5FZIA

Crystal structure of the catalytic domain of human jarid1b in complex with mc3095
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
462
structure length
461
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKLGGGGARDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDGIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with Mc3095
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 147
structure length 461
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fziA01
5FZBA 5IVEA 5FZKA 4CSWA 5F37A 4NUBA 4HOOA 4V2VA 4TN7A 5F3IA 4BISA 3KVAA 5LWBA 5A7PA 5IW0A 5FYIA 2Q8CA 5IVVA 5A80A 5IVFA 3OPWA 2P5BA 4LIUA 5FZ3A 5A1FA 4QU1A 5ISLA 4CCLA 5LY1A 4Y4RA 5FJHA 5IVYA 5FZCA 5FZFA 5FZ1A 3PURA 5FZEA 4IGOA 5FUNA 3KV4A 5IVBA 5FPVA 3K3NA 5FYCA 5FYUA 3DXUA 2XMLA 4Y33A 3LD8A 5FZ0A 5FY7A 5FZIA 5K4LA 3U78A 4XDOA 5FPBA 3ZPOA 4QWNA 2XXZA 5FBJA 5FZ9A 3PU3A 2Q8DA 4CCMA 4ASKA 4CCKA 5FP4A 5FY8A 5F5CA 5FY0A 5ANQA 2YPDA 5FZLA 4AI9A 5FV3A 5F5AA 5FYHA 5FZOB 4QXHA 4XDPA 5F5IA 5FYSA 4UF0B 5IVCA 5FZ7A 3N9NA 2XUEA 4GAZA 4V2WA 4Y3OA 2OT7A 4LXLA 4DIQA 3K3OA 5FYMA 3OPTA 5FJKA 5FY4A 5FZMA 4GJYA 3KVBA 5FYTA 2PXJA 3UYJA 2GP3A 5FZ8A 2XDVA 3K2OA 5FY5A 5FPLA 5FZHA 4CCNA 2OQ6A 2OS2A 3AL6A 3U4SA 5A7OA 3PUQA 4QX8A 5FZ6A 4E4HA 4UF0A 3PTRB 5FP3A 5F39A 3N9LA 5FUPA 5A7QA 3ZLIA 5FPAA 5A3NA 5LW9A 5FYBA 3AL5A 5A7SA 4EZHA 5KR7A 3N9PA 5FZAA 5A3TA 5F3EA 5IWFA 2Q8EA 4BU2A 3PU8A 2W2IA 4GD4A 5FZGA 3PUAA 5FWJA 4HONA 4CUGA 3N9QA 3N9MA 2OX0A 5FYVA 5FY9A 5A7WB 3DXTA 5A3PA 2WWUA 2OQ7A 3NJYA 5F3CA 5A3WA 4EZ4A 3PDQA 4QXCA 5F32A 5LY2A 3KV9A 2YBPA 5FXXA 5F3GA 3KV5A 5CEHA 5FXVA 4BXFA 2YBKA 5A1LA 1VRBA 4D6RA 5IVJA 4GJZA 3KV6A 5FP8A 5FZOA 5FP7A 5FZDA 5FZ4A 5A7NA 5FXZA 4D6QA 5F2SA 5FP9A 4URAA 2GP5A 5E6HA 5FWEA 2VD7A 4CCOA 5FYYA 4IGQA 4D6SA 3LDBA 4CCJA 4DO0A 5FXWA 4IGPA 3AVSA 5A7WA 4C8DA 2WWJA 4EYUA 3PUSA 2YU1A 3N9OA 5FY1A 4QX7A 3RVHA 4AAPA 5F2WA 5FYZA 3AVRA 5FPUA 2YU2A 2YBSA 4LITA 4QXBA 4LIVA
chains in the Genus database with same CATH superfamily
1RUE3 2BV4A 4XTMA 4CDQA 2RDNA 2WT1A 1TME2 4HOOA 2D3SA 3WNKA 2JB8A 4LE3A 1K5MA 1OC1A 4JGYB 5EV7A 4H7MA 5FUIA 3ZX7A 3I2JA 2NQYA 3VBHA 2VMHA 1D4M3 3OUHA 4P9YA 2D6OX 3ENRA 4B7EA 5GZCA 3Q8EA 4GALA 5ISLA 4AW7A 2NZ9A 3KT4A 4QPGC 1VAMA 2OUHA 3K77A 4AVBA 3OJBA 4ZU5A 1OUSA 5FZ1A 3MIBA 4ZS3A 2Y26A 3SEPA 1ND2B 1JXNA 3VBOA 1NE4A 3AKPA 2DCYA 5EQUA 1PZ9A 2OXBA 3RPQA 4IV1A 4QWNA 3WG4A 2E63A 2ZMKA 3PU3A 4CCMA 5JVVA 5JLVA 2RE9A 2WS91 1JOPA 3T0DA 1U5IA 4QQOA 1UOBA 3VV1A 2YPDA 2DV9A 4NIDA 1GNHA 1QQP2 4RR3C 3NJXA 4MZUA 4BK4A 3OOXA 3DN7A 3LCPA 5A6YA 2FZ1A 5AFBA 2QCSB 2WO1A 2ZXQA 5ABJC 1CZSA 1V70A 4I0WB 4XXPA 3WDTA 4E9KA 4PI0A 4PJYA 4TLGA 1OF4A 1LGNA 2K2SA 4HVRA 1CAVA 1WBFA 3AZXA 2RDRA 4OFGA 3KF3A 4CDUB 4CDXA 4XFAA 3MIHA 3VB9A 1UF2C 2ZX4A 4AEDA 2IC1A 3CZJA 1QJU3 3P3PA 2QE3A 4A44A 1S1AA 4GMP3 2BBAA 4QAWA 3X29B 4DFSA 1BXHA 3NNFA 1AHSA 1ENQA 2JEMA 4YM1A 4Q8KA 2BGPA 2RMU3 5A3NA 4DRRA 2JDHA 2EXKA 5JPNB 1UNBA 3HBKA 4LK6A 2ZGTA 3ZR6A 3N9PA 2W3JA 4YZ3A 1QWRA 5FKCA 3MHZA 2C0ZA 1H8TB 4ITCA 5GZGA 3IDBB 4MV2A 2EIBA 4LBNA 3D8CA 3SH3A 4XAEA 3VBRB 1CPMA 2JDYA 1W9YA 1XQNA 2JE7A 4NPLA 3VZKA 3WDVA 4LKEA 3SCGA 3KQRA 4RD7A 4YGCA 2Z2SB 2ZOEB 3AFKA 2R1DA 5C7GA 3KMHA 1JYCA 4PLMA 2XQXA 2JE9A 4BXFA 2PHTA 3MUZ1 4IEZA 1QH7A 2WNVB 1GWMA 4AFCA 1RGSA 5CG8A 1ZBA1 4FXKB 3DKWA 4COVA 2NM1A 4Y4YA 5GZFA 2C9AA 4KWLA 3USUB 5I8TA 1ZNPA 1D2QA 4GMP1 4CCOA 3VD9A 2ENRA 4FPCA 3THDA 3ZYRA 4E2GA 2ZGMA 2ZGQA 5FXWA 3LEKA 1UXXX 3MW2A 4KU8A 3O1UA 3QACA 2VXRA 3OBAA 4EN9B 1ZZ9A 2ZPXA 4C0BA 1YUDA 4WM8B 1H9WA 4JQTA 1AJOA 3NV3A 2VOXA 3GZAA 1OURA 4Q4Y2 5BPXA 2YU2A 3CJIB 3VDDB 2J1TA 3LSEA 1QJX2 4L92A 4JHTA 1N1SA 4IEPA 2HWB3 4PLOA 4QDRA 3WNNA 1KDKA 1IKPA 4FPOB 1BEV3 3AMPA 4MX3A 3E6DA 4YW6A 4JTNA 3S57A 5J7MA 3MDPA 3HT1A 5DN2A 4OLLA 4DUWA 1IS3A 2VVDA 1IS4A 3OYWA 4Z92B 2WABA 3B93A 2P5BA 4UT5A 5FOJB 1NUKA 1VBB3 3CO2A 2PHLA 1DGRA 4LO4B 3I4IA 5FZFA 3WG2A 3WG1A 3WF1A 5C9AB 1BJQA 5DG1A 4H7LA 1CWPA 1F5JA 1RUH2 3ATGA 1OQDA 5FZ0A 3RYKA 2JD9A 2LUWA 4JC1A 2X5IC 2GNMA 4QHBA 1LOFA 2XJUA 1NAEA 2QUOA 3VBSA 5L7OB 4AI9A 1JZ8A 2BRTA 4RFT0 1OH3A 2HBTA 4LBQD 1W6PB 3FJSA 4XAAA 2HWB1 5BV6A 1OFNA 5FMOS 4BQ2A 4BMBA 1BEV1 1W9SA 3OBZA 5EJZB 4GZ9A 1FATA 2JENA 1OD3A 4GKXA 1FPN3 1LAJA 4MGIE 1RJ7A 3HN1A 3VL9A 3RMXA 2YB7A 1CR7A 4XF0A 4BZ4A 2WNUC 3HNBM 1ZRIA 4NRPA 5B2GB 1UL9A 3GJBA 1S0JA 4TZDA 3VKOA 2XB6C 4ZONA 1VBB1 2GP3A 2WYFA 3O12A 2ZACA 1R1ZA 3ECQA 3WHUA 1ULCA 3ACHA 1O3SA 4HBNA 1GZTA 4Q0UA 1UQXA 4HSLA 1E5SA 5FMBA 4N53C 3KCYA 3OD0A 2NMOA 3UJOA 2QQWA 1TVGA 3B9IA 3RQ0A 5KC6A 5FP3A 5A7QA 3N9LA 2IVIB 1WGPA 1AXYA 3HQXA 5I8YA 4FFFA 2BFUS 4BIFA 1C28A 3QOPA 2BVVA 3S5QA 3VBUB 3NKGA 4BU2A 2L9LA 2W2IA 1IG3A 4M3CA 4IE7A 3POGA 2XLGA 1RVF2 4CUGA 2CGPA 4URTA 4XF3A 4XUQA 1VBE3 3MGUA 1OOPB 1FPN1 4HG6B 1JYVA 4G4FA 1VBC2 4H3WA 4Q0SA 1NXD1 2ZHMA 5DZGA 2JIJA 4XUTA 4AGGA 4LPLA 1PGL1 3ZN6B 4CU9A 3ZOIA 1RUD3 2VMEA 4XETA 2B42B 5AC92 1QOSA 1OFSA 4E2SA 1AR83 1XYOA 2DCZA 5C5UA 5G04L 5CAZA 3ACFA 4Y1VA 2RG4A 3VHRA 3KV6A 3OY8A 3M2MA 3I54A 4JAAA 3VD3A 4Y22B 4PI2A 1LJ7A 3ES4A 1Q8VA 1EUTA 1N3QA 2A7AA 5KBFA 2ZABA 2JX9A 2QBXA 3NNMA 2AACA 4ORFA 4UBHA 3DGTA 2V5YA 1PX3A 2BOIA 4IEOA 3WOGA 3E1F1 1OVPA 2AEYA 3H3LA 2ZEYA 3FWEA 3E6BA 2RDQA 4QPWA 4UW4A 4QX7A 3J7MA 1H1IA 2H6CA 1CVNA 1R082 3RWNA 3WG3A 4CU7A 2IFWA 1F4AA 4CVUA 4P02B 5C8CB 1PNGA 4WM7A 5IVEA 1VBE1 4AR2A 4NRQA 2ZS6B 4IE6A 2ZBJA 4KWKA 3POYA 4JGZB 2H0BA 3N7JA 2G9ZA 3DYPA 2YC0A 1ZRCA 1PO23 2O14A 1RUD1 3B00A 3TEYA 1WCDJ 2AUYA 2GC0A 5LRSA 1SLAA 1OLQA 4M3CF 5IVVA 1AR81 1AUYA 4UI9L 4DEVA 3LFMA 5IVYA 4MG2A 2BWAA 1FXZA 2LM3A 1O3RA 1TQ5A 3QH7A 2PHRA 3N3HA 5IVBA 3AYEA 2XVLA 5HI0A 4FP2A 4NWVA 2ARAA 2W95A 5L36A 4N43B 2A6XA 1I5PA 5FY8A 3PLQA 3C7GA 3IIAA 5KXCA 1YQ8A 4EQVA 3SNMA 2DVFA 5I0UA 3OGGA 5F5IA 4YNIA 4BQ4A 4FPYA 4COUA 1C8M2 1XNCA 4UW6A 2E7AA 2G1MA 4YW7A 2Y6FA 2CWSA 1SPPB 4IL7A 1PO21 4JDNA 4XUNA 2CGNA 2VQ0A 2WFPA 4Q27A 4JDOA 3OF1A 2IFRA 1XC6A 3B9CA 3LEMA 1UIJA 1ASJ3 2V4VA 3BPSA 5I91A 2CNAA 4IE0A 4PDWC 4KBBA 2B9VA 4YFWA 4CP9B 3LDRA 2HWF3 3OGSA 3AKTA 3H3UA 2A6ZA 4TYSA 3AFGA 3PTRB 1KQRA 5T5JA 1MVEA 1V9U3 3S7IA 1LHOA 2A6YA 3NV1A 4JGYC 5GLWA 5GLZA 2HWC2 5JSPA 1BBT3 2R063 2VCBA 3K4DA 2DFCA 4Q4W3 4JKKA 1W8OA 4BPZA 2CWMA 3BOWA 5FYVA 3CDZB 5A7WB 3THPA 2HJIA 1W9WA 1WUVA 1CIWA 3V64A 4B1MA 1ND2C 3LIGA 1DBNA 4EZ4A 3AKQA 5CISA 5JMCA 5SV8A 1XNKA 5FPXA 3ZSLA 1DGRN 3T1LA 2JJ6A 4LEJA 1HXS3 1PZ8A 4ZZ5A 1ASJ1 3KF5A 1CAXA 3CIHA 4IE5A 2RDSA 3JBG3 1HV0A 1FV2A 5LA9A 1Z7S2 4DEQA 3LDBA 1HRI3 2XQRA 2RS11 1V9U1 1XRUA 3O7OA 4IXLA 4K8RB 4Q4V2 1X9TA 3EO6A 1BBT1 2R061 1UU5A 2D7FA 2DU1A 2P34A 2VUJA 1OHFA 3M4FA 2VCCA 4O65A 5IAVA 2WO2A 4XMAA 1X9PA 4Q4W1 4D7TA 1JYNA 2YBSA 3OPZA 4CDUC 2YZ4A 3ZN4A 1UN1A 3UGFA 5KC5A 5LBFA 1OBNA 2XJVA 4AVSA 3C7HA 1SFYA 4D7SA 1WW5A 5JSOA 2ZEXA 1EYBA 4FOVA 1E5IA 5A7PA 2NYYA 4YZ1A 5IW0A 3WNOA 4CEYA 1RUI2 2W1QA 1DGWX 1U5YA 4IEWA 5FO7B 2P3YA 4J1WA 5C3PA 1HXS1 1YQ5A 5A33A 5ABJA 1POV3 1UPSA 4BQ3A 2QQPA 2G19A 4AGRA 4E8CA 2WKKA 2ET1A 5CKMA 2UY9A 2X53S 2DTYA 4MSVA 3U75A 1RINA 1G9AA 4QKDA 1H8TC 1UZZA 5FZCA 3JBG1 2Z4FA 3AXEA 3VBRC 1R093 4C0HA 4RQPB 5GZEA 1APNA 2RR12 4LA3A 4YM2A 2AGSA 3ZM8A 1I9RA 3POJA 4XC9A 1RUF3 1H8VA 1W6OB 1JW6A 5JWPA 1FV3A 4YW5A 3T08A 3T2PA 1RMU3 2AYHA 2R072 2PHXA 1HB4A 1O4YA 1Y4WA 2WNVC 4R9AA 1EP0A 1HRV3 5FZOB 3VKFC 1Z78A 1GYKA 4XDPA 3DUIA 1C3HA 1GQGA 4M0HA 4GAZA 1SBEA 2R0FA 3FHQA 4MH0E 2R042 3I2KA 4AWDA 1NY72 1UW8A 3ZXJA 2DF7A 4YM3A 5HBAA 2E7TA 5GKAC 3PL0A 1J84A 1W6MB 4LO7A 1CONA 5L9BA 4EN7B 1MS1A 2BNMA 1POV1 3V0AA 4WM8C 2I07B 4AK3A 2C4XA 1ONAA 1YXWA 4GMP0 4KG0A 3ZDSA 1UIKA 3AP5A 5CFCB 3CJIC 3VDDC 1OH4A 4XABA 1H0BA 4G9SB 3SISA 1W2NA 2QZ3A 5BNNB 3I59A 1JHJA 5CNAA 1YJKA 3O0WA 4NAMA 2UYAA 1LULA 3EJKA 2VXJA 2ZMNA 4O7XA 1NLQA 1OKQA 1RUF1 4ZS2A 3VZNA 2X10A 2WQZC 1W6NA 4XE9A 3WW2A 1V00A 4MGYE 3NNGA 5FZAA 2Q1ZB 1RMU1 3PVOA 3FLRA 4X6RB 3SEEA 1HRV1 1AYM2 3C2UA 3TNPB 3K51A 1KD7A 5BNOB 3M70A 4QU2A 2D97A 4D94A 2WYSA 4IEYA 3VKNA 4KWUA 5C9AC 5BUVA 1L7RA 3VDDA 5F3CA 1XSRA 4F7ZA 2WQ4A 4NOTA 2IXIA 3SMHA 1IPKA 2P3IA 1PIV3 1HB2A 2WJSA 1GWLA 3LZZA 3MYXA 2LALA 1J1TA 4MUVA 3RI8A 1O3QA 1YFYA 5LA2A 4R4ZA 2RHPA 5JDBA 4IQPA 2Y6LA 5L7OC 5CG9A 1FYUA 3VD4A 2A3WA 3OB8A 4FPEA 2WSVA 4HSJA 4IGQA 1OPMA 3ZYFA 5JOWA 4EN6B 2AC1A 4E4DX 1C1FA 3S6PA 3N9OA 1UZYA 4Q4X3 4QD2A 2QQNA 2X5IA 2C9KA 1SHWB 4YZ2A 4BJ0A 1UD1A 3NNJA 4L0PA 3BIWE 3VD5A 4XQWA 1YQCA 3MW4A 2HEWF 4CSWA 3T30A 4ES9A 5JZGA 2JG9B 4L11A 2ORZA 3FHAA 1NXMA 2VOKA 3OD4A 2XPJA 2XJPA 3DYOA 3DPRB 1PIV1 1L3JA 1O4ZA 4FAGA 3RZKA 1X50A 1YC61 4AGVA 1CAWB 2OW4A 3J8F2 1QDOA 1NYWA 2WNUA 1W39A 2B45X 3KT1A 3VBUC 3VBFB 5CBLA 3TWIA 2JDPA 2VTFA 2Y6GA 2ZJCA 1VBA3 1TEIA 2JB4A 3PMSA 1O4TA 5E16A 4QPYA 1MVQA 3A4UA 3EXUA 1CZTA 4PIXA 1H2NA 1OOPC 3BU0A 5BNQA 2FZ2A 4N53A 5T3NA 3PHMA 5FZ9A 2D3PA 3IN9A 5JIAA 4YVSB 4GXLA 4GH4A 4AG4A 4Q4X1 4F3JA 3PVEA 2E26A 1QF3A 1D7PM 5JOZA 2WRAA 2VW1A 2K9ZA 2CY6A 4DINB 3GZTB 3D0JA 4GWJA 1EUUA 1TE1B 1UZVA 1ZBE3 3A22A 5FZ7A 1GUIA 4XURA 5LA1A 2WZR3 3D6EA 2OT7A 5LZ6A 2VM9A 4IESA 4H14A 3LPFA 4HFSA 5H9RA 1WKYA 2GZWA 4BH9A 2AZ5A 2G9GA 1EV13 4LA2A 3LA2A 4XOGA 3KVBA 4X8PA 5HXMA 2V4AA 1LR5A 3K46A 4LTAA 4XEZA 1IZ3A 4BQ1A 2XDVA 2RS33 1KEXA 5C3QA 5APAA 