5FZOA

Crystal structure of the catalytic domain of human jmjd1c
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
343
structure length
338
Chain Sequence
MIPHSWICEKHILWLKDYKNSSNWKLFKECWKQGQPAVVSGVHKKMNISLWKAESISLDFGDHQADLLNCKDSIISNANVKEFWDGFEEVSKRQKETVVLKLKDWPSGEDFKTMMPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROBABLE JMJC DOMAIN-CONTAINING HISTONE DEMETHYLATION PROT E
publication title Crystal Structure of the Catalytic Domain of Human Jmjd1C
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 99
structure length 338
sequence length 343
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fzoA01
3K2OA 4DIQA 2GP5A 2XMLA 5A3TA 3RVHA 4UF0A 4AI9A 1VRBA 5F32A 4ASKA 5ANQA 4XDPA 4HOOA 5A1LA 5FYHA 2Q8EA 5IVFA 5FXVA 5IVBA 2OQ7A 5A7OA 4LXLA 3KV6A 4LIVA 2W2IA 5FYCA 5F3IA 4CCMA 4EZHA 3KVBA 5A3PA 2YBSA 2WWUA 4GD4A 3PUSA 4Y33A 4D6RA 5FZOA 5FY1A 5FPVA 5A3NA 3ZLIA 3DXUA 5FY5A 4QXHA 4BXFA 5F2WA 3OPWA 3U78A 4EZ4A 3PUQA 5FZLA 5FJHA 2Q8DA 5FUPA 5A7QA 4CCNA 5FZ1A 4NUBA 4HONA 5F3EA 2OT7A 4V2WA 4IGQA 4IGOA 5FYMA 3K3OA 4D6SA 4Y3OA 5K4LA 2YU2A 5FY8A 5FP7A 5FZ6A 5FZGA 4CCJA 3PU3A 5F5AA 3PTRB 4CCOA 5F3CA 3AVRA 5F37A 5A7WB 5IW0A 3AVSA 5F39A 3PDQA 5FYYA 2YBKA 5A1FA 5IVJA 5LW9A 4TN7A 4DO0A 5FXZA 3N9OA 5F2SA 4EYUA 5FUNA 4Y4RA 4CCKA 3PU8A 4UF0B 3PUAA 2OS2A 2OX0A 5FZ9A 5FZIA 4BISA 5FYUA 5FZCA 4E4HA 3N9QA 4LITA 2WWJA 3U4SA 5A80A 4LIUA 4QX7A 5FZAA 5LY2A 4QXBA 5FY0A 5FZDA 5F5IA 3LDBA 5FPLA 3KV4A 2GP3A 5A7PA 3AL6A 5FP9A 3PURA 4BU2A 2PXJA 5FBJA 5KR7A 4QX8A 5FPAA 5FY9A 5FYVA 5IWFA 5FZEA 5FWJA 3N9NA 5FWEA 4QU1A 5FZHA 2Q8CA 2OQ6A 5FZMA 3N9MA 5FJKA 5FZFA 2XUEA 3KVAA 2YU1A 2XDVA 3KV9A 4GAZA 5IVYA 3ZPOA 5IVEA 3OPTA 3N9PA 4QWNA 5FP3A 3AL5A 5FYZA 3LD8A 4AAPA 5IVVA 5ISLA 2XXZA 2YPDA 3UYJA 5FYSA 4CCLA 4URAA 5FYTA 4QXCA 2P5BA 5FXWA 5FXXA 3N9LA 5FP8A 5LY1A 4D6QA 5A3WA 5F5CA 4XDOA 5FZ4A 5F3GA 5FYBA 5E6HA 5FY7A 5FP4A 5FZ7A 5FZOB 3DXTA 3K3NA 4V2VA 3KV5A 5FZBA 5A7SA 5CEHA 4CUGA 5FZ0A 5IVCA 5FZ3A 5FZ8A 5FV3A 2YBPA 4CSWA 5FZKA 5LWBA 4GJZA 5A7WA 3NJYA 5FPUA 5FPBA 5A7NA 4C8DA 5FY4A 4IGPA 2VD7A 5FYIA 4GJYA
chains in the Genus database with same CATH superfamily
2PA7A 4PHZA 3GALA 1U5ZA 5EPAA 4IQPA 4GMP1 4Q29A 2VBDA 1GWMA 1H4HA 1WW6A 5IK8A 5A6YA 2Y60A 4J1XA 3TN92 3TEXA 4OHXA 3JB4C 3OG2A 5FMCA 3UKVA 2UY9A 1IZ3A 4LO6B 1PM4A 5KHGA 1G9FA 2WNVA 2WO3A 2Y6JA 3KZ4C 4LMFA 3RSJA 5CG8A 1EPWA 1OMIA 2VNGA 4XXPA 3ZIWA 3ZX7A 3RMYA 2DTYA 1AR91 1QH6A 3FWEA 4YFWA 1PO22 1PMIA 4YLZA 1WCDJ 2RR13 4BK5A 5FPZA 4K7JA 2Y64A 2ZEYA 3MO4A 3ZN5A 3HBKA 1M4WA 4ZZ5A 4AOCA 2WIIB 4IV3A 3C7OA 4H14A 4YM2A 2ZGQA 4HONA 2WBKA 4AF9A 4GMP3 3OB8A 4X8PA 2BGPA 3M3EA 1R1A2 2B45X 4FPGA 3C7EA 1ACCA 5DZGA 5J37A 1HQLA 3SKJE 1MS3A 2BQPA 3LOIA 5GZEA 1JZ2A 4B3NA 1JOPA 1ND2C 4QMAA 3O1MA 4PDWC 1W03A 4FAGA 5L7OC 3WNMA 1ZZ7A 4MOAA 4BLJA 1REDA 1WCQA 1YI9A 2V72A 4UW6A 5GLUA 1DIWA 1DGRA 4D7YA 1N47A 1YFYA 3OBAA 5ABJC 2B9VA 3MBWA 5FXZA 4NIGA 4HSJA 2E7QA 1S55A 2E31A 3A0NA 4WVZA 1TME2 4JQTA 4NRPA 1GZ9A 5L73A 3DECA 3LA3A 2XJRA 2VUAA 1ND2B 1REEA 1IQAA 1QF3A 3CDZB 1HXS2 4LBKA 5LRRA 5T5JA 2VNOA 3AX4A 3M70A 4PDWB 4YW5A 4BQXA 5L7OB 1F5JA 2PMWB 3RZJA 2H0VA 4GH4C 4MHUA 4KG0A 2CWSA 5FZEA 5FWJA 2BW8A 2QQWA 2VQTA 4UFIA 3AP9A 5EJZB 5ABJB 1LOBA 2QUOA 4BA6A 4UI9L 1GANA 1SLCA 1WMXA 2F6BA 1POV1 2Y6FA 5GZFA 3WF0A 3WY6A 3ZYRA 5J48A 1AHSA 1OC1A 3ECQA 4D7TA 3ZFGB 2XDVA 3CBNA 4YGDA 4Q0UA 4ISRA 2RDQA 1T6GC 4P9YA 3AMNA 5C3SA 3BUCA 5IJRA 5I0DA 5FYZA 3I3MA 4R52A 5ISLA 5HCAA 4LT5A 1BEV2 2JDHA 4LNVA 4GH4B 5CB7A 4N9IA 3LEMA 4XUPA 3UYJA 5D1IA 2TBVA 3RMXA 4CU7A 2ZEZA 2H6CA 5A3WA 4A45A 1VBE2 2BOJA 1JU3A 2D6LX 5FP4A 1OLMA 2YC4A 4Q4Y1 4PQQA 2P3IA 4V2VA 5FZBA 1C1FA 3NWKA 2NP0A 3I2DA 2E32A 5FV3A 3H1WA 4P5YA 1POV3 1ZA4A 2VZVA 4J6GA 3ZN6B 3H50A 4IV1C 5FPBA 1FXZA 3HN3A 1JODA 4IGPA 3KCYA 4CYDA 1XBFA 4YZ4A 4AFCA 5FK8A 1Z7S2 2HWF2 5JSPA 4BHPA 1JYIA 1I5PA 4Q1RA 1KGYA 5K7PA 4RS5C 1JZ4A 5F32A 5FMOS 2D6PA 2VM9A 3BU0A 3WOGA 2WYFA 1HV1A 1ND2A 3WG2A 1JYXA 4OYUA 1KQRA 5A7OA 1XSRA 2WZR1 1UYPA 2YFZA 3AFGA 4I3GA 4PDWA 3V64A 5FOBB 5L7OA 3UGFA 1K3IA 4IV1B 4AQSA 2W47A 4EZHA 4DY5A 1W05A 2VOXA 1RC6A 1XE7A 3PUSA 1LJ7A 3R0RA 2JICA 2VCAA 2BNNA 5FPVA 4W65A 1RYYA 4GZ9A 3T2PA 1CJDA 4YW3A 5ABJA 2Q1ZB 4HKLA 4BXFA 4LO5B 5JSOA 1OQDA 3A23A 5LBEA 5IT6A 4AHZA 1JUHA 4CUAA 1UIJA 4RS5B 2IXLA 4AEJA 3ME2A 1OI6A 2WN2A 4IGOA 1QNWA 1YFXA 4OMDA 3I2HA 5K4LA 2DU1A 2VC9A 1H4GA 4P9GA 2JB8A 3EMRA 1BCXA 4GH4A 4BQ1A 1A34A 2B8MA 3DGTA 5F7UA 2WZR3 4S2DA 2RDRA 2NZ9A 2W3JA 1W6MB 3MI8A 1C3HA 4OI2A 5KXCA 4BPZA 1HB2A 1TZOA 1NKGA 3ATGA 1MS8A 4TYSA 4H7MA 4YARA 2C6SA 3SISA 2N7GA 3CU7A 2XQXA 1N3OA 4HVQA 2A6YA 1CAUB 3G6JB 4NAMA 4KWKA 4O61A 3ZN6A 3B93A 1W0NA 3MV11 1IS4A 1PVC2 2D98A 3BN6A 4FFGA 5EJ1B 5FZAA 3WNLA 1IKPA 2X29A 4HMZA 2FDHA 4U36A 5F5IA 1YIFA 3MF6A 4KBZA 1DQ2A 3GCWA 3POEA 1RUC1 5EFUA 3E5XA 1PX3A 4LA3A 1RTVA 3AZXA 2ET1A 1B09A 3IM0A 4MGSA 1H2KA 1GP6A 1QJZA 1T6BX 1MS1A 4Q27A 3U1XA 4DFSA 2VNRA 5IAVA 3KVAA 2CL2A 5D8AC 4EN0A 2WFPA 2ZZQA 4PF5A 2Q1FA 5I0RA 4IV1A 3VZKA 2VNVA 3H9AA 2VVDA 2X09A 4Q0VA 3FBYA 1XU2A 5DUVA 5FP3A 5IK4A 2VZOA 3M7AA 1GZTA 3PLQA 4Q4W1 2YPDA 1AJKA 2EIEA 1RXGA 3POFA 3LA2A 1V70A 5FXWA 2DVDA 4JKMA 4N43C 4RS5A 1POQA 1V6IA 4AVVA 4DUWA 4Z07A 1I6XA 1GOGA 4KU8A 2ZXQA 4AI2A 5FZ4A 3WDVA 2WKKA 1DHKB 3IAQA 3VBOC 5D8AB 5FFOC 4LO8A 2IXCA 1G9BA 1IQDC 1R081 3H7JA 1CD3G 1LULA 3WP6A 3NAPC 1QQP2 3Q8CA 5FZKA 2DTWA 2B42B 4IEUA 1UZ0A 1NQJA 1W2NA 1MS9A 4LBQB 1VBD1 1CX1A 4GJYA 4AVTA 1CIYA 2Y34A 2WNUB 4N43B 3G7DA 3JQWA 3AKRA 4MG2A 1X33A 2VY0A 2E7TA 2IXHA 1RUI2 4Q4W3 2WDBA 4UBGA 1CAUA 5A3TA 4LBLA 2XBO2 1BVP1 4FPKA 3VBOB 1LESA 2WINB 1IS6A 4BIFA 3J26N 3KS7A 1RUF2 2DCYA 5BNOC 3NAPB 1OUXA 2PLV1 1PGSA 3RWNA 2Q30A 3AYEA 2ZX4A 4Y1ZA 1W8OA 2JE8A 1W3VA 1R083 2WFF2 3I3BA 4DXRA 5LEKA 4D6RA 3V0BB 2JE9A 3I2FA 3T0AA 1HKDA 4IE0A 3Q9OA 2P3YA 2FDIA 3D3AA 1VBD3 2WSVA 2WT1A 3WHUA 4Z92B 1D4M1 3A22A 3HPNA 4LQRA 1DQ0A 4XBQA 5FPXA 4MGKE 4NPMA 2E9QA 3E5UA 5FYMA 5IATA 5ANNA 4F8AA 5BNOB 4AGVA 2PAKA 4QX0A 1LOFC 2R49A 2YU2A 