58A 2ZPXA 4QX7A 2E7QA 3ST7A 2ZGLA 1D0HA 4HVRA 2HWC1 5GZEA 4RGKA 4LBLA 3SKVA 2WLQA 2ZGRA 2HWE2 3ZSMA 1CAUB 1GWLA 2FCVA 3VD5A 3I2DA 5A7SA 5FOJB 4RL7A 4P5HA 1REFA 5CA6A 4TLFA 4MGSA 4NIDA 1ASJ2 3AM2A 4LBQB 2B9VA 4O65A 3OUIA 4PF1A 1URXA 1NLSA 4QB6A 3VDBA 4LKDA 5GLWA 4CDUC 5KXDA 4BIOA 5JDBA 2XQXA 4XJ9A 2MEV3 1KRIA 3H1MA 1XB9A 5C4WB 3TBDA 2FQPA 1S0FA 4U2AA 1UPSA 3ZYIB 2OUHA 3IB3A 3KCCA 3LQCA 4JV4A 1EV13 4QQPA 2QDRA 4SLIA 4XAAA 1W9SA 5A3TA 4GH4C 1NCQC 2G1MA 4Y1UA 1H4GA 1SLAA 3WNOA 5FPVA 1GLHA 3H3LA 3IWZA 1F5FA 1ZZBA 2G19A 5DDJ2 3ZKYA 3ZXLA 5JIUA 2TBVA 4QKFA 1Z0HA 4EYUA 2XL7A 1UKGA 4NIAA 3RDIA 3HJRA 3B3QE 1VB2A 4XPVA 1DFQA 5F3IA 1I3HA 2B5HA 1DQ0A 2XJTA 3KSCA 1SLIA 2D6PA 3POEA 3F95A 1EPWA 2BWCA 1W2AX 3LZZA 4Y33A 5KHKA 5FLHA 2IXLA 4EQVA 3BIEA 5EV7A 1JTZX 5CFCA 2MEV1 4KWKA 1WCKA 1QIQA 2GDFA 2Z79A 1OI6A 1WCQA 3LFMA 3BI3A 3VBOA 1S0CA 3M3EA 4YZ3A 1EV11 1WCUA 4GH4A 4R9DA 5FP7A 1HB3A 3SCGA 1SCSA 4QKBA 3SHRA 5JOYA 2MPFA 4PHZA 3TN92 3VLBB 2VVDA 2DV9A 1CZTA 1ENXA 3VBSB 2CGPA 5IW0A 1Q56A 3UJQA 1MZ6A 3NJXA 4QQLA 3MW2A 4QXHA 4FFIA 3WW3A 3TEZA 2Q0AA 1OLRA 3P1IA 4FFHA 4GALA 1O59A 1UX7A 3FLRA 1DG6A 5LASA 2JEMA 1RYYA 1ZZ6A 2EIEA 2RS33 2QTWB 3AXEA 4HFSA 1OUSA 2QDNA 4MHRA 1H9WA 1K45A 2NYYA 4NHXA 3PDQA 4W8JA 5CFDB 1A78A 2YMZA 1OVSA 4DXRA 4EZHA 1JI6A 2BUKA 1YEWA 2C24A 2NLRA 2DCTA 4WVWA 1R093 2D93A 1PVC2 1GNYA 2WSVA 4AVBA 4IEWA 1W6MB 3ON7A 3SEPA 2E26A 2HYXA 2P3JA 3TNPB 3I2FA 3V65A 4TWTA 1DYPA 4KNCA 5L7OB 2QQIA 5GKAC 1QJX3 1VLNA 4MUVA 4NN0A 4URTA 2QBXA 4GB32 2QUOA 5GM0A 3ZKUA 1IPJA 1W3XA 3WCSA 4MSVA 4P9LA 1PIV3 2EICA 4UBHA 3VL9A 1V6OA 2ZHMA 4I0WB 3OY8B 2RS31 3VBUB 1VRH2 4W6WA 1MZ5A 5C3SA 1LB2A 4JX0A 1QXJA 3TAYA 2GMEA 4YARA 3DECA 3GYDA 1O3SA 1VBB2 5C8CA 4PIYA 3KVBA 1V70A 1R091 2DCKA 1X9TA 2PHUA 1W0NA 2RMU3 4P08A 4Q4Y2 4AFDA 4JVAA 5D2AA 4PI0A 4XUPA 4Z07A 1AL23 1C28A 2GN7A 3RQ0A 4Q5OA 4MXWB 3N4MA 1S4CA 2WNVB 1QJX1 5G05L 3AYAA 2W2IA 2TNFA 1BBT2 3B02A 4J25A 1UYZA 3WDUA 2VUCA 1YI7A 2UY9A 3LE0A 3HD8B 4GMP3 4ONUA 5J98B 3WCRA 1FX5A 1PIV1 4FPFA 1XPWA 4YLZA 2VE1A 5GZDA 1DQ5A 3HNBM 4M3CB 4XETA 4HN0A 3AYCA 3FFQA 3T1LA 2ZGQA 5FMBA 4CU7A 1X82A 5BUVA 1EYBA 4IGPA 2KD7A 1JZ2A 3A7QA 3ZYJB 1Q3EA 4EN9B 5CKQA 1F31A 3S30A 3PL0A 3ZSJA 4XF4A 1BQPA 3U4XA 3W9AA 2XVGA 4PDWC 2RMU1 5K7PA 4IEPA 3VV1A 4AVCA 1AL21 1HJFA 5GLVA 4BHPA 1L7LA 1H30A 2VZ1A 1RUJ3 4EV0A 1K5MB 4MVTA 5HXVA 4ISQA 4HN1A 1C1FA 2O8OA 4IGOA 2DVBA 4EWAA 4GMP1 1AYN3 1AVBA 4LNVA 1OA2A 4EN0A 3PMEA 2ZGUA 2YU1A 1XYNA 3MPBA 2QNKA 5F8PA 3Q9OA 4RR3A 3I49A 5F9TA 1HV1A 3ZR5A 2XWJB 4J6GA 1V6NA 1SLBA 3EHKA 3KT4A 1W6PA 3IT8A 1E5RA 1YFUA 5JSRA 1JBCA 2D3PA 3OGGA 4BH9A 4I2OA 3PIGA 4CCOA 4DPNA 1Z7S2 4DS0A 3N7JA 4LUMA 4LOSA 2BPA2 5F5AA 1XYPA 3NNMA 3LSEA 2DUOA 2DCYA 3EQEA 1WD4A 2J1EA 4XFGA 3J26N 1RUJ1 5KHHA 3A4UA 4C1XA 3OG2A 1F2NA 4UWDA 5A7NA 5I8TA 1LOFC 2PN5A 3THCA 5F1RA 2W95A 1AYN1 3LKJA 5FPLA 3UT0A 1GNHA 2HEYF 3PUHA 4PCRA 1YFWA 1ZZ8A 1OBNA 3E5XA 2Q8OA 2VXRA 3IMNA 2XKPA 1JXNA 2EF6A 4FOVA 4I02A 4COZA 1E5HA 3MLJA 1KFXL 2W47A 2HWC2 2P1BA 3ZFFB 5LEKA 3JQWA 2HBUA 1MS4A 3NMBA 2VBPA 1DDLA 1YQ5A 1YQ8A 4ZZ5A 3S7IA 3WT3A 4GA9A 2PQQA 3UGFA 2PA7A 1YRZA 1LHVA 4TLGA 1D2SA 4EWDA 2FMYA 2WC2A 2Y60A 3FUQA 5CZKA 1F15A 2JG8C 3NV1A 1UYYA 4FCAA 4AHXA 5LA0A 4SBVA 5A3LA 2XLGA 2HBTA 4O9EA 2I2SA 3T3YA 2WO1A 3AFKA 1KDMA 4BQ4A 1RUD3 1OLMA 3K3OA 3DUIA 1DZTA 4LJHA 1W8UA 4BXSV 4MGYE 4LULA 3BUCA 2BNMA 5CYYA 1RXFA 1BCXA 1VMHA 4BPZA 1NZIA 1J3RA 4LHNA 1WLDA 5AFBA 5FWEA 1OKOA 1YLLA 2WT2A 3WDYA 3PNAA 4K1ZA 3WF1A 2WBKA 4XF0A 4XFAA 4NR1A 4ZONA 2QQMA 4L9BA 3M70A 4D94A 3ME2A 2CY6A 5JI9A 3C8XA 3VDCA 1HJGA 1YYNA 5FREA 5KHIA 1QDCA 3T2TA 1RUD1 2YBSA 4W6XA 2GSYA 4XFFA 2MEV2 5BY5A 1YUDA 1YO8A 4R9BA 4Y4RA 5DAPA 3CBNA 4BK4A 3VBRB 4FBFA 5C4WC 1EV12 3D8CA 5FUNA 3WP5A 3C7GA 1NUKA 1EP0A 3POSA 4B7EA 3ILRA 2R063 1M4WA 2P3YA 4QT6A 4R4ZA 5KC5A 1X50A 2P2KA 2Y0OA 4EWEA 2JB8A 2PELA 4NPRA 3UETA 5FPBA 3FWEA 3MDPA 3VHRA 3V56A 1OMIA 1TVGA 3N9PA 5FP8A 3TWIA 3KS7A 3ZSEA 2Y33A 1NA1B 1OD5A 2VZTA 3VBFB 2VZVA 2HYKA 3G6JB 5LY2A 5A6ZA 2B42B 3GJAA 3PJQA 1MZFA 2QFEA 5T55A 4XHXA 3BTYA 4GZ9A 3E1F1 5FY9A 1PX4A 4EROA 3NWKA 2LROA 3RI9A 3B93A 3TNQA 3AC0A 2VUDA 4A42A 5LEJA 1W99A 2P3KA 2R061 3MF6A 4IE5A 1WD3A 5FYBA 1JYWA 2PAEA 3I2OA 3DPRB 4Q0UA 5SV5A 4YFWA 4YGEA 2BJSA 3HMYA 4K8RB 4N9HA 3WG4A 3VN4A 4ZS2A 4XQDA 3SXWA 3VBSC 4AEJA 1UU4A 5BNOB 2ARXA 2YPJA 3OGVA 5FRAA 4A4AA 3N9NA 4E2SA 5JOZA 4E4DX 5JZGB 3OSDA 3UK9A 4B1MA 1B35B 4QX2A 2EA7A 5JLVA 3E5UA 4IESA 4IDZA 2VQTA 2JE8A 5EJ1B 2RS32 3WF3A 5BYNA 5K0UC 3T2PA 1CZVA 3RRDA 2HWF3 4D6QA 4NIIA 3M7AA 3BB6A 3ZXFA 5A3OA 4XXAA 5CFDC 4U36A 3C7FA 4JGYC 1R092 4FI9A 4ASLA 5FK8A 3WF0A 2BBVA 1S1AA 1R64A 4AXOA 3H8RA 1LECA 2CWSA 3PU8A 1XSQA 1W6NA 2NQYA 1QDOA 3VBSA 3MIGA 4CDXB 1LHNA 3BCWA 5JCTA 1LOCA 4TTGA 4HKWA 4PT6A 4M01A 1QJX2 2XQRA 3VKNA 5L7OC 3ASIA 1S2KA 4JZRA 3N3HA 3IM0A 4BDVB 2FBEA 2X8KA 5LY1A 4H7LA 4CA9A 4B29A 1PIV2 2Z42A 2W94A 1CGPA 2EXKA 2JECA 1BVVA 5F5CA 4D0QA 3UJOA 4Y5SA 4BMEA 2HWF1 1VBD3 2BZDA 3VBUC 4LLOA 3PUAA 1LJ7A 2RR12 4B4PA 1JZ5A 3FN9A 4RHV3 2J1SA 3AXDA 4L92A 4MH0E 4XABA 1CZSA 4XCBA 2RMU2 1PO13 4X6QB 5JOWA 5I0SA 2VM9A 2AEYA 3ZXKA 4R8HA 4JDNA 3SCHA 5FY4A 3LEMA 1OKQA 4LLFA 2WO7A 3T08A 3LCPA 3ZXDA 1IKPA 5CADA 2B9UA 2WNVC 3JBG3 2K2SA 2VTXA 3N36A 4GQ7A 1XE8A 2VZQA 4LOTA 5FYTA 5EP9A 5H9RA 4EN6B 1XJAA 4QB1A 4LMFA 3U1XA 3Q8EA 2VCAA 4JHTA 2VC9A 3BALA 1S2BA 2XL9A 2GMPA 4PBOA 4EJRA 2NN8A 1VBD1 5EJ3A 4QM8A 3LOBA 4AQTA 5FAXA 1LOBA 4ZU4A 4RQPA 1XNDA 1IHMA 1BHGA 4RFRB 4RHV1 2FDGA 4GWNA 4A44A 4MGQA 1RXGA 1PO11 2BRTA 5FJHA 2JDPA 3JCIA 4K8FA 5BNQA 2R30A 1RUJ2 4RD7A 2YY1A 1MQTA 3ZM8A 2NPIA 4Q4W3 2WNVA 3AMNA 2CDPA 3LDBA 3MYXA 4Q4X3 4YGCA 1N1SA 1K5MC 3WG3A 3JBG1 4Q2FA 3E6BA 5E6HA 1AYN2 1ZBA3 2ORXA 2V72A 3ZMOA 4AE2A 1SPPA 1VPHA 1YIFA 3CZUA 2EXHA 1RC6A 3JB4C 1RGSA 4HETA 4M3CA 4YVWA 1QH7A 4BMBA 1ASJ3 1Y43B 1SDDB 3DYPA 1LOGA 4XMAA 2QE3A 4M4PA 4CCJA 1AR93 4AI2A 2F4LA 4NROA 1IPKA 1OUXA 1S0EA 2DU0A 2VJXA 3K4AA 3UYJA 2UWCA 5IVBA 1GOFA 1D7PM 5CFCB 4N7IA 5A70A 2E31A 1LEMA 2AZ5A 3W58A 5I91A 1BMV1 3BTZA 3VBOB 1J84A 1HIXA 3NNGA 5FOBB 1J3QA 1NCRB 1K5MA 4Q4X1 2EIGA 2YG0A 4Q4W1 4BM8A 1AZDA 4DXSA 4EN8B 1W9WA 3ZOIA 4FTBA 1ZBA1 3NJVA 5CB7A 1KQRA 2Q4SA 2YFZA 5HXMA 4LPLA 1OURA 1SEFA 3CHXA 5FPZA 1UOFA 1D4VB 4PLMA 2JE7A 4OI4A 1AR91 1NQJA 2Q1ZB 2QQPA 1HQWA 1DGWA 4KI5M 2BVVA 1G9DA 3ZFFC 4OI1A 3KVAA 3PIJA 2VW0A 2XJSA 3I2JA 1MR5A 4S2HA 4IV3A 3GCXA 2OIIA 4BQ1A 3KGZA 4CXYA 5FZ1A 5JXHA 4HL0A 1ZM1A 1HKDA 4V1PA 4P5YA 3PVBB 4BK5A 5C33A 1CAXA 1OSGA 4LE3A 1RUD2 2XUEA 4IE4A 2JWPA 4PJYA 1IGOA 2RDRA 3W59A 5FZOA 4E27A 3B7MA 5C5TA 2PHTA 1O6UA 3IZOA 3JZVA 3LA7A 2ZHLA 2E7AA 3AK0A 5J96B 1D0GA 1IG0A 2AREA 3S6PA 5JXGA 4OQ9A 1ZREA 1EPZA 2ARCA 3QLQA 4YM1A 4YFZA 3C7OA 3OBRA 3VDAA 4A2UA 2AH2A 2YFUA 2D5HA 5DXDA 4UW5A 3PJYA 2DBNA 2NP0A 4LIUA 3I3QA 3HT2A 4CPBA 3I8TA 1HXS3 2ZBJA 4JAAA 3ACIA 3UGGA 2IZWA 5C8CB 4XJUA 3KT7A 3GZAA 5ISLA 2PYTA 4K1YA 2SBAA 3GALA 3N7KA 4LBKA 1JYIA 4N7UA 4YZ5A 1GQGA 4XUOA 3ZYPA