1VBA1 1ZM1A 1V6JA 3U4SA 5C8CC 1UCXA 1LECA 3O1VA 4DMIA 4JHZA 3A0KA 3THTA 1QJY3 1RUC2 4JGZC 2HWE2 3FHIB 4Y5Z0 1UOGA 3QD6A 3OUIA 1R1A3 1W0NA 4ASLA 1WCSA 1SLBA 4HK9A 1J3QA 3RI9A 4RHV2 4ZZ8A 2LTNA 4XPVA 2JKXA 2E9QA 3U0ZA 1E5HA 1ZBE1 1TMF2 4RS5A 4A2UA 1QOTA 2WZR1 1BMV1 5D8AB 2PYTA 4A4AA 3WY6A 1SEFA 1QXJA 3O1RA 3KV9A 1GR3A 1QH6A 1GU3A 3ETPA 4XZUG 3MZHA 4S2DA 3LF7A 1UKGA 2PAEA 3GNEA 5A1LA 4N43C 2VUCA 4HXCA 1R64A 2YG0A 3BTXA 5I93A 2C5DA 5FDBA 5CYYA 5FXZA 3WF0A 4D6QA 1YQ2A 4MGZE 5J98B 1RC6A 5LASA 4A3ZA 2Y60A 3ST7A 4HANA 5E8AA 1EPWA 1QJY1 2KA3A 4Q0PA 4Z2AA 3GBWA 5AVPA 4KWJA 3O1OA 4CZSA 1R1A1 5C3RA 4XFBA 3ELNA 3HQUA 3IDAA 3RS6A 4I2OA 1LHWA 1RUG3 2VL4A 4CDWB 4XJ8A 1VLNA 3J4UH 2XBO3 1BK1A 4HETA 4QKBA 1G9FA 3PIGA 4JKMA 4Y1ZA 4QXBA 5LW9A 5FOBB 1JZ2A 4Z2WA 4FVVA 4LBKA 4YVWB 3FUQA 1WCUA 1WD4A 5DAPA 4B29A 3I2OA 1TME3 1UX6A 4GQ7A 4N8MA 1YJLA 2VQTA 1K5JA 5BYNA 3W5NA 1PVC2 5J37A 1W28A 4P9GA 1AR92 3V0BA 1LOGA 1V6MA 2PELA 3I49A 3WF2A 1UOJA 2JIGA 3NJZA 2XONA 2EXJA 1D2SA 2DDUA 5DDJ2 4GB32 1J3PA 5LY1A 1K3IA 3K4ZA 2HLEA 4HVQA 4KI5M 3Q9OA 2Y6JA 4NR1A 4N7UA 3VHPA 1RHI3 1FOD3 2ES3A 1UY2A 4GIQA 1A34A 3O0XA 3K48A 1O3TA 2H6BA 3A7QA 4PDWA 4A45A 2XWBB 1GP6A 1HX6A 2CTVA 1ENSA 3RYPA 4QKNA 3DYMA 4RFRB 1RUG1 2BYVE 2Y33A 1RXGA 4E4ZA 1JH5A 4JGYA 2CDOA 5J36A 3KHCA 2VZTA 4L99A 1W03A 2RJKA 4UFJA 2VH9A 2JDUA 3WNLA 1SLLA 1US2A 3K4AA 2RS52 4DIQA 1O5UA 1N1VA 3JD73 3P5BA 3GDBA 3I3BA 1ND2A 1GZWB 3S30A 1H9PA 5FYTA 1HB1A 1BZWA 1TNRA 5CKQA 4W4ZA 5AVAA 4BK5A 1LU1A 4R9DA 3PTYA 2PQSA 2DUPA 4FPGA 2W08A 3VKMA 3MIFA 1RHI1 1FOD1 3WT3A 1VBD3 3IMMA 3KHBA 4AI8A 1W9TA 3LOIA 3VZJA 4N9HA 3MF6A 2VVEA 3J7NA 5FBZA 4AVAA 3LE0A 2ETEA 1OQ1A 2QQJA 5FO9B 1LOCA 2ZHNA 4L9BA 3ZXKA 4IV3B 1JUHA 1RUE1 3JB4C 2X29A 1UYZA 1NZIA 2D5FA 3VHOA 5LK7B 1SLCA 1BK0A 4CU6A 5EYXA 4BDVB 5JSRA 2WLPA 3J7HA 4FQZA 3NW4A 5HCHA 1UZWA 2Y0IA 3AMNA 1YWKA 2WWUA 1D4M1 1XNDA 2WS92 1BQPA 4WBBA 4CDUA 1ULGA 2VZQA 3VBOB 3MF9A 3U4XA 4RQPC 3PUHA 2XVKA 3JD71 3OGRA 4QX0A 2P6CA 4IE4A 5CEHA 1US3A 2GH2A 1ZZ7A 4W65A 2ZKNA 5FXVA 3LOBA 1VPHA 1VRBA 1V6IA 2A5ZA 3RMYA 1UO9A 4XCBA 1I6XA 5A7NA 4AFDA 1U12A 5H9PA 1VBD1 2ZKLA 4NE9A 2JICA 1CX1A 2Y38A 5L9RA 1QXPA 2WBKA 4ZXKA 2VECA 1PO13 3KWVA 4M0NA 2GN7A 3VBRA 4CPBD 5C70A 1ZRFA 4FT8A 2BBVA 3HQRA 2YU1A 1SLTA 2MEV3 3F2ZA 2GMMA 1CX4A 2ZTNA 1WLTA 4QKFA 4HKOA 2NLRA 1NCRB 1QHDA 5K7PA 2O0OA 3BODA 1S2EA 4LITA 2VJXA 4MHRA 2RJ2A 3VUOA 5F9TA 5KHHA 1PMHX 3IT8A 2XLFA 5A32B 3PNAA 2WNVA 4DPNA 3NAPB 5CFCC 3OGJA 4A3XA 5BNNC 2A73B 1JUIA 1ULFA 2A3XA 4BLJA 1VB4A 3ZKYA 3USUA 1XOYA 4YW4A 4NHYA 1CPNA 5FYIA 2AREA 4JQRA 4HZFA 1QJU1 2GC3A 3EYPA 4YW2A 3WDWA 4BHPA 4P00B 1GZ9A 3FL7A 3H9AA 4AVTA 1WCKA 5IJRA 1AR73 3ZFEA 4FPFA 2RMU1 4WM8A 4MGTA 4NVPA 5BNOC 1OD5A 2BU9A 3CJIA 4RYDA 1MS5A 5FYCA 2X05A 1PO11 2VY0A 4QQLA 5FK7A 3DXUA 4COYA 1H1MA 3U78A 1SFPA 1RUJ3 1S4CA 1ZBA2 3QCWA 2MEV1 3EHKA 4R9CA 4UW5A 1MZ5A 4Y1YA 5HCFA 5JI7A 2VZOA 4CCKA 1ZA7A 2QQLA 3AYCA 5FV3A 5FYHA 4DRVA 5GJ6A 1FI2A 3R4DB 4KG8A 2Q5TA 5GM0A 3T1MA 3WR0A 4P14A 3TRSB 2UU8A 1GMMA 2FQPA 5C33A 1MZ6A 3C8XA 4L97A 2BZDA 4QPIB 3WCSA 1O7FA 1PGW1 3ETQA 4ONUA 3ZIXA 3AKRA 3FMGA 1DCSA 4ARXA 5C9AA 4P9LA 5LRRA 3I8TA 4GJYA 1W99A 2EXIA 2BPA2 1MZFA 1BCXA 5LEKA 2P2KA 1JBCA 3M3EA 1W6QB 1Z0HA 4Q5OA 3UK9A 3JUUA 3MO4A 3VKLA 1VP6A 4E2QA 2A70A 1AR71 3M3IA 1NLSA 1QJEA 2D44A 2WZPP 4AI2A 2D6PA 5L7OA 1J59A 3J26N 2ZX1A 5I0TA 3ACLA 4D7YA 2IXKA 3HMYA 4CUCA 4XVHA 2CAVA 1RUJ1 2JG9C 5IYYA 3UNPA 1WLCA 5EFUA 3GZEA 2WFF3 1SQ4A 3DPRC 2VULA 2YPJA 1WCQA 3B94A 3OYWB 5A3TA 2HBUA 1AZDA 2WLQA 2Y0OA 2P37A 3WVJA 3WP3A 5AFEA 3VBFC 1DLLA 5FWJA 3QLQA 5E88A 3SXWA 2EA7A 3IM0A 2WWSA 3NWKA 1GQHA 1SMVA 2W9XA 1ALYA 2QKDA 4KL1A 4FSJA 2FCTA 1DYPA 2VBPA 3E5XA 3BPZA 3FBMA 2IXLA 5FXXA 2HWB2 5A6QA 2GN3A 3MPPG 3WSOA 3C3VA 1AVBA 3C7OA 3ZMNA 1BEV2 3AZZA 1JS9A 2O8OA 4YVSC 4D6RA 4A7KA 5FP8A 4JVAA 1W8WA 5EJ1B 3ZPYA 2PHUA 5G05L 1AF9A 1CQ9A 1XU2A 4BQWA 1JYXA 4EN8B 1MS4A 3MFAA 3U1XA 3TYJA 4AL9A 4ISRA 3SQOA 1X8MA 2V5DA 1YIFA 1VBB2 2W52A 4DO0A 4EJRA 4ZY9A 4EYUA 1HN0A 2WFF1 3H42B 2VW0A 3N35A 4IEVA 2BGOA 2QDRA 2RV9A 1QOOA 1SCSA 5FYZA 5JXGA 3C7EA 1OA2A 4PLNA 4LIVA 5IFTA 1AX2A 1HQNA 1X36A 2CDPA 3MIDA 3RZZA 5IAXA 1JZ7A 3B3QE 1MQTB 1ULDA 4QB1A 5K0UB 2ZX2A 4XJUA 4Y22A 5BY5A 2C6SA 1QEXA 4DZGA 1ZA4A 5TSWA 5T5LA 4QDSA 4CEWC 1GOHA 2Q8CA 4AHXA 4D69A 2WA3A 1BYHA 4RSUA 1FPN2 2PAKA 1G7YA 3UGHA 3WNMA 4IUGA 5FJHA 1PGL2 1J1LA 3MIEA 1NA1B 2JG8B 3KZ4C 4LHLA 2ADDA 4QM8A 5FK8A 3CMGA 1W8ZA 1UMZA 5FYUA 5C8CA 3FE5A 1JMUB 1L7LA 5D8AC 2D93A 3ZPOA 4OI0A 2W47A 5FBJA 3KT7A 3MI8A 4MADA 4QGNA 4XF4A 5C71A 2UY8A 5LA0A 3LQCA 4AVCA 1XNTA 2VC9A 1UMHA 2NPIA 3FN9A 1XSQA 2Y64A 2C26A 4UF0B 1FNYA 1N1TA 1DQ1A 4XF9A 1C8M3 1JU3A 3T2OA 4GULA 4K6BA 4M4RA 3WCRA 1JI6A 5JMOA 1EPZA 1MPXA 4DXTA 2IXHA 1HLCA 1WBLA 5JOYA 3RRDA 3SITA 1VE0A 2D3RA 2PHDA 3GBFA 4AZZA 3RNSA 4UFMA 1ULEA 1VBE2 1XNAA 5LBBA 4Z1VA 3HWJA 4CDWC 2JE8A 3HOBA 4BQYA 4N43A 3AL6A 1RUD2 3ILFA 4YVWC 1AR82 3IKWA 3UL2A 4ZHNA 3WW4A 3ON7A 5FZ6A 5GZDA 4NPRA 1XB9A 4JCKA 3O14A 1YI9A 2ZX0A 4CXWA 1VMHA 4M01A 3NV4A 5LCWL 1SPPA 2E51A 3ABZA 2LROA 1YFWA 4DUXA 2JKBA 5A3LA 2FDIA 3HN3A 1LKNA 1W0PA 4F8AA 1LODA 4LHKA 3B01A 4BIOA 3I2FA 3OBTA 3C7FA 1K45A 4MLOA 5FKBA 1SCRA 4RN5A 3OUJA 2VZVA 3HVDA 5A3MA 2ARXA 4P9XA 3N7LA 2EIDA 1AL23 2WR9A 4CP9A 4ZPIA 2A6WA 4DS0A 1URXA 4BWOA 5CADA 1KS4A 5JR7B 4OYUA 3GXUA 4COWA 1T6GC 4QDQA 4QB2A 1JU4A 1PO22 2X8KA 5FZ4A 3WQ1A 5HXVA 2XJTA 5EWSA 4BB3A 2PTMA 2VD7A 4B4RA 2XWJB 4D6SA 1CZVA 2CYFA 5T5PA 1L7QA 1JYIA 1NZCA 1QNYA 4NWWA 5DXDA 1BKZA 5E89A 5A7WA 2W94A 4ZXEA 1H6YA 2OYZA 3JU9A 4XIKA 4C8DA 2PQQA 5FY1A 1KFXL 2HYKA 3OG2A 2D6MA 3VL8A 2BWCA 2XJRA 1AXKA 3M3CA 3ZVXA 1AX1A 4LK7A 4LOTA 5F6KA 3T09A 4CCEA 3T0BA 3P1IA 1LHUA 1B35B 2R49A 5FZBA 3EQEA 5FZKA 3LGRA 4JV4A 1UZ0A 2Y34A 2J1EA 2YFZA 5FRAA 2VBDA 2C1FA 1J83A 1HDKA 2Q1MA 4MGSA 1AL21 4YLZA 1GV9A 3IWZA 4TWTA 3H0OA 4QPGA 4IV3C 1U0AA 3WUDA 4L2NA 4D3WA 5JXHA 2PHFA 2HWF1 1H2MA 5A1FA 3WP5A 1OT5A 2ARBA 1GFF2 1JZ4A 4EWDA 3WF4A 3L2YA 1Q8PA 3CF6E 4IGOA 1FT9A 1VIWB 1D0GA 3KV4A 5DAQA 4YARA 3V56A 5KWRA 4LOSA 4AI0A 1A6CA 2QQMA 4XZPA 4OVEA 1ASJ2 1DFQA 5K4LA 3VBOC 4LMFA 1KS5A 1IS6A 3AMHA 2WZ8A 2VO5A 4FPHA 4XHXA 2IWGB 4OI1A 2YHJA 2ZA9A 1H2LA 3R05A 1QDCA 4LKDA 5KHGA 2VNOA 1SBFA 2Q1FA 2ZGRA 5F5AA 4RR3A 2UYBA 2VNGA 2WO3A 3SHRA 2RS12 1NKGA 1V9U2 5C8WA 4QX5A 1W3XA 4LUMA 2BUKA 3NVCA 4Z8BA 4QQ2A 4I01A 1BBT2 2R062 1DQ2A 5DUWA 1PNFA 3RWKX 4Q4W2 3OPTA 3ZFFB 2GNTA 1S0CA 2VPVA 2ZGKA 4NIGA 3DCQA 5C4WA 3AX4A 4RQPA 4A7ZA 4HL0A 2VOTA 4W8JA 4WVMA 4GWNA 3ZDVA 1N1YA 1NCRC 4EROA 1HRI1 1W6OA 4Y5SA 5IATA 1AR63 4XQ4A 2YFUA 2Z42A 4PIYA 1QXRA 4IEUA 4FOQA 5FR3A 5CFDB 5A6XA 1HXS2 3HR9A 1SLIA 3H3ZA 3NAPC 3CNAA 4O9EA 3O1MA 5T50A 1YRZA 1UKRA 2WNEA 5HCBA 2AH2A 2WN2A 4LBQA 3W58A 2DFBA 2VW2A 3WW3A 3ZYBA 1YO8A 4CEYB 3M7AA 4UWDA 3LA3A 1ZZBA 3JBG2 3ZYIB 1LEMA 5F3EA 1FAYA 5A33B 3FZ3A 4U2AA 4XJWA 5T5OA 1W6MA 1QJFA 3OCPA 2J1SA 4JTOA 2OX0A 3TEZA 4NMIA 1OSGA 1STMA 3PVNA 4OUSA 2DYCA 4I3PA 4FCAA 1LGBA 4MOAA 5CFCA 2P4EA 3W20A 4NHMA 4K20A 5BNNA 1UMIA 4FTEA 4ZKTB 3LKJA 1O8SA 1JOJA 1R091 4S2FA 1KDMA 3DEMA 3U10A 1Y9MA 1AR61 3WUCA 3RFRA 2EAAA 1O8PA 5A70A 3RG0A 2VE1A 4URAA 1JYTA 3Q8FA 5ACA3 2PFWA 3P6BA 1X82A 5DZEA 5BNOA 2GAUA 5FMCA 4QPIC 3LEGA 4OCTA 4Y20A 3NRUA 3LAGA 2CAUA 1EAH3 2DCTA 2K46A 4YG3A 3IPVB 4OHZA 5BNPB 1MS8A 2XR4A 5FLIA 3WD5A 1RUF2 2ADEA 1RXFA 1MS9A 2TBVA 1I3HA 4NUBA 1RMU2 2OPKA 5F3IA 3UKVA 3POEA 2Q8OA 3BN6A 4B7KA 1HRV2 2WUHA 1IPJA 4I3GA 1F2NA 3O1TA 1NX9A 1JZ3A 4HKLA 4D0QA 4BM8A 4RL7A 1NLRA 3Q8CA 1V6OA 3D0SA 1YFXA 1JTZX 2P3KA 5FREA 4CP1A 1MS3A 2UWCA 4KU7A 1HB3A 1PM7A 4AE2A 5ACA1 1ODMA 5FUNA 1XJAA 1IQDC 1KXGA 4XDQA 2HWD3 1PK6B 4PIZA 5FQ0B 5FZIA 3CKHA 3RYRA 1NCQB 2LRPA 3AK0A 3AJZA 1KJRA 4ASKA 1OUXA 2JG9A 1W0OA 5H9QA 4HN1A 1ENRA 2J1RA 3AYDA 3ITQA 1EAH1 1W06A 2UWBA 4OI2A 4YZ5A 2GNDA 5CB7A 3ZXDA 2YDEA 1QU0A 4LO5B 2HEVF 1CAWA 5FLJA 4NRMA 2F4PA 4Q8LA 3VBFA 4O61A 2VAUA 3OSDA 3PMEA 4LXLA 4CRQA 1VRH3 4COZA 2Q30A 2F17A 5J1XA 2J22A 1H30A 1LESA 4XFCA 2IUWA 3UKNA 3UETA 3Q8BA 2DTWA 2G9FA 2PXJA 3BCWA 3UYJA 5FZ8A 1VB2A 2R6QA 5I8SA 1JZ5A 2GC1A 2XHNA 4YVSA 4CCCA 1BLZA 1PIV2 3TEWA 1COV3 4FP3A 5IK7A 3VLBB 1QNWA 1FMD3 1MEC3 1QY4A 1T2XA 4META 2HWD1 1MQTC 4LBLA 4BYYA 3GBGA 5K0UC 2DUQA 1E5RA 2E33A 3AL5A 1ND3B 1W2UA 5KHJA 2KXLA 2V73A 1RB8G 5IFPA 1POQA 4YRDA 2I45A 5GLVA 4XMIA 3M1HA 4AQ6A 4HONA 5FY9A 4AFMA 3DXTA 4DXRA 4KGGA 2A71A 3TN93 1NA1C 1GOFA 2JG8C 3OBRA 4YWAA 2OQ7A 1VRH1 2VTXJ 4Q4X2 4KGQA 4INDA 4AHWA 2B7YA 3IB3A 4AAXA 2CGOA 1UWWA 5A3OA 5F3GA 1W8TA 3A21A 2C24A 2W68A 1RTVA 3W59A 3WP6A 2YBKA 2FCVA 2PLV3 1OVSA 2Y6KA 3DF0A 3HBZA 4GH4B 2OZ6A 1OA4A 1YLLA 2DURA 3ZXEA 4CUBA 5FO8B 4BLIA 4GWMA 2VBBA 4CEWB 4XJAA 5F2SA 4FQ4A 1COV1 1BVP1 4YPJA 5E6HA 2ZAHA 4OUMA 3DL3A 3H50A 1IKQA 1FMD1 1MEC1 2Q0AA 4J6GA 4XIOA 4CP0A 3LB9A 1W8HA 2YUEA 3NQHA 5A6ZA 4AVVA 3CJXA 5I0SA 4NPMA 1VBA2 2ZX3A 1VMFA 5D8AA 4QMAA 1CIYA 4QHOA 2VGDA 2RM23 2GMPA 2WO7A 5FPUA 2VZRA 2VZUA 3GALA 3MV11 3VDCA 4JX0A 4Y1UA 5CZKA 2A75A 4CA9A 1GKBA 4Z07A 1EV11 3MUY1 1YHFA 5J09A 1W8FA 5KXEA 2HKXA 3TN91 2YXSA 1AYN3 5F37A 4LT5A 2YROA 4JDMA 2O8QA 2OA2A 5JR2A 3WHTA 2RS31 4RGAA 2W1UA 1ZBE2 4AEJA 1XYPA 2WZR2 1A78A 1LHNA 2PLV1 3AZYA 3I2HA 1DP0A 3OPWA 