1EAH1 1CR7A 2RDNA 5JAXA 3ETPA 1N3PA 3N7MA 4YW6A 5F5AA 3WHTA 2PLV3 4XFFA 3POWA 3OPZA 1CONA 3KT7A 3IWZA 3PDQA 2SBAA 1ZRIA 2DFCA 3ZSKA 1FT9A 3U10A 1ZREA 3W5MA 2RR12 2Z4FA 5D8AA 5I93A 1S1AA 3DCQA 5D2AA 4CCKA 4YG6A 3PU8A 3WW3A 2OX0A 5FZIA 3WW4A 4OZOA 3IBMA 4PQ9A 5LASA 2J1TA 1HRV2 1DZQA 4LITA 1D4M3 1TVGA 3I3DA 2VJXA 1XJAA 3OGGA 5FZDA 2ILMA 5IFPA 2V4VA 1ULEA 3MZHA 2D6OX 1UN1A 2VOTA 4FPHA 3AL6A 4GA9A 4N43A 1L7QA 4PLMA 1EAH3 2R071 4IUGA 4AFMA 4EJRA 4EE2A 4CTEA 1GU3A 2W39A 2UU8A 5GLWA 5J09A 4MUVA 3GHMA 4XHBA 2RJ2A 3NNLA 3T4VA 3VBOA 5F9TA 5J7MA 4P9WA 1XE8A 2VU9A 4D3WA 1SG3A 2DURA 3NAPA 3DKQA 4FP3A 4KWLA 3OD0A 3LPGA 2C1FA 1YFUA 3O12A 4QT6A 4YGBA 2JG8C 1QU0A 3FC0A 4A7KA 3EO6A 1DCSA 5CBLA 1WMDA 3UETA 4EN7B 4NJ4A 5FK7A 3V0BA 4AFAA 2VULA 1CZVA 2TEPA 2WNEA 4XCAA 1O8SA 4AI3A 1F9KA 5DXDA 1C1LA 4IL7A 1QXJA 3TN91 1OH3A 1LTEA 4XUOA 5I0UA 1I5ZA 1V6OA 4NR1A 3BTXA 1YQCA 1MS0A 4XDOA 3T30A 5T54A 2QVSB 4OZXA 5BNOA 4HN0A 4JKKA 5FRAA 1DF0A 5DDJ1 4HZFA 1U5XA 3IPVB 5EV7A 1D2QA 4M3CE 4B29A 5A6QA 4ZONA 2D44A 1MEC1 4CSWA 5FMDA 5K9YA 2FHRA 4OULA 2WC2A 4UW4A 3GZAA 4P9IA 5EYYA 4YZ1A 1XNCA 3SCFA 2YB7A 2WO1A 4X6RB 3NMBA 2A5ZA 2G9FA 2JDPA 3NKGA 5DG2A 4UBHA 3WLUA 2RE9A 1HQWA 5B4NA 2W91A 1F31A 3BKZA 2XJVA 3PMEA 5T5LA 1JYCA 5LRSA 1R1A1 2K2SA 4GMP0 1J3PA 2BTVC 1LOFA 2V73A 4PJYA 4ZXEA 5HCHA 1F2NA 1WWYA 3C7HA 3VBSB 4QKBA 1BVVA 3L9JT 5K0UC 3IAPA 1SBFA 3GJBA 1OOPC 5DDJ3 2WQ8A 1V6MA 2QQVA 3LAGA 3MV01 3ZO0B 1MEC3 1WLTA 2VW0A 5FZOA 2GC1A 1S0EA 1JYWA 1QIQA 2DV9A 2J1RA 4EZ4A 4QX5A 1CAWB 4JAAA 2A3YA 4P5HA 2CDOA 3ZYGA 4CCNA 1TME1 4DUXA 1QNYA 2VMCA 3ASIA 3H7YA 4IGQA 3VGIA 3VBRC 1W6PB 2J1EA 3FFQA 1W90A 5K0UB 1X82A 1HXS1 1F15A 4MHRA 3GZUC 4YRDA 1OOPB 5FP7A 3E6CC 2D43A 3LIHA 1YLLA 4C0BA 2X8KA 2JDKA 4MH0E 1T2XA 1AXYA 2CY6A 2W0XA 5FREA 4XABA 4CP0A 2WN3A 4D7SA 1FNYA 2H6BA 2ZHMA 2RS33 4XMAA 4B7KA 2CSGA 4PCRA 5CKQA 5LW9A 4UT5A 3N4MA 3D0SA 3IPVA 3POYA 4OLLA 4EYUA 3B69A 5KXDA 2JG8A 2FDGA 3RYPA 3VBRB 3IDEA 1Q56A 2QQLA 4BISA 5DAPA 1C4RA 1GZWB 1E57A 1SBEA 1VAMA 3EB7A 3MEPA 5HPOA 5SV5A 1TME3 1HB4A 3MUZ1 4LIUA 5A80A 2W1UA 3CL1A 3KF5A 1BEV1 4AQ2A 3K4AA 3KF3A 1PM7A 4NMIA 4UW3A 3P3PA 3BIEA 2A6ZA 4BK4A 5JR7B 1HN0A 3R4SA 1O59A 4QM8A 4SLIA 3ELNA 4FXGB 4NHMA 3HIFA 1N3QA 2JWPA 2WZR2 3LF7A 2ORZA 1CESA 4FOWA 3ZOIA 5FCCA 2I07B 4EQVA 2NMNA 2D97A 2JE7A 3LQCA 5B2GB 1N1SA 1RUG3 2Y8KA 2FD8A 2D6MA 3ZPOA 2P3JA 3OCPA 1D7PM 3KT4A 3J7LA 1POV0 4HFSA 3UK9A 4IEVA 4XF0A 3OJBA 3QOPA 4WVMB 2GMPA 2ZGLA 4AL9A 3O1VA 1BMV1 3ST7A 2YHJA 1S2KA 4XJWA 1YQ5A 4CU6A 3WP3A 4HVOA 1BEV3 1CAWA 1W8HA 3JZVA 4WM7C 2WAAA 4BB3A 5FP8A 2IVJA 1W6PA 4OUMA 1PK6C 3ES4A 5K0UA 2ETEA 3EQEA 3OYWB 4OHVA 3JB8A 2OA2A 1K5MC 4JGZB 4IETA 1OOPA 3MIHA 3DL3A 2YBPA 1BQPA 4ZS2A 3ZYIB 4R9BA 4LKEA 2DFBA 1X50A 3O7OA 4Z2AA 3MIDA 4YW2A 3NV4A 5FKBA 2FCUA 3KM5A 4BQ3A 4WM7B 1VE0A 2JG9C 2GP5A 3AYDA 2X5IC 3FUOA 2JXAA 4KNCA 3RS6A 4DQAA 3ACLA 4UAPA 3ZKUA 3VBRA 2R6QA 4AI9A 4Z8BA 1JBCA 1GZWA 2CNAA 3KWVA 4FQZA 2OPWA 4FT8A 3SEEA 2QBXA 2P1BA 4Y5SA 1V0AA 5IVBA 4FTSA 4CU8A 4IEOA 5I0TA 3WX5A 4QQOA 5EQUA 5A70A 2JD4A 4DOUA 1V00A 4P9LA 4DUVA 1OPOA 2CTVA 3WG1A 1GNHA 3NKTA 4PI0A 4NWWA 2UURA 2LM3A 4LK6A 2A7AA 3UV9A 4CVUA 1NCRC 1UX6A 3VZJA 1RJ7A 2ES3A 2VCBA 4GWMA 4AW7A 2JG9B 1UO9A 2X5IB 4LE4A 2V5YA 4RD7A 2MHFA 2CGNA 3N3HA 3OPWA 4NIIA 3ZXJA 4DY3A 4AG4A 2YZ4A 4KU7A 3ILNA 4WZCA 4Q4W2 1GZCA 2KA3A 3N7KA 3ZVXA 1PVC1 3GBGA 4KWUA 1PNGA 4ASLA 4IEPA 4D6SA 4OI0A 5IFTA 3TEYA 1LU1A 1UOGA 3POBA 2A6VA 3RNSA 1NZCA 1NYWA 1OURA 3M1HA 3LOBA 3IDAA 4RA0A 4E4SA 2GMEA 5E1RA 3FX3A 1R082 1OFNA 1SMVA 4PIZA 1XQNA 4YZ5A 4KGQA 4LLFA 1ZBE1 2P6CA 2A6XA 2ZGNA 3OYWA 1UOBA 4LBQD 1SQ4A 1VBD2 4NHKA 4A2UA 5CISA 5E89A 4CXXA 3MF9A 4UWDA 3SKVA 3J8F1 1FPN1 4IEQA 4XQWA 5CG9A 2PHFA 4ET7A 3ZFEC 4XC9A 1XNAA 3C2UA 4YGEA 1GQHA 4BQ4A 1EYBA 4QXBA 1GR3A 3OEBA 5FY0A 1RIRA 1H1MA 4I09A 3CZUA 1WA6X 5JCTA 4BWOA 3M3CA 3PUIA 4WM7A 4TWTA 2WSUA 2DCJA 1BJQA 4K20A 4DXZA 4GKYA 5CA6A 2PLV2 1XNKA 3WINE 1FI2A 1PK6A 1V6LA 4QU1A 2BNOA 3VDDB 2Q8CA 4WV8A 1EV11 1K5MA 4QGLA 5A33B 2IWGB 2J1VA 3FL7A 3RI9A 1VR3A 3NVCA 1YI7A 1ZBE3 3ZFEB 2BFUL 3MIGA 3EBRA 1W6QB 3PVBB 4M01A 3UGGA 2QKDA 3NV1A 3IN9A 4KL1A 3THDA 5CKNA 1D4M2 1FPN3 2WS91 3J8F3 4IV3C 2D6KA 1NZIA 5L19A 2JG9A 4LKSA 2XXZA 3LKJA 3SH4A 3TWIA 4QXCA 1G6NA 2JDYA 1EAH2 1ODNA 5B4XA 2DUOA 4YW4A 1LOGA 4KWJA 2C24A 2I2SA 5IHRA 5AVAA 3KQRA 1ASJ1 4XPVA 1XXNA 4LK7A 4MGYE 1QH7A 1V6KA 3QACA 5CEHA 1EV13 1Q5OA 5IVCA 3WQ1A 4CE8A 2WFF1 5LWBA 4OQ9A 1VMJA 2RM23 4XETA 1NCRA 3AYAA 4BCUA 3ORJA 4IV3B 4C8DA 5FY4A 3SEPA 2D40A 4WZFA 3D6EA 4P9XA 4DXTA 3T09A 1R091 1ZZBA 2ARBA 2BDRA 2P6HA 2WS93 4Y1UA 5DZEA 5K8SA 3BB6A 1G9CA 3TEZA 5C3OA 3KB5A 3LZZA 2ZGMA 1XOYA 4A7ZA 5DAQA 5ANQA 4NWVA 4CU9A 2R043 1H1AA 3LPFA 2VQUA 2B5HA 2UWAA 2EXKA 2QQMA 5CADA 1ZRDA 4LIVA 1ASJ3 1JTZX 3HBZA 4CDUC 2XJPA 2FCVA 2Y38A 1HJGA 3RDIA 4FO9A 2MPFA 1RITA 2WWUA 3VBHC 1OSGA 4QHBA 5HV0A 1UL9A 2O1QA 2WFF3 3TBDA 4AI1A 1IPJA 4QXHA 2LS6A 4HT1T 3SMHA 5A33A 1CAVB 1RUH1 1O4YA 3D5OA 4HVRA 4B1MA 1R093 1FYUA 3ZFEA 2RMU3 2NQYA 1AL0G 5ERLA 1W6QA 2Q4SA 1HRV1 5F3EA 1LOAA 4BLIA 3POIA 4YYOA 5A3LA 2J1UA 2HH9A 2G9GA 4Y1XA 4G9SB 5EIYB 4NIHA 1OA3A 1FV3A 2K0GA 4KQ7A 4Q0SA 3UJQA 4CDUB 1WCSA 3VBHB 2IXKA 3PTRB 1H6XA 4E2GA 2OKXA 5DDJ2 5F3CA 3U75A 1ZNPA 3HQUA 2JKBA 5CFCC 1MEC2 2LW8A 5JMCA 1PMJX 5IK5A 2Y6HA 2FQPA 1PX4A 2XH6A 4Z1VA 2ZA9A 4AWDA 1MZ5A 1AJOA 1OKOA 4MO3M 3NV3A 3FLTA 1RUH3 4INDA 4LUMA 4Y4YA 1UMHA 4HSLA 4FFHA 4DEQA 4FFFA 3BYWA 1GWLA 5HCFA 1HRV3 2AH2A 3LSDA 3Q8FA 5G04L 5A7PA 1UY1A 2Q8OA 3SHRA 5BV6A 4QX8A 2XG3A 2C9KA 4LPLA 5CFCB 1O3SA 5JI9A 5ACA3 2WQZC 2WUHA 1CJPA 5I0SA 2RS32 3I2KA 3NNMA 4HANA 4IXLA 4PBOA 3T2QA 3ZFFC 3UKNA 5I8YA 5JDBA 4DINB 3DYMA 3O1PA 1YCIA 4EWDA 1W9TA 5IVEA 3PUHA 1LGBA 1JYVA 4EV0A 3WD5A 3FJSA 3AL5A 2DUQA 3FLRA 3JBG1 3HVDA 5IVVA 4XZUG 1V9U3 3INAA 3Q8AA 1CAVA 2HYXA 4GWJA 2JIGA 4COVA 3NJXA 2ZAHA 1QGLA 2VUCA 1SLBA 2PQQA 3PVOA 1AYN3 4QGMA 2C4XA 5DQ0A 3ZFFB 1PNFA 1OF4A 1UMZA 3GXUA 5KHJA 1IGOA 5CAZA 2A1XA 1J58A 5FZ7A 1UY4A 2VMGA 1RUE1 4CDUA 3W59A 1DYKA 