chains in the Genus database with same CATH topology
5FP3A 4BXFA 4HONA 4QXBA 5FZGA 2GP3A 4Y4RA 5FXXA 5FXZA 5A3NA 5FUPA 4CCKA 5FZBA 4DIQA 4AI9A 4CCLA 2OQ7A 5FUNA 4IGPA 5LWBA 4EZ4A 5KR7A 5FP9A 4UF0A 4URAA 2Q8CA 5FJHA 5A3TA 2Q8DA 4IGQA 5FYZA 4QX8A 5FZ3A 5FPBA 5FPVA 5A1FA 5IVVA 5LW9A 5F3EA 4UF0B 5FZCA 4QXCA 4D6RA 4XDPA 3LDBA 3N9PA 5FBJA 5FP8A 2VD7A 3PUQA 2OT7A 5IVJA 2YU2A 4AAPA 5A7QA 4C8DA 5E6HA 4EYUA 5F37A 5FZ0A 5FYMA 5F39A 5F3IA 5FYCA 5F2WA 5LY2A 4IGOA 5FJKA 4ASKA 4LIVA 3KV5A 4Y33A 5F2SA 2P5BA 5FZ8A 3AVSA 2YU1A 1VRBA 5FY9A 3DXUA 4CCJA 3PURA 5FZ9A 4GAZA 5IVBA 2YBKA 3UYJA 5FYSA 5FZ4A 5FYIA 5FYBA 4BISA 4QWNA 2PXJA 5FP7A 3U4SA 4CCOA 5FZIA 3K3NA 4Y3OA 5FYUA 5FZAA 4DO0A 2OS2A 5FZ7A 5F5AA 3OPWA 5IWFA 4LITA 4V2WA 3U78A 3KV4A 4CUGA 4QU1A 5FZFA 5FWJA 5ANQA 3N9NA 5F5IA 5FYVA 5IW0A 2XXZA 5FY5A 5FY7A 4QXHA 5FY0A 5A7NA 4BU2A 4CSWA 3N9LA 5IVFA 5A7WB 3AVRA 5FPLA 2XMLA 3K2OA 2OQ6A 3NJYA 4XDOA 4D6QA 5FZHA 3DXTA 4CCNA 5F32A 3KVAA 5FYYA 3ZLIA 4D6SA 3PDQA 2YBPA 2YPDA 5FP4A 4NUBA 4E4HA 2WWUA 5A80A 4EZHA 4LXLA 5FPAA 3PU8A 4GJYA 5FZ1A 5FZMA 3N9OA 4V2VA 3PTRB 2XDVA 3ZPOA 5F3GA 5K4LA 2XUEA 3AL6A 5A7WA 3N9MA 5LY1A 3KV6A 5FZOA 5A7OA 4TN7A 3LD8A 4GJZA 5A3WA 5FPUA 3K3OA 5FYHA 5FV3A 5F5CA 5FZOB 4GD4A 5FY8A 5FZLA 5A1LA 3PUAA 3AL5A 5IVEA 5A3PA 5FY1A 3N9QA 4CCMA 5FWEA 4HOOA 2Q8EA 4QX7A 5FZKA 5CEHA 5IVCA 4LIUA 3KVBA 5FXVA 5F3CA 5IVYA 2OX0A 5FY4A 2WWJA 5A7SA 5FXWA 3KV9A 3PUSA 5FZ6A 5A7PA 5ISLA 5FYTA 5FZDA 3OPTA 5FZEA 3PU3A 2W2IA 3RVHA 2YBSA 2GP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FP3 A;  4BXF A;  4HON A;  4QXB A;  5FZG A;  2GP3 A;  4Y4R A;  5FXX A;  5FXZ A;  5A3N A;  5FUP A;  4CCK A;  5FZB A;  4DIQ A;  4AI9 A;  4CCL A;  2OQ7 A;  5FUN A;  4IGP A;  5LWB A;  4EZ4 A;  5KR7 A;  5FP9 A;  4UF0 A;  4URA A;  2Q8C A;  5FJH A;  5A3T A;  2Q8D A;  4IGQ A;  5FYZ A;  4QX8 A;  5FZ3 A;  5FPB A;  5FPV A;  5A1F A;  5IVV A;  5LW9 A;  5F3E A;  4UF0 B;  5FZC A;  4QXC A;  4D6R A;  4XDP A;  3LDB A;  3N9P A;  5FBJ A;  5FP8 A;  2VD7 A;  3PUQ A;  2OT7 A;  5IVJ A;  2YU2 A;  4AAP A;  5A7Q A;  4C8D A;  5E6H A;  4EYU A;  5F37 A;  5FZ0 A;  5FYM A;  5F39 A;  5F3I A;  5FYC A;  5F2W A;  5LY2 A;  4IGO A;  5FJK A;  4ASK A;  4LIV A;  3KV5 A;  4Y33 A;  5F2S A;  2P5B A;  5FZ8 A;  3AVS A;  2YU1 A;  1VRB A;  5FY9 A;  3DXU A;  4CCJ A;  3PUR A;  5FZ9 A;  4GAZ A;  5IVB A;  2YBK A;  3UYJ A;  5FYS A;  5FZ4 A;  5FYI A;  5FYB A;  4BIS A;  4QWN A;  2PXJ A;  5FP7 A;  3U4S A;  4CCO A;  5FZI A;  3K3N A;  4Y3O A;  5FYU A;  5FZA A;  4DO0 A;  2OS2 A;  5FZ7 A;  5F5A A;  3OPW A;  5IWF A;  4LIT A;  4V2W A;  3U78 A;  3KV4 A;  4CUG A;  4QU1 A;  5FZF A;  5FWJ A;  5ANQ A;  3N9N A;  5F5I A;  5FYV A;  5IW0 A;  2XXZ A;  5FY5 A;  5FY7 A;  4QXH A;  5FY0 A;  5A7N A;  4BU2 A;  4CSW A;  3N9L A;  5IVF A;  5A7W B;  3AVR A;  5FPL A;  2XML A;  3K2O A;  2OQ6 A;  3NJY A;  4XDO A;  4D6Q A;  5FZH A;  3DXT A;  4CCN A;  5F32 A;  3KVA A;  5FYY A;  3ZLI A;  4D6S A;  3PDQ A;  2YBP A;  2YPD A;  5FP4 A;  4NUB A;  4E4H A;  2WWU A;  5A80 A;  4EZH A;  4LXL A;  5FPA A;  3PU8 A;  4GJY A;  5FZ1 A;  5FZM A;  3N9O A;  4V2V A;  3PTR B;  2XDV A;  3ZPO A;  5F3G A;  5K4L A;  2XUE A;  3AL6 A;  5A7W A;  3N9M A;  5LY1 A;  3KV6 A;  5FZO A;  5A7O A;  4TN7 A;  3LD8 A;  4GJZ A;  5A3W A;  5FPU A;  3K3O A;  5FYH A;  5FV3 A;  5F5C A;  5FZO B;  4GD4 A;  5FY8 A;  5FZL A;  5A1L A;  3PUA A;  3AL5 A;  5IVE A;  5A3P A;  5FY1 A;  3N9Q A;  4CCM A;  5FWE A;  4HOO A;  2Q8E A;  4QX7 A;  5FZK A;  5CEH A;  5IVC A;  4LIU A;  3KVB A;  5FXV A;  5F3C A;  5IVY A;  2OX0 A;  5FY4 A;  2WWJ A;  5A7S A;  5FXW A;  3KV9 A;  3PUS A;  5FZ6 A;  5A7P A;  5ISL A;  5FYT A;  5FZD A;  3OPT A;  5FZE A;  3PU3 A;  2W2I A;  3RVH A;  2YBS A;  2GP5 A; 
#chains in the Genus database with same CATH topology
 1NY7 1;  1RMU 3;  4FPO B;  5FZG A;  3DCQ A;  2ZGO A;  1LCL A;  2R06 2;  3VBR C;  2FDH A;  1HX6 A;  3J8F 1;  4CCL A;  2R49 A;  3C7E A;  4AI3 A;  4YZ2 A;  2XKO A;  1OQD A;  4JKL A;  5FBZ A;  5EPA A;  3URF A;  5JUV A;  2L9L A;  3AZW A;  2HKX A;  2VCM A;  3VZL A;  2G4I A;  4IGQ A;  5FZ3 A;  4QX8 A;  1HXS 1;  2FCU A;  3I59 A;  2XGX A;  4KQ7 A;  1NA1 C;  3WW1 A;  4Z2W A;  4QMA A;  3VBF C;  3CJI A;  5F37 A;  2QQK A;  5A6Y A;  4QHB A;  5FZ0 A;  4BB3 A;  2WAO A;  1PNG A;  2X05 A;  3RZK A;  1LEN A;  1NKG A;  3VBR A;  1RMU 1;  4A45 A;  3MID A;  3ZXA C;  2VTF A;  1W2O A;  4Q4V 3;  1ZVF A;  4FPC A;  1NX9 A;  1GU3 A;  4UFH A;  2ZAH A;  1UU5 A;  3DPR C;  4NO4 A;  4RR3 B;  3N35 A;  3NKG A;  1POV 0;  3SIT A;  3WW2 A;  5IYY A;  1W6P B;  5E89 A;  1ZA4 A;  3GNE A;  2RJL A;  1OVP A;  2Q30 A;  2VR4 A;  3HNY M;  3I3B A;  3LSD A;  4P9Y A;  5BNO C;  3VBF A;  2LTN A;  3IPV B;  3RFR A;  4MGI E;  4AGG A;  3W21 A;  3P5B A;  3R4U A;  5T52 A;  5FKB A;  2CYF A;  3WDW A;  1B35 C;  5FO9 B;  4DXT A;  5JXI A;  4LBM A;  1CIW A;  2HWF 2;  5A7W B;  4JDM A;  4ZZ8 A;  2WWS A;  2P6H A;  2JDU A;  2K9Z A;  1BEV 3;  3K2O A;  4BCU A;  4CXW A;  4Q4V 1;  3WSO A;  5F32 A;  5FYY A;  1AJK A;  4JRL A;  1W90 A;  3LOI A;  1EUU A;  1U12 A;  4Y22 B;  4CDX C;  1LED A;  1FAT A;  3WVJ A;  1C1L A;  1Y9M A;  2EAK A;  2XDV A;  3I4I A;  3WHU A;  3RZH A;  4L11 A;  5JZG A;  3WXP A;  1VMF A;  1ND3 A;  1O4Y A;  4XFC A;  1B35 A;  1HRI 3;  1MS0 A;  2RM2 3;  5AVP A;  5GJ6 A;  3ZXE A;  3KB5 A;  5J37 A;  1RL3 A;  3HNM A;  4DQA A;  4TN7 A;  3RJR A;  4FPE A;  1KJL A;  4GWM A;  2PHW A;  4LBJ A;  5FYH A;  3CEW A;  3RWK X;  4C91 A;  4HZF A;  4QPI C;  2ES3 A;  5L9B A;  1S2E A;  1BEV 1;  3NNF A;  3T30 A;  2ZGK A;  4AI1 A;  4B4Q A;  2XOM A;  4RHV 2;  1UOG A;  2PTM A;  2CV6 A;  4OHZ A;  2GZW A;  1PO1 2;  1ZZ7 A;  4X6R B;  5C7G A;  5IVE A;  1CVN A;  3LB9 A;  1V0A A;  3N9Q A;  2WJS A;  1UO9 A;  4CDX A;  1SAC A;  4XFB A;  1UWW A;  2VBB A;  2ZML A;  3HPN A;  3IDE A;  1SFP A;  2E51 A;  3FFZ A;  4MGZ E;  4AGR A;  2PMW B;  2C6S A;  1MZE A;  3TEW A;  2W1W A;  2PHD A;  3KV9 A;  1HRI 1;  2RM2 1;  1TMF 3;  4FT8 A;  1GIC A;  2GNM A;  1RVF 3;  3I2I A;  1OA3 A;  4B1L A;  1J1T A;  1OPO A;  1X33 A;  1X9P A;  2IFR A;  4ARY A;  5A6Q A;  4KBZ A;  