1WW4A 1BMV2 4FTBA 4Y24A 1S0FA 3E6CC 1G6NA 3VDAA 3TBDA 4B4PA 3TAYA 4CDWA 1IGOA 3POIA 4FOWA 4N9IA 4RS5B 4TLFA 4OHYA 2JECA 1LENA 1OLME 2W1SA 3GYDA 2XGXA 3B5LB 3APBA 2AEZA 3VD7A 2NP0A 2Q4SA 4EN0A 2BERA 1CAUB 1H1AA 1V0AA 2Q8DA 2XL7A 3T0AA 5C5TA 1XNBA 1ZYBA 2RM21 3B7MA 1Y43B 5B4XA 3ZYJB 1QJY2 4A6SA 2V72A 5HV4A 3BB6A 3PIJA 4R9BA 4I30A 4KMQA 1Q8QA 1R1A2 2PHWA 2XUEA 1AYN1 4PBPA 3ZSJA 2NN8A 2SBAA 5FYMA 1UYXA 1S2KA 4XBQA 3SC7X 3TEXA 1GWKA 2A1XA 5H9SA 1BVVA 1OQEA 3IDCB 3FFQA 3ZFGB 3ZMOA 3ZXLA 2J1UA 1N3OA 4JRLA 1GQPA 2W92A 4CCNA 4FI9A 4B1LA 4D8MA 1W2TA 4P9JA 5A7OA 4LBOA 3SKVA 5LB6A 3WDYA 3KQ4B 4ISQA 1B35C 4K9SA 4OHVA 4CCDA 1RITA 3ZKUA 5DABA 5FPZA 2XBO1 3SH4A 2B4KA 1I1EA 4FTSA 5JPMB 1W04A 1QQP3 1T6BX 3JQWA 5KR7A 1LNSA 1TME1 2VMFA 3RDIA 4IEQA 4NHKA 1PX4A 1GZWA 4HPKB 4P5HA 3VZLA 3FBYA 1OXCA 1ULPA 1HV1A 1RUG2 1Q5OA 1UOFA 1AX0A 1XE8A 2VG9A 4NHXA 1VALA 3NJYA 3WXPA 4B4QA 3N36A 2XUMA 3E97A 4H2AA 1OPOA 1CESA 2EALA 3ZYPA 4I09A 4MXWB 4AOCA 3KV5A 4EE2A 4PQQA 4EV0A 4XFHA 4C1WA 1G86A 3P3NA 4CDQB 2GU9A 2CU5A 5C4WC 4IV3A 3HT2A 3ZSEA 1YYNA 1K5MB 3WW1A 1J3RA 3S0MA 3TNQA 4WZCA 3VBHB 2RJLA 4UW3A 1MR5A 4J25A 1EY2A 3NSTA 2VTXA 1Q8SA 2H0VA 1QQP1 2A3YA 3ZFFC 2IXJA 1RHI2 1FOD2 3HAGA 4YGEA 5F2WA 3GHMA 3LFIA 3GGLA 1X7NA 3AVRA 4OHXA 3WQ7A 4XHBA 2QVSB 1UAIA 2ZMLA 3CBNA 4MHUA 5LK5A 1YIPA 3MICA 4IV1B 4YG0A 4PF1A 1RUE2 3KB5A 3MFCA 4P08A 5IK4A 1C1LA 3ES1A 5CIRA 4TN7A 2XH6A 4DY3A 1RIRA 5CFDC 4CXYA 3OEBA 1NT0A 3O0VA 4BE3A 3H1MA 5HCAA 2WIIB 5FFOC 4CEYC 4W6YA 4XJ9A 1D4M2 3WLUA 1H8TA 3WZ1A 1QIQA 3VZOA 3H8XA 3I3DA 4FXGB 4AYUA 2EXHA 4FFHA 3JD72 4QHZA 4Q1RA 4FFGA 5FZEA 1NCRA 1JN2P 2MPFA 4OI4A 4ARYA 2GMEA 2TEPA 4Q4Y3 4L8QA 2VMGA 3WQBA 1ZBA3 4A41A 2NMNA 5A32A 2E53A 1CAVB 1QJX3 1SBDA 5FPBA 4CDXB 2W5FA 2JDMA 3NAPA 3U11A 4PCRA 3KM5A 3R4UA 1F8VA 1HN1A 1VBD2 2P3JA 4AEDB 2VCMA 2BNOA 5FP4A 4CP2A 4WVZA 5ANQA 3CU7A 5KHKA 3HEIA 4YSFA 5T55A 1POV0 4HLTA 3ACIA 3DECA 4QGLA 4P9IA 5IUQA 2TUNA 2YY1A 1UYPA 4ZU7A 3KCCA 5DUXA 2DUOA 4R8HA 1KRIA 4X6QB 4LE4A 5FZMA 1DG6A 1OI6A 2Y6HA 3ME2A 3BVCA 1JODA 1RUH3 4LLFA 5CA6A 2OUJA 2YC4A 2VNRA 2D5HA 2YGLA 1WMFA 1DGWA 3CEWA 5FZHA 5JIUA 5L19A 5BNPC 2ZGNA 3POFA 3NL1A 5FMOL 3SCHA 5I0RA 1A3KA 2B39A 1QJU2 4LBMA 2VZSA 2XOMA 2VZ1A 3PUQA 4FPLA 4Q4Y1 4EWAA 4IDZA 3WQ0A 5J48A 1FNZA 4YG6A 1QJX1 4HVOA 4FBFA 1TG7A 3ALQA 5FUPA 5F5QA 4Y26A 2OVUA 5FPAA 1M4WA 2RMU2 1QJZA 4XXAA 1DQ0A 3JCIA 1B09A 3AP9A 4QPIA 2Q8EA 3WF3A 1WLWA 4XFGA 5M0TA 4XCAA 1PO12 3BOPA 5FTTC 4AI1A 3ZFEB 1ZX5A 1C5HA 1LTEA 2MEV2 3MPBA 1W6QA 4R52A 4PT6A 1IG0A 4GKYA 4KQ7A 1DQ4A 5EIYB 5FAXA 5KXBA 3PDQA 3S5AA 1Y9GA 5JXIA 1PK6C 2WAOA 2FDHA 2YBPA 1NCQC 5A1AA 5EZWA 1D0HA 3MIGA 2WSUA 3BKZA 2BFUL 4YGDA 5BXXA 1CGPA 1RUH1 2OIIA 2UWAA 2VZPA 4GJZA 2VVFA 1OMIA 1W6PA 1XXNA 5DPNA 5FZDA 1PGW2 1GOGA 1GLHA 1MACA 3BTYA 2GP5A 4W6XA 1W3VA 3HJRA 4RA0A 4YW1A 1ZRRA 4YFZA 5F7UA 2DU0A 3VDBA 1AR72 2G4IA 1F9KA 1DYOA 1RVF3 3LWCA 4WV8A 5DUVA 4ASMB 3JZVA 4CTEA 2DBNA 4AAPA 2GC2A 1IOAA 5FMDA 1WW6A 4M00A 2ZEZA 2JDZA 1VBC3 2BTVC 4MXVA 1ZREA 3K75B 2PA7A 2FBEA 3GF6A 4PHZA 1C5IA 1G8WA 1RUJ2 1IPSA 2HEYF 2V09A 5J96B 3RJRA 4TSVA 2WA4A 2ZZJA 2E6VA 5DAXA 5AC93 1AL0G 5HPOA 4E8DA 4V2VA 1XE7A 2WDBA 3KVAA 3ZYHA 4RGGA 5LWBA 3AP6A 3VBSB 2FD8A 3PJYA 5JZGC 2VMDA 3H8RA 1IQAA 2JWPA 4E27A 2B9UA 3VBUA 4FOYA 4JZRA 5A80A 3E5UA 4DXZA 4NN0A 1IHMA 1ND3C 1REEA 1REDA 2J1AA 3I3EA 4LIUA 4Q26A 4CCLA 4MO3M 2B5HA 4Y4RA 1SZBA 4X8NA 1WZXA 5SV5A 3UT0A 1ODNA 3A0NA 1GP4A 1F5FA 1VR3A 2R7EB 4LORA 3PJQA 4XYXA 3ASIA 4NIHA 2OPWA 1OOPA 3IBMA 1R083 3ORJA 3THCA 5T52A 5JUVA 4NROA 2XMLA 1U5ZA 3AM2A 4J1XA 3ZN6A 1RVF1 3HIFA 5L73A 1MQTA 1OA3A 1PGSA 4K1ZA 3MLKA 5C3OA 4LHSA 3EMRA 2R1BA 5K0UA 1ENXA 4O9GA 1VBC1 3I2GA 1LGCA 1LOEA 1UY0A 4OMCA 1O5LA 4QQHA 4QT6A 4R4XA 5D21A 4GH4C 4KBZA 3AC0A 3URFA 2D43A 3GHNA 2A6VA 2WFF2 3R6SA 1HJFA 2ILMA 1KJLA 2CL2A 5LBCA 4Y3OA 4C91A 5AC91 1IS5A 5IK5A 1W2OA 1LRHA 1NA1A 2JG8A 2QJVA 3BALA 4B8EA 4M3CB 5FY4A 3I2DA 4CU8A 3HNMA 1C57A 3WV6A 3H7YA 5FLHA 2VMIA 3ZR5A 3MLLA 5FY5A 1YI7A 3B69A 1YFUA 4SLIA 1DLCA 4W6WA 1X33A 3ZSMA 3QH6A 2FDGA 1R081 4JGZA 3FUOA 1OKOA 2B8MA 2EIGA 4P5YA 4QX8A 1HJGA 5GLUA 2KR2A 4UF0A 2TNFA 3I97A 5F39A 2PN5A 3OY8B 2WNOA 4G3YC 5CU1A 5FYBA 5LBEA 5A7SA 4EZHA 3MLJA 3AP4A 4LKSA 3KSCA 1V6NA 5B4NA 3PU8A 5FZGA 3RZGA 4NJ4A 4QX2A 3T4VA 5A3UA 4ES8A 4PQ9A 4UFHA 4B3NA 1D4VB 1ZRDA 4RS5C 4E4SA 2CV6A 1KFUL 3GM8A 4H55A 3UESA 2FDFA 1W05A 1H2KA 4K21A 1LOAA 4QXCA 4Z82A 5F32A 4S2HA 2EVXA 4LULA 1W2AX 1QGLA 1MS0A 4Q0VA 1ZVFA 3T3YA 4WM7B 3UGGA 1QKQA 3IMNA 2W91A 3FC0A 2KM2A 3POWA 3AYAA 2GNBA 2ZGUA 2D6LX 2X09A 3MV01 3PVBB 2HWC3 5FWEA 4K7JA 5C6CA 5JCTA 2ZGOA 1W9FA 2ERFA 4MGKE 3KLSA 2F6BA 4BCUA 3WNPA 2Z69A 3G7DA 3HNYM 5EPAA 3RZMA 3U14A 1C8M1 4OHWA 5CKNA 1DDLA 3H8UA 2VU9A 4NIAA 2VCAA 4DXSA 1UXZA 3ZFGC 3T2QA 2BOJA 3WNXA 1SACA 1SG3A 3EBRA 1XBFA 3GJAA 4SBVA 1DZQA 2YC2A 1CJPA 1GICA 1YNAA 3POSA 1O6UA 3ZXGA 4BISA 3IIIA 1NQDA 5HV0A 3CHXA 2FDKA 4AQSA 2QZ2A 3FLTA 2LW8A 1G9BA 1WWYA 2EIEA 3ILRA 5IVFA 1Z7S3 1VMJA 4UFKA 2J7MA 4QU1A 4IERA 2VOWA 1I5ZA 3E5QA 1H4GA 4TXWA 5DAVA 4XFIA 4CPBA 4TTGA 3MBWA 4PF5A 4OULA 2WT0A 2HWC1 4Q4V3 4AQTA 3O5SA 4XQDA 5FPVA 2YMZA 4IETA 4LKFA 2ZEWA 2RVAA 2ZGPA 3I3MA 4IEXA 4QB6A 4UFIA 2DVBA 1B35A 3LD8A 3TB0A 4XDOA 1DHKB 1NE6A 2WAAA 3AZVA 1RYYA 2FMYA 3AB0A 3L9JT 4DY5A 5FZLA 4BOWA 4GA9A 2RS13 5FCCA 2VZ3A 4CDQC 1RUNA 2W87A 2E31A 1HQWA 2Z5WA 1RUI3 2DVAA 1ZZ6A 3WDUA 2FDJA 3Q8AA 2I74A 1LU2A 1QMJA 1K5MC 5GLTA 2P6HA 2R30A 3VBHC 5IHRA 3RZHA 3FFZA 1RUOA 1TNFA 1N3PA 5E1RA 3BI3A 1C8NA 3NO8A 3UV9A 1V6LA 4I0AA 4KNCA 1Z7S1 2FMDA 3D5OA 4AI3A 3IDEA 4DNYA 4ET7A 2WC2A 1Q56A 1W90A 3OGVA 2RR13 5EYYA 3NV2A 1N47A 1GBGA 1PZ7A 2OQ6A 2OS2A 3J7LA 3R0RA 1SDWA 4HT1T 1AL22 1K12A 4LJHA 4Q4V1 1NQJA 4HK8A 4UBGA 1Q3EA 4IV1C 1J58A 3BGAA 2QDNA 2R073 1VAKA 2MHFA 2HWF2 3N7MA 4YYOA 2CHHA 5T54A 2DWRA 5FIXA 1HW5A 3ZLIA 5ERLA 4M3CE 5JOXA 1CAXB 1KITA 4Y5TA 1VJ2A 3EB7A 3PUIA 4QPGB 4C90A 2R043 4AFBA 2AR6A 3ZFFA 4GD4A 3H7JA 2EF6A 1RUI1 2DCJA 1DZTA 3H1YA 2IXCA 4XBNA 4C1XA 4M4PA 5A3PA 1RJ8A 1W8UA 1GNYA 2GSYA 1LCLA 3OEAA 3IAQA 1UYYA 5LY2A 2W1WA 2I2SA 4PBOA 4MYEA 3W9AA 5CFDA 4CDXC 2JD4A 4LO8A 1S2BA 2RR11 4AEDC 5FZOA 2GALA 5FP7A 4OQ9A 4RR3B 2R0HA 2WN3A 2WQ8A 1XE0A 3AMQA 5FP9A 3HPNA 1PMIA 1DIWA 3RSJA 1Y3TA 2PMWB 3INAA 2R071 4OUEA 1SFNA 2ZGSA 4CUAA 5ABJB 2QQOA 4AEKA 1G9CA 3O1PA 1AYM3 1HRI2 1F31A 1ZZCA 2Y8KA 3AXDA 2WL1A 3KS7A 4NIIA 3A23A 3KCXA 3USSA 5C4WB 3I7DA 2VQAA 1WLDA 3WX5A 2R041 4OZXA 1LHVA 1DZRA 2K0GA 1NY71 4WVMB 3IAPA 1CN1A 2B46X 3GCWA 1U5XA 3SKJE 5F1RA 5EP9A 4U36A 4FAHA 3IZOA 3L2HA 4MVTA 4BA6A 1W8NA 2BGCA 1UU4A 1JYWA 1XU1A 2DBIA 2VR4A 4LQRA 4Q2FA 3ZIWA 2VNVA 4AHZA 3CLPA 3S7EA 4LBQB 2BDRA 1UX7A 1YQ6A 2R32A 5D2AA 1JHNA 4XACA 4EWEA 1P8JA 2JDNA 2ZCWA 4XFFA 2BJSA 3UJQA 4OQ8A 3H8OA 1OLRA 3PURA 4YW3A 4XUOA 4NAOA 5DMYA 3ZFEC 3K3NA 1WW7A 3T2TA 3IPVA 1DQ5A 3J9SA 2OZJA 1R092 4Q29A 5BNPA 1AYM1 3V0AB 4Y33A 5FY7A 2JXAA 1AR62 4LO6B 2WZEA 2XXZA 3ZO0B 2WINB 1OLMA 4QX3A 1Q8OA 1Y7BA 1RL3A 3MEPA 5FY0A 4QQPA 3VGIA 3G6JB 3I59B 2HH9A 1Q43A 4LR4A 4N7IA 4AFAA 3D4KA 4ZU4A 1KGYA 1XPWA 5IVCA 4ATEA 3N9NA 4Y1XA 2LS6A 1W6NB 5EHDA 2YYOA 3J8F3 2EICA 1AXZA 4A7YA 3JQXA 1O59A 2W46A 3RGBA 5KHIA 1JZ6A 2XJSA 1ACCA 2BNNA 2ZGLA 3U37A 3SCFA 1F4HA 1YCIA 2ATFA 1UPIA 4Y20B 1GSLA 1PK6A 4UAPA 5FQ0A 5C3SA 1C4RA 2ZHKA 1NCQA 2ZAAA 2VQUA 2SLIA 3K2OA 4BQXA 2PAMA 3NJVA 5J3UA 1UY4A 4IW3A 3VHNA 5I0DA 5LATA 3OTFA 2BQPA 4LNVA 2BW8A 2QQUA 4FPKA 3ILNA 5DUUA 3BTZA 4GWIA 4QGMA 4E4HA 1LOFC 3DPRA 3GCXA 4JRAA 2KD7A 2XLAA 4NO4A 3VBSC 3AZWA 5ACA2 2ET7A 2DCKA 3LPGA 1PMJX 2VUAA 1HIXA 4YGBA 2AENA 5D1IA 4UYBA 2P17A 5IWFA 3U07A 3B02A 1GANA 1GP5A 2D6KA 5CVRA 3N9QA 5IT6A 2QFEA 1CJDA 4N90A 1AJKA 1UY1A 3VZMA 3J8F1 1G9DA 1OF3A 2FHRA 2P1BA 2XVGA 4AF9A 3WEZA 1EAH2 3SH5A 1JOBA 3NNLA 5A3WA 2JDAA 3I2IA 4A6OA 4YZ4A 2X5IB 2YGMA 1FX5A 1O91A 1S55A 2GDFA 4WZFA 3ACGA 3NMBA 3WINE 3WP4A 5IK8A 2DVGA 1F35A 2D40A 5IVJA 4A42A 1RUC3 2HWE3 4MGQA 5JZGB 5F6LB 3N7KA 1ND3A 1DYKA 2QQKA 3LSDA 3LIHA 3M3OA 4RGKA 1HQLA 4WVVA 4XF1A 1BHGA 1DF0A 1VAVA 2R16A 2ZZQA 4DUVA 4DB5A 1ST8A 4RHV3 4OMDA 3BUCA 2WNUB 2UURA 5JI9A 4YM0A 3W21A 1TMF3 1ZZ8A 4AEMA 2VMCA 5GALA 3LA7A 3LEIA 5DZFA 3T4HB 2ORXA 2HWD2 2MNGA 2E7QA 2IVJA 4QX1A 4V1PA 1TZOA 3VN4A 2J1VA 3FLPA 4N53B 1GNZA 2BVBA 4ATFA 3ZXFA 4CEWA 4OZOA 3KGZA 1A8MA 1H4HA 3AJYA 2VOVA 2EAKA 3DV8A 1S0IA 2D98A 1WMDA 3TOJA 4JKLA 4XILA 2DVDA 1WMEA 4QM9A 5FZ3A 3I3QA 1RUC1 1VRH2 2HWE1 1NOVA 4XJZA 3POBA 4UOJA 2E32A 4AHYA 1DGLA 2WT2A 3NKTA 3R4SA 5DG2A 1WMXA 3ROUA 4HMZA 3AP7A 4I0BA 4RHV1 4LBJA 2ARCA 4UXAA 1F15A 1WA4A 1CD3G 1TMF1 2FCUA 2Z79A 1PHMA 3BTAA 4Q0QA 1COV2 2ZHLA 3UKTA 4CE8A 5DQ0A 5ANNA 1FMD2 1MEC2 1PVC3 2N7GA 4WM7C 4XBLA 2CSGA 1DU3D 1AR93 3ZYGA 4BXSV 2YV8A 4QXHA 1LB2A 5FYSA 4LLOA 3CZUA 4K40A 3LDKA 4V2WA 2VUDA 2GH8A 5DDJ3 3O1SA 4GB33 1A8DA 3M3QA 4QXKA 3W5MA 2XKOA 3F95A 4W50A 5K8SA 2JDKA 3K3OA 1H6XA 4LHNA 4K3UA 4F83A 1M06G 1YEWA 4XUPA 5FJKA 1ULOA 3JB8A 4FPJA 1EV12 1Y9QA 3KD4A 4DQAA 4XW3A 2QTWB 2XL9A 3JXSA 4S2GA 3TN92 3RZJA 2ID4A 3V65A 1K42A 1HKDA 3CL1A 3QBQA 1CAUA 3SLIA 5FPLA 3MW3A 3AMMA 2RS32 4YVWA 3AKSA 1REFA 4CYDA 1S0BA 1NG0A 2W0XA 3BU7A 4KH9A 2PLV2 5F8PA 1UY3A 3H1WA 1X8EA 5LEJA 3M8LA 1V6KA 1S0EA 3BYWA 2HYXA 3WDXA 4HKWA 2QNKA 3D3AA 2XKPA 1LOBA 3BIEA 2J42A 3RJ2X 1PVC1 2XHKA 5K9YA 2RS53 1WA6X 1AR91 4BQ5A 3PUAA 2O1QA 3ZSKA 5EJ3A 4XTPA 1PVXA 3N9MA 3ZFGA 4DOUA 4NHLA 4CXXA 5DDJ1 3FX3A 5EXOA 4GB31 2XG3A 2BP6A 2RM22 3ZN5A 5KXDA 1XYNA 5JXJA 4K8FA 4WVWA 1MZEA 5L9VA 4LUKA 3CQOA 3GZUC 3D82A 3DKQA 1S0DA 1S0GA 3HD8B 1AYN2 3RZLA 1LEDA 4Q1PA 1GZCA 2W39A 5F5CA 4P9WA 2BEOA 3V0BB 2F4LA 1PM4A 4K1YA 2OKXA 1UU6A 2XJQA 5FYYA 1SDDB 4I02A 4HPKA 4AXOA 4CCJA 2QQVA 4FFIA 4FO9A 4IGPA 3AVSA 4UFLA 2WWJA 3PUSA 2D6NA 4HN0A 1DQ6A 2QQIA 3RVHA 3N4MA 1E57A 2WS93 2RS51 5JAXA 1WD3A 2IZWA 3ZXAC 4AQ2A 2XBO2 5DAWA 3KGLA 4MXWA 4BMEA 4PDWB