2HYKA 4D8MA 4AVBA 3VBHA 4B7EA 4EN8B 4JX0A 1RUG2 1BBT3 1W6OB 5JOZA 1AX1A 4XBLA 4HBNA 4AGRA 2XKOA 1VMFA 4A44A 4TSVA 3W5NA 1HQNA 2UWCA 3ZR6A 2X05A 3ZKYA 4RQPC 1S0BA 1Y9GA 4ASMB 2IC1A 1W9YA 2JX9A 3H0OA 3JBG3 3MICA 4G3YC 3MW3A 1OQ1A 2VTXJ 4LOSA 4E4DX 4GB31 4NIDA 2R0HA 3M8LA 4PLOA 1UY2A 4NRMA 4HXCA 1KRIA 4R8HA 1DDLA 3H42B 4DXSA 1W0OA 4HG6B 4Y1YA 2WQ4A 2LALA 3D4KA 1YQ2A 4L99A 1UU4A 1RUE3 1WLCA 2DVBA 3MFAA 4GD4A 5CFCA 2A75A 3AFKA 4RQPB 4WVWA 4MXWA 4JV4A 4XILA 4Y24A 4XDQA 1YO8A 1FMD1 1AXZA 3AJZA 3ZXGA 3RWKX 3WT3A 1CAXB 4RN5A 4QQ2A 1JZ8A 2EALA 1BMV2 2HLEA 2CAVA 1UIKA 1OQEA 4Y20B 2D3RA 1AYM3 2QTWB 2VTXA 3F2ZA 3JXSA 1WZXA 1XYOA 3OEAA 1UCXA 1LKNA 1OLQA 1CPNA 3FFZA 4FSJA 4O7XA 1S0JA 3T3YA 1K12A 4GB33 2GDFA 3OSDA 1YRZA 2VH9A 1AL21 1KFXL 5F39A 2V09A 1LOEA 2CV6A 4M4RA 4ZS3A 3ZFFA 4MYEA 1MZ6A 2PHRA 2D5FA 2XWBB 2J22A 1JZ5A 3WXPA 4CA9A 3VL9A 2XVLA 1UZZA 1VRH3 4QPWA 5F2SA 1H2LA 3S7EA 3SXWA 1N1VA 3MFCA 3T4HB 2EIGA 1FMD3 2OS2A 3OUJA 4NHYA 4EROA 5FYUA 1SLAA 1W6OA 1WW5A 2ZMLA 2D93A 1YIPA 1SFNA 4UFHA 2G19A 1DQ4A 4XMIA 2XWJB 5FP9A 2LRPA 2IFRA 5EHDA 3WNXA 4D69A 3WP5A 2YROA 2NMOA 3AZWA 3NJZA 4Q2FA 4Z82A 4A41A 3I54A 1JN2P 1NE6A 2V4AA 1ZM1A 2DBIA 1AL23 3AP7A 4LULA 2XUEA 2VUDA 4OUSA 4WM8C 3SH3A 4OMCA 3SLIA 1RHI1 4AHYA 4PBPA 4QPIC 2C5DA 1ST8A 1J1LA 1YQ8A 3ZDVA 4FI9A 1MVQA 3FLPA 1S2EA 4IEWA 1MS4A 4RQPA 5BNPC 3QBQA 1TG7A 4CCLA 5JPNB 1OT5A 5GLVA 4E27A 2BBAA 1CAXA 3ZSJA 3HT2A 4HKWA 4Y20A 1MVEA 4QKDA 4RFRB 1RVF1 3BGAA 4LBJA 4AQ6A 1W2TA 2ZX2A 1OA2A 1US2A 4QPIB 3ZN4A 4LORA 1IG3A 1UKRA 2R32A 5C7GA 2VZRA 1GMMA 1ZBE2 2NPIA 4JHZA 2A3XA 4M3CF 1RHI3 4Y22B 3S5AA 4P9JA 5BY5A 1C5HA 4XQDA 5BNPB 2OXBA 2DWRA 3J8F2 1FPN2 1AX2A 4JGYC 3WDTA 5KXEA 5IK7A 2XJUA 3K2OA 4QX2A 1LAJA 2CU5A 4PI2A 3HAGA 1ZRRA 1LR5A 2YFUA 5C6CA 1OFSA 2Y26A 3T08A 5JIUA 4PIYA 2DF7A 4HETA 4AGGA 1OA4A 2X10A 1SPPB 3GCXA 4FQ4A 3O0WA 3AC0A 4M4PA 3KHBA 3PTYA 3DF0A 3POGA 5LA9A 1RVF3 3ZSMA 2IUWA 3JCIA 1DFQA 1Q43A 2JDNA 4BMEA 1EV12 3FBMA 3K51A 5A3PA 2ID4A 3B5LB 2RM22 2YGLA 3Q8BA 4JGYB 3R4UA 3WV6A 4LOTA 5A3NA 1U5IA 4XFHA 2ZGSA 1J59A 2XB6C 3MW4A 4I01A 1W3XA 1TEIA 4AEDC 2WS92 3EXUA 5FJHA 2HWC1 2ZGPA 3I2GA 2AR6A 1UZWA 2PAMA 2ZTNA 4JCKA 4ZPIA 3J7HA 4YZ2A 3K3OA 4DZGA 1FAYA 1NQDA 1QJY3 4LA2A 3HQRA 4LHNA 1TNFA 3WVJA 2R042 2QCSB 3GZTB 3KGZA 5FZGA 3BOWA 1UU5A 1O3QA 2VZPA 2VVFA 1ASJ2 5F37A 3VD9A 3DN7A 4Z2WA 5E88A 2EAKA 3IZOA 4YVSC 2EAAA 4WM8A 1PZ8A 4AEDB 1Y9QA 1ZA7A 1BK0A 4JDOA 4XBNA 4KH9A 1O91A 4L8QA 4QPIA 5A3OA 3LB9A 4XIOA 3ZPYA 2CGOA 4XFCA 3LEIA 2ZOEB 1R092 5I8SA 2VOWA 1IOAA 4Y22A 2RMU2 4BXSV 2FDFA 1F4HA 1UD1A 1XNTA 2HWC3 5BNPA 2ZABA 5EWSA 2PHTA 2NYYA 1LNSA 2A3WA 1URXA 3W58A 3WNPA 4I0WB 1YFWA 5FBJA 1XNDA 4YW7A 5FY9A 4XW3A 1OD5A 4S2GA 2WLQA 2XUMA 4YVSB 3AZVA 4P00B 2ZHLA 2ZX3A 3NRUA 5F6LB 1SPPA 3N9MA 5FMOL 1UYXA 1KDKA 2JIJA 4ONUA 5FZFA 4N9HA 5F6KA 1REFA 1IPKA 1VAKA 2YC0A 3BOPA 3GBWA 4QQPA 2JECA 4LHSA 4A4AA 2D3SA 1H6YA 1O6UA 3VHOA 1W2AX 3AXDA 1NLSA 2JEMA 5CFDC 1RUH2 2VZ3A 1LHOA 3BCWA 4JGYA 3JQXA 4K9SA 4ES9A 3H8UA 4AVSA 1LGNA 1RL3A 4K6BA 2RJKA 3WF3A 4GXLA 5FYTA 1ZVFA 2VVEA 1GNZA 2BU9A 3URFA 4E9KA 4UFKA 1ENXA 3OY8B 1ND3C 2RHPA 3GHNA 1KS5A 5F3GA 4K1YA 5ACA2 1GYKA 4DMIA 4UOJA 4B8EA 5EZWA 2VOKA 5FZOB 2XOMA 4W6XA 3OUHA 4YM0A 1QJX1 4UFLA 1B35C 3I3EA 3WW2A 5CFDB 4RHV1 4XEZA 3W21A 3H8OA 1CWPA 3AP6A 4E8DA 4BYYA 2GMMA 2G1MA 2IVIB 4AEDA 2XHNA 3FN9A 4LKDA 3VB9A 4DIQA 1V9U2 2PHUA 2Z2SB 4MXVA 2VGDA 4RGKA 2XMLA 3HNMA 2FDKA 4XQ4A 1JU4A 1NXD1 2DCTA 1AYN2 2Z42A 3DV8A 4XTMA 5C3RA 3H1YA 1E5SA 4ITCA 2VG9A 2VZQA 4BOWA 5LK7B 2GSYA 3KV6A 4QDSA 5F3IA 4R4ZA 1OXCA 3WDYA 3ENRA 1EP0A 3NSTA 3B94A 1QJX3 2YBSA 1BBT2 2JG8B 4JDNA 4YVSA 1W39A 1GICA 4FOQA 4RHV3 5JXHA 3S57A 3VUOA 3C7FA 1O4ZA 5FY5A 2BGCA 3PVNA 3ZM8A 4ZU5A 1ZZ9A 5FZLA 2I74A 3ZMOA 1PHMA 1SFPA 3K4ZA 2E26A 3JBG2 1UZYA 3UGHA 1H30A 1PZ9A 5AVPA 1NXMA 5HXVA 1LECA 1UNBA 3KSCA 4TLGA 4QHZA 3UKTA 2VO5A 3ZXEA 2J7MA 3H8XA 1CPMA 1W8UA 4I0BA 1QOTA 1O7FA 5H9SA 4AVCA 2RJLA 4BQ2A 1COV1 1CN1A 1H8VA 4FOYA 4FPYA 1PZ7A 1Q8VA 4TXWA 1RUE2 2AEZA 3AVSA 3OY8A 3AKQA 2R1BA 2VBBA 3AKSA 1ONAA 2RS31 4Y5TA 1OLME 2J1SA 3LFIA 1WLWA 3M2MA 2PQSA 4RFT0 5SV8A 3RZGA 4K8FA 1JI6A 5JLVA 4FCAA 5BUVA 2O14A 2PFWA 5CFDA 2AC1A 2W52A 2QFEA 5HI0A 2QQKA 3GM8A 1PGL1 1AUYA 4NN0A 2VZUA 1AYM2 2HKXA 1UAIA 2W87A 4GWNA 4MZUA 4R4XA 5FBZA 2Q1MA 2QDRA 1AR61 2QNKA 2YYOA 1JHJA 4GB32 4AHXA 1ND3A 5FYVA 3AMHA 1E5IA 2TNFA 5FO7B 5JIAA 1COV3 4Q8KA 2VCMA 5FZMA 1VJ2A 5FJKA 5JR2A 5AFBA 2GZWA 4XF9A 1B35A 1BYHA 2DVGA 3I7DA 3TB0A 3MPPG 4GIQA 3WCRA 3KT1A 1W99A 1VRH2 1R1ZA 2QQUA 3O0VA 1RUG1 3A7QA 2ZHNA 4Q1PA 1HW5A 4QHOA 5HCBA 5KHHA 3VZOA 5LCWL 1FMD2 1X9TA 2A73B 1ZYBA 3OPTA 3IDCB 5KXBA 2Y33A 1NE4A 5KWRA 3LD8A 3VKNA 3V56A 3MLLA 1OF3A 4OHYA 3JUUA 1JHNA 1NCQC 1VBA1 3WF1A 1UOJA 2HWD2 4MGIE 5GJ6A 2VL4A 3UJOA 1H9WA 2QJVA 2PYTA 1AR63 3K75B 3S7IA 5JMOA 5F5CA 1N1TA 3HWJA 2YV8A 1RJ8A 2OZJA 3LA7A 4C91A 1RUNA 1AL22 5FO8B 3E5QA 4WBBA 1C8M3 2R16A 2FZ2A 3U07A 4YM1A 2E7AA 3LWCA 4N53C 3S6PA 1OVPA 5DG1A 2VBPA 4A7YA 3VKLA 1VBC1 2VD7A 4RSUA 4J1WA 1NCQB 3OBZA 4Q26A 5JUVA 4XCBA 3ZR5A 3WQBA 3KCCA 3E6BA 4FOVA 2XPJA 2JDMA 3ILFA 2P34A 3S0MA 2JDAA 3TNPB 1VBA3 5BNNC 3O1SA 2VUJA 3VZLA 1UPSA 5LK5A 4CEWC 3ZMNA 4KMQA 2BEOA 4YGCA 2GN7A 4N53B 5C8WA 1QWRA 5D21A 4I02A 1UYZA 3MW2A 2GNBA 1RHI2 2ATFA 4QB6A 1VPHA 4C0HA 3IMMA 3SCGA 2HEVF 3WQ0A 1IPSA 1PO11 3C7GA 1C57A 3DXUA 4XVHA 1UYYA 4O9EA 1VBC3 2O0OA 4HLTA 2VXJA 2VECA 3EJKA 4NROA 5BNNB 2R0FA 2VE1A 1W2UA 1OH4A 5BPXA 4CEWB 1SCRA 1S2BA 1GOFA 1F5FA 1PK6B 4I30A 1WA4A 3D82A 1K5MB 1KS4A 1RVF2 3U4XA 5GLZA 4B4RA 5CYYA 3NNFA 2ZPXA 3WG3A 3TRSB 4QKFA 2ZGUA 3J4UH 4BH9A 3M4FA 5E8AA 5EP9A 3EYPA 4IE7A 4ARXA 4LUKA 3N9OA 1DGLA 4H7LA 1PO13 2GU9A 4O9GA 1V6NA 4XFGA 5EJ3A 1KFUL 3T2OA 4UF0B 4I0AA 5FZ9A 4D0QA 4E4HA 4RR3C 2YDEA 3FMGA 4PT6A 5FTTC 3U4SA 4M0NA 3GBFA 2IZWA 5LA1A 1QJY2 2B9UA 2W1SA 1VAVA 3CJXA 5C70A 1UWWA 4B1LA 1NCQA 1WW4A 5DAWA 3KV4A 1YNAA 1A8DA 1R64A 2VCCA 3O1UA 1EY2A 4W6WA 4K8RB 1WLDA 1HRI2 1U12A 1OHFA 3N9NA 3PMSA 4FPJA 5TSWA 1NY72 5BYNA 3OGSA 