3PU3 A;  4ORF A;  4DNY A;  2OZ6 A;  2O8Q A;  2HEW F;  2WIN B;  1GUI A;  5C3Q A;  4KL1 A;  4B4R A;  1W8T A;  3RG0 A;  4FPL A;  4N53 B;  4CU6 A;  5APA A;  3FL7 A;  3T0D A;  2YUE A;  4PIZ A;  5FZB A;  3M2M A;  4Q29 A;  4OHY A;  1C5I A;  5HCA A;  1AXZ A;  4EZ4 A;  1BMV 2;  2D97 A;  1ZYB A;  3ZPY A;  3ABZ A;  4Q0S A;  4F3J A;  2ZEX A;  4Q4W 2;  4Q4X 2;  4BYY A;  3OB8 A;  2Q8D A;  1RUI 3;  3BGA A;  5DUX A;  4CCC A;  2VNG A;  5F3E A;  1ZBA 2;  4BWO A;  3WQ1 A;  4XDP A;  5FBJ A;  2VD7 A;  1TMF 1;  2BNN A;  3MUY 1;  1RVF 1;  4D8M A;  3EBR A;  2AUY A;  2AC1 A;  5F2W A;  1OF4 A;  1AR9 2;  1UY4 A;  4H55 A;  5B2G B;  1OT5 A;  3QH6 A;  3S57 A;  1DF0 A;  2P5B A;  2VZP A;  1YIP A;  3O0W A;  4XBQ A;  5CBL A;  2WQZ C;  3O1V A;  4YGD A;  2XWB B;  2VZ3 A;  3AJZ A;  4M4R A;  1AR7 3;  1ZZC A;  3LA2 A;  1CPN A;  3MFC A;  4LK7 A;  1GQP A;  4MZU A;  5EHD A;  3ZN6 A;  5CFC C;  1X8M A;  3I2K A;  2WZE A;  1A8D A;  1QJU 3;  5H9P A;  4CP0 A;  1A3K A;  4Y3O A;  3VBO C;  2J1A A;  1RUI 1;  1N1Y A;  4XCA A;  5F7U A;  4Z92 B;  5BPX A;  1NCR C;  1OLQ A;  2ZEZ A;  2Z5W A;  3OPW A;  4IEO A;  1LU1 A;  4L0P A;  4YGB A;  4COU A;  4V2W A;  5ACA 3;  5IAT A;  1UMZ A;  1H6Y A;  2ZX0 A;  3IAP A;  2ID4 A;  2WZR 3;  1F4H A;  3MO4 A;  5CIS A;  4BU2 A;  3LAG A;  3O1P A;  1JS9 A;  1XNT A;  3IN9 A;  4DMI A;  1CON A;  1SFY A;  3WQB A;  5DPN A;  4FAG A;  2CAV A;  1GKB A;  1ND2 A;  4DRR A;  2OQ6 A;  3E6C C;  1MVQ A;  2BQP A;  2XON A;  4JKK A;  2WDB A;  4QQ2 A;  1AR7 1;  1R1Z A;  4HPK B;  2D40 A;  3HQR A;  1G8W A;  5DZF A;  2JE9 A;  2BEO A;  3APB A;  3CLP A;  4WVZ A;  1QJU 1;  2VCC A;  1NCR A;  2G9G A;  4FO9 A;  1GWM A;  2VCB A;  2XJU A;  3FBM A;  3N9O A;  1UAI A;  3H8U A;  1C3H A;  2CDO A;  2RE9 A;  2W0X A;  1FXZ A;  3HQU A;  3N7M A;  5GLU A;  3ZPO A;  5ACA 1;  3FHQ A;  1W6N B;  3VKF C;  1G9A A;  5K4L A;  3WF4 A;  2WZR 1;  4JQT A;  1CX1 A;  2ADD A;  4OFG A;  3IKW A;  2E6V A;  1NY7 2;  3LD8 A;  5A7O A;  3LIG A;  1IG3 A;  2X5I B;  3J8F 2;  3VKO A;  5E16 A;  2Y26 A;  2WQ8 A;  3CNA A;  4DFS A;  2WII B;  3E97 A;  2C5D A;  5C5U A;  2RS1 3;  4AVA A;  4CP9 B;  5A3P A;  4DUW A;  5T3N A;  2QKD A;  1SBE A;  1HXS 2;  1XE0 A;  3HT1 A;  4HOO A;  4UFM A;  1PNF A;  1JN2 P;  3O1R A;  2ZJC A;  4O9G A;  4IUG A;  5IVY A;  3IDA A;  4QAW A;  5C8C C;  2ZMK A;  1HB2 A;  1LOA A;  1H1M A;  3DKW A;  3DYO A;  3ZYH A;  4IEZ A;  3SC7 X;  2ZHK A;  4YW3 A;  3GGL A;  5FZ6 A;  4E8C A;  2W1S A;  4BLI A;  1RMU 2;  1XNK A;  5LRR A;  3ZYB A;  2LW8 A;  4XTP A;  1E57 A;  2A6X A;  5LCW L;  2B4K A;  5F6L B;  1KEX A;  2BGC A;  3FLT A;  4PIX A;  4AEM A;  3RMY A;  3O14 A;  4AQ2 A;  2ZHN A;  4BJ0 A;  2Q5T A;  2LM3 A;  1R08 3;  2RS1 1;  3WNL A;  2WRA A;  2YC2 A;  3TOJ A;  4E8D A;  2ZX3 A;  2WO3 A;  5LWB A;  3V0B A;  2RVA A;  1WLT A;  2P6C A;  4XF9 A;  2VH9 A;  4RQP B;  5FLJ A;  5T5L A;  3INA A;  3VHP A;  2RR1 3;  2A3W A;  3PVN A;  2AR6 A;  2WO2 A;  3T0A A;  2WFP A;  2W39 A;  2Z69 A;  2BTV C;  4MX3 A;  1MPX A;  2VZO A;  1UZZ A;  4N90 A;  5LBE A;  1H4H A;  2R1D A;  4C0B A;  5LA2 A;  3M3Q A;  3AP7 A;  1MQT B;  5ABJ B;  1RB8 G;  3POB A;  3RZM A;  2DBI A;  3WY6 A;  4PF5 A;  4XJW A;  4ASK A;  5D8A A;  5HV0 A;  3RZG A;  4JDO A;  1EUT A;  4Q4V 2;  4FPJ A;  1TEI A;  2KM2 A;  3I2H A;  3VHO A;  4ISR A;  4J1X A;  1SPP B;  1I5Z A;  5T50 A;  3SH5 A;  1YJL A;  1H2N A;  1VMJ A;  1R08 1;  2IC1 A;  1W06 A;  2O1Q A;  4QX3 A;  4YVW B;  3WP3 A;  2YBK A;  4RR3 C;  1JZ4 A;  4LBN A;  1OXC A;  3O0V A;  3RNS A;  4QWN A;  2PXJ A;  5LK7 B;  1HN1 A;  2RR1 1;  1H6X A;  3VBH B;  3K3N A;  3H3Z A;  4FQ4 A;  1GYK A;  5FZA A;  1ZRD A;  5FZ7 A;  4M3C F;  2YXS A;  5JR7 B;  1H1A A;  5SV8 A;  4CCE A;  2QZ2 A;  3GZE A;  1UX6 A;  5LBB A;  1C8N A;  2XG3 A;  4WVV A;  4XUQ A;  2QQJ A;  5T54 A;  4CUG A;  4DUX A;  1O8S A;  2VOT A;  2PHF A;  1DYK A;  3M3O A;  2DFC A;  4HAN A;  1BEV 2;  3AB0 A;  2E32 A;  1ODM A;  4E2G A;  1Y4W A;  3GBG A;  4CP2 A;  3T09 A;  4ZXK A;  5E8A A;  3K51 A;  3FE5 A;  5JPM B;  4R9A A;  2GU9 A;  3I3D A;  1RJ7 A;  4CP1 A;  3R05 A;  1O91 A;  5FZH A;  2HWD 3;  1FNZ A;  1CAW B;  4XE9 A;  1K3I A;  3UKN A;  1C57 A;  4LO8 A;  3RMX A;  2PHX A;  2YPD A;  4LXL A;  2WR9 A;  4W65 A;  5FPA A;  1W3V A;  2VOV A;  3U75 A;  2DVG A;  2JKX A;  1HRI 2;  2RM2 2;  3IPV A;  2DVD A;  3NQH A;  3QAC A;  1PHM A;  5FFO C;  4IV3 B;  4WZC A;  5BNN A;  3Q8F A;  1ULD A;  3HIF A;  4FP2 A;  1KFU L;  2PLV 3;  1G9B A;  2J1V A;  5A7W A;  3N9M A;  4GMP 0;  1CAX B;  1UYX A;  2D43 A;  2V09 A;  3I7D A;  2EAA A;  4XMI A;  3VZK A;  2XLA A;  1NOV A;  5C3P A;  3I2G A;  2YRO A;  5FZO B;  2CGN A;  2VQU A;  5IFP A;  4QB2 A;  2IXH A;  2XR4 A;  1GNZ A;  3HBK A;  4M0H A;  1CJP A;  1UZW A;  3POF A;  2HWD 1;  3CJX A;  3LIH A;  5EJZ B;  4ZXE A;  2CHH A;  1JYV A;  4GWJ A;  4Y22 A;  1F5J A;  4ES8 A;  4K21 A;  2A6W A;  3ZN4 A;  1UPI A;  1K5J A;  3D4K A;  2D5F A;  3NO8 A;  1WCD J;  1NAE A;  4PQQ A;  3I3M A;  1TMF 2;  1RVF 2;  3VD4 A;  2OX0 A;  2XJQ A;  2FDJ A;  2KR2 A;  5FXW A;  1F9K A;  2N7G A;  2PLV 1;  2UYA A;  2WN3 A;  4TSV A;  1QHD A;  1PMH X;  1N3Q A;  4AYU A;  1EAH 3;  1OPM A;  5FZD A;  5FZE A;  5AVA A;  3TEY A;  4IQP A;  1UD1 A;  2Y6H A;  2A73 B;  3ZN5 A;  2WKK A;  1NLQ A;  3FUO A;  3I97 A;  3T1M A;  4DB5 A;  3VZM A;  3PVE A;  1O4T A;  3WQ7 A;  1RUI 2;  2VMC A;  5IK4 A;  3III A;  1NXM A;  2VMI A;  3OF1 A;  3BOW A;  4QPG B;  1UZV A;  3SEE A;  5KXB A;  1VAK A;  1A8M A;  2XUM A;  1GMM A;  4LR4 A;  2XJP A;  4D7T A;  3NAP B;  1EAH 1;  3NRU A;  4FFG A;  4KWJ A;  3WOG A;  2VW1 A;  3I59 B;  4K9S A;  3H8O A;  3WG1 A;  5BV6 A;  2WFF 3;  4ZU7 A;  3AYD A;  2WT0 A;  2GND A;  1WW6 A;  3H50 A;  3CJI B;  1AR6 3;  3MIC A;  4N53 A;  5H9Q A;  2V4V A;  3GBW A;  1HB4 A;  3Q8B A;  1W8W A;  1QJZ A;  4LT5 A;  2TEP A;  1AR7 2;  5GZF A;  4LTA A;  5FZ9 A;  1RIN A;  1UU6 A;  4BZ4 A;  4RYD A;  1OFS A;  1QJU 2;  2W91 A;  1FYU A;  2OW4 A;  2WNO A;  4WVM B;  1SFN A;  1ONA A;  1Y9Q A;  2D6N A;  2RHP A;  2V5Y A;  4Q1R A;  5ACA 2;  4CDQ A;  2WS9 3;  2I07 B;  1Z78 A;  5FMO L;  2WZR 2;  1AL0 G;  1RED A;  3F2Z A;  4HVQ A;  3JB8 A;  1DGR N;  3KV4 A;  4A3Z A;  1JUI A;  2ZEW A;  3C2U A;  5HV4 A;  3S5A A;  2AEZ A;  1FI2 A;  1OHF A;  5G04 L;  2WNU A;  4B3N A;  4UFJ A;  3RGB A;  2WFF 1;  2E9Q A;  4FOY A;  4RS5 B;  1IS3 A;  3AVR A;  1AR6 1;  2GAL A;  2ZKN A;  4A7K A;  2DTW A;  1RIR A;  3ZYR A;  3ZR6 A;  1IS6 A;  1V9U 3;  4DY5 A;  2JDY A;  2OZJ A;  1VB4 A;  4LKE A;  1DGR A;  2WLP A;  3M4F A;  4YG3 A;  