chains in the Genus database with same CATH topology
5FZBA 5IVEA 5FZKA 4CSWA 5F37A 4NUBA 4HOOA 4V2VA 4TN7A 5F3IA 4BISA 3KVAA 5LWBA 5A7PA 5IW0A 5FYIA 2Q8CA 5IVVA 5A80A 5IVFA 3OPWA 2P5BA 4LIUA 5FZ3A 5A1FA 4QU1A 5ISLA 4CCLA 5LY1A 4Y4RA 5FJHA 5IVYA 5FZCA 5FZFA 5FZ1A 3PURA 5FZEA 4IGOA 5FUNA 3KV4A 5IVBA 5FPVA 3K3NA 5FYCA 5FYUA 3DXUA 2XMLA 4Y33A 3LD8A 5FZ0A 5FY7A 5FZIA 5K4LA 3U78A 4XDOA 5FPBA 3ZPOA 4QWNA 2XXZA 5FBJA 5FZ9A 3PU3A 2Q8DA 4CCMA 4ASKA 4CCKA 5FP4A 5FY8A 5F5CA 5FY0A 5ANQA 2YPDA 5FZLA 4AI9A 5FV3A 5F5AA 5FYHA 5FZOB 4QXHA 4XDPA 5F5IA 5FYSA 4UF0B 5IVCA 5FZ7A 3N9NA 2XUEA 4GAZA 4V2WA 4Y3OA 2OT7A 4LXLA 4DIQA 3K3OA 5FYMA 3OPTA 5FJKA 5FY4A 5FZMA 4GJYA 3KVBA 5FYTA 2PXJA 3UYJA 2GP3A 5FZ8A 2XDVA 3K2OA 5FY5A 5FPLA 5FZHA 4CCNA 2OQ6A 2OS2A 3AL6A 3U4SA 5A7OA 3PUQA 4QX8A 5FZ6A 4E4HA 4UF0A 3PTRB 5FP3A 5F39A 3N9LA 5FUPA 5A7QA 3ZLIA 5FPAA 5A3NA 5LW9A 5FYBA 3AL5A 5A7SA 4EZHA 5KR7A 3N9PA 5FZAA 5A3TA 5F3EA 5IWFA 2Q8EA 4BU2A 3PU8A 2W2IA 4GD4A 5FZGA 3PUAA 5FWJA 4HONA 4CUGA 3N9QA 3N9MA 2OX0A 5FYVA 5FY9A 5A7WB 3DXTA 5A3PA 2WWUA 2OQ7A 3NJYA 5F3CA 5A3WA 4EZ4A 3PDQA 4QXCA 5F32A 5LY2A 3KV9A 2YBPA 5FXXA 5F3GA 3KV5A 5CEHA 5FXVA 4BXFA 2YBKA 5A1LA 1VRBA 4D6RA 5IVJA 4GJZA 3KV6A 5FP8A 5FZOA 5FP7A 5FZDA 5FZ4A 5A7NA 5FXZA 4D6QA 5F2SA 5FP9A 4URAA 2GP5A 5E6HA 5FWEA 2VD7A 4CCOA 5FYYA 4IGQA 4D6SA 3LDBA 4CCJA 4DO0A 5FXWA 4IGPA 3AVSA 5A7WA 4C8DA 2WWJA 4EYUA 3PUSA 2YU1A 3N9OA 5FY1A 4QX7A 3RVHA 4AAPA 5F2WA 5FYZA 3AVRA 5FPUA 2YU2A 2YBSA 4LITA 4QXBA 4LIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZB A;  5IVE A;  5FZK A;  4CSW A;  5F37 A;  4NUB A;  4HOO A;  4V2V A;  4TN7 A;  5F3I A;  4BIS A;  3KVA A;  5LWB A;  5A7P A;  5IW0 A;  5FYI A;  2Q8C A;  5IVV A;  5A80 A;  5IVF A;  3OPW A;  2P5B A;  4LIU A;  5FZ3 A;  5A1F A;  4QU1 A;  5ISL A;  4CCL A;  5LY1 A;  4Y4R A;  5FJH A;  5IVY A;  5FZC A;  5FZF A;  5FZ1 A;  3PUR A;  5FZE A;  4IGO A;  5FUN A;  3KV4 A;  5IVB A;  5FPV A;  3K3N A;  5FYC A;  5FYU A;  3DXU A;  2XML A;  4Y33 A;  3LD8 A;  5FZ0 A;  5FY7 A;  5FZI A;  5K4L A;  3U78 A;  4XDO A;  5FPB A;  3ZPO A;  4QWN A;  2XXZ A;  5FBJ A;  5FZ9 A;  3PU3 A;  2Q8D A;  4CCM A;  4ASK A;  4CCK A;  5FP4 A;  5FY8 A;  5F5C A;  5FY0 A;  5ANQ A;  2YPD A;  5FZL A;  4AI9 A;  5FV3 A;  5F5A A;  5FYH A;  5FZO B;  4QXH A;  4XDP A;  5F5I A;  5FYS A;  4UF0 B;  5IVC A;  5FZ7 A;  3N9N A;  2XUE A;  4GAZ A;  4V2W A;  4Y3O A;  2OT7 A;  4LXL A;  4DIQ A;  3K3O A;  5FYM A;  3OPT A;  5FJK A;  5FY4 A;  5FZM A;  4GJY A;  3KVB A;  5FYT A;  2PXJ A;  3UYJ A;  2GP3 A;  5FZ8 A;  2XDV A;  3K2O A;  5FY5 A;  5FPL A;  5FZH A;  4CCN A;  2OQ6 A;  2OS2 A;  3AL6 A;  3U4S A;  5A7O A;  3PUQ A;  4QX8 A;  5FZ6 A;  4E4H A;  4UF0 A;  3PTR B;  5FP3 A;  5F39 A;  3N9L A;  5FUP A;  5A7Q A;  3ZLI A;  5FPA A;  5A3N A;  5LW9 A;  5FYB A;  3AL5 A;  5A7S A;  4EZH A;  5KR7 A;  3N9P A;  5FZA A;  5A3T A;  5F3E A;  5IWF A;  2Q8E A;  4BU2 A;  3PU8 A;  2W2I A;  4GD4 A;  5FZG A;  3PUA A;  5FWJ A;  4HON A;  4CUG A;  3N9Q A;  3N9M A;  2OX0 A;  5FYV A;  5FY9 A;  5A7W B;  3DXT A;  5A3P A;  2WWU A;  2OQ7 A;  3NJY A;  5F3C A;  5A3W A;  4EZ4 A;  3PDQ A;  4QXC A;  5F32 A;  5LY2 A;  3KV9 A;  2YBP A;  5FXX A;  5F3G A;  3KV5 A;  5CEH A;  5FXV A;  4BXF A;  2YBK A;  5A1L A;  1VRB A;  4D6R A;  5IVJ A;  4GJZ A;  3KV6 A;  5FP8 A;  5FZO A;  5FP7 A;  5FZD A;  5FZ4 A;  5A7N A;  5FXZ A;  4D6Q A;  5F2S A;  5FP9 A;  4URA A;  2GP5 A;  5E6H A;  5FWE A;  2VD7 A;  4CCO A;  5FYY A;  4IGQ A;  4D6S A;  3LDB A;  4CCJ A;  4DO0 A;  5FXW A;  4IGP A;  3AVS A;  5A7W A;  4C8D A;  2WWJ A;  4EYU A;  3PUS A;  2YU1 A;  3N9O A;  5FY1 A;  4QX7 A;  3RVH A;  4AAP A;  5F2W A;  5FYZ A;  3AVR A;  5FPU A;  2YU2 A;  2YBS A;  4LIT A;  4QXB A;  4LIV A; 
#chains in the Genus database with same CATH topology
 1RUE 3;  2BV4 A;  4XTM A;  4CDQ A;  2RDN A;  2WT1 A;  1TME 2;  4HOO A;  2D3S A;  3WNK A;  2JB8 A;  4LE3 A;  1K5M A;  1OC1 A;  4JGY B;  5EV7 A;  4H7M A;  5FUI A;  3ZX7 A;  3I2J A;  2NQY A;  3VBH A;  2VMH A;  1D4M 3;  3OUH A;  4P9Y A;  2D6O X;  3ENR A;  4B7E A;  5GZC A;  3Q8E A;  4GAL A;  5ISL A;  4AW7 A;  2NZ9 A;  3KT4 A;  4QPG C;  1VAM A;  2OUH A;  3K77 A;  4AVB A;  3OJB A;  4ZU5 A;  1OUS A;  5FZ1 A;  3MIB A;  4ZS3 A;  2Y26 A;  3SEP A;  1ND2 B;  1JXN A;  3VBO A;  1NE4 A;  3AKP A;  2DCY A;  5EQU A;  1PZ9 A;  2OXB A;  3RPQ A;  4IV1 A;  4QWN A;  3WG4 A;  2E63 A;  2ZMK A;  3PU3 A;  4CCM A;  5JVV A;  5JLV A;  2RE9 A;  2WS9 1;  1JOP A;  3T0D A;  1U5I A;  4QQO A;  1UOB A;  3VV1 A;  2YPD A;  2DV9 A;  4NID A;  1GNH A;  1QQP 2;  4RR3 C;  3NJX A;  4MZU A;  4BK4 A;  3OOX A;  3DN7 A;  3LCP A;  5A6Y A;  2FZ1 A;  5AFB A;  2QCS B;  2WO1 A;  2ZXQ A;  5ABJ C;  1CZS A;  1V70 A;  4I0W B;  4XXP A;  3WDT A;  4E9K A;  4PI0 A;  4PJY A;  4TLG A;  1OF4 A;  1LGN A;  2K2S A;  4HVR A;  1CAV A;  1WBF A;  3AZX A;  2RDR A;  4OFG A;  3KF3 A;  4CDU B;  4CDX A;  4XFA A;  3MIH A;  3VB9 A;  1UF2 C;  2ZX4 A;  4AED A;  2IC1 A;  3CZJ A;  1QJU 3;  3P3P A;  2QE3 A;  4A44 A;  1S1A A;  4GMP 3;  2BBA A;  4QAW A;  3X29 B;  4DFS A;  1BXH A;  3NNF A;  1AHS A;  1ENQ A;  2JEM A;  4YM1 A;  4Q8K A;  2BGP A;  2RMU 3;  5A3N A;  4DRR A;  2JDH A;  2EXK A;  5JPN B;  1UNB A;  3HBK A;  4LK6 A;  2ZGT A;  3ZR6 A;  3N9P A;  2W3J A;  4YZ3 A;  1QWR A;  5FKC A;  3MHZ A;  2C0Z A;  1H8T B;  4ITC A;  5GZG A;  3IDB B;  4MV2 A;  2EIB A;  4LBN A;  3D8C A;  3SH3 A;  4XAE A;  3VBR B;  1CPM A;  2JDY A;  1W9Y A;  1XQN A;  2JE7 A;  4NPL A;  3VZK A;  3WDV A;  4LKE A;  3SCG A;  3KQR A;  4RD7 A;  4YGC A;  2Z2S B;  2ZOE B;  3AFK A;  2R1D A;  5C7G A;  3KMH A;  1JYC A;  4PLM A;  2XQX A;  2JE9 A;  4BXF A;  2PHT A;  3MUZ 1;  4IEZ A;  1QH7 A;  2WNV B;  1GWM A;  4AFC A;  1RGS A;  5CG8 A;  1ZBA 1;  4FXK B;  3DKW A;  4COV A;  2NM1 A;  4Y4Y A;  5GZF A;  2C9A A;  4KWL A;  3USU B;  5I8T A;  1ZNP A;  1D2Q A;  4GMP 1;  4CCO A;  3VD9 A;  2ENR A;  4FPC A;  3THD A;  3ZYR A;  4E2G A;  2ZGM A;  2ZGQ A;  5FXW A;  3LEK A;  1UXX X;  3MW2 A;  4KU8 A;  3O1U A;  3QAC A;  2VXR A;  3OBA A;  4EN9 B;  1ZZ9 A;  2ZPX A;  4C0B A;  1YUD A;  4WM8 B;  1H9W A;  4JQT A;  1AJO A;  3NV3 A;  2VOX A;  3GZA A;  1OUR A;  4Q4Y 2;  5BPX A;  2YU2 A;  3CJI B;  3VDD B;  2J1T A;  3LSE A;  1QJX 2;  4L92 A;  4JHT A;  1N1S A;  4IEP A;  2HWB 3;  4PLO A;  4QDR A;  3WNN A;  1KDK A;  1IKP A;  4FPO B;  1BEV 3;  3AMP A;  4MX3 A;  3E6D A;  4YW6 A;  4JTN A;  3S57 A;  5J7M A;  3MDP A;  3HT1 A;  5DN2 A;  4OLL A;  4DUW A;  1IS3 A;  2VVD A;  1IS4 A;  3OYW A;  4Z92 B;  2WAB A;  3B93 A;  2P5B A;  4UT5 A;  5FOJ B;  1NUK A;  1VBB 3;  3CO2 A;  2PHL A;  1DGR A;  4LO4 B;  3I4I A;  5FZF A;  3WG2 A;  3WG1 A;  3WF1 A;  5C9A B;  1BJQ A;  5DG1 A;  4H7L A;  1CWP A;  1F5J A;  1RUH 2;  3ATG A;  1OQD A;  5FZ0 A;  3RYK A;  2JD9 A;  2LUW A;  4JC1 A;  2X5I C;  2GNM A;  4QHB A;  1LOF A;  2XJU A;  1NAE A;  2QUO A;  3VBS A;  5L7O B;  4AI9 A;  1JZ8 A;  2BRT A;  4RFT 0;  1OH3 A;  2HBT A;  4LBQ D;  1W6P B;  3FJS A;  4XAA A;  2HWB 1;  5BV6 A;  1OFN A;  5FMO S;  4BQ2 A;  4BMB A;  1BEV 1;  1W9S A;  3OBZ A;  5EJZ B;  4GZ9 A;  1FAT A;  2JEN A;  1OD3 A;  4GKX A;  1FPN 3;  1LAJ A;  4MGI E;  1RJ7 A;  3HN1 A;  3VL9 A;  3RMX A;  2YB7 A;  1CR7 A;  4XF0 A;  4BZ4 A;  2WNU C;  3HNB M;  1ZRI A;  4NRP A;  5B2G B;  1UL9 A;  3GJB A;  1S0J A;  4TZD A;  3VKO A;  2XB6 C;  4ZON A;  1VBB 1;  2GP3 A;  2WYF A;  3O12 A;  2ZAC A;  1R1Z A;  3ECQ A;  3WHU A;  1ULC A;  3ACH A;  1O3S A;  4HBN A;  1GZT A;  4Q0U A;  1UQX A;  4HSL A;  1E5S A;  5FMB A;  4N53 C;  3KCY A;  3OD0 A;  2NMO A;  3UJO A;  2QQW A;  1TVG A;  3B9I A;  3RQ0 A;  5KC6 A;  5FP3 A;  5A7Q A;  3N9L A;  2IVI B;  1WGP A;  1AXY A;  3HQX A;  5I8Y A;  4FFF A;  2BFU S;  4BIF A;  1C28 A;  3QOP A;  2BVV A;  3S5Q A;  3VBU B;  3NKG A;  4BU2 A;  2L9L A;  2W2I A;  1IG3 A;  4M3C A;  4IE7 A;  3POG A;  2XLG A;  1RVF 2;  4CUG A;  2CGP A;  4URT A;  4XF3 A;  4XUQ A;  1VBE 3;  3MGU A;  1OOP B;  1FPN 1;  4HG6 B;  1JYV A;  4G4F A;  1VBC 2;  4H3W A;  4Q0S A;  1NXD 1;  2ZHM A;  5DZG A;  2JIJ A;  4XUT A;  4AGG A;  4LPL A;  1PGL 1;  3ZN6 B;  4CU9 A;  3ZOI A;  1RUD 3;  2VME A;  4XET A;  2B42 B;  5AC9 2;  1QOS A;  1OFS A;  4E2S A;  1AR8 3;  1XYO A;  2DCZ A;  5C5U A;  5G04 L;  5CAZ A;  3ACF A;  4Y1V A;  2RG4 A;  3VHR A;  3KV6 A;  3OY8 A;  3M2M A;  3I54 A;  4JAA A;  3VD3 A;  4Y22 B;  4PI2 A;  1LJ7 A;  3ES4 A;  1Q8V A;  1EUT A;  1N3Q A;  2A7A A;  5KBF A;  2ZAB A;  2JX9 A;  2QBX A;  3NNM A;  2AAC A;  4ORF A;  4UBH A;  3DGT A;  2V5Y A;  1PX3 A;  2BOI A;  4IEO A;  3WOG A;  3E1F 1;  1OVP A;  2AEY A;  3H3L