3BALA 1NCRB 2UY8A 4LO7A 4OI4A 4XE9A 4CP9B 2F4LA 1JOBA 1HDKA 5J1XA 3I8TA 3BPSA 4N53A 1FX5A 4LEJA 5IVYA 5GLTA 4AYUA 5C3PA 5GKAC 2NM1A 2H0BA 3ETQA 2W68A 1UQXA 2HWC2 4L92A 2DCKA 1DBNA 4AFBA 4Y5Z0 4AAPA 1H2MA 1YWKA 1IHMA 2WNOA 2FZ1A 3AZZA 3L2HA 1JZ7A 1ZZCA 3DEMA 2W95A 4YSFA 4URAA 1YUDA 3H3ZA 1NG0A 1RUD2 2FMYA 2V5DA 4NAOA 4DEVA 3IIIA 5BNNA 1DGWA 4WVVA 4GWIA 2L9LA 3U11A 4CEWA 2ZX1A 4Q4V1 4LO4B 3TYJA 5E6HA 1JS9A 4XFAA 1NLQA 3DXTA 1UW8A 1PIV1 4MGTA 2GC0A 3RZZA 5T5OA 2MEV2 1BK1A 2RM21 5A7NA 2IXJA 3E6DA 4A42A 2PAEA 5J36A 4NVPA 5DMYA 4K40A 1FNZA 3U37A 1QDCA 1NLRA 2R1DA 2CYFA 4HPKA 4KI5M 3P5BA 4RGAA 3I4IA 4UF0A 2E51A 1VRBA 3LDRA 2E53A 1AZDA 1QJU1 1GUIA 2OZ6A 4XDPA 4HOOA 2R041 3RZMA 5IVFA 4W6YA 2VXRA 4Q4V3 1YEWA 4R9DA 4U2AA 5T3NA 1W8TA 2JD9A 4DB5A 5G05L 3GGLA 1J84A 4B4PA 4BQYA 2GN3A 1PIV3 2DVFA 2EF6A 1J1TA 2Q0AA 1APNA 2ZKLA 2DDUA 4O65A 4Q4X1 3SNMA 3WQ7A 2ZZJA 3O1TA 1HX6A 3ON7A 5GALA 3USSA 3ZLIA 5A3MA 1DYPA 4C1WA 3MHZA 4CP9A 2QE3A 1RGSA 1XU1A 3MLJA 4AR2A 3ACHA 3VD3A 4V1PA 3ZYBA 2JKXA 2P17A 3FUQA 4RR3A 3BTYA 2RMU1 2XKPA 2BJSA 2XONA 3GNEA 5J98B 4AQTA 2C26A 3I2IA 3AP5A 4LHLA 5GZDA 1J3QA 2UYAA 1KJRA 2GC2A 2OIIA 3D8CA 4FTBA 1QJU3 5FIXA 3V0AA 4I3PA 2QQOA 4CCOA 1QKQA 2OUHA 3B7MA 5A7WB 5C71A 3MIFA 5IW0A 1QJX2 1P8JA 4RHV2 2WZEA 4HK8A 4Q4X3 1G7YA 2F4PA 4XF4A 3RZHA 1O5UA 2ZMNA 4JKLA 4XHXA 4AE2A 4NRQA 4XXAA 4L97A 1LRHA 2KXLA 2VW1A 1ODMA 2WWJA 4YG0A 1K45A 5E16A 4QX7A 1BHGA 4XUQA 1RINA 3KMHA 2C9AA 5L9VA 2BVBA 1VB2A 3K4DA 4UXAA 2IXIA 4EN6B 1ULGA 5L36A 1H1IA 5LBCA 2ZGOA 1V6JA 2WRAA 5FPAA 4LJHA 5DN2A 3HNYM 3X29B 2UWBA 5FKCA 5A32B 5FWEA 1QOSA 5FZHA 5ACA1 5FUIA 2OQ6A 2R30A 1ZX5A 3LEKA 4FPFA 3VD7A 4M00A 1FV2A 3VLBB 2R063 1OKQA 1QOOA 2YU1A 1S0GA 2K46A 4MV2A 1D0HA 3WCSA 4GAZA 4BZ4A 5A3UA 3O1RA 3I2OA 2CGPA 4QQLA 3HQXA 3HJRA 2W9XA 3GJAA 1W28A 1WD3A 3RFRA 2VQ0A 1AX0A 2W46A 1WMFA 5AFEA 5DPNA 1V9U1 4B4QA 4KBBA 4M3CB 1YC61 1OD3A 2XLGA 5FYSA 5KBFA 3DPRC 2P5BA 2YY1A 3C3VA 3NO8A 4H2AA 4XJ9A 1K42A 1AYN1 2XVKA 4LLOA 1Y7BA 1VLNA 1COV2 4LE3A 1GFF2 3HD8B 4AI0A 5JZGC 4NHXA 3LFMA 4AAXA 2QDNA 3AP4A 4MXWB 3KV5A 3OGJA 4CUGA 3KQ4B 3H1MA 2YMZA 1BBT1 2BNMA 5A7WA 5FYIA 4HK9A 4S2HA 4ATFA 3J7NA 4QPGC 5A6ZA 3DPRB 1PGL2 4DPNA 1W8ZA 3ITQA 3N7LA 3OGRA 1GP5A 2VMEA 2XJTA 2ZMKA 3TAYA 3VD5A 1Q8OA 1SHWB 1YHFA 1HN1A 4ASKA 3P3NA 3ZIXA 1S4CA 5JZGB 1AR62 4IW3A 2Q8EA 1MZEA 3VDCA 4CCEA 3WEZA 3IB3A 3B3QE 4LXLA 2XJQA 2XQRA 3ZYFA 1C8M2 4RL7A 2GNDA 4JC1A 4CCMA 5FLIA 4DRVA 2OUJA 1ENSA 5I91A 1W9SA 2GNMA 2WT0A 1W8NA 1BXHA 2JJ6A 1AR93 3LSEA 3W20A 1SLTA 1K5JA 2EIBA 3M3QA 3OF1A 4FPOB 4META 2VR4A 4QPGB 3RI8A 4TTGA 2Y6LA 2XHKA 4HL0A 1GQGA 4JZRA 3ZFGC 5CVRA 1WBLA 2W92A 2Y0IA 3MUY1 4AFDA 2CHHA 1IS3A 2OT7A 1ULOA 4V2WA 1SCSA 1VBA2 2B39A 1AYM1 1LHUA 1SFYA 4BQWA 2BYVE 2O8QA 5FY8A 5I8TA 4CP2A 4CUCA 2ET7A 2BBVA 1PMHX 4XJAA 4M3CA 2DU0A 1TNRA 5FMBA 2WR9A 1SDDB 4NHLA 4YWAA 1RUJ1 2YXSA 4P08A 4A6SA 3T0BA 3SITA 4FBFA 1Q3EA 4K3UA 1G8WA 1S0DA 1Z78A 2ZS6B 4GULA 4OVEA 4XF1A 1TMF2 1L7LA 2B46X 1VRH1 1VBC2 4LBNA 5FUNA 5FQ0B 2VMHA 3HEIA 1HB1A 4R9AA 3MPBA 2I45A 5T5PA 1ULPA 1WCKA 1DU3D 1ALYA 3QH7A 2VZTA 3CJIC 4RYDA 1XRUA 3LEGA 1DQ6A 4URTA 3DPRA 3ILRA 1STMA 2HWD1 3VHNA 1VIWB 1W6NB 1W04A 2DVAA 1UZVA 4CPBA 1RUJ3 5JZGA 1XB9A 3OGVA 1O3TA 3QLQA 3O5SA 2ZHKA 4XYXA 4CXYA 1D2SA 1J83A 2YUEA 1DP0A 3JD71 1PO12 1QJEA 1NX9A 3SC7X 4IE5A 3W9AA 1JZ3A 1A3KA 1LODA 3AMMA 4CDWC 3CJIB 1DGRN 1MQTC 4QAWA 3N9PA 5CIRA 1QY4A 1ZBA1 5EYXA 3WF2A 1MPXA 4QPGA 2VAUA 5A1AA 2QQNA 3AM2A 1VBB1 5KHIA 1G9DA 1ZRCA 1ULCA 4QX1A 5A6XA 3ZXAC 2HWD3 4LR4A 5FAXA 4LKFA 3VZNA 3OBTA 2ARCA 4XJ8A 5KC6A 1KD7A 4Q4Y3 2EVXA 5CZKA 5H9RA 1JOJA 1XE0A 3WR0A 4ZU7A 4IEZA 1PGW2 4CDWB 5FZ3A 5FZ8A 2HBTA 3WDUA 1MQTB 4Y1VA 4K21A 3QD6A 3THTA 1DG6A 3CF6E 3NJYA 5FPUA 1AR72 2ADEA 3Q8EA 2WT2A 3JD73 4XUNA 1X8MA 3AB0A 5C33A 3POSA 2IFWA 3DUIA 1ZBA3 3IIAA 4JHTA 4JTNA 4NO4A 3VBUC 3ZFGA 4QM9A 2ENRA 4XJUA 1CIWA 3WUCA 4COWA 5FQ0A 3NNJA 2YGMA 3RVHA 2XLAA 5JOWA 1VBB3 5LATA 1H9PA 2ZGKA 2EA7A 5FYHA 3I3QA 5F1RA 2QQIA 3J9SA 4WM8B 1DQ1A 3HR9A 3PHMA 5FYCA 3ZXKA 3K77A 1QXPA 4MVTA 4TZDA 3ALQA 3KVBA 1U0AA 1QMJA 1KEXA 1W6NA 2RS51 4FPLA 5C8CC 1GNYA 2XVGA 1EUUA 5DUUA 4ATEA 3USUB 1YJKA 3VBUB 3ROUA 4F7ZA 2P4EA 2P3KA 1MS5A 1AR81 1ZZ6A 3ZYJB 1SDWA 2OVUA 2R7EB 2G9ZA 1AVBA 5GM0A 4D94A 5A7QA 5C4WC 4P14A 2HWB1 4NUBA 3S5QA 2XR4A 2ZKNA 3CJIA 4M0HA 2ZAAA 4OCTA 3UESA 3BPZA 4Y3OA 1QJY1 2EICA 3HNBM 3ACIA 2WZPP 3RZLA 3TNQA 4HN1A 1F8VA 5FZ6A 4X6QB 2WLPA 4PLNA 4Q4V2 1W2OA 1H8TC 2EXIA 4LBMA 4C1XA 1LHNA 4CCJA 4ZHNA 3AJYA 3PU3A 5C8CB 2RDSA 5FOJB 2A6WA 3I97A 1HRI1 1PIV2 4FPCA 5AC91 1NY71 1IKQA 2FBEA 1VMHA 4XFIA 4XUTA 4OHZA 2RS53 4XACA 1QEXA 5DZFA 1RXFA 5C4WB 4YVWC 1VALA 4XAEA 4EN9B 3BTZA 3FHIB 1LU2A 3SCHA 3WDXA 3ZSLA 4BE3A 1QDOA 1RB8G 1XNBA 3CKHA 4CDWA 2AREA 2NLRA 5GZCA 1MQTA 4YZ3A 1AR83 4I2OA 3B00A 3UT0A 1W06A 3BU7A 1XPWA 2DUPA 2HWB3 1KITA 2JB4A 3RYRA 4COUA 1GP4A 4ZY9A 1O4TA 1H8TB 4K1ZA 3NL1A 2WNUC 4ZU4A 4QDQA 1QJU2 1RUD1 2WAOA 1RUC3 4BU2A 4QPYA 5KR7A 2XL9A 3UNPA 1JH5A 1Q8PA 2Q5TA 3ES1A 4F3JA 2CAUA 1YXWA 1KXGA 2XJSA 3HN1A 4P02B 4YVWB 4F83A 1AF9A 3NW4A 5LA2A 1HRI3 4Q0PA 3O14A 5AC93 1ENQA 2GC3A 4Q4X2 2ZBJA 4IDZA 4ARYA 1W6MA 4C90A 4BM8A 3MLKA 3KV9A 4AHWA 5DAXA 3ACGA 2MEV1 3K46A 3O0XA 1JYNA 1UKGA 2P37A 4QWNA 5H9PA 3H8RA 3A21A 4AVAA 2Y6GA 3USUA 3THPA 3VBUA 2WZ8A 1VB4A 3BVCA 4CXWA 1SLIA 3HMYA 3H3UA 1OPMA 1RUD3 2PHXA 3GZEA 4XZPA 3ZXFA 2ARAA 1FOD1 4MGZE 4E4ZA 1NUKA 1O8PA 3R6SA 4X8NA 3T0DA 4ISQA 4W8JA 2ZEWA 3PNAA 1Y4WA 1UF2C 1LEDA 1NAEA 3BTAA 5A7SA 1I3HA 5H9QA 2R062 2ZJCA 1GWKA 3WW1A 2A71A 5C8CA 3FHAA 4GJZA 2WJSA 2HWE1 4MLOA 1Y43B 2MEV3 4JQRA 4OUEA 4YG3A 4J25A 2OW4A 3AKPA 1YQ6A 5CKMA 2VMIA 5C4WA 1LB2A 3BI3A 2OYZA 2OPKA 4XURA 4OQ8A 3WNKA 3E97A 1C8NA 4UFMA 4CP1A 1C5IA 2W1QA 4OI1A 3VHPA 4AXOA 3RZKA 2BPA2 1A8MA 1FOD3 1H8TA 1W9FA 1XC6A 1E5RA 2VMDA 1WUVA 3VDAA 4UYBA 2FMDA 1Y3TA 3KCXA 2FCTA 3OUIA 2AGSA 3LGRA 2BV4A 2ZCWA 2EXJA 2AEYA 3VKMA 3NJVA 4YVWA 5J96B 3PIJA 1O5LA 1WKYA 1RMU1 5F2WA 2HWE3 1UOFA 4YFZA 4W50A 2ZGRA 1UX7A 3NQHA 4LBQA 