2Y38 A;  3Q8C A;  2X10 A;  2YBP A;  2JDA A;  2DUP A;  3VKM A;  3OEA A;  4BIF A;  5GZC A;  3U10 A;  4FQZ A;  2WS9 1;  1QJY 3;  4IE0 A;  1STM A;  1KD7 A;  1TG7 A;  3KD4 A;  3VHN A;  4YZ1 A;  2WYF A;  4QPY A;  1UW8 A;  1PGL 1;  1H2K A;  1VBA 3;  1VE0 A;  4LA3 A;  3AYE A;  2P34 A;  4QQO A;  1DIW A;  1ND3 B;  1MEC 3;  2VMD A;  2X5I C;  1XRU A;  1JYN A;  1MS8 A;  1V9U 1;  2RS1 2;  4QKN A;  2J22 A;  4HPK A;  2ZX2 A;  2EXI A;  3NNJ A;  1RTV A;  1TNF A;  1W8O A;  2LAL A;  3J7M A;  5J7M A;  2PHR A;  2VVF A;  3FZ3 A;  4IND A;  1BVP 1;  1CAV B;  1NE4 A;  3IAQ A;  3ACG A;  1QJY 1;  3SKJ E;  1UYP A;  4NHL A;  3MW4 A;  1DLL A;  4AI8 A;  1YQC A;  2ZA9 A;  3PUS A;  2D98 A;  3EMR A;  3OGS A;  1ULG A;  1VBA 1;  4IER A;  3VZJ A;  1WBL A;  1QJF A;  2X5I A;  4CYD A;  1MEC 1;  1IPS A;  4UW4 A;  2BNO A;  3AP4 A;  1R08 2;  5EWS A;  4DOU A;  4CP9 A;  2GP3 A;  5FXZ A;  4EN7 B;  1WMF A;  1GP4 A;  1LES A;  1YI9 A;  3FBY A;  2D6O X;  4P14 A;  4XUR A;  4RSU A;  1WUV A;  3QD6 A;  2JDK A;  1KS5 A;  1OQ1 A;  4RQP C;  2VUJ A;  4DY3 A;  3L2Y A;  2JG9 B;  2IVJ A;  4GIQ A;  5IFT A;  4LBO A;  4KWL A;  3UKT A;  1JYT A;  1LGB A;  5CAZ A;  3PLQ A;  3WX5 A;  4YG6 A;  1LTE A;  3POJ A;  2Y6F A;  3AZX A;  3J7N A;  4NIH A;  1NZC A;  4TYS A;  5IVJ A;  1DCS A;  1S0I A;  2P37 A;  4LE4 A;  1MQT C;  1QQP 3;  3LPG A;  4HSL A;  4FPY A;  4M00 A;  5FYM A;  4AFB A;  5ABJ C;  4YM3 A;  4YW5 A;  1DGL A;  4M0N A;  1OD3 A;  2EXJ A;  1V6I A;  3ZXJ A;  5ABJ A;  3WNX A;  4YVW C;  5AFE A;  3PVO A;  2ZXQ A;  5LA1 A;  1I9R A;  1AX2 A;  3RWN A;  1DZR A;  2VW2 A;  5FDB A;  2GC3 A;  5CG9 A;  1UY1 A;  3R4D B;  4RFT 0;  4PQ9 A;  3VBH C;  5IK5 A;  1RUF 3;  4I3P A;  4AF9 A;  3DL3 A;  1UZ0 A;  4D7S A;  4IV1 A;  3ZN6 B;  2Q1M A;  1PZ7 A;  4OHX A;  1D2Q A;  2WQ4 A;  2RDQ A;  2RDS A;  3ACF A;  2ZAC A;  3VD7 A;  4MET A;  2A7A A;  2B8M A;  3MF9 A;  1QQP 1;  4LO6 B;  4UT5 A;  5FZF A;  5FWJ A;  3MIE A;  1O3T A;  5FY0 A;  4FTS A;  2VL4 A;  2ET1 A;  4ZS3 A;  4CSW A;  1ENS A;  2ZOE B;  2B46 X;  2CL2 A;  2Y0I A;  1QOS A;  3EJK A;  2HWD 2;  2XH6 A;  2A3Y A;  2A6Z A;  3UV9 A;  3CU7 A;  2WUH A;  4A7Z A;  3DN7 A;  4F8A A;  3DXT A;  1H1I A;  4CCN A;  5IAV A;  4KG0 A;  1DYO A;  4XTM A;  1ND2 B;  3VBH A;  3AX4 A;  1NE6 A;  2VUA A;  2XHN A;  2XVK A;  3AMH A;  1WWY A;  1RUF 1;  4P9I A;  3THT A;  3ZSK A;  4IEY A;  5J09 A;  4GJY A;  2PLV 2;  3NJZ A;  3O12 A;  4V2V A;  4IV3 C;  2ATF A;  3DV8 A;  4FXK B;  2ARA A;  4S2F A;  1GZT A;  4QM9 A;  5BNP B;  4YW6 A;  1UIK A;  3W20 A;  1QXR A;  4IET A;  4AOC A;  5HI0 A;  4HMZ A;  3I54 A;  2JXA A;  5GAL A;  2RJ2 A;  1TQ5 A;  1GOG A;  4OCT A;  2GNB A;  1CAW A;  3CKH A;  4A41 A;  4GD4 A;  3OYW A;  2AAC A;  5JR2 A;  3O1T A;  3VDD A;  2JD4 A;  3P3N A;  4P02 B;  1JU3 A;  1KIT A;  3J7H A;  1CQ9 A;  3MGU A;  3WDX A;  4DEV A;  1NLR A;  4GWI A;  1LU2 A;  3MZH A;  4MOA A;  1UY3 A;  1AXK A;  1GBG A;  2RJK A;  3L2H A;  1U5Z A;  4GUL A;  4JQR A;  4YVS B;  1YCI A;  4COV A;  5ANN A;  2J1U A;  5C9A B;  5IK7 A;  1GZW A;  3MV0 1;  2FZ1 A;  1DBN A;  1EAH 2;  2G9F A;  3USU A;  4Q1P A;  4CEY A;  5HBA A;  1M06 G;  1QEX A;  1T6G C;  5A7P A;  5H9S A;  1GZ9 A;  4AHW A;  4AVS A;  1SLC A;  1PZ9 A;  3RVH A;  2LRP A;  2E53 A;  4WM7 A;  1LUL A;  1YQ2 A;  5C3R A;  1DQ4 A;  1JZ6 A;  4AFM A;  5FXX A;  5A3N A;  2Z4F A;  4ARX A;  1JYX A;  3NKT A;  4FVV A;  2A75 A;  5TSW A;  2YGL A;  1NXD 1;  3J8F 3;  2FHR A;  1RHI 1;  2X29 A;  5I8Y A;  1XQN A;  1ULP A;  3QBQ A;  3WP4 A;  2C0Z A;  4AQS A;  5KR7 A;  1UOJ A;  1PM4 A;  4F83 A;  2WA4 A;  3HQX A;  2BGP A;  4YM0 A;  4AFA A;  4AQ6 A;  3V0B B;  5IHR A;  1ZRI A;  1N3O A;  4DZG A;  5AC9 2;  1NQD A;  5JIA A;  1J3P A;  3IIA A;  4QXC A;  3U37 A;  3GDB A;  2WFF 2;  3NAP C;  4AED A;  4G3Y C;  1QNY A;  4BQW A;  4C8D A;  1X8E A;  5J3U A;  1AR6 2;  1HDK A;  5A3M A;  5KWR A;  1H0B A;  1WLC A;  5J1X A;  3C7H A;  2YV8 A;  3BTX A;  3CJI C;  1I6X A;  4LIV A;  1JHJ A;  3KV5 A;  4QXK A;  5C3O A;  3WNN A;  5FZ8 A;  4I0B A;  1ENQ A;  5HCH A;  5D8A B;  1WA6 X;  2ZAA A;  2ZGM A;  4MAD A;  1RUE 3;  4C90 A;  4WZF A;  3THD A;  2B39 A;  1RUG 3;  1U5I A;  2UY8 A;  4Y24 A;  3SCF A;  3SH4 A;  2WS9 2;  4GKY A;  4QPG A;  4MYE A;  5FYI A;  4JTN A;  1QH6 A;  3ZXG A;  1JOP A;  2VUL A;  1CD3 G;  2XJV A;  3AKS A;  3MHZ A;  2PHL A;  4KH9 A;  2J42 A;  1Q5O A;  2JIC A;  5LBC A;  3OEB A;  4L97 A;  5FYU A;  1WMD A;  2LS6 A;  4DUV A;  4X8P A;  3OUH A;  5IWF A;  5C6C A;  1PGW 1;  3LEI A;  2QQO A;  2JEN A;  3IMM A;  3NAP A;  3GHN A;  1PGL 2;  2CNA A;  3P3P A;  1ZNP A;  1Y7B A;  2OPW A;  3JQX A;  3MPP G;  4YSF A;  2J7M A;  4QDR A;  4RS5 C;  1IQD C;  1V9U 2;  2WA3 A;  1Q8S A;  1W2U A;  1W03 A;  3E6D A;  4JCK A;  2ARB A;  2C4X A;  3S7E A;  4QGN A;  3GXU A;  5ERL A;  4RGG A;  2EAL A;  3K77 A;  3A0K A;  3R0R A;  3IDC B;  4WVM A;  5JAX A;  3I3E A;  1RUE 1;  4XC9 A;  1RUG 1;  2ZTN A;  1C4R A;  3VZO A;  2WT1 A;  2DUQ A;  3FLP A;  3BOP A;  4DXZ A;  1QJY 2;  4OZO A;  4ASM B;  2ZGP A;  1SHW B;  4BLJ A;  5A1A A;  2JX9 A;  4A7Y A;  5JMC A;  5FZM A;  1KS4 A;  4FOQ A;  2W68 A;  2BDR A;  1VBA 2;  4LO4 B;  4R9C A;  5EYY A;  2OUJ A;  1JYC A;  4KU8 A;  3ATG A;  4KBB A;  4S2D A;  1ST8 A;  1JHN A;  1UN1 A;  4RS5 A;  1FOD 3;  1MEC 2;  1WBF A;  1WKY A;  3H42 B;  5JZG C;  3TRS B;  3CZJ A;  3K75 B;  1LNS A;  1ND3 C;  5BNN B;  3ZYG A;  2VGD A;  4Z8B A;  5FPU A;  1MS3 A;  4NHY A;  3OJB A;  4JRA A;  1ZBE 3;  2ZS6 B;  2VZU A;  4KGQ A;  2JDM A;  1C5H A;  3EB7 A;  5A3U A;  5A1L A;  5GLT A;  1SQ4 A;  3ECQ A;  3AL5 A;  1VBC 3;  1BKZ A;  1OC1 A;  2DCZ A;  2PAM A;  1UKR A;  4NAO A;  4NMI A;  4CCM A;  5C8W A;  2JDZ A;  4K3U A;  5IVC A;  4N43 B;  4AL9 A;  1ULE A;  2J1R A;  1W8Z A;  1QU0 A;  2ZX1 A;  3MLK A;  5DZG A;  3QH7 A;  1L7Q A;  1FOD 1;  5FQ0 B;  2V73 A;  4XZP A;  2BV4 A;  3AMP A;  3HBZ A;  3PHM A;  2GP5 A;  1LHW A;  1ZBE 1;  5T5J A;  4CEW A;  4DRV A;  5FP3 A;  2UWA A;  1UCX A;  2IXJ A;  5DUW A;  3QOP A;  1H9P A;  2C9A A;  4DIQ A;  4P9X A;  1YFX A;  2OQ7 A;  1VBC 1;  5DMY A;  2ZCW A;  1CAV A;  4AI0 A;  4MLO A;  1RUO A;  4NE9 A;  4UF0 A;  4LEJ A;  3DF0 A;  4QHO A;  5LAT A;  1J83 A;  4URA A;  4PLO A;  5L9V A;  2UUR A;  1L3J A;  5A1F A;  5LW9 A;  1QQP 2;  4CRQ A;  3LDK A;  1VR3 A;  3H7J A;  4NOT A;  4XF1 A;  5FZC A;  3H1Y A;  4J1W A;  3U14 A;  2LUW A;  4JGZ B;  2YU2 A;  4ITC A;  2GN3 A;  2QCS B;  4LKS A;  4RA0 A;  4XAE A;  5DN2 A;  5T5P A;  1QF3 A;  5FJK A;  1LR5 A;  1QOT A;  4Q26 A;  4MXV A;  3MI8 A;  5IK8 A;  