A;  2ZEY A;  3FWE A;  3E6B A;  2RDQ A;  4QPW A;  4UW4 A;  4QX7 A;  3J7M A;  1H1I A;  2H6C A;  1CVN A;  1R08 2;  3RWN A;  3WG3 A;  4CU7 A;  2IFW A;  1F4A A;  4CVU A;  4P02 B;  5C8C B;  1PNG A;  4WM7 A;  5IVE A;  1VBE 1;  4AR2 A;  4NRQ A;  2ZS6 B;  4IE6 A;  2ZBJ A;  4KWK A;  3POY A;  4JGZ B;  2H0B A;  3N7J A;  2G9Z A;  3DYP A;  2YC0 A;  1ZRC A;  1PO2 3;  2O14 A;  1RUD 1;  3B00 A;  3TEY A;  1WCD J;  2AUY A;  2GC0 A;  5LRS A;  1SLA A;  1OLQ A;  4M3C F;  5IVV A;  1AR8 1;  1AUY A;  4UI9 L;  4DEV A;  3LFM A;  5IVY A;  4MG2 A;  2BWA A;  1FXZ A;  2LM3 A;  1O3R A;  1TQ5 A;  3QH7 A;  2PHR A;  3N3H A;  5IVB A;  3AYE A;  2XVL A;  5HI0 A;  4FP2 A;  4NWV A;  2ARA A;  2W95 A;  5L36 A;  4N43 B;  2A6X A;  1I5P A;  5FY8 A;  3PLQ A;  3C7G A;  3IIA A;  5KXC A;  1YQ8 A;  4EQV A;  3SNM A;  2DVF A;  5I0U A;  3OGG A;  5F5I A;  4YNI A;  4BQ4 A;  4FPY A;  4COU A;  1C8M 2;  1XNC A;  4UW6 A;  2E7A A;  2G1M A;  4YW7 A;  2Y6F A;  2CWS A;  1SPP B;  4IL7 A;  1PO2 1;  4JDN A;  4XUN A;  2CGN A;  2VQ0 A;  2WFP A;  4Q27 A;  4JDO A;  3OF1 A;  2IFR A;  1XC6 A;  3B9C A;  3LEM A;  1UIJ A;  1ASJ 3;  2V4V A;  3BPS A;  5I91 A;  2CNA A;  4IE0 A;  4PDW C;  4KBB A;  2B9V A;  4YFW A;  4CP9 B;  3LDR A;  2HWF 3;  3OGS A;  3AKT A;  3H3U A;  2A6Z A;  4TYS A;  3AFG A;  3PTR B;  1KQR A;  5T5J A;  1MVE A;  1V9U 3;  3S7I A;  1LHO A;  2A6Y A;  3NV1 A;  4JGY C;  5GLW A;  5GLZ A;  2HWC 2;  5JSP A;  1BBT 3;  2R06 3;  2VCB A;  3K4D A;  2DFC A;  4Q4W 3;  4JKK A;  1W8O A;  4BPZ A;  2CWM A;  3BOW A;  5FYV A;  3CDZ B;  5A7W B;  3THP A;  2HJI A;  1W9W A;  1WUV A;  1CIW A;  3V64 A;  4B1M A;  1ND2 C;  3LIG A;  1DBN A;  4EZ4 A;  3AKQ A;  5CIS A;  5JMC A;  5SV8 A;  1XNK A;  5FPX A;  3ZSL A;  1DGR N;  3T1L A;  2JJ6 A;  4LEJ A;  1HXS 3;  1PZ8 A;  4ZZ5 A;  1ASJ 1;  3KF5 A;  1CAX A;  3CIH A;  4IE5 A;  2RDS A;  3JBG 3;  1HV0 A;  1FV2 A;  5LA9 A;  1Z7S 2;  4DEQ A;  3LDB A;  1HRI 3;  2XQR A;  2RS1 1;  1V9U 1;  1XRU A;  3O7O A;  4IXL A;  4K8R B;  4Q4V 2;  1X9T A;  3EO6 A;  1BBT 1;  2R06 1;  1UU5 A;  2D7F A;  2DU1 A;  2P34 A;  2VUJ A;  1OHF A;  3M4F A;  2VCC A;  4O65 A;  5IAV A;  2WO2 A;  4XMA A;  1X9P A;  4Q4W 1;  4D7T A;  1JYN A;  2YBS A;  3OPZ A;  4CDU C;  2YZ4 A;  3ZN4 A;  1UN1 A;  3UGF A;  5KC5 A;  5LBF A;  1OBN A;  2XJV A;  4AVS A;  3C7H A;  1SFY A;  4D7S A;  1WW5 A;  5JSO A;  2ZEX A;  1EYB A;  4FOV A;  1E5I A;  5A7P A;  2NYY A;  4YZ1 A;  5IW0 A;  3WNO A;  4CEY A;  1RUI 2;  2W1Q A;  1DGW X;  1U5Y A;  4IEW A;  5FO7 B;  2P3Y A;  4J1W A;  5C3P A;  1HXS 1;  1YQ5 A;  5A33 A;  5ABJ A;  1POV 3;  1UPS A;  4BQ3 A;  2QQP A;  2G19 A;  4AGR A;  4E8C A;  2WKK A;  2ET1 A;  5CKM A;  2UY9 A;  2X53 S;  2DTY A;  4MSV A;  3U75 A;  1RIN A;  1G9A A;  4QKD A;  1H8T C;  1UZZ A;  5FZC A;  3JBG 1;  2Z4F A;  3AXE A;  3VBR C;  1R09 3;  4C0H A;  4RQP B;  5GZE A;  1APN A;  2RR1 2;  4LA3 A;  4YM2 A;  2AGS A;  3ZM8 A;  1I9R A;  3POJ A;  4XC9 A;  1RUF 3;  1H8V A;  1W6O B;  1JW6 A;  5JWP A;  1FV3 A;  4YW5 A;  3T08 A;  3T2P A;  1RMU 3;  2AYH A;  2R07 2;  2PHX A;  1HB4 A;  1O4Y A;  1Y4W A;  2WNV C;  4R9A A;  1EP0 A;  1HRV 3;  5FZO B;  3VKF C;  1Z78 A;  1GYK A;  4XDP A;  3DUI A;  1C3H A;  1GQG A;  4M0H A;  4GAZ A;  1SBE A;  2R0F A;  3FHQ A;  4MH0 E;  2R04 2;  3I2K A;  4AWD A;  1NY7 2;  1UW8 A;  3ZXJ A;  2DF7 A;  4YM3 A;  5HBA A;  2E7T A;  5GKA C;  3PL0 A;  1J84 A;  1W6M B;  4LO7 A;  1CON A;  5L9B A;  4EN7 B;  1MS1 A;  2BNM A;  1POV 1;  3V0A A;  4WM8 C;  2I07 B;  4AK3 A;  2C4X A;  1ONA A;  1YXW A;  4GMP 0;  4KG0 A;  3ZDS A;  1UIK A;  3AP5 A;  5CFC B;  3CJI C;  3VDD C;  1OH4 A;  4XAB A;  1H0B A;  4G9S B;  3SIS A;  1W2N A;  2QZ3 A;  5BNN B;  3I59 A;  1JHJ A;  5CNA A;  1YJK A;  3O0W A;  4NAM A;  2UYA A;  1LUL A;  3EJK A;  2VXJ A;  2ZMN A;  4O7X A;  1NLQ A;  1OKQ A;  1RUF 1;  4ZS2 A;  3VZN A;  2X10 A;  2WQZ C;  1W6N A;  4XE9 A;  3WW2 A;  1V00 A;  4MGY E;  3NNG A;  5FZA A;  2Q1Z B;  1RMU 1;  3PVO A;  3FLR A;  4X6R B;  3SEE A;  1HRV 1;  1AYM 2;  3C2U A;  3TNP B;  3K51 A;  1KD7 A;  5BNO B;  3M70 A;  4QU2 A;  2D97 A;  4D94 A;  2WYS A;  4IEY A;  3VKN A;  4KWU A;  5C9A C;  5BUV A;  1L7R A;  3VDD A;  5F3C A;  1XSR A;  4F7Z A;  2WQ4 A;  4NOT A;  2IXI A;  3SMH A;  1IPK A;  2P3I A;  1PIV 3;  1HB2 A;  2WJS A;  1GWL A;  3LZZ A;  3MYX A;  2LAL A;  1J1T A;  4MUV A;  3RI8 A;  1O3Q A;  1YFY A;  5LA2 A;  4R4Z A;  2RHP A;  5JDB A;  4IQP A;  2Y6L A;  5L7O C;  5CG9 A;  1FYU A;  3VD4 A;  2A3W A;  3OB8 A;  4FPE A;  2WSV A;  4HSJ A;  4IGQ A;  1OPM A;  3ZYF A;  5JOW A;  4EN6 B;  2AC1 A;  4E4D X;  1C1F A;  3S6P A;  3N9O A;  1UZY A;  4Q4X 3;  4QD2 A;  2QQN A;  2X5I A;  2C9K A;  1SHW B;  4YZ2 A;  4BJ0 A;  1UD1 A;  3NNJ A;  4L0P A;  3BIW E;  3VD5 A;  4XQW A;  1YQC A;  3MW4 A;  2HEW F;  4CSW A;  3T30 A;  4ES9 A;  5JZG A;  2JG9 B;  4L11 A;  2ORZ A;  3FHA A;  1NXM A;  2VOK A;  3OD4 A;  2XPJ A;  2XJP A;  3DYO A;  3DPR B;  1PIV 1;  1L3J A;  1O4Z A;  4FAG A;  3RZK A;  1X50 A;  1YC6 1;  4AGV A;  1CAW B;  2OW4 A;  3J8F 2;  1QDO A;  1NYW A;  2WNU A;  1W39 A;  2B45 X;  3KT1 A;  3VBU C;  3VBF B;  5CBL A;  3TWI A;  2JDP A;  2VTF A;  2Y6G A;  2ZJC A;  1VBA 3;  1TEI A;  2JB4 A;  3PMS A;  1O4T A;  5E16 A;  4QPY A;  1MVQ A;  3A4U A;  3EXU A;  1CZT A;  4PIX A;  1H2N A;  1OOP C;  3BU0 A;  5BNQ A;  2FZ2 A;  4N53 A;  5T3N A;  3PHM A;  5FZ9 A;  2D3P A;  3IN9 A;  5JIA A;  4YVS B;  4GXL A;  4GH4 A;  4AG4 A;  4Q4X 1;  4F3J A;  3PVE A;  2E26 A;  1QF3 A;  1D7P M;  5JOZ A;  2WRA A;  2VW1 A;  2K9Z A;  2CY6 A;  4DIN B;  3GZT B;  3D0J A;  4GWJ A;  1EUU A;  1TE1 B;  1UZV A;  1ZBE 3;  3A22 A;  5FZ7 A;  1GUI A;  4XUR A;  5LA1 A;  2WZR 3;  3D6E A;  2OT7 A;  5LZ6 A;  2VM9 A;  4IES A;  4H14 A;  3LPF A;  4HFS A;  5H9R A;  1WKY A;  2GZW A;  4BH9 A;  2AZ5 A;  2G9G A;  1EV1 3;  4LA2 A;  3LA2 A;  4XOG A;  3KVB A;  4X8P A;  5HXM A;  2V4A A;  1LR5 A;  3K46 A;  4LTA A;  4XEZ A;  1IZ3 A;  4BQ1 A;  2XDV A;  2RS3 3;  1KEX A;  5C3Q A;  5APA A;  1VBA 1;  1ZM1 A;  1V6J A;  3U4S A;  5C8C C;  1UCX A;  1LEC A;  3O1V A;  4DMI A;  4JHZ A;  3A0K A;  3THT A;  1QJY 3;  1RUC 2;  4JGZ C;  2HWE 2;  3FHI B;  4Y5Z 0;  1UOG A;  3QD6 A;  3OUI A;  1R1A 3;  1W0N A;  4ASL A;  1WCS A;  1SLB A;  4HK9 A;  1J3Q A;  3RI9 A;  4RHV 2;  4ZZ8 A;  2LTN A;  4XPV A;  2JKX A;  2E9Q A;  3U0Z A;  1E5H A;  1ZBE 1;  1TMF 2;  4RS5 A;  4A2U A;  1QOT A;  2WZR 1;  1BMV 1;  5D8A B;  2PYT A;  4A4A A;  3WY6 A;  1SEF A;  1QXJ A;  3O1R A;  3KV9 A;  1GR3 A;  1QH6 A;  1GU3 A;  3ETP A;  4XZU G;  3MZH A;  4S2D A;  3LF7 A;  1UKG A;  2PAE A;  3GNE A;  5A1L A;  4N43 C;  2VUC A;  4HXC A;  1R64 A;  2YG0 A;  3BTX A;  5I93 A;  2C5D A;  5FDB A;  5CYY A;  5FXZ A;  3WF0 A;  4D6Q A;  1YQ2 A;  4MGZ E;  5J98 B;  1RC6 A;  5LAS A;  4A3Z A;  2Y60 A;  3ST7 A;  4HAN A;  5E8A A;  1EPW A;  1QJY 1;  2KA3 A;  4Q0P A;  4Z2A A;  3GBW A;  5AVP A;  4KWJ A;  3O1O A;  4CZS A;  1R1A 1;  5C3R A;  4XFB A;  3ELN A;  3HQU A;  3IDA A;  3RS6 A;  4I2O A;  1LHW A;  1RUG 3;  2VL4 A;  4CDW B;  4XJ8 A;  1VLN A;  3J4U H;  2XBO 3;  1BK1 A;  4HET A;  4QKB A;  1G9F A;  3PIG A;  4JKM A;  4Y1Z A;  4QXB A;  5LW9 A;  5FOB B;  1JZ2 A;  4Z2W A;  4FVV A;  4LBK A;  4YVW B;  3FUQ A;  1WCU A;  1WD4 A;  5DAP A;  4B29 A;  3I2O A;  1TME 3;  1UX6 A;  4GQ7 A;  4N8M A;  1YJL A;  2VQT A;  1K5J A;  5BYN A;  3W5N A;  1PVC 2;  5J37 A;  1W28 A;  4P9G A;  1AR9 2;  3V0B A;  1LOG A;  1V6M A;  2PEL A;  3I49 A;  3WF2 A;  1UOJ A;  2JIG A;  3NJZ A;  2XON A;  2EXJ A;  1D2S A;  2DDU A;  5DDJ 2;  4GB3 2;  1J3P A;  5LY1 A;  1K3I A;  3K4Z A;  2HLE A;  4HVQ A;  4KI5 M;  3Q9O A;  2Y6J A;  4NR1 A;  4N7U A;  3VHP A;  1RHI 3;  1FOD 3;  2ES3 A;  1UY2 A;  4GIQ A;  1A34 A;  3O0X A;  3K48 A;  1O3T A;  2H6B A;  3A7Q A;  4PDW A;  4A45 A;  2XWB B;  1GP6 A;  1HX6 A;  2CTV A;  1ENS A;  3RYP A;  4QKN A;  3DYM A;  4RFR B;  1RUG 1;  2BYV E;  2Y33 A;  1RXG A;  4E4Z A;  1JH5 A;  4JGY A;  2CDO A;  5J36 A;  3KHC A;  2VZT A;  4L99 A;  1W03 A;  2RJK A;  4UFJ A;  2VH9 A;  2JDU A;  3WNL A;  1SLL A;  1US2 A;  3K4A A;  2RS5 2;  4DIQ A;  1O5U A;  1N1V A;  3JD7 3;  3P5B A;  3GDB A;  3I3B A;  1ND2 A;  1GZW B;  3S30 A;  1H9P A;  5FYT A;  1HB1 A;  1BZW A;  1TNR A;  5CKQ A;  4W4Z A;  5AVA A;  4BK5 A;  1LU1 A;  4R9D A;  3PTY A;  2PQS A;  2DUP A;  4FPG A;  2W08 A;  3VKM A;  3MIF A;  1RHI 1;  1FOD 1;  3WT3 A;  1VBD 3;  3IMM A;  3KHB A;  4AI8 A;  1W9T A;  3LOI A;  3VZJ A;  4N9H A;  3MF6 A;  2VVE A;  3J7N A;  5FBZ A;  4AVA A;  3LE0 A;  2ETE A;  1OQ1 A;  2QQJ A;  5FO9 B;  1LOC A;  2ZHN A;  4L9B A;  3ZXK A;  4IV3 B;  1JUH A;  1RUE 1;  3JB4 C;  2X29 A;  1UYZ A;  1NZI A;  2D5F A;  3VHO A;  5LK7 B;  1SLC A;  1BK0 A;  4CU6 A;  5EYX A;  4BDV B;  5JSR A;  2WLP A;  3J7H A;  4FQZ A;  3NW4 A;  5HCH A;  1UZW A;  2Y0I A;  3AMN A;  1YWK A;  2WWU A;  1D4M 1;  1XND A;  2WS9 2;  1BQP A;  4WBB A;  4CDU A;  1ULG A;  2VZQ A;  3VBO B;  3MF9 A;  3U4X A;  4RQP C;  3PUH A;  2XVK A;  3JD7 1;  3OGR A;  4QX0 A;  2P6C A;  4IE4 A;  5CEH A;  1US3 A;  2GH2 A;  1ZZ7 A;  4W65 A;  2ZKN A;  5FXV A;  3LOB A;  1VPH A;  1VRB A;  1V6I A;  2A5Z A;  3RMY A;  1UO9 A;  4XCB A;  1I6X A;  5A7N A;  4AFD A;  1U12 A;  5H9P A;  1VBD 1;  2ZKL A;  