3H3LA 3M3OA 4EWAA 1G86A 2VZSA 1ND3B 1LHVA 1W8WA 1OLRA 1CX4A 2LUWA 2RS11 2BGOA 2WNUA 2BERA 2YC2A 4CEYC 2BUKA 3BODA 1CZSA 2ZACA 3P1IA 1NA1C 1B35B 1SZBA 1GLHA 4MADA 4NE9A 4NIAA 4LTAA 1I9RA 5HBAA 5FYYA 1AR92 2YBKA 1LENA 5A1FA 4QB1A 3M3IA 4CDQC 2G4IA 3LDKA 4IEXA 4IE4A 3JU9A 5CNAA 2W08A 4S2FA 3UL2A 4L11A 4DNYA 3RPQA 2CDPA 4N7UA 3EHKA 1RMU3 4Y4RA 4Q5OA 3PUAA 1KDMA 4G4FA 5HXMA 3N9QA 1D0GA 3N7JA 3PVEA 4CEYB 1HIXA 2EIDA 4XOGA 4CPBD 2ZEXA 1NA1B 2VOVA 1LEMA 4A6OA 5BNQA 2GP3A 2RS13 2AENA 4QB2A 2R073 1LOCA 2FDJA 3ZXLA 5BXXA 1O3RA 3GDBA 4FFIA 4CDQB 5DUXA 2LROA 2VZ1A 4N8MA 3VBSC 2PHLA 1X9PA 1XYNA 2Z69A 4BIOA 1PO21 5F8PA 4FXKB 4OFGA 1IS5A 2YPJA 1MZFA 4CDXC 5M0TA 3A4UA 1UY3A 1IG0A 4XFBA 3A0KA 1A78A 4XF3A 2QZ2A 3TN93 3N9LA 1SEFA 2WL1A 4FVVA 1S0IA 1TE1B 4SBVA 3CNAA 5JI7A 4AZZA 5LY1A 1CVNA 1WW7A 1GQPA 2D7FA 4JRLA 5FYBA 5FY7A 5L9RA 3VKOA 1RUJ2 3AMPA 3KGLA 2GNTA 1MR5A 3HT1A 1C8M1 5DAVA 5KHKA 2WABA 1H2NA 2AZ5A 2Y0OA 4LBOA 4CDXB 5EXOA 2GALA 1WCUA 3KHCA 1EUTA 5F5QA 1PO23 3T2TA 4XAAA 1JMUB 1CGPA 5FLHA 1BLZA 4ZKTB 3FZ3A 1HV0A 2GAUA 1Q8SA 2AUYA 1TQ5A 2TUNA 4NPLA 1X36A 1X7NA 1UXZA 3NNGA 3HOBA 3IDBB 3MIEA 1E5HA 3QCWA 3RJRA 3T1MA 4A3ZA 4A3XA 3TOJA 4E8CA 2QQPA 1DGWX 2RVAA 4AEKA 1R1A3 2D5HA 4ORFA 2GH2A 2WO7A 5LBBA 3KLSA 3RG0A 4CEYA 3MYXA 3DYPA 5FXVA 1NA1A 2PTMA 4Q4Y2 1DZRA 3THCA 4COYA 2ZX0A 1F35A 2BFUS 1DQ5A 4ES8A 2J1AA 2PHDA 4COZA 4JRAA 5JPMB 4BDVB 3ZDSA 2BWCA 2ERFA 1ULDA 4Y33A 4CDQA 2X53S 3VDBA 1NOVA 3JD72 5FY1A 1NT0A 1UMIA 3IMNA 2Y6KA 4QD2A 4FTEA 4MX3A 3CIHA 5C5UA 1TMF1 3U78A 1S0CA 1ZBA2 4QKNA 1LHWA 2Q8DA 5FUPA 5JXIA 2SLIA 4XTPA 1WBFA 1VBB2 3ZYHA 5C5TA 1HXS3 2WWSA 2KM2A 3CHXA 3P6BA 4JVAA 1Y9MA 4OHWA 3WNNA 1VBE1 5T52A 4W4ZA 4FP2A 1CQ9A 3CEWA 5JXGA 1UU6A 2AYHA 2O8OA 4GALA 1GBGA 2D3PA 2KD7A 2XGXA 3CLPA 3K48A 2WA4A 4IEYA 3VBSA 1SBDA 2HBUA 1PVXA 1XSQA 3R4DB 5IVJA 1JXNA 3I2JA 4JGZC 3QH6A 4TN7A 1SLLA 2WYSA 2KR2A 3GYDA 2J42A 3LE0A 3NV2A 4CCCA 4EWEA 5JSRA 5C9AC 1VP6A 4CUBA 1TMF3 4CDXA 4L9BA 1Z7S1 2HWF1 4PIXA 3WG4A 2D6NA 2PELA 2LTNA 4QDRA 3OOXA 5LBFA 1M06G 2VW2A 3B01A 4JDMA 2HEYF 3LDBA 5FPLA 5IUQA 1WGPA 4BJ0A 5FDBA 2BOIA 3PURA 2PXJA 4Q8LA 1QJFA 5JXJA 1VBE3 3AMQA 1GKBA 3ABZA 1W8FA 2JDUA 5JOYA 1S0FA 4GQ7A 1A6CA 4UW5A 1YYNA 4H3WA 2RS52 3VBFC 3MGUA 5C9AB 3ZXDA 2MNGA 1PGW1 2B4KA 4YNIA 4MGQA 3RYKA 2AACA 3WZ1A 1UXXX 1X8EA 4E2QA 1AR71 3WSOA 1AR82 2EXHA 4HPKB 4KG8A 3R05A 1I1EA 3U14A 3ACFA 2HWB2 1DZTA 1Z7S3 2HWF3 2GH8A 5A32A 3VN4A 2JDZA 2DBNA 2P2KA 2UYBA 2ZGTA 3MDPA 2VTFA 4FAHA 1RUC2 2Z79A 3AK0A 3OBRA 4GKXA 3O1OA 3CO2A 3WP4A 1JW6A 3VBFB 3I49A 1HJFA 1GV9A 2E33A 5IYYA 3KD4A 4QQHA 2DCZA 2RG4A 5AC92 2F17A 1US3A 1DYOA 4XJZA 4CZSA 3RQ0A 3AXEA 2VQAA 5KC5A 3GF6A 2XL7A 1Z0HA 1HB3A 2E6VA 1MACA 3CZJA 4RR3B 5FR3A 4KGGA 1RUOA 1AR73 1FATA 3T1LA 5HV4A 4ZZ8A 1D4VB 2ADDA 4N7IA 1U5YA 1XYPA 4Q0QA 4FPEA 1DLCA 4ZXKA 4NOTA 2PN5A 4WVMA 4AEMA 3E1F1 4QX3A 3V65A 1WMEA 5J3UA 3N35A 4QXKA 5A1LA 3SH5A 2BP6A 1N1YA 2OQ7A 3PIGA 5T55A 3VL8A 1UPIA 2W2IA 4IESA 1EPZA 1GOHA 3WNOA 1OUSA 3DKWA 4BMBA 3WDWA 5LEJA 3B9IA 3VDDC 4AK3A 4XIKA 1JUIA 3CQOA 4JGZA 3VKFC 2QQJA 4LHKA 5FLJA 1SACA 2BWAA 3AZYA 3I59B 4YM3A 5IAXA 5C9AA 2YG0A 1KJLA 3POJA 4QGNA 2BRTA 3PUQA 4QU2A 3RGBA 3S30A 4IE6A 2Z5WA 3PJQA 3APBA 5FZ1A 1QHDA 1W9WA 3V0AB 1OBNA 1HLCA 2BVVA 4CRQA 1PVC3 5T50A 3DYOA 4AI8A 3WUDA 3TEWA 1GSLA 1BKZA 5CU1A 1FOD2 1ULFA 4YPJA 4DRRA 2WNVC 2C0ZA 3AVRA 1F4AA 1AXKA 1OVSA 5APAA 2VPVA 3VBFA 3BIWE 1QQP1 1LCLA 2QZ3A 2XLFA 2ARXA 3FE5A 4NPRA 4DO0A 5C3QA 5FO9B 3L2YA 2HWE2 3LCPA 4L2NA 3VV1A 1L3JA 3FHQA 1WD4A 4IERA 3ZYPA 2W94A 5FZCA 3RRDA 3ZSEA 2X5IA 4BQ5A 4JTOA 2B7YA 4N90A 4UFJA 5LY2A 4DS0A 3MIBA 3VD4A 1G9AA 1RUI1 1YJLA 2WNVB 2W1WA 2XBO1 2WO2A 2W5FA 3CMGA 3AKTA 4HKOA 1BZWA 1LGCA 5L9BA 5JOXA 2HJIA 5IWFA 3LIGA 1RUF1 3J7MA 5JWPA 1CZTA 5JVVA 1H0BA 4MSVA 4R9CA 3PL0A 1C28A 2BZDA 4CCDA 3U0ZA 2ORXA 1Q8QA 3IKWA 2R061 3VHRA 1QQP3 4PF1A 1W0PA 1ZZ8A 1DLLA 2JENA 2E63A 3PJYA 1RMU2 4Y26A 3IT8A 1UY0A 3C8XA 3F95A 4RGGA 2VMFA 3OD4A 5DABA 1JZ6A 1JYTA 4L0PA 3I59A 3B02A 3B9CA 3OTFA 4YW1A 3N36A 3WF4A 2K9ZA 1RUI3 2RS12 3VZMA 2A70A 2R072 5FXXA 5GZGA 2XBO3 2RV9A 4D6QA 2HEWF 2DYCA 4E2SA 1RUF3 1J3RA 3D0JA 1L7RA 1ZRFA 3K3NA 4H55A 5DUWA 2PHWA 3RJ2X 3SQOA 2WA3A 5FZ0A 5LA0A 3VDDA 5LZ6A 1QXRA 2RR11 2NN8A 3AYCA 4TLFA 5LB6A 1ENRA 2CWMA
chains in the Genus database with same CATH topology
3K2OA 4DIQA 2GP5A 2XMLA 5A3TA 3RVHA 4UF0A 4AI9A 1VRBA 5F32A 4ASKA 5ANQA 4XDPA 4HOOA 5A1LA 5FYHA 2Q8EA 5IVFA 5FXVA 5IVBA 2OQ7A 5A7OA 4LXLA 3KV6A 4LIVA 2W2IA 5FYCA 5F3IA 4CCMA 4EZHA 3KVBA 5A3PA 2YBSA 2WWUA 4GD4A 3PUSA 4Y33A 4D6RA 5FZOA 5FY1A 5FPVA 5A3NA 3ZLIA 3DXUA 5FY5A 4QXHA 4BXFA 5F2WA 3OPWA 3U78A 4EZ4A 3PUQA 5FZLA 5FJHA 2Q8DA 5FUPA 5A7QA 4CCNA 5FZ1A 4NUBA 4HONA 5F3EA 2OT7A 4V2WA 4IGQA 4IGOA 5FYMA 3K3OA 4D6SA 4Y3OA 5K4LA 2YU2A 5FY8A 5FP7A 5FZ6A 5FZGA 4CCJA 3PU3A 5F5AA 3PTRB 4CCOA 5F3CA 3AVRA 5F37A 5A7WB 5IW0A 3AVSA 5F39A 3PDQA 5FYYA 2YBKA 5A1FA 5IVJA 5LW9A 4TN7A 4DO0A 5FXZA 3N9OA 5F2SA 4EYUA 5FUNA 4Y4RA 4CCKA 3PU8A 4UF0B 3PUAA 2OS2A 2OX0A 5FZ9A 5FZIA 4BISA 5FYUA 5FZCA 4E4HA 3N9QA 4LITA 2WWJA 3U4SA 5A80A 4LIUA 4QX7A 5FZAA 5LY2A 4QXBA 5FY0A 5FZDA 5F5IA 3LDBA 5FPLA 3KV4A 2GP3A 5A7PA 3AL6A 5FP9A 3PURA 4BU2A 2PXJA 5FBJA 5KR7A 4QX8A 5FPAA 5FY9A 5FYVA 5IWFA 5FZEA 5FWJA 3N9NA 5FWEA 4QU1A 5FZHA 2Q8CA 2OQ6A 5FZMA 3N9MA 5FJKA 5FZFA 2XUEA 3KVAA 2YU1A 2XDVA 3KV9A 4GAZA 5IVYA 3ZPOA 5IVEA 3OPTA 3N9PA 4QWNA 5FP3A 3AL5A 5FYZA 3LD8A 4AAPA 5IVVA 5ISLA 2XXZA 2YPDA 3UYJA 5FYSA 4CCLA 4URAA 5FYTA 4QXCA 2P5BA 5FXWA 5FXXA 3N9LA 5FP8A 5LY1A 4D6QA 5A3WA 5F5CA 4XDOA 5FZ4A 5F3GA 5FYBA 5E6HA 5FY7A 5FP4A 5FZ7A 5FZOB 3DXTA 3K3NA 4V2VA 3KV5A 5FZBA 5A7SA 5CEHA 4CUGA 5FZ0A 5IVCA 5FZ3A 5FZ8A 5FV3A 2YBPA 4CSWA 5FZKA 5LWBA 4GJZA 5A7WA 3NJYA 5FPUA 5FPBA 5A7NA 4C8DA 5FY4A 4IGPA 2VD7A 5FYIA 4GJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K2O A;  4DIQ A;  2GP5 A;  2XML A;  5A3T A;  3RVH A;  4UF0 A;  4AI9 A;  1VRB A;  5F32 A;  4ASK A;  5ANQ A;  4XDP A;  4HOO A;  5A1L A;  5FYH A;  2Q8E A;  5IVF