3OBT A;  5F5Q A;  4R52 A;  2GNT A;  2J1T A;  4XQ4 A;  1VBE 3;  5I0T A;  4TZD A;  3POW A;  3GJB A;  2A3X A;  2JG9 A;  2ZEY A;  3J9S A;  3T4H B;  3OPZ A;  1RUF 2;  3LPF A;  1PMI A;  2DYC A;  3BN6 A;  3UL2 A;  1IS4 A;  3DEM A;  1WCS A;  4ATE A;  4PBP A;  5F6K A;  3NV3 A;  4A6S A;  1GV9 A;  4I3G A;  4TXW A;  5JMO A;  2DUR A;  4LIT A;  4CDQ B;  5IT6 A;  3WR0 A;  1U5X A;  2JG8 B;  2P17 A;  4WV8 A;  1ULF A;  2UWB A;  5F5I A;  4AW7 A;  3D6E A;  3MLL A;  4OUE A;  4UW3 A;  4E9K A;  2VTX J;  2OPK A;  3KLS A;  4Y1Z A;  1ZRF A;  2C26 A;  1J59 A;  2VPV A;  2WNU B;  3KZ4 C;  2VG9 A;  1DGW X;  2DTY A;  2ET7 A;  1BZW A;  2BFU L;  1K12 A;  1VBE 1;  5A32 A;  1MS5 A;  3ILN A;  4LK6 A;  2E7T A;  1ND2 C;  3M3I A;  4IEX A;  3D3A A;  3ZLI A;  1R1A 1;  3O1U A;  1PK6 A;  4AG4 A;  1EY2 A;  2RDN A;  4XEZ A;  5FP4 A;  1QNW A;  2BBA A;  2WWU A;  4YWA A;  4H14 A;  4UFI A;  2ZX4 A;  4Y1V A;  5BNP C;  4LA2 A;  2VOX A;  5LK5 A;  3U11 A;  2YYO A;  3AKR A;  2ZGN A;  3V0A A;  4UXA A;  3JXS A;  3PTY A;  2FCT A;  1FAY A;  4YW4 A;  3B9C A;  4BQ5 A;  1H8T A;  2BWA A;  1OOP A;  2CGO A;  4COW A;  4I09 A;  3GHM A;  4YZ4 A;  1G9C A;  4K20 A;  2BW8 A;  3WUC A;  4PLN A;  3SH3 A;  2R07 3;  1ZA7 A;  1RHI 2;  3ACH A;  4P9W A;  2AGS A;  2CTV A;  1ZRR A;  3OBZ A;  4LQR A;  1V6L A;  4YPJ A;  2MNG A;  2DU1 A;  4FSJ A;  3LEK A;  2JIG A;  4YVS C;  1WW7 A;  2BYV E;  3EYP A;  5C9A C;  1N1V A;  5BNP A;  2VQA A;  1GP5 A;  4ATF A;  2VME A;  2R7E B;  3B9I A;  2JIJ A;  4BQY A;  4HK9 A;  4AGV A;  4NVP A;  2P4E A;  4NRQ A;  1ACC A;  1UZY A;  2XVL A;  1NT0 A;  1POQ A;  5FMD A;  4CDU A;  1MS1 A;  2UU8 A;  5KBF A;  1UY2 A;  3HN3 A;  4FPG A;  4W50 A;  5EYX A;  1HN0 A;  1US2 A;  2R07 1;  1FV2 A;  3ZMN A;  4BXF A;  1YC6 1;  2QQL A;  3GF6 A;  3MIF A;  3VD3 A;  3WP6 A;  4QX0 A;  4O61 A;  3WUD A;  4FAH A;  5DG1 A;  1SBF A;  4YVS A;  1AF9 A;  3MUZ 1;  5C9A A;  1NCQ A;  3HOB A;  4NRP A;  4FXG B;  1PGW 2;  5L73 A;  3FHA A;  4LUK A;  5DQ0 A;  1Q8P A;  3JU9 A;  2W5F A;  1X7N A;  2XLF A;  1N3P A;  2W46 A;  2BU9 A;  2CAU A;  3H9A A;  4CVU A;  3VL8 A;  4D6R A;  1K42 A;  4QU2 A;  1BK0 A;  1CJD A;  1Q8O A;  1X36 A;  2X53 S;  5A7Q A;  1WA4 A;  3A21 A;  2ENR A;  4K40 A;  4HSJ A;  1SDW A;  1UMH A;  1O3R A;  2W1U A;  5K0U B;  1RUE 2;  2ZZQ A;  4FP3 A;  5JSP A;  3ZIW A;  1RUG 2;  2WYS A;  2Q1F A;  3KT1 A;  1OA4 A;  5D8A C;  1MVE A;  1VRB A;  3ENR A;  3WNM A;  4ES9 A;  1E5I A;  5EQU A;  5JVV A;  1C8M 3;  2KXL A;  5D1I A;  2A5Z A;  4JGY B;  4LHL A;  4BIS A;  3HEI A;  3U4S A;  4HXC A;  1CR7 A;  1WMX A;  1SG3 A;  1XNB A;  1UXX X;  1ZZ9 A;  4AR2 A;  3KF5 A;  4LKF A;  1JW6 A;  2W08 A;  2GC2 A;  4IV1 B;  1LGC A;  4QU1 A;  5I0U A;  3MEP A;  3ZVX A;  4E4S A;  5C70 A;  3UKV A;  2R04 3;  5EXO A;  4I0A A;  3T2O A;  4QKD A;  1GQH A;  3BPS A;  3UGH A;  4F7Z A;  4OHW A;  5DUV A;  3ALQ A;  5KC6 A;  3ILF A;  3NJY A;  1WME A;  1JU4 A;  3SLI A;  1AX0 A;  1C8M 1;  1AR8 3;  2DF7 A;  1W6Q B;  3WHT A;  4CUA A;  4QHZ A;  4X8N A;  1CES A;  4D6S A;  4D7Y A;  3BTA A;  4OI0 A;  1SLL A;  5K8S A;  4BA6 A;  4NUB A;  5DZE A;  2D7F A;  3X29 B;  5L19 A;  4C0H A;  4QGL A;  1FOD 2;  3VGI A;  2WAB A;  3B69 A;  2K0G A;  4BQX A;  1W2N A;  1HQN A;  2W1Q A;  2W52 A;  3M8L A;  4XW3 A;  4AVV A;  2ZGT A;  2H6B A;  3G7D A;  5T5O A;  1ZBE 2;  3NV2 A;  4UOJ A;  5BNN C;  2R04 1;  4BE3 A;  2RS5 3;  4GJZ A;  4K7J A;  1W28 A;  2DDU A;  2WN2 A;  3ROU A;  3B5L B;  1V00 A;  3AZY A;  4MO3 M;  3U0Z A;  1VBC 2;  5GLZ A;  5FCC A;  1VIW B;  2JJ6 A;  4I01 A;  3R6S A;  1D4M 3;  1O4Z A;  4Q8L A;  5FZL A;  3T4V A;  2E63 A;  5A33 A;  1W6O A;  1AR8 1;  2XHK A;  3ORJ A;  2D3R A;  2ZZJ A;  2NMO A;  4D3W A;  4QX1 A;  5I93 A;  5GZG A;  3AZV A;  1I5P A;  1PGS A;  1W39 A;  3OYW B;  1KDK A;  4OHV A;  3USS A;  3VDD B;  2X09 A;  4N43 C;  3MBW A;  1QJE A;  5CNA A;  3THP A;  1RUC 3;  5CEH A;  2FMD A;  1VAV A;  2JB4 A;  2NM1 A;  5FXV A;  1OQE A;  3WNP A;  3T2Q A;  2F6B A;  4AFC A;  5F3C A;  4OYU A;  2XB6 C;  4YYO A;  4CU8 A;  1ZX5 A;  4Y4Y A;  3WW4 A;  3ETP A;  4GXL A;  1GZW B;  1AX1 A;  2A6Y A;  4QX5 A;  5DAX A;  4B8E A;  3USU B;  3OPT A;  3A23 A;  3BKZ A;  2RS5 1;  4XJ8 A;  4NHM A;  3KQR A;  3LA3 A;  4NJ4 A;  1PO2 3;  2XBO 3;  3SMH A;  4CEY B;  5CG8 A;  3H7Y A;  1AUY A;  2FD8 A;  1PX3 A;  2VXJ A;  4XZU G;  2VMH A;  1D4M 1;  1W9Y A;  2YZ4 A;  3V64 A;  4WM7 B;  4EE2 A;  4KGG A;  3CDZ B;  4OMD A;  5DUU A;  2VZR A;  4YW7 A;  4N43 A;  2BOI A;  1S0J A;  2KA3 A;  3RZZ A;  4PDW A;  1RUC 1;  3ZFG B;  2WSU A;  5E1R A;  2VNO A;  2JDN A;  3TEX A;  4BQ3 A;  5IVV A;  1TZO A;  3CMG A;  2E33 A;  5FQ0 A;  1XNA A;  3RSJ A;  4PI2 A;  4JGZ C;  1A34 A;  1RIT A;  2AEN A;  5CIR A;  5HPO A;  2JDH A;  4AAP A;  1W04 A;  2I74 A;  4P9J A;  4XDQ A;  1JOB A;  4P00 B;  3RYR A;  1SLT A;  3S0M A;  4AED B;  1PO2 1;  2XBO 1;  2EVX A;  3NNL A;  1XU1 A;  1VBE 2;  3ACL A;  3WD5 A;  5JWP A;  4XAC A;  5F2S A;  5CVR A;  3K46 A;  4UFL A;  4N53 C;  1R1A 2;  3PUR A;  1VAL A;  4AAX A;  4Q0V A;  4Y1Y A;  4L99 A;  4XIO A;  1OH3 A;  3S5Q A;  5FZ4 A;  5HCB A;  1GSL A;  3EXU A;  3POG A;  3OCP A;  1OLM E;  2AYH A;  1GAN A;  1ULO A;  1UXZ A;  1IQA A;  1HW5 A;  2OXB A;  4LHS A;  1N1T A;  1RUH 3;  3KGL A;  2HH9 A;  1G9F A;  4MV2 A;  5JXJ A;  3OD0 A;  1F8V A;  4I30 A;  2H0V A;  2D6K A;  3OTF A;  4JGZ A;  4CDQ C;  3RZJ A;  2QVS B;  1KJR A;  2F4P A;  3RYK A;  4OVE A;  5FTT C;  2IVI B;  2VNV A;  1LOF A;  1SBD A;  4CUB A;  5EFU A;  4D69 A;  1CX4 A;  2RV9 A;  5EZW A;  5AC9 3;  3O1O A;  2GC0 A;  4UYB A;  2WNU C;  2ZKL A;  2QQV A;  3L9J T;  2WZP P;  4XDO A;  3ELN A;  1BXH A;  1SMV A;  4HG6 B;  1MS9 A;  2EIB A;  4XUT A;  1UOB A;  4XFH A;  4A3X A;  2Y6K A;  2Z2S B;  1OFN A;  1JZ7 A;  1BLZ A;  4NWW A;  5FMO S;  2R0H A;  5FPX A;  4E4H A;  2IXI A;  2C1F A;  2D6L X;  2W87 A;  5A80 A;  4A6O A;  1RUH 1;  2VZS A;  4Z2A A;  2OVU A;  2JG8 A;  2W92 A;  3ZFE B;  5E88 A;  3HVD A;  4KG8 A;  1AXY A;  4XFI A;  2RG4 A;  3A22 A;  3AJY A;  1HQL A;  5CKN A;  3FMG A;  2YC0 A;  5I0D A;  4N8M A;  3ZYF A;  2EID A;  1YWK A;  1G7Y A;  2P3I A;  1J1L A;  5AC9 1;  4HVO A;  2R07 2;  3Q8A A;  3NST A;  2O0O A;  4QDQ A;  4XOG A;  4QGM A;  1Q8V A;  1YHF A;  2BP6 A;  3B94 A;  3HN1 A;  3TB0 A;  5KHG A;  1I1E A;  1HRV 3;  3MFA A;  4FPK A;  4MGK E;  4UAP A;  5IJR A;  3WLU A;  1NG0 A;  2Y64 A;  3BYW A;  3O7O A;  2HLE A;  3MIB A;  3DYM A;  4MHU A;  3RYP A;  5LA9 A;  1KXG A;  3BU7 A;  3ZDV A;  1CAU A;  4QPW A;  2VEC A;  3OUJ A;  4JHZ A;  1W8N A;  