4NE9 A;  2JIC A;  1CX1 A;  2Y38 A;  5L9R A;  1QXP A;  2WBK A;  4ZXK A;  2VEC A;  1PO1 3;  3KWV A;  4M0N A;  2GN7 A;  3VBR A;  4CPB D;  5C70 A;  1ZRF A;  4FT8 A;  2BBV A;  3HQR A;  2YU1 A;  1SLT A;  2MEV 3;  3F2Z A;  2GMM A;  1CX4 A;  2ZTN A;  1WLT A;  4QKF A;  4HKO A;  2NLR A;  1NCR B;  1QHD A;  5K7P A;  2O0O A;  3BOD A;  1S2E A;  4LIT A;  2VJX A;  4MHR A;  2RJ2 A;  3VUO A;  5F9T A;  5KHH A;  1PMH X;  3IT8 A;  2XLF A;  5A32 B;  3PNA A;  2WNV A;  4DPN A;  3NAP B;  5CFC C;  3OGJ A;  4A3X A;  5BNN C;  2A73 B;  1JUI A;  1ULF A;  2A3X A;  4BLJ A;  1VB4 A;  3ZKY A;  3USU A;  1XOY A;  4YW4 A;  4NHY A;  1CPN A;  5FYI A;  2ARE A;  4JQR A;  4HZF A;  1QJU 1;  2GC3 A;  3EYP A;  4YW2 A;  3WDW A;  4BHP A;  4P00 B;  1GZ9 A;  3FL7 A;  3H9A A;  4AVT A;  1WCK A;  5IJR A;  1AR7 3;  3ZFE A;  4FPF A;  2RMU 1;  4WM8 A;  4MGT A;  4NVP A;  5BNO C;  1OD5 A;  2BU9 A;  3CJI A;  4RYD A;  1MS5 A;  5FYC A;  2X05 A;  1PO1 1;  2VY0 A;  4QQL A;  5FK7 A;  3DXU A;  4COY A;  1H1M A;  3U78 A;  1SFP A;  1RUJ 3;  1S4C A;  1ZBA 2;  3QCW A;  2MEV 1;  3EHK A;  4R9C A;  4UW5 A;  1MZ5 A;  4Y1Y A;  5HCF A;  5JI7 A;  2VZO A;  4CCK A;  1ZA7 A;  2QQL A;  3AYC A;  5FV3 A;  5FYH A;  4DRV A;  5GJ6 A;  1FI2 A;  3R4D B;  4KG8 A;  2Q5T A;  5GM0 A;  3T1M A;  3WR0 A;  4P14 A;  3TRS B;  2UU8 A;  1GMM A;  2FQP A;  5C33 A;  1MZ6 A;  3C8X A;  4L97 A;  2BZD A;  4QPI B;  3WCS A;  1O7F A;  1PGW 1;  3ETQ A;  4ONU A;  3ZIX A;  3AKR A;  3FMG A;  1DCS A;  4ARX A;  5C9A A;  4P9L A;  5LRR A;  3I8T A;  4GJY A;  1W99 A;  2EXI A;  2BPA 2;  1MZF A;  1BCX A;  5LEK A;  2P2K A;  1JBC A;  3M3E A;  1W6Q B;  1Z0H A;  4Q5O A;  3UK9 A;  3JUU A;  3MO4 A;  3VKL A;  1VP6 A;  4E2Q A;  2A70 A;  1AR7 1;  3M3I A;  1NLS A;  1QJE A;  2D44 A;  2WZP P;  4AI2 A;  2D6P A;  5L7O A;  1J59 A;  3J26 N;  2ZX1 A;  5I0T A;  3ACL A;  4D7Y A;  2IXK A;  3HMY A;  4CUC A;  4XVH A;  2CAV A;  1RUJ 1;  2JG9 C;  5IYY A;  3UNP A;  1WLC A;  5EFU A;  3GZE A;  2WFF 3;  1SQ4 A;  3DPR C;  2VUL A;  2YPJ A;  1WCQ A;  3B94 A;  3OYW B;  5A3T A;  2HBU A;  1AZD A;  2WLQ A;  2Y0O A;  2P37 A;  3WVJ A;  3WP3 A;  5AFE A;  3VBF C;  1DLL A;  5FWJ A;  3QLQ A;  5E88 A;  3SXW A;  2EA7 A;  3IM0 A;  2WWS A;  3NWK A;  1GQH A;  1SMV A;  2W9X A;  1ALY A;  2QKD A;  4KL1 A;  4FSJ A;  2FCT A;  1DYP A;  2VBP A;  3E5X A;  3BPZ A;  3FBM A;  2IXL A;  5FXX A;  2HWB 2;  5A6Q A;  2GN3 A;  3MPP G;  3WSO A;  3C3V A;  1AVB A;  3C7O A;  3ZMN A;  1BEV 2;  3AZZ A;  1JS9 A;  2O8O A;  4YVS C;  4D6R A;  4A7K A;  5FP8 A;  4JVA A;  1W8W A;  5EJ1 B;  3ZPY A;  2PHU A;  5G05 L;  1AF9 A;  1CQ9 A;  1XU2 A;  4BQW A;  1JYX A;  4EN8 B;  1MS4 A;  3MFA A;  3U1X A;  3TYJ A;  4AL9 A;  4ISR A;  3SQO A;  1X8M A;  2V5D A;  1YIF A;  1VBB 2;  2W52 A;  4DO0 A;  4EJR A;  4ZY9 A;  4EYU A;  1HN0 A;  2WFF 1;  3H42 B;  2VW0 A;  3N35 A;  4IEV A;  2BGO A;  2QDR A;  2RV9 A;  1QOO A;  1SCS A;  5FYZ A;  5JXG A;  3C7E A;  1OA2 A;  4PLN A;  4LIV A;  5IFT A;  1AX2 A;  1HQN A;  1X36 A;  2CDP A;  3MID A;  3RZZ A;  5IAX A;  1JZ7 A;  3B3Q E;  1MQT B;  1ULD A;  4QB1 A;  5K0U B;  2ZX2 A;  4XJU A;  4Y22 A;  5BY5 A;  2C6S A;  1QEX A;  4DZG A;  1ZA4 A;  5TSW A;  5T5L A;  4QDS A;  4CEW C;  1GOH A;  2Q8C A;  4AHX A;  4D69 A;  2WA3 A;  1BYH A;  4RSU A;  1FPN 2;  2PAK A;  1G7Y A;  3UGH A;  3WNM A;  4IUG A;  5FJH A;  1PGL 2;  1J1L A;  3MIE A;  1NA1 B;  2JG8 B;  3KZ4 C;  4LHL A;  2ADD A;  4QM8 A;  5FK8 A;  3CMG A;  1W8Z A;  1UMZ A;  5FYU A;  5C8C A;  3FE5 A;  1JMU B;  1L7L A;  5D8A C;  2D93 A;  3ZPO A;  4OI0 A;  2W47 A;  5FBJ A;  3KT7 A;  3MI8 A;  4MAD A;  4QGN A;  4XF4 A;  5C71 A;  2UY8 A;  5LA0 A;  3LQC A;  4AVC A;  1XNT A;  2VC9 A;  1UMH A;  2NPI A;  3FN9 A;  1XSQ A;  2Y64 A;  2C26 A;  4UF0 B;  1FNY A;  1N1T A;  1DQ1 A;  4XF9 A;  1C8M 3;  1JU3 A;  3T2O A;  4GUL A;  4K6B A;  4M4R A;  3WCR A;  1JI6 A;  5JMO A;  1EPZ A;  1MPX A;  4DXT A;  2IXH A;  1HLC A;  1WBL A;  5JOY A;  3RRD A;  3SIT A;  1VE0 A;  2D3R A;  2PHD A;  3GBF A;  4AZZ A;  3RNS A;  4UFM A;  1ULE A;  1VBE 2;  1XNA A;  5LBB A;  4Z1V A;  3HWJ A;  4CDW C;  2JE8 A;  3HOB A;  4BQY A;  4N43 A;  3AL6 A;  1RUD 2;  3ILF A;  4YVW C;  1AR8 2;  3IKW A;  3UL2 A;  4ZHN A;  3WW4 A;  3ON7 A;  5FZ6 A;  5GZD A;  4NPR A;  1XB9 A;  4JCK A;  3O14 A;  1YI9 A;  2ZX0 A;  4CXW A;  1VMH A;  4M01 A;  3NV4 A;  5LCW L;  1SPP A;  2E51 A;  3ABZ A;  2LRO A;  1YFW A;  4DUX A;  2JKB A;  5A3L A;  2FDI A;  3HN3 A;  1LKN A;  1W0P A;  4F8A A;  1LOD A;  4LHK A;  3B01 A;  4BIO A;  3I2F A;  3OBT A;  3C7F A;  1K45 A;  4MLO A;  5FKB A;  1SCR A;  4RN5 A;  3OUJ A;  2VZV A;  3HVD A;  5A3M A;  2ARX A;  4P9X A;  3N7L A;  2EID A;  1AL2 3;  2WR9 A;  4CP9 A;  4ZPI A;  2A6W A;  4DS0 A;  1URX A;  4BWO A;  5CAD A;  1KS4 A;  5JR7 B;  4OYU A;  3GXU A;  4COW A;  1T6G C;  4QDQ A;  4QB2 A;  1JU4 A;  1PO2 2;  2X8K A;  5FZ4 A;  3WQ1 A;  5HXV A;  2XJT A;  5EWS A;  4BB3 A;  2PTM A;  2VD7 A;  4B4R A;  2XWJ B;  4D6S A;  1CZV A;  2CYF A;  5T5P A;  1L7Q A;  1JYI A;  1NZC A;  1QNY A;  4NWW A;  5DXD A;  1BKZ A;  5E89 A;  5A7W A;  2W94 A;  4ZXE A;  1H6Y A;  2OYZ A;  3JU9 A;  4XIK A;  4C8D A;  2PQQ A;  5FY1 A;  1KFX L;  2HYK A;  3OG2 A;  2D6M A;  3VL8 A;  2BWC A;  2XJR A;  1AXK A;  3M3C A;  3ZVX A;  1AX1 A;  4LK7 A;  4LOT A;  5F6K A;  3T09 A;  4CCE A;  3T0B A;  3P1I A;  1LHU A;  1B35 B;  2R49 A;  5FZB A;  3EQE A;  5FZK A;  3LGR A;  4JV4 A;  1UZ0 A;  2Y34 A;  2J1E A;  2YFZ A;  5FRA A;  2VBD A;  2C1F A;  1J83 A;  1HDK A;  2Q1M A;  4MGS A;  1AL2 1;  4YLZ A;  1GV9 A;  3IWZ A;  4TWT A;  3H0O A;  4QPG A;  4IV3 C;  1U0A A;  3WUD A;  4L2N A;  4D3W A;  5JXH A;  2PHF A;  2HWF 1;  1H2M A;  5A1F A;  3WP5 A;  1OT5 A;  2ARB A;  1GFF 2;  1JZ4 A;  4EWD A;  3WF4 A;  3L2Y A;  1Q8P A;  3CF6 E;  4IGO A;  1FT9 A;  1VIW B;  1D0G A;  3KV4 A;  5DAQ A;  4YAR A;  3V56 A;  5KWR A;  4LOS A;  4AI0 A;  1A6C A;  2QQM A;  4XZP A;  4OVE A;  1ASJ 2;  1DFQ A;  5K4L A;  3VBO C;  4LMF A;  1KS5 A;  1IS6 A;  3AMH A;  2WZ8 A;  2VO5 A;  4FPH A;  4XHX A;  2IWG B;  4OI1 A;  2YHJ A;  2ZA9 A;  1H2L A;  3R05 A;  1QDC A;  4LKD A;  5KHG A;  2VNO A;  1SBF A;  2Q1F A;  2ZGR A;  5F5A A;  4RR3 A;  2UYB A;  2VNG A;  2WO3 A;  3SHR A;  2RS1 2;  1NKG A;  1V9U 2;  5C8W A;  4QX5 A;  1W3X A;  4LUM A;  2BUK A;  3NVC A;  4Z8B A;  4QQ2 A;  4I01 A;  1BBT 2;  2R06 2;  1DQ2 A;  5DUW A;  1PNF A;  3RWK X;  4Q4W 2;  3OPT A;  3ZFF B;  2GNT A;  1S0C A;  2VPV A;  2ZGK A;  4NIG A;  3DCQ A;  5C4W A;  3AX4 A;  4RQP A;  4A7Z A;  4HL0 A;  2VOT A;  4W8J A;  4WVM A;  4GWN A;  3ZDV A;  1N1Y A;  1NCR C;  4ERO A;  1HRI 1;  1W6O A;  4Y5S A;  5IAT A;  1AR6 3;  4XQ4 A;  2YFU A;  2Z42 A;  4PIY A;  1QXR A;  4IEU A;  4FOQ A;  5FR3 A;  5CFD B;  5A6X A;  1HXS 2;  3HR9 A;  1SLI A;  3H3Z A;  3NAP C;  3CNA A;  4O9E A;  3O1M A;  5T50 A;  1YRZ A;  1UKR A;  2WNE A;  5HCB A;  2AH2 A;  2WN2 A;  4LBQ A;  3W58 A;  2DFB A;  2VW2 A;  3WW3 A;  3ZYB A;  1YO8 A;  4CEY B;  3M7A A;  4UWD A;  3LA3 A;  1ZZB A;  3JBG 2;  3ZYI B;  1LEM A;  5F3E A;  1FAY A;  5A33 B;  3FZ3 A;  4U2A A;  4XJW A;  5T5O A;  1W6M A;  1QJF A;  3OCP A;  2J1S A;  4JTO A;  2OX0 A;  3TEZ A;  4NMI A;  1OSG A;  1STM A;  3PVN A;  4OUS A;  2DYC A;  4I3P A;  4FCA A;  1LGB A;  4MOA A;  5CFC A;  2P4E A;  3W20 A;  4NHM A;  4K20 A;  5BNN A;  1UMI A;  4FTE A;  4ZKT B;  3LKJ A;  1O8S A;  1JOJ A;  1R09 1;  4S2F A;  1KDM A;  3DEM A;  3U10 A;  1Y9M A;  1AR6 1;  3WUC A;  3RFR A;  2EAA A;  1O8P A;  5A70 A;  3RG0 A;  2VE1 A;  4URA A;  1JYT A;  3Q8F A;  5ACA 3;  2PFW A;  3P6B A;  1X82 A;  5DZE A;  5BNO A;  2GAU A;  5FMC A;  4QPI C;  3LEG A;  4OCT A;  4Y20 A;  3NRU A;  3LAG A;  2CAU A;  1EAH 3;  2DCT A;  2K46 A;  4YG3 A;  3IPV B;  4OHZ A;  5BNP B;  1MS8 A;  2XR4 A;  5FLI A;  3WD5 A;  1RUF 2;  2ADE A;  1RXF A;  1MS9 A;  2TBV A;  1I3H A;  4NUB A;  1RMU 2;  2OPK A;  5F3I A;  3UKV A;  3POE A;  2Q8O A;  3BN6 A;  4B7K A;  1HRV 2;  2WUH A;  1IPJ A;  4I3G A;  1F2N A;  3O1T A;  1NX9 A;  1JZ3 A;  4HKL A;  4D0Q A;  4BM8 A;  4RL7 A;  1NLR A;  3Q8C A;  1V6O A;  3D0S A;  1YFX A;  1JTZ X;  2P3K A;  5FRE A;  4CP1 A;  1MS3 A;  2UWC A;  4KU7 A;  1HB3 A;  1PM7 A;  4AE2 A;  5ACA 1;  1ODM A;  5FUN A;  1XJA A;  1IQD C;  1KXG A;  4XDQ A;  2HWD 3;  1PK6 B;  4PIZ A;  5FQ0 B;  5FZI A;  3CKH A;  3RYR A;  1NCQ B;  2LRP A;  3AK0 A;  3AJZ A;  1KJR A;  4ASK A;  1OUX A;  2JG9 A;  1W0O A;  5H9Q A;  4HN1 A;  1ENR A;  2J1R A;  3AYD A;  3ITQ A;  1EAH 1;  1W06 A;  2UWB A;  4OI2 A;  4YZ5 A;  2GND A;  5CB7 A;  3ZXD A;  2YDE A;  1QU0 A;  4LO5 B;  2HEV F;  1CAW A;  5FLJ A;  4NRM A;  2F4P A;  4Q8L A;  3VBF A;  4O61 A;  2VAU A;  3OSD A;  3PME A;  4LXL A;  4CRQ A;  1VRH 3;  4COZ A;  2Q30 A;  2F17 A;  5J1X A;  2J22 A;  1H30 A;  1LES A;  4XFC A;  2IUW A;  3UKN A;  3UET A;  3Q8B A;  2DTW A;  2G9F A;  2PXJ A;  3BCW A;  3UYJ A;  5FZ8 A;  1VB2 A;  2R6Q A;  5I8S A;  1JZ5 A;  2GC1 A;  2XHN A;  4YVS A;  4CCC A;  1BLZ A;  1PIV 2;  3TEW A;  1COV 3;  4FP3 A;  5IK7 A;  3VLB B;  1QNW A;  1FMD 3;  1MEC 3;  1QY4 A;  1T2X A;  4MET A;  2HWD 1;  1MQT C;  4LBL A;  4BYY A;  3GBG A;  5K0U C;  2DUQ A;  1E5R A;  2E33 A;  3AL5 A;  1ND3 B;  1W2U A;  5KHJ A;  2KXL A;  2V73 A;  1RB8 