A;  5FXV A;  5IVB A;  2OQ7 A;  5A7O A;  4LXL A;  3KV6 A;  4LIV A;  2W2I A;  5FYC A;  5F3I A;  4CCM A;  4EZH A;  3KVB A;  5A3P A;  2YBS A;  2WWU A;  4GD4 A;  3PUS A;  4Y33 A;  4D6R A;  5FZO A;  5FY1 A;  5FPV A;  5A3N A;  3ZLI A;  3DXU A;  5FY5 A;  4QXH A;  4BXF A;  5F2W A;  3OPW A;  3U78 A;  4EZ4 A;  3PUQ A;  5FZL A;  5FJH A;  2Q8D A;  5FUP A;  5A7Q A;  4CCN A;  5FZ1 A;  4NUB A;  4HON A;  5F3E A;  2OT7 A;  4V2W A;  4IGQ A;  4IGO A;  5FYM A;  3K3O A;  4D6S A;  4Y3O A;  5K4L A;  2YU2 A;  5FY8 A;  5FP7 A;  5FZ6 A;  5FZG A;  4CCJ A;  3PU3 A;  5F5A A;  3PTR B;  4CCO A;  5F3C A;  3AVR A;  5F37 A;  5A7W B;  5IW0 A;  3AVS A;  5F39 A;  3PDQ A;  5FYY A;  2YBK A;  5A1F A;  5IVJ A;  5LW9 A;  4TN7 A;  4DO0 A;  5FXZ A;  3N9O A;  5F2S A;  4EYU A;  5FUN A;  4Y4R A;  4CCK A;  3PU8 A;  4UF0 B;  3PUA A;  2OS2 A;  2OX0 A;  5FZ9 A;  5FZI A;  4BIS A;  5FYU A;  5FZC A;  4E4H A;  3N9Q A;  4LIT A;  2WWJ A;  3U4S A;  5A80 A;  4LIU A;  4QX7 A;  5FZA A;  5LY2 A;  4QXB A;  5FY0 A;  5FZD A;  5F5I A;  3LDB A;  5FPL A;  3KV4 A;  2GP3 A;  5A7P A;  3AL6 A;  5FP9 A;  3PUR A;  4BU2 A;  2PXJ A;  5FBJ A;  5KR7 A;  4QX8 A;  5FPA A;  5FY9 A;  5FYV A;  5IWF A;  5FZE A;  5FWJ A;  3N9N A;  5FWE A;  4QU1 A;  5FZH A;  2Q8C A;  2OQ6 A;  5FZM A;  3N9M A;  5FJK A;  5FZF A;  2XUE A;  3KVA A;  2YU1 A;  2XDV A;  3KV9 A;  4GAZ A;  5IVY A;  3ZPO A;  5IVE A;  3OPT A;  3N9P A;  4QWN A;  5FP3 A;  3AL5 A;  5FYZ A;  3LD8 A;  4AAP A;  5IVV A;  5ISL A;  2XXZ A;  2YPD A;  3UYJ A;  5FYS A;  4CCL A;  4URA A;  5FYT A;  4QXC A;  2P5B A;  5FXW A;  5FXX A;  3N9L A;  5FP8 A;  5LY1 A;  4D6Q A;  5A3W A;  5F5C A;  4XDO A;  5FZ4 A;  5F3G A;  5FYB A;  5E6H A;  5FY7 A;  5FP4 A;  5FZ7 A;  5FZO B;  3DXT A;  3K3N A;  4V2V A;  3KV5 A;  5FZB A;  5A7S A;  5CEH A;  4CUG A;  5FZ0 A;  5IVC A;  5FZ3 A;  5FZ8 A;  5FV3 A;  2YBP A;  4CSW A;  5FZK A;  5LWB A;  4GJZ A;  5A7W A;  3NJY A;  5FPU A;  5FPB A;  5A7N A;  4C8D A;  5FY4 A;  4IGP A;  2VD7 A;  5FYI A;  4GJY A; 
#chains in the Genus database with same CATH topology
 2PA7 A;  4PHZ A;  3GAL A;  1U5Z A;  5EPA A;  4IQP A;  4GMP 1;  4Q29 A;  2VBD A;  1GWM A;  1H4H A;  1WW6 A;  5IK8 A;  5A6Y A;  2Y60 A;  4J1X A;  3TN9 2;  3TEX A;  4OHX A;  3JB4 C;  3OG2 A;  5FMC A;  3UKV A;  2UY9 A;  1IZ3 A;  4LO6 B;  1PM4 A;  5KHG A;  1G9F A;  2WNV A;  2WO3 A;  2Y6J A;  3KZ4 C;  4LMF A;  3RSJ A;  5CG8 A;  1EPW A;  1OMI A;  2VNG A;  4XXP A;  3ZIW A;  3ZX7 A;  3RMY A;  2DTY A;  1AR9 1;  1QH6 A;  3FWE A;  4YFW A;  1PO2 2;  1PMI A;  4YLZ A;  1WCD J;  2RR1 3;  4BK5 A;  5FPZ A;  4K7J A;  2Y64 A;  2ZEY A;  3MO4 A;  3ZN5 A;  3HBK A;  1M4W A;  4ZZ5 A;  4AOC A;  2WII B;  4IV3 A;  3C7O A;  4H14 A;  4YM2 A;  2ZGQ A;  4HON A;  2WBK A;  4AF9 A;  4GMP 3;  3OB8 A;  4X8P A;  2BGP A;  3M3E A;  1R1A 2;  2B45 X;  4FPG A;  3C7E A;  1ACC A;  5DZG A;  5J37 A;  1HQL A;  3SKJ E;  1MS3 A;  2BQP A;  3LOI A;  5GZE A;  1JZ2 A;  4B3N A;  1JOP A;  1ND2 C;  4QMA A;  3O1M A;  4PDW C;  1W03 A;  4FAG A;  5L7O C;  3WNM A;  1ZZ7 A;  4MOA A;  4BLJ A;  1RED A;  1WCQ A;  1YI9 A;  2V72 A;  4UW6 A;  5GLU A;  1DIW A;  1DGR A;  4D7Y A;  1N47 A;  1YFY A;  3OBA A;  5ABJ C;  2B9V A;  3MBW A;  5FXZ A;  4NIG A;  4HSJ A;  2E7Q A;  1S55 A;  2E31 A;  3A0N A;  4WVZ A;  1TME 2;  4JQT A;  4NRP A;  1GZ9 A;  5L73 A;  3DEC A;  3LA3 A;  2XJR A;  2VUA A;  1ND2 B;  1REE A;  1IQA A;  1QF3 A;  3CDZ B;  1HXS 2;  4LBK A;  5LRR A;  5T5J A;  2VNO A;  3AX4 A;  3M70 A;  4PDW B;  4YW5 A;  4BQX A;  5L7O B;  1F5J A;  2PMW B;  3RZJ A;  2H0V A;  4GH4 C;  4MHU A;  4KG0 A;  2CWS A;  5FZE A;  5FWJ A;  2BW8 A;  2QQW A;  2VQT A;  4UFI A;  3AP9 A;  5EJZ B;  5ABJ B;  1LOB A;  2QUO A;  4BA6 A;  4UI9 L;  1GAN A;  1SLC A;  1WMX A;  2F6B A;  1POV 1;  2Y6F A;  5GZF A;  3WF0 A;  3WY6 A;  3ZYR A;  5J48 A;  1AHS A;  1OC1 A;  3ECQ A;  4D7T A;  3ZFG B;  2XDV A;  3CBN A;  4YGD A;  4Q0U A;  4ISR A;  2RDQ A;  1T6G C;  4P9Y A;  3AMN A;  5C3S A;  3BUC A;  5IJR A;  5I0D A;  5FYZ A;  3I3M A;  4R52 A;  5ISL A;  5HCA A;  4LT5 A;  1BEV 2;  2JDH A;  4LNV A;  4GH4 B;  5CB7 A;  4N9I A;  3LEM A;  4XUP A;  3UYJ A;  5D1I A;  2TBV A;  3RMX A;  4CU7 A;  2ZEZ A;  2H6C A;  5A3W A;  4A45 A;  1VBE 2;  2BOJ A;  1JU3 A;  2D6L X;  5FP4 A;  1OLM A;  2YC4 A;  4Q4Y 1;  4PQQ A;  2P3I A;  4V2V A;  5FZB A;  1C1F A;  3NWK A;  2NP0 A;  3I2D A;  2E32 A;  5FV3 A;  3H1W A;  4P5Y A;  1POV 3;  1ZA4 A;  2VZV A;  4J6G A;  3ZN6 B;  3H50 A;  4IV1 C;  5FPB A;  1FXZ A;  3HN3 A;  1JOD A;  4IGP A;  3KCY A;  4CYD A;  1XBF A;  4YZ4 A;  4AFC A;  5FK8 A;  1Z7S 2;  2HWF 2;  5JSP A;  4BHP A;  1JYI A;  1I5P A;  4Q1R A;  1KGY A;  5K7P A;  4RS5 C;  1JZ4 A;  5F32 A;  5FMO S;  2D6P A;  2VM9 A;  3BU0 A;  3WOG A;  2WYF A;  1HV1 A;  1ND2 A;  3WG2 A;  1JYX A;  4OYU A;  1KQR A;  5A7O A;  1XSR A;  2WZR 1;  1UYP A;  2YFZ A;  3AFG A;  4I3G A;  4PDW A;  3V64 A;  5FOB B;  5L7O A;  3UGF A;  1K3I A;  4IV1 B;  4AQS A;  2W47 A;  4EZH A;  4DY5 A;  1W05 A;  2VOX A;  1RC6 A;  1XE7 A;  3PUS A;  1LJ7 A;  3R0R A;  2JIC A;  2VCA A;  2BNN A;  5FPV A;  4W65 A;  1RYY A;  4GZ9 A;  3T2P A;  1CJD A;  4YW3 A;  5ABJ A;  2Q1Z B;  4HKL A;  4BXF A;  4LO5 B;  5JSO A;  1OQD A;  3A23 A;  5LBE A;  5IT6 A;  4AHZ A;  1JUH A;  4CUA A;  1UIJ A;  4RS5 B;  2IXL A;  4AEJ A;  3ME2 A;  1OI6 A;  2WN2 A;  4IGO A;  1QNW A;  1YFX A;  4OMD A;  3I2H A;  5K4L A;  2DU1 A;  2VC9 A;  1H4G A;  4P9G A;  2JB8 A;  3EMR A;  1BCX A;  4GH4 A;  4BQ1 A;  1A34 A;  2B8M A;  3DGT A;  5F7U A;  2WZR 3;  4S2D A;  2RDR A;  2NZ9 A;  2W3J A;  1W6M B;  3MI8 A;  1C3H A;  4OI2 A;  5KXC A;  4BPZ A;  1HB2 A;  1TZO A;  1NKG A;  3ATG A;  1MS8 A;  4TYS A;  4H7M A;  4YAR A;  2C6S A;  3SIS A;  2N7G A;  3CU7 A;  2XQX A;  1N3O A;  4HVQ A;  2A6Y A;  1CAU B;  3G6J B;  4NAM A;  4KWK A;  4O61 A;  3ZN6 A;  3B93 A;  1W0N A;  3MV1 1;  1IS4 A;  1PVC 2;  2D98 A;  3BN6 A;  4FFG A;  5EJ1 B;  5FZA A;  3WNL A;  1IKP A;  2X29 A;  4HMZ A;  2FDH A;  4U36 A;  5F5I A;  1YIF A;  3MF6 A;  4KBZ A;  