4E4Z A;  3SQO A;  2BER A;  4Y20 B;  1JUH A;  4AK3 A;  1GP6 A;  3OBA A;  4LBQ A;  1O5U A;  2YC4 A;  1GR3 A;  3UNP A;  3VD9 A;  3WG2 A;  4XVH A;  3WIN E;  5HCF A;  2QQN A;  1AYM 3;  1W9T A;  3LFI A;  2D6M A;  1SZB A;  4IL7 A;  1Q8Q A;  1WZX A;  1W9F A;  3IDB B;  4Z1V A;  1IZ3 A;  1DQ1 A;  5JI7 A;  2DVA A;  1XOY A;  5DG2 A;  4OI2 A;  3HWJ A;  5C4W A;  1HLC A;  1Q43 A;  1HRV 1;  1GFF 2;  1L7R A;  1IOA A;  5FUP A;  5FK7 A;  5LB6 A;  1FNY A;  3KWV A;  4CEW B;  2WAA A;  4NIG A;  2WZ8 A;  5J36 A;  1S0D A;  2F17 A;  5JPN B;  2ILM A;  3VKL A;  3WF2 A;  3LGR A;  2Q8C A;  1DQ6 A;  2ETE A;  5DAQ A;  3FX3 A;  1P8J A;  3LEG A;  3IBM A;  2QQU A;  4UF0 B;  5KXE A;  1O5L A;  5BXX A;  4DIN B;  2XJR A;  1AYM 1;  3D5O A;  5F39 A;  5FYC A;  4Y1X A;  5JSO A;  4FFF A;  4WM8 B;  2VAU A;  3KQ4 B;  2ZMN A;  4NPL A;  3KM5 A;  3GCW A;  4CDW B;  1C8M 2;  3MIH A;  1GOH A;  3DXU A;  3M3C A;  2ADE A;  4CU9 A;  1QGL A;  2GC1 A;  3BIW E;  5IAX A;  1F4A A;  2YDE A;  4B7K A;  3KCX A;  1TME 3;  3AKT A;  1LHO A;  3MW3 A;  5FYS A;  4YW1 A;  3PUI A;  1S55 A;  3U07 A;  2NMN A;  1XE7 A;  2YHJ A;  3P6B A;  5B4X A;  3BU0 A;  1XBF A;  2V5D A;  4CCD A;  4FTE A;  2A1X A;  2YGM A;  2GAU A;  4IE7 A;  4YW2 A;  1FPN 3;  1DHK B;  1LGN A;  2IXC A;  5FR3 A;  2R04 2;  4IV1 C;  2MHF A;  5D21 A;  5ANQ A;  5K0U A;  5LRS A;  1W2T A;  2GH8 A;  2IXK A;  2NZ9 A;  5FY7 A;  2QZ3 A;  3ZO0 B;  5M0T A;  3N9L A;  5IVF A;  4W6Y A;  2XML A;  4QPI B;  1AR8 2;  1QY4 A;  3AZZ A;  5CFD A;  3JD7 3;  1US3 A;  1OF3 A;  2BVB A;  4JGY A;  3W5M A;  4YM2 A;  5DAV A;  1TME 1;  1JH5 A;  3POY A;  2Y34 A;  4OMC A;  4LO7 A;  5A32 B;  1JZ8 A;  1AJO A;  2HEV F;  2FDI A;  1AL2 2;  1A6C A;  1W6M A;  4UFK A;  4XBN A;  4OZX A;  1PK6 B;  1XNC A;  4OLL A;  5L7O A;  1FPN 1;  2B7Y A;  1YJK A;  2VY0 A;  1HB1 A;  1VJ2 A;  3CQO A;  4AWD A;  4HT1 T;  4ZU5 A;  2RS5 2;  1CPM A;  1COV 3;  4JKM A;  3MV1 1;  4ZY9 A;  5B4N A;  5DAB A;  1DP0 A;  4LBQ D;  4CUC A;  5FKC A;  2VNR A;  4S2G A;  4BOW A;  3ZX7 A;  3V0A B;  1BJQ A;  5A3W A;  3CO2 A;  1D4M 2;  1XC6 A;  3OY8 A;  1SCR A;  4HBN A;  4LO5 B;  3TYJ A;  3W5N A;  3VBU A;  4COY A;  3DKQ A;  3NW4 A;  3R4S A;  1H8T B;  2BGO A;  4GKX A;  2A70 A;  1W0O A;  2HWB 3;  1OOP B;  2R0F A;  3JD7 1;  1W6Q A;  1JOD A;  3GZT B;  3H3U A;  4IEQ A;  4YG0 A;  4O7X A;  4NWV A;  1RUC 2;  2OYZ A;  1DZQ A;  3WDV A;  3O1M A;  3VDD C;  1N47 A;  1VAM A;  3AMM A;  5L36 A;  3ZIX A;  4M3C E;  2WL1 A;  2G9Z A;  5FZK A;  4AEK A;  2I45 A;  1FMD 3;  3HR9 A;  3POI A;  2ERF A;  1RUN A;  3E5Q A;  1ODN A;  4MG2 A;  2PFW A;  4MXW A;  1LAJ A;  3FJS A;  4IE6 A;  1W05 A;  3KCY A;  3AMQ A;  4C1W A;  4DEQ A;  1COV 1;  1UMI A;  1PO2 2;  1UL9 A;  2XBO 2;  2VVE A;  5C71 A;  2HWE 3;  4AHZ A;  4CEY C;  4AZZ A;  4L8Q A;  2R6Q A;  3ITQ A;  2VO5 A;  2CU5 A;  1V6J A;  3ZSL A;  4BQ2 A;  1H2M A;  4ET7 A;  1YNA A;  1OH4 A;  1QKQ A;  2HWB 1;  4QXB A;  4WM7 C;  3T0B A;  4CDU B;  4RGA A;  1CN1 A;  1WGP A;  2V4A A;  4OQ8 A;  2B45 X;  1B09 A;  3VUO A;  1RHI 3;  3ZFG C;  2FDF A;  5FP9 A;  5J48 A;  1FMD 1;  4G9S B;  4KWU A;  2WNE A;  5FYZ A;  1XXN A;  2K46 A;  1NCQ B;  4GH4 B;  1UIJ A;  2VU9 A;  3KF3 A;  3AKP A;  1RJ8 A;  1E5S A;  3O1S A;  1DU3 D;  2HWE 1;  3H8X A;  1WW5 A;  5JOX A;  4AED C;  3CIH A;  3O5S A;  4IEU A;  1XYO A;  4NRM A;  1FT9 A;  3H1W A;  5DDJ 3;  3AFG A;  1ASJ 1;  4XBL A;  4YRD A;  2IWG B;  1CWP A;  4Y5Z 0;  4K6B A;  3CL1 A;  2GH2 A;  3OGR A;  3AVS A;  4KMQ A;  2CSG A;  2VQ0 A;  4P9G A;  4ZPI A;  3ZFG A;  1RUH 2;  1GWK A;  4JTO A;  4XXP A;  1QXP A;  5FMC A;  1F35 A;  1U0A A;  3RI8 A;  4QPG C;  5FZI A;  5KHJ A;  2PAK A;  3K4D A;  3KMH A;  4DO0 A;  5IUQ A;  1W0P A;  2XPJ A;  1O3Q A;  3OOX A;  3OGJ A;  1REE A;  4R4X A;  4ZHN A;  3ETQ A;  4OUS A;  1YQ6 A;  1IKQ A;  3TN9 3;  5FYV A;  2PQS A;  3BOD A;  1KGY A;  3LWC A;  5DDJ 1;  3JUU A;  3VZN A;  1V6K A;  3OD4 A;  1AHS A;  3UES A;  4N9I A;  4QQH A;  2D3S A;  3ZFF A;  4CZS A;  2H6C A;  3AP5 A;  1JOJ A;  3M1H A;  5LBF A;  2ZAB A;  2VMF A;  1LHU A;  1VP6 A;  3KHC A;  3K48 A;  2VBD A;  3C3V A;  3SIS A;  1ALY A;  1S0G A;  2A71 A;  5FUI A;  3ZFE C;  1POV 3;  1JMU B;  1G86 A;  3QCW A;  2CWM A;  4QD2 A;  3A0N A;  3B00 A;  4UW6 A;  5F3G A;  1YXW A;  3CF6 E;  4XJA A;  4OUM A;  3TN9 1;  1PVC 3;  2IUW A;  4JC1 A;  4XHB A;  4YNI A;  1T6B X;  4E2Q A;  4W4Z A;  3KV6 A;  2OKX A;  2JD9 A;  1HRV 2;  1PMJ X;  1UF2 C;  3NL1 A;  1QOO A;  3PMS A;  4H7M A;  1MAC A;  5FV3 A;  5CKM A;  5K9Y A;  1CIY A;  2DWR A;  3ES4 A;  5DAW A;  2Y8K A;  2JKB A;  4AVT A;  1ENR A;  5FIX A;  4GB3 3;  5FY1 A;  1BK1 A;  4QDS A;  3AP9 A;  1BYH A;  2HJI A;  4HKO A;  2Q8E A;  5A33 B;  1W6O B;  1VRH 3;  3ZFE A;  4UI9 L;  4Q8K A;  4XYX A;  1POV 1;  1Y3T A;  4NAM A;  1HV0 A;  2Y6G A;  4L2N A;  5FO8 B;  1VBB 3;  1AYM 2;  2WWJ A;  3FC0 A;  3DGT A;  3J7L A;  4G4F A;  4CTE A;  3ZDS A;  1PVC 1;  2OA2 A;  2R16 A;  3H0O A;  5CU1 A;  4Q4Y 3;  1H2L A;  1FV3 A;  2DCJ A;  1UNB A;  2ORZ A;  4FOW A;  2Y6J A;  4ZKT B;  3KHB A;  5KXC A;  1APN A;  1IS5 A;  4FPH A;  3D0S A;  2DFB A;  3EO6 A;  4IW3 A;  4HON A;  1UQX A;  4AHY A;  2TUN A;  1QWR A;  1BBT 3;  3LDR A;  1LOE A;  2DVF A;  4GB3 1;  4CCK A;  4CEW C;  4AI9 A;  1QMJ A;  4UBG A;  1G6N A;  1W8F A;  4LHK A;  2W3J A;  4H2A A;  4Y20 A;  1O8P A;  1PVX A;  3NVC A;  3BPZ A;  3VB9 A;  1VRH 1;  2QJV A;  1UY0 A;  4XIK A;  1U5Y A;  3ES1 A;  3FHI B;  3AKQ A;  4H3W A;  4OUL A;  1NA1 A;  1VBB 1;  1YFY A;  4PDW B;  1NYW A;  3PUQ A;  2FDK A;  2OT7 A;  1PM7 A;  3WV6 A;  4Q4Y 1;  5EIY B;  4WM8 C;  4Q0P A;  1XU2 A;  3GM8 A;  3GBF A;  4HLT A;  2VOK A;  3WQ0 A;  4CDW C;  3D0J A;  2Y6L A;  4MGT A;  5FLI A;  1TME 2;  1ZRC A;  1BBT 1;  4XJZ A;  3RS6 A;  2O14 A;  2C9K A;  3DPR A;  2R1B A;  4GAZ A;  4Q27 A;  1TNR A;  1T2X A;  3NV4 A;  1JZ3 A;  1ULC A;  4RN5 A;  1O7F A;  2JG9 C;  3WDT A;  1FPN 2;  4IEV A;  5BNO A;  5I0R A;  2OS2 A;  2ZGS A;  4IXL A;  1LKN A;  5I8S A;  1Z7S 3;  4CPB D;  1Y9G A;  2YB7 A;  3U78 A;  4Y26 A;  4WM8 A;  1GZC A;  2XXZ A;  5FY5 A;  4XIL A;  1VBD 2;  4HK8 A;  4CDW A;  3WZ1 A;  3JD7 2;  2IFW A;  3D82 A;  4Q0Q A;  3WEZ A;  4CE8 A;  2VMG A;  1H8V A;  5LZ6 A;  4WBB A;  4XF3 A;  3SNM A;  1R1A 3;  3LF7 A;  4NPM A;  1LOD A;  1PK6 C;  2QQW A;  2HWC 3;  3JBG 2;  1COV 2;  3PTR B;  4Z82 A;  5FO7 B;  5L9R A;  1LRH A;  1PZ8 A;  3K4Z A;  2VOW A;  1Z7S 1;  3BVC A;  4HKL A;  2FZ2 A;  3HAG A;  2SLI A;  3AL6 A;  3B01 A;  1V6M A;  2BOJ A;  1WLW A;  3RPQ A;  4CXX A;  4QPI A;  