G;  5IFP A;  1POQ A;  4YRD A;  2I45 A;  5GLV A;  4XMI A;  3M1H A;  4AQ6 A;  4HON A;  5FY9 A;  4AFM A;  3DXT A;  4DXR A;  4KGG A;  2A71 A;  3TN9 3;  1NA1 C;  1GOF A;  2JG8 C;  3OBR A;  4YWA A;  2OQ7 A;  1VRH 1;  2VTX J;  4Q4X 2;  4KGQ A;  4IND A;  4AHW A;  2B7Y A;  3IB3 A;  4AAX A;  2CGO A;  1UWW A;  5A3O A;  5F3G A;  1W8T A;  3A21 A;  2C24 A;  2W68 A;  1RTV A;  3W59 A;  3WP6 A;  2YBK A;  2FCV A;  2PLV 3;  1OVS A;  2Y6K A;  3DF0 A;  3HBZ A;  4GH4 B;  2OZ6 A;  1OA4 A;  1YLL A;  2DUR A;  3ZXE A;  4CUB A;  5FO8 B;  4BLI A;  4GWM A;  2VBB A;  4CEW B;  4XJA A;  5F2S A;  4FQ4 A;  1COV 1;  1BVP 1;  4YPJ A;  5E6H A;  2ZAH A;  4OUM A;  3DL3 A;  3H50 A;  1IKQ A;  1FMD 1;  1MEC 1;  2Q0A A;  4J6G A;  4XIO A;  4CP0 A;  3LB9 A;  1W8H A;  2YUE A;  3NQH A;  5A6Z A;  4AVV A;  3CJX A;  5I0S A;  4NPM A;  1VBA 2;  2ZX3 A;  1VMF A;  5D8A A;  4QMA A;  1CIY A;  4QHO A;  2VGD A;  2RM2 3;  2GMP A;  2WO7 A;  5FPU A;  2VZR A;  2VZU A;  3GAL A;  3MV1 1;  3VDC A;  4JX0 A;  4Y1U A;  5CZK A;  2A75 A;  4CA9 A;  1GKB A;  4Z07 A;  1EV1 1;  3MUY 1;  1YHF A;  5J09 A;  1W8F A;  5KXE A;  2HKX A;  3TN9 1;  2YXS A;  1AYN 3;  5F37 A;  4LT5 A;  2YRO A;  4JDM A;  2O8Q A;  2OA2 A;  5JR2 A;  3WHT A;  2RS3 1;  4RGA A;  2W1U A;  1ZBE 2;  4AEJ A;  1XYP A;  2WZR 2;  1A78 A;  1LHN A;  2PLV 1;  3AZY A;  3I2H A;  1DP0 A;  3OPW A;  1WW4 A;  1BMV 2;  4FTB A;  4Y24 A;  1S0F A;  3E6C C;  1G6N A;  3VDA A;  3TBD A;  4B4P A;  3TAY A;  4CDW A;  1IGO A;  3POI A;  4FOW A;  4N9I A;  4RS5 B;  4TLF A;  4OHY A;  2JEC A;  1LEN A;  1OLM E;  2W1S A;  3GYD A;  2XGX A;  3B5L B;  3APB A;  2AEZ A;  3VD7 A;  2NP0 A;  2Q4S A;  4EN0 A;  2BER A;  1CAU B;  1H1A A;  1V0A A;  2Q8D A;  2XL7 A;  3T0A A;  5C5T A;  1XNB A;  1ZYB A;  2RM2 1;  3B7M A;  1Y43 B;  5B4X A;  3ZYJ B;  1QJY 2;  4A6S A;  2V72 A;  5HV4 A;  3BB6 A;  3PIJ A;  4R9B A;  4I30 A;  4KMQ A;  1Q8Q A;  1R1A 2;  2PHW A;  2XUE A;  1AYN 1;  4PBP A;  3ZSJ A;  2NN8 A;  2SBA A;  5FYM A;  1UYX A;  1S2K A;  4XBQ A;  3SC7 X;  3TEX A;  1GWK A;  2A1X A;  5H9S A;  1BVV A;  1OQE A;  3IDC B;  3FFQ A;  3ZFG B;  3ZMO A;  3ZXL A;  2J1U A;  1N3O A;  4JRL A;  1GQP A;  2W92 A;  4CCN A;  4FI9 A;  4B1L A;  4D8M A;  1W2T A;  4P9J A;  5A7O A;  4LBO A;  3SKV A;  5LB6 A;  3WDY A;  3KQ4 B;  4ISQ A;  1B35 C;  4K9S A;  4OHV A;  4CCD A;  1RIT A;  3ZKU A;  5DAB A;  5FPZ A;  2XBO 1;  3SH4 A;  2B4K A;  1I1E A;  4FTS A;  5JPM B;  1W04 A;  1QQP 3;  1T6B X;  3JQW A;  5KR7 A;  1LNS A;  1TME 1;  2VMF A;  3RDI A;  4IEQ A;  4NHK A;  1PX4 A;  1GZW A;  4HPK B;  4P5H A;  3VZL A;  3FBY A;  1OXC A;  1ULP A;  1HV1 A;  1RUG 2;  1Q5O A;  1UOF A;  1AX0 A;  1XE8 A;  2VG9 A;  4NHX A;  1VAL A;  3NJY A;  3WXP A;  4B4Q A;  3N36 A;  2XUM A;  3E97 A;  4H2A A;  1OPO A;  1CES A;  2EAL A;  3ZYP A;  4I09 A;  4MXW B;  4AOC A;  3KV5 A;  4EE2 A;  4PQQ A;  4EV0 A;  4XFH A;  4C1W A;  1G86 A;  3P3N A;  4CDQ B;  2GU9 A;  2CU5 A;  5C4W C;  4IV3 A;  3HT2 A;  3ZSE A;  1YYN A;  1K5M B;  3WW1 A;  1J3R A;  3S0M A;  3TNQ A;  4WZC A;  3VBH B;  2RJL A;  4UW3 A;  1MR5 A;  4J25 A;  1EY2 A;  3NST A;  2VTX A;  1Q8S A;  2H0V A;  1QQP 1;  2A3Y A;  3ZFF C;  2IXJ A;  1RHI 2;  1FOD 2;  3HAG A;  4YGE A;  5F2W A;  3GHM A;  3LFI A;  3GGL A;  1X7N A;  3AVR A;  4OHX A;  3WQ7 A;  4XHB A;  2QVS B;  1UAI A;  2ZML A;  3CBN A;  4MHU A;  5LK5 A;  1YIP A;  3MIC A;  4IV1 B;  4YG0 A;  4PF1 A;  1RUE 2;  3KB5 A;  3MFC A;  4P08 A;  5IK4 A;  1C1L A;  3ES1 A;  5CIR A;  4TN7 A;  2XH6 A;  4DY3 A;  1RIR A;  5CFD C;  4CXY A;  3OEB A;  1NT0 A;  3O0V A;  4BE3 A;  3H1M A;  5HCA A;  2WII B;  5FFO C;  4CEY C;  4W6Y A;  4XJ9 A;  1D4M 2;  3WLU A;  1H8T A;  3WZ1 A;  1QIQ A;  3VZO A;  3H8X A;  3I3D A;  4FXG B;  4AYU A;  2EXH A;  4FFH A;  3JD7 2;  4QHZ A;  4Q1R A;  4FFG A;  5FZE A;  1NCR A;  1JN2 P;  2MPF A;  4OI4 A;  4ARY A;  2GME A;  2TEP A;  4Q4Y 3;  4L8Q A;  2VMG A;  3WQB A;  1ZBA 3;  4A41 A;  2NMN A;  5A32 A;  2E53 A;  1CAV B;  1QJX 3;  1SBD A;  5FPB A;  4CDX B;  2W5F A;  2JDM A;  3NAP A;  3U11 A;  4PCR A;  3KM5 A;  3R4U A;  1F8V A;  1HN1 A;  1VBD 2;  2P3J A;  4AED B;  2VCM A;  2BNO A;  5FP4 A;  4CP2 A;  4WVZ A;  5ANQ A;  3CU7 A;  5KHK A;  3HEI A;  4YSF A;  5T55 A;  1POV 0;  4HLT A;  3ACI A;  3DEC A;  4QGL A;  4P9I A;  5IUQ A;  2TUN A;  2YY1 A;  1UYP A;  4ZU7 A;  3KCC A;  5DUX A;  2DUO A;  4R8H A;  1KRI A;  4X6Q B;  4LE4 A;  5FZM A;  1DG6 A;  1OI6 A;  2Y6H A;  3ME2 A;  3BVC A;  1JOD A;  1RUH 3;  4LLF A;  5CA6 A;  2OUJ A;  2YC4 A;  2VNR A;  2D5H A;  2YGL A;  1WMF A;  1DGW A;  3CEW A;  5FZH A;  5JIU A;  5L19 A;  5BNP C;  2ZGN A;  3POF A;  3NL1 A;  5FMO L;  3SCH A;  5I0R A;  1A3K A;  2B39 A;  1QJU 2;  4LBM A;  2VZS A;  2XOM A;  2VZ1 A;  3PUQ A;  4FPL A;  4Q4Y 1;  4EWA A;  4IDZ A;  3WQ0 A;  5J48 A;  1FNZ A;  4YG6 A;  1QJX 1;  4HVO A;  4FBF A;  1TG7 A;  3ALQ A;  5FUP A;  5F5Q A;  4Y26 A;  2OVU A;  5FPA A;  1M4W A;  2RMU 2;  1QJZ A;  4XXA A;  1DQ0 A;  3JCI A;  1B09 A;  3AP9 A;  4QPI A;  2Q8E A;  3WF3 A;  1WLW A;  4XFG A;  5M0T A;  4XCA A;  1PO1 2;  3BOP A;  5FTT C;  4AI1 A;  3ZFE B;  1ZX5 A;  1C5H A;  1LTE A;  2MEV 2;  3MPB A;  1W6Q A;  4R52 A;  4PT6 A;  1IG0 A;  4GKY A;  4KQ7 A;  1DQ4 A;  5EIY B;  5FAX A;  5KXB A;  3PDQ A;  3S5A A;  1Y9G A;  5JXI A;  1PK6 C;  2WAO A;  2FDH A;  2YBP A;  1NCQ C;  5A1A A;  5EZW A;  1D0H A;  3MIG A;  2WSU A;  3BKZ A;  2BFU L;  4YGD A;  5BXX A;  1CGP A;  1RUH 1;  2OII A;  2UWA A;  2VZP A;  4GJZ A;  2VVF A;  1OMI A;  1W6P A;  1XXN A;  5DPN A;  5FZD A;  1PGW 2;  1GOG A;  1GLH A;  1MAC A;  3BTY A;  2GP5 A;  4W6X A;  1W3V A;  3HJR A;  4RA0 A;  4YW1 A;  1ZRR A;  4YFZ A;  5F7U A;  2DU0 A;  3VDB A;  1AR7 2;  2G4I A;  1F9K A;  1DYO A;  1RVF 3;  3LWC A;  4WV8 A;  5DUV A;  4ASM B;  3JZV A;  4CTE A;  2DBN A;  4AAP A;  2GC2 A;  1IOA A;  5FMD A;  1WW6 A;  4M00 A;  2ZEZ A;  2JDZ A;  1VBC 3;  2BTV C;  4MXV A;  1ZRE A;  3K75 B;  2PA7 A;  2FBE A;  3GF6 A;  4PHZ A;  1C5I A;  1G8W A;  1RUJ 2;  1IPS A;  2HEY F;  2V09 A;  5J96 B;  3RJR A;  4TSV A;  2WA4 A;  2ZZJ A;  2E6V A;  5DAX A;  5AC9 3;  1AL0 G;  5HPO A;  4E8D A;  4V2V A;  1XE7 A;  2WDB A;  3KVA A;  3ZYH A;  4RGG A;  5LWB A;  3AP6 A;  3VBS B;  2FD8 A;  3PJY A;  5JZG C;  2VMD A;  3H8R A;  1IQA A;  2JWP A;  4E27 A;  2B9U A;  3VBU A;  4FOY A;  4JZR A;  5A80 A;  3E5U A;  4DXZ A;  4NN0 A;  1IHM A;  1ND3 C;  1REE A;  1RED A;  2J1A A;  3I3E A;  4LIU A;  4Q26 A;  4CCL A;  4MO3 M;  2B5H A;  4Y4R A;  1SZB A;  4X8N A;  1WZX A;  5SV5 A;  3UT0 A;  1ODN A;  3A0N A;  1GP4 A;  1F5F A;  1VR3 A;  2R7E B;  4LOR A;  3PJQ A;  4XYX A;  3ASI A;  4NIH A;  2OPW A;  1OOP A;  3IBM A;  1R08 3;  3ORJ A;  3THC A;  5T52 A;  5JUV A;  4NRO A;  2XML A;  1U5Z A;  3AM2 A;  4J1X A;  3ZN6 A;  1RVF 1;  3HIF A;  5L73 A;  1MQT A;  1OA3 A;  1PGS A;  4K1Z A;  3MLK A;  5C3O A;  4LHS A;  3EMR A;  2R1B A;  5K0U A;  1ENX A;  4O9G A;  1VBC 1;  3I2G A;  1LGC A;  1LOE A;  1UY0 A;  4OMC A;  1O5L A;  4QQH A;  4QT6 A;  4R4X A;  5D21 A;  4GH4 C;  4KBZ A;  3AC0 A;  3URF A;  2D43 A;  3GHN A;  2A6V A;  2WFF 2;  3R6S A;  1HJF A;  2ILM A;  1KJL A;  2CL2 A;  5LBC A;  4Y3O A;  4C91 A;  5AC9 1;  1IS5 A;  5IK5 A;  1W2O A;  1LRH A;  1NA1 A;  2JG8 A;  2QJV A;  3BAL A;  4B8E A;  4M3C B;  5FY4 A;  3I2D A;  4CU8 A;  3HNM A;  1C57 A;  3WV6 A;  3H7Y A;  5FLH A;  2VMI A;  3ZR5 A;  3MLL A;  5FY5 A;  1YI7 A;  3B69 A;  1YFU A;  4SLI A;  1DLC A;  4W6W A;  1X33 A;  3ZSM A;  3QH6 A;  2FDG A;  1R08 1;  4JGZ A;  3FUO A;  1OKO A;  2B8M A;  2EIG A;  4P5Y A;  4QX8 A;  1HJG A;  5GLU A;  2KR2 A;  4UF0 A;  2TNF A;  3I97 A;  5F39 A;  2PN5 A;  3OY8 B;  2WNO A;  4G3Y C;  5CU1 A;  5FYB A;  5LBE A;  5A7S A;  4EZH A;  3MLJ A;  3AP4 A;  4LKS A;  3KSC A;  1V6N A;  5B4N A;  3PU8 A;  5FZG A;  3RZG A;  4NJ4 A;  4QX2 A;  3T4V A;  5A3U A;  4ES8 A;  4PQ9 A;  4UFH A;  4B3N A;  1D4V B;  1ZRD A;  4RS5 C;  4E4S A;  2CV6 A;  1KFU L;  3GM8 A;  4H55 A;  3UES A;  2FDF A;  1W05 A;  1H2K A;  4K21 A;  1LOA A;  4QXC A;  4Z82 A;  5F32 A;  4S2H A;  2EVX A;  4LUL A;  1W2A X;  1QGL A;  1MS0 A;  4Q0V A;  1ZVF A;  3T3Y A;  4WM7 B;  3UGG A;  1QKQ A;  3IMN A;  2W91 A;  3FC0 A;  2KM2 A;  3POW A;  3AYA A;  2GNB A;  2ZGU A;  2D6L X;  2X09 A;  3MV0 1;  3PVB B;  2HWC 3;  5FWE A;  4K7J A;  5C6C A;  5JCT A;  2ZGO A;  1W9F A;  2ERF A;  4MGK E;  3KLS A;  2F6B A;  4BCU A;  3WNP A;  2Z69 A;  3G7D A;  3HNY M;  5EPA A;  3RZM A;  3U14 A;  1C8M 1;  4OHW A;  5CKN A;  1DDL A;  3H8U A;  2VU9 A;  4NIA A;  2VCA A;  4DXS A;  1UXZ A;  3ZFG C;  3T2Q A;  2BOJ A;  3WNX A;  1SAC A;  1SG3 A;  3EBR A;  1XBF A;  3GJA A;  4SBV A;  1DZQ A;  2YC2 A;  1CJP A;  1GIC A;  1YNA A;  3POS A;  1O6U A;  3ZXG A;  4BIS A;  3III A;  1NQD A;  5HV0 A;  3CHX A;  2FDK A;  4AQS A;  2QZ2 A;  3FLT A;  2LW8 A;  1G9B A;  1WWY A;  2EIE A;  3ILR A;  5IVF A;  1Z7S 3;  1VMJ A;  4UFK A;  2J7M A;  4QU1 A;  4IER A;  2VOW A;  1I5Z A;  3E5Q A;  1H4G A;  4TXW A;  5DAV A;  4XFI A;  4CPB A;  4TTG A;  3MBW A;  4PF5 A;  4OUL A;  2WT0 A;  2HWC 1;  4Q4V 3;  4AQT A;  3O5S A;  4XQD A;  5FPV A;  2YMZ A;  4IET A;  4LKF A;  2ZEW A;  2RVA A;  2ZGP A;  3I3M A;  4IEX A;  4QB6 A;  4UFI A;  2DVB A;  1B35 A;  3LD8 A;  