1DQ2 A;  3GCW A;  3POE A;  1RUC 1;  5EFU A;  3E5X A;  1PX3 A;  4LA3 A;  1RTV A;  3AZX A;  2ET1 A;  1B09 A;  3IM0 A;  4MGS A;  1H2K A;  1GP6 A;  1QJZ A;  1T6B X;  1MS1 A;  4Q27 A;  3U1X A;  4DFS A;  2VNR A;  5IAV A;  3KVA A;  2CL2 A;  5D8A C;  4EN0 A;  2WFP A;  2ZZQ A;  4PF5 A;  2Q1F A;  5I0R A;  4IV1 A;  3VZK A;  2VNV A;  3H9A A;  2VVD A;  2X09 A;  4Q0V A;  3FBY A;  1XU2 A;  5DUV A;  5FP3 A;  5IK4 A;  2VZO A;  3M7A A;  1GZT A;  3PLQ A;  4Q4W 1;  2YPD A;  1AJK A;  2EIE A;  1RXG A;  3POF A;  3LA2 A;  1V70 A;  5FXW A;  2DVD A;  4JKM A;  4N43 C;  4RS5 A;  1POQ A;  1V6I A;  4AVV A;  4DUW A;  4Z07 A;  1I6X A;  1GOG A;  4KU8 A;  2ZXQ A;  4AI2 A;  5FZ4 A;  3WDV A;  2WKK A;  1DHK B;  3IAQ A;  3VBO C;  5D8A B;  5FFO C;  4LO8 A;  2IXC A;  1G9B A;  1IQD C;  1R08 1;  3H7J A;  1CD3 G;  1LUL A;  3WP6 A;  3NAP C;  1QQP 2;  3Q8C A;  5FZK A;  2DTW A;  2B42 B;  4IEU A;  1UZ0 A;  1NQJ A;  1W2N A;  1MS9 A;  4LBQ B;  1VBD 1;  1CX1 A;  4GJY A;  4AVT A;  1CIY A;  2Y34 A;  2WNU B;  4N43 B;  3G7D A;  3JQW A;  3AKR A;  4MG2 A;  1X33 A;  2VY0 A;  2E7T A;  2IXH A;  1RUI 2;  4Q4W 3;  2WDB A;  4UBG A;  1CAU A;  5A3T A;  4LBL A;  2XBO 2;  1BVP 1;  4FPK A;  3VBO B;  1LES A;  2WIN B;  1IS6 A;  4BIF A;  3J26 N;  3KS7 A;  1RUF 2;  2DCY A;  5BNO C;  3NAP B;  1OUX A;  2PLV 1;  1PGS A;  3RWN A;  2Q30 A;  3AYE A;  2ZX4 A;  4Y1Z A;  1W8O A;  2JE8 A;  1W3V A;  1R08 3;  2WFF 2;  3I3B A;  4DXR A;  5LEK A;  4D6R A;  3V0B B;  2JE9 A;  3I2F A;  3T0A A;  1HKD A;  4IE0 A;  3Q9O A;  2P3Y A;  2FDI A;  3D3A A;  1VBD 3;  2WSV A;  2WT1 A;  3WHU A;  4Z92 B;  1D4M 1;  3A22 A;  3HPN A;  4LQR A;  1DQ0 A;  4XBQ A;  5FPX A;  4MGK E;  4NPM A;  2E9Q A;  3E5U A;  5FYM A;  5IAT A;  5ANN A;  4F8A A;  5BNO B;  4AGV A;  2PAK A;  4QX0 A;  1LOF C;  2R49 A;  2YU2 A;  1EAH 1;  1CR7 A;  2RDN A;  5JAX A;  3ETP A;  1N3P A;  3N7M A;  4YW6 A;  5F5A A;  3WHT A;  2PLV 3;  4XFF A;  3POW A;  3OPZ A;  1CON A;  3KT7 A;  3IWZ A;  3PDQ A;  2SBA A;  1ZRI A;  2DFC A;  3ZSK A;  1FT9 A;  3U10 A;  1ZRE A;  3W5M A;  2RR1 2;  2Z4F A;  5D8A A;  5I93 A;  1S1A A;  3DCQ A;  5D2A A;  4CCK A;  4YG6 A;  3PU8 A;  3WW3 A;  2OX0 A;  5FZI A;  3WW4 A;  4OZO A;  3IBM A;  4PQ9 A;  5LAS A;  2J1T A;  1HRV 2;  1DZQ A;  4LIT A;  1D4M 3;  1TVG A;  3I3D A;  2VJX A;  1XJA A;  3OGG A;  5FZD A;  2ILM A;  5IFP A;  2V4V A;  1ULE A;  3MZH A;  2D6O X;  1UN1 A;  2VOT A;  4FPH A;  3AL6 A;  4GA9 A;  4N43 A;  1L7Q A;  4PLM A;  1EAH 3;  2R07 1;  4IUG A;  4AFM A;  4EJR A;  4EE2 A;  4CTE A;  1GU3 A;  2W39 A;  2UU8 A;  5GLW A;  5J09 A;  4MUV A;  3GHM A;  4XHB A;  2RJ2 A;  3NNL A;  3T4V A;  3VBO A;  5F9T A;  5J7M A;  4P9W A;  1XE8 A;  2VU9 A;  4D3W A;  1SG3 A;  2DUR A;  3NAP A;  3DKQ A;  4FP3 A;  4KWL A;  3OD0 A;  3LPG A;  2C1F A;  1YFU A;  3O12 A;  4QT6 A;  4YGB A;  2JG8 C;  1QU0 A;  3FC0 A;  4A7K A;  3EO6 A;  1DCS A;  5CBL A;  1WMD A;  3UET A;  4EN7 B;  4NJ4 A;  5FK7 A;  3V0B A;  4AFA A;  2VUL A;  1CZV A;  2TEP A;  2WNE A;  4XCA A;  1O8S A;  4AI3 A;  1F9K A;  5DXD A;  1C1L A;  4IL7 A;  1QXJ A;  3TN9 1;  1OH3 A;  1LTE A;  4XUO A;  5I0U A;  1I5Z A;  1V6O A;  4NR1 A;  3BTX A;  1YQC A;  1MS0 A;  4XDO A;  3T30 A;  5T54 A;  2QVS B;  4OZX A;  5BNO A;  4HN0 A;  4JKK A;  5FRA A;  1DF0 A;  5DDJ 1;  4HZF A;  1U5X A;  3IPV B;  5EV7 A;  1D2Q A;  4M3C E;  4B29 A;  5A6Q A;  4ZON A;  2D44 A;  1MEC 1;  4CSW A;  5FMD A;  5K9Y A;  2FHR A;  4OUL A;  2WC2 A;  4UW4 A;  3GZA A;  4P9I A;  5EYY A;  4YZ1 A;  1XNC A;  3SCF A;  2YB7 A;  2WO1 A;  4X6R B;  3NMB A;  2A5Z A;  2G9F A;  2JDP A;  3NKG A;  5DG2 A;  4UBH A;  3WLU A;  2RE9 A;  1HQW A;  5B4N A;  2W91 A;  1F31 A;  3BKZ A;  2XJV A;  3PME A;  5T5L A;  1JYC A;  5LRS A;  1R1A 1;  2K2S A;  4GMP 0;  1J3P A;  2BTV C;  1LOF A;  2V73 A;  4PJY A;  4ZXE A;  5HCH A;  1F2N A;  1WWY A;  3C7H A;  3VBS B;  4QKB A;  1BVV A;  3L9J T;  5K0U C;  3IAP A;  1SBF A;  3GJB A;  1OOP C;  5DDJ 3;  2WQ8 A;  1V6M A;  2QQV A;  3LAG A;  3MV0 1;  3ZO0 B;  1MEC 3;  1WLT A;  2VW0 A;  5FZO A;  2GC1 A;  1S0E A;  1JYW A;  1QIQ A;  2DV9 A;  2J1R A;  4EZ4 A;  4QX5 A;  1CAW B;  4JAA A;  2A3Y A;  4P5H A;  2CDO A;  3ZYG A;  4CCN A;  1TME 1;  4DUX A;  1QNY A;  2VMC A;  3ASI A;  3H7Y A;  4IGQ A;  3VGI A;  3VBR C;  1W6P B;  2J1E A;  3FFQ A;  1W90 A;  5K0U B;  1X82 A;  1HXS 1;  1F15 A;  4MHR A;  3GZU C;  4YRD A;  1OOP B;  5FP7 A;  3E6C C;  2D43 A;  3LIH A;  1YLL A;  4C0B A;  2X8K A;  2JDK A;  4MH0 E;  1T2X A;  1AXY A;  2CY6 A;  2W0X A;  5FRE A;  4XAB A;  4CP0 A;  2WN3 A;  4D7S A;  1FNY A;  2H6B A;  2ZHM A;  2RS3 3;  4XMA A;  4B7K A;  2CSG A;  4PCR A;  5CKQ A;  5LW9 A;  4UT5 A;  3N4M A;  3D0S A;  3IPV A;  3POY A;  4OLL A;  4EYU A;  3B69 A;  5KXD A;  2JG8 A;  2FDG A;  3RYP A;  3VBR B;  3IDE A;  1Q56 A;  2QQL A;  4BIS A;  5DAP A;  1C4R A;  1GZW B;  1E57 A;  1SBE A;  1VAM A;  3EB7 A;  3MEP A;  5HPO A;  5SV5 A;  1TME 3;  1HB4 A;  3MUZ 1;  4LIU A;  5A80 A;  2W1U A;  3CL1 A;  3KF5 A;  1BEV 1;  4AQ2 A;  3K4A A;  3KF3 A;  1PM7 A;  4NMI A;  4UW3 A;  3P3P A;  3BIE A;  2A6Z A;  4BK4 A;  5JR7 B;  1HN0 A;  3R4S A;  1O59 A;  4QM8 A;  4SLI A;  3ELN A;  4FXG B;  4NHM A;  3HIF A;  1N3Q A;  2JWP A;  2WZR 2;  3LF7 A;  2ORZ A;  1CES A;  4FOW A;  3ZOI A;  5FCC A;  2I07 B;  4EQV A;  2NMN A;  2D97 A;  2JE7 A;  3LQC A;  5B2G B;  1N1S A;  1RUG 3;  2Y8K A;  2FD8 A;  2D6M A;  3ZPO A;  2P3J A;  3OCP A;  1D7P M;  3KT4 A;  3J7L A;  1POV 0;  4HFS A;  3UK9 A;  4IEV A;  4XF0 A;  3OJB A;  3QOP A;  4WVM B;  2GMP A;  2ZGL A;  4AL9 A;  3O1V A;  1BMV 1;  3ST7 A;  2YHJ A;  1S2K A;  4XJW A;  1YQ5 A;  4CU6 A;  3WP3 A;  4HVO A;  1BEV 3;  1CAW A;  1W8H A;  3JZV A;  4WM7 C;  2WAA A;  4BB3 A;  5FP8 A;  2IVJ A;  1W6P A;  4OUM A;  1PK6 C;  3ES4 A;  5K0U A;  2ETE A;  3EQE A;  3OYW B;  4OHV A;  3JB8 A;  2OA2 A;  1K5M C;  4JGZ B;  4IET A;  1OOP A;  3MIH A;  3DL3 A;  2YBP A;  1BQP A;  4ZS2 A;  3ZYI B;  4R9B A;  4LKE A;  2DFB A;  1X50 A;  3O7O A;  4Z2A A;  3MID A;  4YW2 A;  3NV4 A;  5FKB