2HWB 2;  2BFU S;  3RZL A;  1H8T C;  1TE1 B;  3O0X A;  2GMM A;  1OOP C;  2D44 A;  2R32 A;  5A6X A;  4NHK A;  4LOR A;  2W9X A;  1XSR A;  4Y5T A;  4XUN A;  5FY8 A;  3AP6 A;  3GZU C;  1WW4 A;  1W8H A;  2UYB A;  1DLC A;  1FMD 2;  3J4U H;  1DQ2 A;  4KU7 A;  4XQW A;  3N7L A;  3RJ2 X;  2H0B A;  3WNK A;  2A6V A;  1S0B A;  1J58 A;  2ZPX A;  4QX7 A;  2E7Q A;  3ST7 A;  2ZGL A;  1D0H A;  4HVR A;  2HWC 1;  5GZE A;  4RGK A;  4LBL A;  3SKV A;  2WLQ A;  2ZGR A;  2HWE 2;  3ZSM A;  1CAU B;  1GWL A;  2FCV A;  3VD5 A;  3I2D A;  5A7S A;  5FOJ B;  4RL7 A;  4P5H A;  1REF A;  5CA6 A;  4TLF A;  4MGS A;  4NID A;  1ASJ 2;  3AM2 A;  4LBQ B;  2B9V A;  4O65 A;  3OUI A;  4PF1 A;  1URX A;  1NLS A;  4QB6 A;  3VDB A;  4LKD A;  5GLW A;  4CDU C;  5KXD A;  4BIO A;  5JDB A;  2XQX A;  4XJ9 A;  2MEV 3;  1KRI A;  3H1M A;  1XB9 A;  5C4W B;  3TBD A;  2FQP A;  1S0F A;  4U2A A;  1UPS A;  3ZYI B;  2OUH A;  3IB3 A;  3KCC A;  3LQC A;  4JV4 A;  1EV1 3;  4QQP A;  2QDR A;  4SLI A;  4XAA A;  1W9S A;  5A3T A;  4GH4 C;  1NCQ C;  2G1M A;  4Y1U A;  1H4G A;  1SLA A;  3WNO A;  5FPV A;  1GLH A;  3H3L A;  3IWZ A;  1F5F A;  1ZZB A;  2G19 A;  5DDJ 2;  3ZKY A;  3ZXL A;  5JIU A;  2TBV A;  4QKF A;  1Z0H A;  4EYU A;  2XL7 A;  1UKG A;  4NIA A;  3RDI A;  3HJR A;  3B3Q E;  1VB2 A;  4XPV A;  1DFQ A;  5F3I A;  1I3H A;  2B5H A;  1DQ0 A;  2XJT A;  3KSC A;  1SLI A;  2D6P A;  3POE A;  3F95 A;  1EPW A;  2BWC A;  1W2A X;  3LZZ A;  4Y33 A;  5KHK A;  5FLH A;  2IXL A;  4EQV A;  3BIE A;  5EV7 A;  1JTZ X;  5CFC A;  2MEV 1;  4KWK A;  1WCK A;  1QIQ A;  2GDF A;  2Z79 A;  1OI6 A;  1WCQ A;  3LFM A;  3BI3 A;  3VBO A;  1S0C A;  3M3E A;  4YZ3 A;  1EV1 1;  1WCU A;  4GH4 A;  4R9D A;  5FP7 A;  1HB3 A;  3SCG A;  1SCS A;  4QKB A;  3SHR A;  5JOY A;  2MPF A;  4PHZ A;  3TN9 2;  3VLB B;  2VVD A;  2DV9 A;  1CZT A;  1ENX A;  3VBS B;  2CGP A;  5IW0 A;  1Q56 A;  3UJQ A;  1MZ6 A;  3NJX A;  4QQL A;  3MW2 A;  4QXH A;  4FFI A;  3WW3 A;  3TEZ A;  2Q0A A;  1OLR A;  3P1I A;  4FFH A;  4GAL A;  1O59 A;  1UX7 A;  3FLR A;  1DG6 A;  5LAS A;  2JEM A;  1RYY A;  1ZZ6 A;  2EIE A;  2RS3 3;  2QTW B;  3AXE A;  4HFS A;  1OUS A;  2QDN A;  4MHR A;  1H9W A;  1K45 A;  2NYY A;  4NHX A;  3PDQ A;  4W8J A;  5CFD B;  1A78 A;  2YMZ A;  1OVS A;  4DXR A;  4EZH A;  1JI6 A;  2BUK A;  1YEW A;  2C24 A;  2NLR A;  2DCT A;  4WVW A;  1R09 3;  2D93 A;  1PVC 2;  1GNY A;  2WSV A;  4AVB A;  4IEW A;  1W6M B;  3ON7 A;  3SEP A;  2E26 A;  2HYX A;  2P3J A;  3TNP B;  3I2F A;  3V65 A;  4TWT A;  1DYP A;  4KNC A;  5L7O B;  2QQI A;  5GKA C;  1QJX 3;  1VLN A;  4MUV A;  4NN0 A;  4URT A;  2QBX A;  4GB3 2;  2QUO A;  5GM0 A;  3ZKU A;  1IPJ A;  1W3X A;  3WCS A;  4MSV A;  4P9L A;  1PIV 3;  2EIC A;  4UBH A;  3VL9 A;  1V6O A;  2ZHM A;  4I0W B;  3OY8 B;  2RS3 1;  3VBU B;  1VRH 2;  4W6W A;  1MZ5 A;  5C3S A;  1LB2 A;  4JX0 A;  1QXJ A;  3TAY A;  2GME A;  4YAR A;  3DEC A;  3GYD A;  1O3S A;  1VBB 2;  5C8C A;  4PIY A;  3KVB A;  1V70 A;  1R09 1;  2DCK A;  1X9T A;  2PHU A;  1W0N A;  2RMU 3;  4P08 A;  4Q4Y 2;  4AFD A;  4JVA A;  5D2A A;  4PI0 A;  4XUP A;  4Z07 A;  1AL2 3;  1C28 A;  2GN7 A;  3RQ0 A;  4Q5O A;  4MXW B;  3N4M A;  1S4C A;  2WNV B;  1QJX 1;  5G05 L;  3AYA A;  2W2I A;  2TNF A;  1BBT 2;  3B02 A;  4J25 A;  1UYZ A;  3WDU A;  2VUC A;  1YI7 A;  2UY9 A;  3LE0 A;  3HD8 B;  4GMP 3;  4ONU A;  5J98 B;  3WCR A;  1FX5 A;  1PIV 1;  4FPF A;  1XPW A;  4YLZ A;  2VE1 A;  5GZD A;  1DQ5 A;  3HNB M;  4M3C B;  4XET A;  4HN0 A;  3AYC A;  3FFQ A;  3T1L A;  2ZGQ A;  5FMB A;  4CU7 A;  1X82 A;  5BUV A;  1EYB A;  4IGP A;  2KD7 A;  1JZ2 A;  3A7Q A;  3ZYJ B;  1Q3E A;  4EN9 B;  5CKQ A;  1F31 A;  3S30 A;  3PL0 A;  3ZSJ A;  4XF4 A;  1BQP A;  3U4X A;  3W9A A;  2XVG A;  4PDW C;  2RMU 1;  5K7P A;  4IEP A;  3VV1 A;  4AVC A;  1AL2 1;  1HJF A;  5GLV A;  4BHP A;  1L7L A;  1H30 A;  2VZ1 A;  1RUJ 3;  4EV0 A;  1K5M B;  4MVT A;  5HXV A;  4ISQ A;  4HN1 A;  1C1F A;  2O8O A;  4IGO A;  2DVB A;  4EWA A;  4GMP 1;  1AYN 3;  1AVB A;  4LNV A;  1OA2 A;  4EN0 A;  3PME A;  2ZGU A;  2YU1 A;  1XYN A;  3MPB A;  2QNK A;  5F8P A;  3Q9O A;  4RR3 A;  3I49 A;  5F9T A;  1HV1 A;  3ZR5 A;  2XWJ B;  4J6G A;  1V6N A;  1SLB A;  3EHK A;  3KT4 A;  1W6P A;  3IT8 A;  1E5R A;  1YFU A;  5JSR A;  1JBC A;  2D3P A;  3OGG A;  4BH9 A;  4I2O A;  3PIG A;  4CCO A;  4DPN A;  1Z7S 2;  4DS0 A;  3N7J A;  4LUM A;  4LOS A;  2BPA 2;  5F5A A;  1XYP A;  3NNM A;  3LSE A;  2DUO A;  2DCY A;  3EQE A;  1WD4 A;  2J1E A;  4XFG A;  3J26 N;  1RUJ 1;  5KHH A;  3A4U A;  4C1X A;  3OG2 A;  1F2N A;  4UWD A;  5A7N A;  5I8T A;  1LOF C;  2PN5 A;  3THC A;  5F1R A;  2W95 A;  1AYN 1;  3LKJ A;  5FPL A;  3UT0 A;  1GNH A;  2HEY F;  3PUH A;  4PCR A;  1YFW A;  1ZZ8 A;  1OBN A;  3E5X A;  2Q8O A;  2VXR A;  3IMN A;  2XKP A;  1JXN A;  2EF6 A;  4FOV A;  4I02 A;  4COZ A;  1E5H A;  3MLJ A;  1KFX L;  2W47 A;  2HWC 2;  2P1B A;  3ZFF B;  5LEK A;  3JQW A;  2HBU A;  1MS4 A;  3NMB A;  2VBP A;  1DDL A;  1YQ5 A;  1YQ8 A;  4ZZ5 A;  3S7I A;  3WT3 A;  4GA9 A;  2PQQ A;  3UGF A;  2PA7 A;  1YRZ A;  1LHV A;  4TLG A;  1D2S A;  4EWD A;  2FMY A;  2WC2 A;  2Y60 A;  3FUQ A;  5CZK A;  1F15 A;  2JG8 C;  3NV1 A;  1UYY A;  4FCA A;  4AHX A;  5LA0 A;  4SBV A;  5A3L A;  2XLG A;  2HBT A;  4O9E A;  2I2S A;  3T3Y A;  2WO1 A;  3AFK A;  1KDM A;  4BQ4 A;  1RUD 3;  1OLM A;  3K3O A;  3DUI A;  1DZT A;  4LJH A;  1W8U A;  4BXS V;  4MGY E;  4LUL A;  3BUC A;  2BNM A;  5CYY A;  1RXF A;  1BCX A;  1VMH A;  4BPZ A;  1NZI A;  1J3R A;  4LHN A;  1WLD A;  5AFB A;  5FWE A;  1OKO A;  1YLL A;  2WT2 A;  3WDY A;  3PNA A;  4K1Z A;  3WF1 A;  2WBK A;  4XF0 A;  4XFA A;  4NR1 A;  4ZON A;  2QQM A;  4L9B A;  3M70 A;  4D94 A;  3ME2 A;  2CY6 A;  5JI9 A;  3C8X A;  3VDC A;  1HJG A;  1YYN A;  5FRE A;  5KHI A;  1QDC A;  3T2T A;  1RUD 1;  2YBS A;  4W6X A;  2GSY A;  4XFF A;  2MEV 2;  5BY5 A;  1YUD A;  1YO8 A;  4R9B A;  4Y4R A;  5DAP A;  3CBN A;  4BK4 A;  3VBR B;  4FBF A;  5C4W C;  1EV1 2;  3D8C A;  5FUN A;  3WP5 A;  3C7G A;  1NUK A;  1EP0 A;  3POS A;  4B7E A;  3ILR A;  2R06 3;  1M4W A;  2P3Y A;  4QT6 A;  4R4Z A;  5KC5 A;  1X50 A;  2P2K A;  2Y0O A;  4EWE A;  2JB8 A;  2PEL A;  4NPR A;  3UET A;  5FPB A;  3FWE A;  3MDP A;  3VHR A;  3V56 A;  1OMI A;  1TVG A;  3N9P A;  5FP8 A;  3TWI A;  3KS7 A;  3ZSE A;  2Y33 A;  1NA1 B;  1OD5 A;  2VZT A;  3VBF B;  2VZV A;  2HYK A;  3G6J B;  5LY2 A;  5A6Z A;  2B42 B;  3GJA A;  3PJQ A;  1MZF A;  2QFE A;  5T55 A;  4XHX A;  3BTY A;  4GZ9 A;  3E1F 1;  5FY9 A;  1PX4 A;  4ERO A;  3NWK A;  2LRO A;  3RI9 A;  3B93 