3TB0 A;  4XDO A;  1DHK B;  1NE6 A;  2WAA A;  3AZV A;  1RYY A;  2FMY A;  3AB0 A;  3L9J T;  4DY5 A;  5FZL A;  4BOW A;  4GA9 A;  2RS1 3;  5FCC A;  2VZ3 A;  4CDQ C;  1RUN A;  2W87 A;  2E31 A;  1HQW A;  2Z5W A;  1RUI 3;  2DVA A;  1ZZ6 A;  3WDU A;  2FDJ A;  3Q8A A;  2I74 A;  1LU2 A;  1QMJ A;  1K5M C;  5GLT A;  2P6H A;  2R30 A;  3VBH C;  5IHR A;  3RZH A;  3FFZ A;  1RUO A;  1TNF A;  1N3P A;  5E1R A;  3BI3 A;  1C8N A;  3NO8 A;  3UV9 A;  1V6L A;  4I0A A;  4KNC A;  1Z7S 1;  2FMD A;  3D5O A;  4AI3 A;  3IDE A;  4DNY A;  4ET7 A;  2WC2 A;  1Q56 A;  1W90 A;  3OGV A;  2RR1 3;  5EYY A;  3NV2 A;  1N47 A;  1GBG A;  1PZ7 A;  2OQ6 A;  2OS2 A;  3J7L A;  3R0R A;  1SDW A;  4HT1 T;  1AL2 2;  1K12 A;  4LJH A;  4Q4V 1;  1NQJ A;  4HK8 A;  4UBG A;  1Q3E A;  4IV1 C;  1J58 A;  3BGA A;  2QDN A;  2R07 3;  1VAK A;  2MHF A;  2HWF 2;  3N7M A;  4YYO A;  2CHH A;  5T54 A;  2DWR A;  5FIX A;  1HW5 A;  3ZLI A;  5ERL A;  4M3C E;  5JOX A;  1CAX B;  1KIT A;  4Y5T A;  1VJ2 A;  3EB7 A;  3PUI A;  4QPG B;  4C90 A;  2R04 3;  4AFB A;  2AR6 A;  3ZFF A;  4GD4 A;  3H7J A;  2EF6 A;  1RUI 1;  2DCJ A;  1DZT A;  3H1Y A;  2IXC A;  4XBN A;  4C1X A;  4M4P A;  5A3P A;  1RJ8 A;  1W8U A;  1GNY A;  2GSY A;  1LCL A;  3OEA A;  3IAQ A;  1UYY A;  5LY2 A;  2W1W A;  2I2S A;  4PBO A;  4MYE A;  3W9A A;  5CFD A;  4CDX C;  2JD4 A;  4LO8 A;  1S2B A;  2RR1 1;  4AED C;  5FZO A;  2GAL A;  5FP7 A;  4OQ9 A;  4RR3 B;  2R0H A;  2WN3 A;  2WQ8 A;  1XE0 A;  3AMQ A;  5FP9 A;  3HPN A;  1PMI A;  1DIW A;  3RSJ A;  1Y3T A;  2PMW B;  3INA A;  2R07 1;  4OUE A;  1SFN A;  2ZGS A;  4CUA A;  5ABJ B;  2QQO A;  4AEK A;  1G9C A;  3O1P A;  1AYM 3;  1HRI 2;  1F31 A;  1ZZC A;  2Y8K A;  3AXD A;  2WL1 A;  3KS7 A;  4NII A;  3A23 A;  3KCX A;  3USS A;  5C4W B;  3I7D A;  2VQA A;  1WLD A;  3WX5 A;  2R04 1;  4OZX A;  1LHV A;  1DZR A;  2K0G A;  1NY7 1;  4WVM B;  3IAP A;  1CN1 A;  2B46 X;  3GCW A;  1U5X A;  3SKJ E;  5F1R A;  5EP9 A;  4U36 A;  4FAH A;  3IZO A;  3L2H A;  4MVT A;  4BA6 A;  1W8N A;  2BGC A;  1UU4 A;  1JYW A;  1XU1 A;  2DBI A;  2VR4 A;  4LQR A;  4Q2F A;  3ZIW A;  2VNV A;  4AHZ A;  3CLP A;  3S7E A;  4LBQ B;  2BDR A;  1UX7 A;  1YQ6 A;  2R32 A;  5D2A A;  1JHN A;  4XAC A;  4EWE A;  1P8J A;  2JDN A;  2ZCW A;  4XFF A;  2BJS A;  3UJQ A;  4OQ8 A;  3H8O A;  1OLR A;  3PUR A;  4YW3 A;  4XUO A;  4NAO A;  5DMY A;  3ZFE C;  3K3N A;  1WW7 A;  3T2T A;  3IPV A;  1DQ5 A;  3J9S A;  2OZJ A;  1R09 2;  4Q29 A;  5BNP A;  1AYM 1;  3V0A B;  4Y33 A;  5FY7 A;  2JXA A;  1AR6 2;  4LO6 B;  2WZE A;  2XXZ A;  3ZO0 B;  2WIN B;  1OLM A;  4QX3 A;  1Q8O A;  1Y7B A;  1RL3 A;  3MEP A;  5FY0 A;  4QQP A;  3VGI A;  3G6J B;  3I59 B;  2HH9 A;  1Q43 A;  4LR4 A;  4N7I A;  4AFA A;  3D4K A;  4ZU4 A;  1KGY A;  1XPW A;  5IVC A;  4ATE A;  3N9N A;  4Y1X A;  2LS6 A;  1W6N B;  5EHD A;  2YYO A;  3J8F 3;  2EIC A;  1AXZ A;  4A7Y A;  3JQX A;  1O59 A;  2W46 A;  3RGB A;  5KHI A;  1JZ6 A;  2XJS A;  1ACC A;  2BNN A;  2ZGL A;  3U37 A;  3SCF A;  1F4H A;  1YCI A;  2ATF A;  1UPI A;  4Y20 B;  1GSL A;  1PK6 A;  4UAP A;  5FQ0 A;  5C3S A;  1C4R A;  2ZHK A;  1NCQ A;  2ZAA A;  2VQU A;  2SLI A;  3K2O A;  4BQX A;  2PAM A;  3NJV A;  5J3U A;  1UY4 A;  4IW3 A;  3VHN A;  5I0D A;  5LAT A;  3OTF A;  2BQP A;  4LNV A;  2BW8 A;  2QQU A;  4FPK A;  3ILN A;  5DUU A;  3BTZ A;  4GWI A;  4QGM A;  4E4H A;  1LOF C;  3DPR A;  3GCX A;  4JRA A;  2KD7 A;  2XLA A;  4NO4 A;  3VBS C;  3AZW A;  5ACA 2;  2ET7 A;  2DCK A;  3LPG A;  1PMJ X;  2VUA A;  1HIX A;  4YGB A;  2AEN A;  5D1I A;  4UYB A;  2P17 A;  5IWF A;  3U07 A;  3B02 A;  1GAN A;  1GP5 A;  2D6K A;  5CVR A;  3N9Q A;  5IT6 A;  2QFE A;  1CJD A;  4N90 A;  1AJK A;  1UY1 A;  3VZM A;  3J8F 1;  1G9D A;  1OF3 A;  2FHR A;  2P1B A;  2XVG A;  4AF9 A;  3WEZ A;  1EAH 2;  3SH5 A;  1JOB A;  3NNL A;  5A3W A;  2JDA A;  3I2I A;  4A6O A;  4YZ4 A;  2X5I B;  2YGM A;  1FX5 A;  1O91 A;  1S55 A;  2GDF A;  4WZF A;  3ACG A;  3NMB A;  3WIN E;  3WP4 A;  5IK8 A;  2DVG A;  1F35 A;  2D40 A;  5IVJ A;  4A42 A;  1RUC 3;  2HWE 3;  4MGQ A;  5JZG B;  5F6L B;  3N7K A;  1ND3 A;  1DYK A;  2QQK A;  3LSD A;  3LIH A;  3M3O A;  4RGK A;  1HQL A;  4WVV A;  4XF1 A;  1BHG A;  1DF0 A;  1VAV A;  2R16 A;  2ZZQ A;  4DUV A;  4DB5 A;  1ST8 A;  4RHV 3;  4OMD A;  3BUC A;  2WNU B;  2UUR A;  5JI9 A;  4YM0 A;  3W21 A;  1TMF 3;  1ZZ8 A;  4AEM A;  2VMC A;  5GAL A;  3LA7 A;  3LEI A;  5DZF A;  3T4H B;  2ORX A;  2HWD 2;  2MNG A;  2E7Q A;  2IVJ A;  4QX1 A;  4V1P A;  1TZO A;  3VN4 A;  2J1V A;  3FLP A;  4N53 B;  1GNZ A;  2BVB A;  4ATF A;  3ZXF A;  4CEW A;  4OZO A;  3KGZ A;  1A8M A;  1H4H A;  3AJY A;  2VOV A;  2EAK A;  3DV8 A;  1S0I A;  2D98 A;  1WMD A;  3TOJ A;  4JKL A;  4XIL A;  2DVD A;  1WME A;  4QM9 A;  5FZ3 A;  3I3Q A;  1RUC 1;  1VRH 2;  2HWE 1;  1NOV A;  4XJZ A;  3POB A;  4UOJ A;  2E32 A;  4AHY A;  1DGL A;  2WT2 A;  3NKT A;  3R4S A;  5DG2 A;  1WMX A;  3ROU A;  4HMZ A;  3AP7 A;  4I0B A;  4RHV 1;  4LBJ A;  2ARC A;  4UXA A;  1F15 A;  1WA4 A;  1CD3 G;  1TMF 1;  2FCU A;  2Z79 A;  1PHM A;  3BTA A;  4Q0Q A;  1COV 2;  2ZHL A;  3UKT A;  4CE8 A;  5DQ0 A;  5ANN A;  1FMD 2;  1MEC 2;  1PVC 3;  2N7G A;  4WM7 C;  4XBL A;  2CSG A;  1DU3 D;  1AR9 3;  3ZYG A;  4BXS V;  2YV8 A;  4QXH A;  1LB2 A;  5FYS A;  4LLO A;  3CZU A;  4K40 A;  3LDK A;  4V2W A;  2VUD A;  2GH8 A;  5DDJ 3;  3O1S A;  4GB3 3;  1A8D A;  3M3Q A;  4QXK A;  3W5M A;  2XKO A;  3F95 A;  4W50 A;  5K8S A;  2JDK A;  3K3O A;  1H6X A;  4LHN A;  4K3U A;  4F83 A;  1M06 G;  1YEW A;  4XUP A;  5FJK A;  1ULO A;  3JB8 A;  4FPJ A;  1EV1 2;  1Y9Q A;  3KD4 A;  4DQA A;  4XW3 A;  2QTW B;  2XL9 A;  3JXS A;  4S2G A;  3TN9 2;  3RZJ A;  2ID4 A;  3V65 A;  1K42 A;  1HKD A;  3CL1 A;  3QBQ A;  1CAU A;  3SLI A;  5FPL A;  3MW3 A;  3AMM A;  2RS3 2;  4YVW A;  3AKS A;  1REF A;  4CYD A;  1S0B A;  1NG0 A;  2W0X A;  3BU7 A;  4KH9 A;  2PLV 2;  5F8P A;  1UY3 A;  3H1W A;  1X8E A;  5LEJ A;  3M8L A;  1V6K A;  1S0E A;  3BYW A;  2HYX A;  3WDX A;  4HKW A;  2QNK A;  3D3A A;  2XKP A;  1LOB A;  3BIE A;  2J42 A;  3RJ2 X;  1PVC 1;  2XHK A;  5K9Y A;  2RS5 3;  1WA6 X;  1AR9 1;  4BQ5 A;  3PUA A;  2O1Q A;  3ZSK A;  5EJ3 A;  4XTP A;  1PVX A;  3N9M A;  3ZFG A;  4DOU A;  4NHL A;  4CXX A;  5DDJ 1;  3FX3 A;  5EXO A;  4GB3 1;  2XG3 A;  2BP6 A;  2RM2 2;  3ZN5 A;  5KXD A;  1XYN A;  5JXJ A;  4K8F A;  4WVW A;  1MZE A;  5L9V A;  4LUK A;  3CQO A;  3GZU C;  3D82 A;  3DKQ A;  1S0D A;  1S0G A;  3HD8 B;  1AYN 2;  3RZL A;  1LED A;  4Q1P A;  1GZC A;  2W39 A;  5F5C A;  4P9W A;  2BEO A;  3V0B B;  2F4L A;  1PM4 A;  4K1Y A;  2OKX A;  1UU6 A;  2XJQ A;  5FYY A;  1SDD B;  4I02 A;  4HPK A;  4AXO A;  4CCJ A;  2QQV A;  4FFI A;  4FO9 A;  4IGP A;  3AVS A;  4UFL A;  2WWJ A;  3PUS A;  2D6N A;  4HN0 A;  1DQ6 A;  2QQI A;  3RVH A;  3N4M A;  1E57 A;  2WS9 3;  2RS5 1;  5JAX A;  1WD3 A;  2IZW A;  3ZXA C;  4AQ2 A;  2XBO 2;  5DAW A;  3KGL A;  4MXW A;  4BME A;  4PDW B; 
#chains in the Genus database with same CATH homology
 5FZB A;  5IVE A;  5FZK A;  4CSW A;  5F37 A;  4NUB A;  4HOO A;  4V2V A;  4TN7 A;  5F3I A;  4BIS A;  3KVA A;  5LWB A;  5A7P A;  5IW0 A;  5FYI A;  2Q8C A;  5IVV A;  5A80 A;  5IVF A;  3OPW A;  2P5B A;  4LIU A;  5FZ3 A;  5A1F A;  4QU1 A;  5ISL A;  4CCL A;  5LY1 A;  4Y4R A;  5FJH A;  5IVY A;  5FZC A;  5FZF A;  5FZ1 A;  3PUR A;  5FZE A;  4IGO A;  5FUN A;  3KV4 A;  5IVB A;  5FPV A;  3K3N A;  5FYC A;  5FYU A;  3DXU A;  2XML A;  4Y33 A;  3LD8 A;  5FZ0 A;  5FY7 A;  5FZI A;  5K4L A;  3U78 A;  4XDO A;  5FPB A;  3ZPO A;  4QWN A;  2XXZ A;  5FBJ A;  5FZ9 A;  3PU3 A;  2Q8D A;  4CCM A;  4ASK A;  4CCK A;  5FP4 A;  5FY8 A;  5F5C A;  5FY0 A;  5ANQ A;  2YPD A;  5FZL A;  4AI9 A;  5FV3 A;  5F5A A;  5FYH A;  5FZO B;  4QXH A;  4XDP A;  5F5I A;  5FYS A;  4UF0 B;  5IVC A;  5FZ7 A;  3N9N A;  2XUE A;  4GAZ A;  4V2W A;  4Y3O A;  2OT7 A;  4LXL A;  4DIQ A;  3K3O A;  5FYM A;  3OPT A;  5FJK A;  5FY4 A;  5FZM A;  4GJY A;  3KVB A;  5FYT A;  2PXJ A;  3UYJ A;  2GP3 A;  5FZ8 A;  2XDV A;  3K2O A;  5FY5 A;  5FPL A;  5FZH A;  4CCN A;  2OQ6 A;  2OS2 A;  3AL6 A;  3U4S A;  5A7O A;  3PUQ A;  4QX8 A;  5FZ6 A;  4E4H A;  4UF0 A;  3PTR B;  5FP3 A;  5F39 A;  3N9L A;  5FUP A;  5A7Q A;  3ZLI A;  5FPA A;  5A3N A;  5LW9 A;  5FYB A;  3AL5 A;  5A7S A;  4EZH A;  5KR7 A;  3N9P A;  5FZA A;  5A3T A;  5F3E A;  5IWF A;  2Q8E A;  4BU2 A;  3PU8 A;  2W2I A;  4GD4 A;  5FZG A;  3PUA A;  5FWJ A;  4HON A;  4CUG A;  3N9Q A;  3N9M A;  2OX0 A;  5FYV A;  5FY9 A;  5A7W B;  3DXT A;  5A3P A;  2WWU A;  2OQ7 A;  3NJY A;  5F3C A;  5A3W A;  4EZ4 A;  3PDQ A;  4QXC A;  5F32 A;  5LY2 A;  3KV9 A;  2YBP A;  5FXX A;  5F3G A;  3KV5 A;  5CEH A;  5FXV A;  4BXF A;  2YBK A;  5A1L A;  1VRB A;  4D6R A;  5IVJ A;  4GJZ A;  3KV6 A;  5FP8 A;  5FZO A;  5FP7 A;  5FZD A;  5FZ4 A;  5A7N A;  5FXZ A;  4D6Q A;  5F2S A;  5FP9 A;  4URA A;  2GP5 A;  5E6H A;  5FWE A;  2VD7 A;  4CCO A;  5FYY A;  4IGQ A;  4D6S A;  3LDB A;  4CCJ A;  4DO0 A;  5FXW A;  4IGP A;  3AVS A;  5A7W A;  4C8D A;  2WWJ A;  4EYU A;  3PUS A;  2YU1 A;  3N9O A;  5FY1 A;  4QX7 A;  3RVH A;  4AAP A;  5F2W A;  5FYZ A;  3AVR A;  5FPU A;  2YU2 A;  2YBS A;  4LIT A;  4QXB A;  4LIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...