A;  3TNQ A;  3AC0 A;  2VUD A;  4A42 A;  5LEJ A;  1W99 A;  2P3K A;  2R06 1;  3MF6 A;  4IE5 A;  1WD3 A;  5FYB A;  1JYW A;  2PAE A;  3I2O A;  3DPR B;  4Q0U A;  5SV5 A;  4YFW A;  4YGE A;  2BJS A;  3HMY A;  4K8R B;  4N9H A;  3WG4 A;  3VN4 A;  4ZS2 A;  4XQD A;  3SXW A;  3VBS C;  4AEJ A;  1UU4 A;  5BNO B;  2ARX A;  2YPJ A;  3OGV A;  5FRA A;  4A4A A;  3N9N A;  4E2S A;  5JOZ A;  4E4D X;  5JZG B;  3OSD A;  3UK9 A;  4B1M A;  1B35 B;  4QX2 A;  2EA7 A;  5JLV A;  3E5U A;  4IES A;  4IDZ A;  2VQT A;  2JE8 A;  5EJ1 B;  2RS3 2;  3WF3 A;  5BYN A;  5K0U C;  3T2P A;  1CZV A;  3RRD A;  2HWF 3;  4D6Q A;  4NII A;  3M7A A;  3BB6 A;  3ZXF A;  5A3O A;  4XXA A;  5CFD C;  4U36 A;  3C7F A;  4JGY C;  1R09 2;  4FI9 A;  4ASL A;  5FK8 A;  3WF0 A;  2BBV A;  1S1A A;  1R64 A;  4AXO A;  3H8R A;  1LEC A;  2CWS A;  3PU8 A;  1XSQ A;  1W6N A;  2NQY A;  1QDO A;  3VBS A;  3MIG A;  4CDX B;  1LHN A;  3BCW A;  5JCT A;  1LOC A;  4TTG A;  4HKW A;  4PT6 A;  4M01 A;  1QJX 2;  2XQR A;  3VKN A;  5L7O C;  3ASI A;  1S2K A;  4JZR A;  3N3H A;  3IM0 A;  4BDV B;  2FBE A;  2X8K A;  5LY1 A;  4H7L A;  4CA9 A;  4B29 A;  1PIV 2;  2Z42 A;  2W94 A;  1CGP A;  2EXK A;  2JEC A;  1BVV A;  5F5C A;  4D0Q A;  3UJO A;  4Y5S A;  4BME A;  2HWF 1;  1VBD 3;  2BZD A;  3VBU C;  4LLO A;  3PUA A;  1LJ7 A;  2RR1 2;  4B4P A;  1JZ5 A;  3FN9 A;  4RHV 3;  2J1S A;  3AXD A;  4L92 A;  4MH0 E;  4XAB A;  1CZS A;  4XCB A;  2RMU 2;  1PO1 3;  4X6Q B;  5JOW A;  5I0S A;  2VM9 A;  2AEY A;  3ZXK A;  4R8H A;  4JDN A;  3SCH A;  5FY4 A;  3LEM A;  1OKQ A;  4LLF A;  2WO7 A;  3T08 A;  3LCP A;  3ZXD A;  1IKP A;  5CAD A;  2B9U A;  2WNV C;  3JBG 3;  2K2S A;  2VTX A;  3N36 A;  4GQ7 A;  1XE8 A;  2VZQ A;  4LOT A;  5FYT A;  5EP9 A;  5H9R A;  4EN6 B;  1XJA A;  4QB1 A;  4LMF A;  3U1X A;  3Q8E A;  2VCA A;  4JHT A;  2VC9 A;  3BAL A;  1S2B A;  2XL9 A;  2GMP A;  4PBO A;  4EJR A;  2NN8 A;  1VBD 1;  5EJ3 A;  4QM8 A;  3LOB A;  4AQT A;  5FAX A;  1LOB A;  4ZU4 A;  4RQP A;  1XND A;  1IHM A;  1BHG A;  4RFR B;  4RHV 1;  2FDG A;  4GWN A;  4A44 A;  4MGQ A;  1RXG A;  1PO1 1;  2BRT A;  5FJH A;  2JDP A;  3JCI A;  4K8F A;  5BNQ A;  2R30 A;  1RUJ 2;  4RD7 A;  2YY1 A;  1MQT A;  3ZM8 A;  2NPI A;  4Q4W 3;  2WNV A;  3AMN A;  2CDP A;  3LDB A;  3MYX A;  4Q4X 3;  4YGC A;  1N1S A;  1K5M C;  3WG3 A;  3JBG 1;  4Q2F A;  3E6B A;  5E6H A;  1AYN 2;  1ZBA 3;  2ORX A;  2V72 A;  3ZMO A;  4AE2 A;  1SPP A;  1VPH A;  1YIF A;  3CZU A;  2EXH A;  1RC6 A;  3JB4 C;  1RGS A;  4HET A;  4M3C A;  4YVW A;  1QH7 A;  4BMB A;  1ASJ 3;  1Y43 B;  1SDD B;  3DYP A;  1LOG A;  4XMA A;  2QE3 A;  4M4P A;  4CCJ A;  1AR9 3;  4AI2 A;  2F4L A;  4NRO A;  1IPK A;  1OUX A;  1S0E A;  2DU0 A;  2VJX A;  3K4A A;  3UYJ A;  2UWC A;  5IVB A;  1GOF A;  1D7P M;  5CFC B;  4N7I A;  5A70 A;  2E31 A;  1LEM A;  2AZ5 A;  3W58 A;  5I91 A;  1BMV 1;  3BTZ A;  3VBO B;  1J84 A;  1HIX A;  3NNG A;  5FOB B;  1J3Q A;  1NCR B;  1K5M A;  4Q4X 1;  2EIG A;  2YG0 A;  4Q4W 1;  4BM8 A;  1AZD A;  4DXS A;  4EN8 B;  1W9W A;  3ZOI A;  4FTB A;  1ZBA 1;  3NJV A;  5CB7 A;  1KQR A;  2Q4S A;  2YFZ A;  5HXM A;  4LPL A;  1OUR A;  1SEF A;  3CHX A;  5FPZ A;  1UOF A;  1D4V B;  4PLM A;  2JE7 A;  4OI4 A;  1AR9 1;  1NQJ A;  2Q1Z B;  2QQP A;  1HQW A;  1DGW A;  4KI5 M;  2BVV A;  1G9D A;  3ZFF C;  4OI1 A;  3KVA A;  3PIJ A;  2VW0 A;  2XJS A;  3I2J A;  1MR5 A;  4S2H A;  4IV3 A;  3GCX A;  2OII A;  4BQ1 A;  3KGZ A;  4CXY A;  5FZ1 A;  5JXH A;  4HL0 A;  1ZM1 A;  1HKD A;  4V1P A;  4P5Y A;  3PVB B;  4BK5 A;  5C33 A;  1CAX A;  1OSG A;  4LE3 A;  1RUD 2;  2XUE A;  4IE4 A;  2JWP A;  4PJY A;  1IGO A;  2RDR A;  3W59 A;  5FZO A;  4E27 A;  3B7M A;  5C5T A;  2PHT A;  1O6U A;  3IZO A;  3JZV A;  3LA7 A;  2ZHL A;  2E7A A;  3AK0 A;  5J96 B;  1D0G A;  1IG0 A;  2ARE A;  3S6P A;  5JXG A;  4OQ9 A;  1ZRE A;  1EPZ A;  2ARC A;  3QLQ A;  4YM1 A;  4YFZ A;  3C7O A;  3OBR A;  3VDA A;  4A2U A;  2AH2 A;  2YFU A;  2D5H A;  5DXD A;  4UW5 A;  3PJY A;  2DBN A;  2NP0 A;  4LIU A;  3I3Q A;  3HT2 A;  4CPB A;  3I8T A;  1HXS 3;  2ZBJ A;  4JAA A;  3ACI A;  3UGG A;  2IZW A;  5C8C B;  4XJU A;  3KT7 A;  3GZA A;  5ISL A;  2PYT A;  4K1Y A;  2SBA A;  3GAL A;  3N7K A;  4LBK A;  1JYI A;  4N7U A;  4YZ5 A;  1GQG A;  4XUO A;  3ZYP A; 
#chains in the Genus database with same CATH homology
 5FP3 A;  4BXF A;  4HON A;  4QXB A;  5FZG A;  2GP3 A;  4Y4R A;  5FXX A;  5FXZ A;  5A3N A;  5FUP A;  4CCK A;  5FZB A;  4DIQ A;  4AI9 A;  4CCL A;  2OQ7 A;  5FUN A;  4IGP A;  5LWB A;  4EZ4 A;  5KR7 A;  5FP9 A;  4UF0 A;  4URA A;  2Q8C A;  5FJH A;  5A3T A;  2Q8D A;  4IGQ A;  5FYZ A;  4QX8 A;  5FZ3 A;  5FPB A;  5FPV A;  5A1F A;  5IVV A;  5LW9 A;  5F3E A;  4UF0 B;  5FZC A;  4QXC A;  4D6R A;  4XDP A;  3LDB A;  3N9P A;  5FBJ A;  5FP8 A;  2VD7 A;  3PUQ A;  2OT7 A;  5IVJ A;  2YU2 A;  4AAP A;  5A7Q A;  4C8D A;  5E6H A;  4EYU A;  5F37 A;  5FZ0 A;  5FYM A;  5F39 A;  5F3I A;  5FYC A;  5F2W A;  5LY2 A;  4IGO A;  5FJK A;  4ASK A;  4LIV A;  3KV5 A;  4Y33 A;  5F2S A;  2P5B A;  5FZ8 A;  3AVS A;  2YU1 A;  1VRB A;  5FY9 A;  3DXU A;  4CCJ A;  3PUR A;  5FZ9 A;  4GAZ A;  5IVB A;  2YBK A;  3UYJ A;  5FYS A;  5FZ4 A;  5FYI A;  5FYB A;  4BIS A;  4QWN A;  2PXJ A;  5FP7 A;  3U4S A;  4CCO A;  5FZI A;  3K3N A;  4Y3O A;  5FYU A;  5FZA A;  4DO0 A;  2OS2 A;  5FZ7 A;  5F5A A;  3OPW A;  5IWF A;  4LIT A;  4V2W A;  3U78 A;  3KV4 A;  4CUG A;  4QU1 A;  5FZF A;  5FWJ A;  5ANQ A;  3N9N A;  5F5I A;  5FYV A;  5IW0 A;  2XXZ A;  5FY5 A;  5FY7 A;  4QXH A;  5FY0 A;  5A7N A;  4BU2 A;  4CSW A;  3N9L A;  5IVF A;  5A7W B;  3AVR A;  5FPL A;  2XML A;  3K2O A;  2OQ6 A;  3NJY A;  4XDO A;  4D6Q A;  5FZH A;  3DXT A;  4CCN A;  5F32 A;  3KVA A;  5FYY A;  3ZLI A;  4D6S A;  3PDQ A;  2YBP A;  2YPD A;  5FP4 A;  4NUB A;  4E4H A;  2WWU A;  5A80 A;  4EZH A;  4LXL A;  5FPA A;  3PU8 A;  4GJY A;  5FZ1 A;  5FZM A;  3N9O A;  4V2V A;  3PTR B;  2XDV A;  3ZPO A;  5F3G A;  5K4L A;  2XUE A;  3AL6 A;  5A7W A;  3N9M A;  5LY1 A;  3KV6 A;  5FZO A;  5A7O A;  4TN7 A;  3LD8 A;  4GJZ A;  5A3W A;  5FPU A;  3K3O A;  5FYH A;  5FV3 A;  5F5C A;  5FZO B;  4GD4 A;  5FY8 A;  5FZL A;  5A1L A;  3PUA A;  3AL5 A;  5IVE A;  5A3P A;  5FY1 A;  3N9Q A;  4CCM A;  5FWE A;  4HOO A;  2Q8E A;  4QX7 A;  5FZK A;  5CEH A;  5IVC A;  4LIU A;  3KVB A;  5FXV A;  5F3C A;  5IVY A;  2OX0 A;  5FY4 A;  2WWJ A;  5A7S A;  5FXW A;  3KV9 A;  3PUS A;  5FZ6 A;  5A7P A;  5ISL A;  5FYT A;  5FZD A;  3OPT A;  5FZE A;  3PU3 A;  2W2I A;  3RVH A;  2YBS A;  2GP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...