A;  2FCU A;  3KM5 A;  4BQ3 A;  4WM7 B;  1VE0 A;  2JG9 C;  2GP5 A;  3AYD A;  2X5I C;  3FUO A;  2JXA A;  4KNC A;  3RS6 A;  4DQA A;  3ACL A;  4UAP A;  3ZKU A;  3VBR A;  2R6Q A;  4AI9 A;  4Z8B A;  1JBC A;  1GZW A;  2CNA A;  3KWV A;  4FQZ A;  2OPW A;  4FT8 A;  3SEE A;  2QBX A;  2P1B A;  4Y5S A;  1V0A A;  5IVB A;  4FTS A;  4CU8 A;  4IEO A;  5I0T A;  3WX5 A;  4QQO A;  5EQU A;  5A70 A;  2JD4 A;  4DOU A;  1V00 A;  4P9L A;  4DUV A;  1OPO A;  2CTV A;  3WG1 A;  1GNH A;  3NKT A;  4PI0 A;  4NWW A;  2UUR A;  2LM3 A;  4LK6 A;  2A7A A;  3UV9 A;  4CVU A;  1NCR C;  1UX6 A;  3VZJ A;  1RJ7 A;  2ES3 A;  2VCB A;  4GWM A;  4AW7 A;  2JG9 B;  1UO9 A;  2X5I B;  4LE4 A;  2V5Y A;  4RD7 A;  2MHF A;  2CGN A;  3N3H A;  3OPW A;  4NII A;  3ZXJ A;  4DY3 A;  4AG4 A;  2YZ4 A;  4KU7 A;  3ILN A;  4WZC A;  4Q4W 2;  1GZC A;  2KA3 A;  3N7K A;  3ZVX A;  1PVC 1;  3GBG A;  4KWU A;  1PNG A;  4ASL A;  4IEP A;  4D6S A;  4OI0 A;  5IFT A;  3TEY A;  1LU1 A;  1UOG A;  3POB A;  2A6V A;  3RNS A;  1NZC A;  1NYW A;  1OUR A;  3M1H A;  3LOB A;  3IDA A;  4RA0 A;  4E4S A;  2GME A;  5E1R A;  3FX3 A;  1R08 2;  1OFN A;  1SMV A;  4PIZ A;  1XQN A;  4YZ5 A;  4KGQ A;  4LLF A;  1ZBE 1;  2P6C A;  2A6X A;  2ZGN A;  3OYW A;  1UOB A;  4LBQ D;  1SQ4 A;  1VBD 2;  4NHK A;  4A2U A;  5CIS A;  5E89 A;  4CXX A;  3MF9 A;  4UWD A;  3SKV A;  3J8F 1;  1FPN 1;  4IEQ A;  4XQW A;  5CG9 A;  2PHF A;  4ET7 A;  3ZFE C;  4XC9 A;  1XNA A;  3C2U A;  4YGE A;  1GQH A;  4BQ4 A;  1EYB A;  4QXB A;  1GR3 A;  3OEB A;  5FY0 A;  1RIR A;  1H1M A;  4I09 A;  3CZU A;  1WA6 X;  5JCT A;  4BWO A;  3M3C A;  3PUI A;  4WM7 A;  4TWT A;  2WSU A;  2DCJ A;  1BJQ A;  4K20 A;  4DXZ A;  4GKY A;  5CA6 A;  2PLV 2;  1XNK A;  3WIN E;  1FI2 A;  1PK6 A;  1V6L A;  4QU1 A;  2BNO A;  3VDD B;  2Q8C A;  4WV8 A;  1EV1 1;  1K5M A;  4QGL A;  5A33 B;  2IWG B;  2J1V A;  3FL7 A;  3RI9 A;  1VR3 A;  3NVC A;  1YI7 A;  1ZBE 3;  3ZFE B;  2BFU L;  3MIG A;  3EBR A;  1W6Q B;  3PVB B;  4M01 A;  3UGG A;  2QKD A;  3NV1 A;  3IN9 A;  4KL1 A;  3THD A;  5CKN A;  1D4M 2;  1FPN 3;  2WS9 1;  3J8F 3;  4IV3 C;  2D6K A;  1NZI A;  5L19 A;  2JG9 A;  4LKS A;  2XXZ A;  3LKJ A;  3SH4 A;  3TWI A;  4QXC A;  1G6N A;  2JDY A;  1EAH 2;  1ODN A;  5B4X A;  2DUO A;  4YW4 A;  1LOG A;  4KWJ A;  2C24 A;  2I2S A;  5IHR A;  5AVA A;  3KQR A;  1ASJ 1;  4XPV A;  1XXN A;  4LK7 A;  4MGY E;  1QH7 A;  1V6K A;  3QAC A;  5CEH A;  1EV1 3;  1Q5O A;  5IVC A;  3WQ1 A;  4CE8 A;  2WFF 1;  5LWB A;  4OQ9 A;  1VMJ A;  2RM2 3;  4XET A;  1NCR A;  3AYA A;  4BCU A;  3ORJ A;  4IV3 B;  4C8D A;  5FY4 A;  3SEP A;  2D40 A;  4WZF A;  3D6E A;  4P9X A;  4DXT A;  3T09 A;  1R09 1;  1ZZB A;  2ARB A;  2BDR A;  2P6H A;  2WS9 3;  4Y1U A;  5DZE A;  5K8S A;  3BB6 A;  1G9C A;  3TEZ A;  5C3O A;  3KB5 A;  3LZZ A;  2ZGM A;  1XOY A;  4A7Z A;  5DAQ A;  5ANQ A;  4NWV A;  4CU9 A;  2R04 3;  1H1A A;  3LPF A;  2VQU A;  2B5H A;  2UWA A;  2EXK A;  2QQM A;  5CAD A;  1ZRD A;  4LIV A;  1ASJ 3;  1JTZ X;  3HBZ A;  4CDU C;  2XJP A;  2FCV A;  2Y38 A;  1HJG A;  3RDI A;  4FO9 A;  2MPF A;  1RIT A;  2WWU A;  3VBH C;  1OSG A;  4QHB A;  5HV0 A;  1UL9 A;  2O1Q A;  2WFF 3;  3TBD A;  4AI1 A;  1IPJ A;  4QXH A;  2LS6 A;  4HT1 T;  3SMH A;  5A33 A;  1CAV B;  1RUH 1;  1O4Y A;  3D5O A;  4HVR A;  4B1M A;  1R09 3;  1FYU A;  3ZFE A;  2RMU 3;  2NQY A;  1AL0 G;  5ERL A;  1W6Q A;  2Q4S A;  1HRV 1;  5F3E A;  1LOA A;  4BLI A;  3POI A;  4YYO A;  5A3L A;  2J1U A;  2HH9 A;  2G9G A;  4Y1X A;  4G9S B;  5EIY B;  4NIH A;  1OA3 A;  1FV3 A;  2K0G A;  4KQ7 A;  4Q0S A;  3UJQ A;  4CDU B;  1WCS A;  3VBH B;  2IXK A;  3PTR B;  1H6X A;  4E2G A;  2OKX A;  5DDJ 2;  5F3C A;  3U75 A;  1ZNP A;  3HQU A;  2JKB A;  5CFC C;  1MEC 2;  2LW8 A;  5JMC A;  1PMJ X;  5IK5 A;  2Y6H A;  2FQP A;  1PX4 A;  2XH6 A;  4Z1V A;  2ZA9 A;  4AWD A;  1MZ5 A;  1AJO A;  1OKO A;  4MO3 M;  3NV3 A;  3FLT A;  1RUH 3;  4IND A;  4LUM A;  4Y4Y A;  1UMH A;  4HSL A;  4FFH A;  4DEQ A;  4FFF A;  3BYW A;  1GWL A;  5HCF A;  1HRV 3;  2AH2 A;  3LSD A;  3Q8F A;  5G04 L;  5A7P A;  1UY1 A;  2Q8O A;  3SHR A;  5BV6 A;  4QX8 A;  2XG3 A;  2C9K A;  4LPL A;  5CFC B;  1O3S A;  5JI9 A;  5ACA 3;  2WQZ C;  2WUH A;  1CJP A;  5I0S A;  2RS3 2;  3I2K A;  3NNM A;  4HAN A;  4IXL A;  4PBO A;  3T2Q A;  3ZFF C;  3UKN A;  5I8Y A;  5JDB A;  4DIN B;  3DYM A;  3O1P A;  1YCI A;  4EWD A;  1W9T A;  5IVE A;  3PUH A;  1LGB A;  1JYV A;  4EV0 A;  3WD5 A;  3FJS A;  3AL5 A;  2DUQ A;  3FLR A;  3JBG 1;  3HVD A;  5IVV A;  4XZU G;  1V9U 3;  3INA A;  3Q8A A;  1CAV A;  2HYX A;  4GWJ A;  2JIG A;  4COV A;  3NJX A;  2ZAH A;  1QGL A;  2VUC A;  1SLB A;  2PQQ A;  3PVO A;  1AYN 3;  4QGM A;  2C4X A;  5DQ0 A;  3ZFF B;  1PNF A;  1OF4 A;  1UMZ A;  3GXU A;  5KHJ A;  1IGO A;  5CAZ A;  2A1X A;  1J58 A;  5FZ7 A;  1UY4 A;  2VMG A;  1RUE 1;  4CDU A;  3W59 A;  1DYK A;  2HYK A;  4D8M A;  4AVB A;  3VBH A;  4B7E A;  4EN8 B;  4JX0 A;  1RUG 2;  1BBT 3;  1W6O B;  5JOZ A;  1AX1 A;  4XBL A;  4HBN A;  4AGR A;  2XKO A;  1VMF A;  4A44 A;  4TSV A;  3W5N A;  1HQN A;  2UWC A;  3ZR6 A;  2X05 A;  3ZKY A;  4RQP C;  1S0B A;  1Y9G A;  4ASM B;  2IC1 A;  1W9Y A;  2JX9 A;  3H0O A;  3JBG 3;  3MIC A;  4G3Y C;  3MW3 A;  1OQ1 A;  2VTX J;  4LOS A;  4E4D X;  4GB3 1;  4NID A;  2R0H A;  3M8L A;  4PLO A;  1UY2 A;  4NRM A;  4HXC A;  1KRI A;  4R8H A;  1DDL A;  3H42 B;  4DXS A;  1W0O A;  4HG6 B;  4Y1Y A;  2WQ4 A;  2LAL A;  3D4K A;  1YQ2 A;  4L99 A;  1UU4 A;  1RUE 3;  1WLC A;  2DVB A;  3MFA A;  4GD4 A;  5CFC A;  2A75 A;  3AFK A;  4RQP B;  4WVW A;  4MXW A;  4JV4 A;  4XIL A;  4Y24 A;  4XDQ A;  1YO8 A;  1FMD 1;  1AXZ A;  3AJZ A;  3ZXG A;  3RWK X;  3WT3 A;  1CAX B;  4RN5 A;  4QQ2 A;  1JZ8 A;  2EAL A;  1BMV 2;  2HLE A;  2CAV A;  1UIK A;  1OQE A;  4Y20 B;  2D3R A;  1AYM 3;  2QTW B;  2VTX A;  3F2Z A;  3JXS A;  1WZX A;  1XYO A;  3OEA A;  1UCX A;  1LKN A;  1OLQ A;  1CPN A;  3FFZ A;  4FSJ A;  4O7X A;  1S0J A;  3T3Y A;  1K12 A;  4GB3 3;  2GDF A;  3OSD A;  1YRZ A;  2VH9 A;  1AL2 1;  1KFX L;  5F39 A;  2V09 A;  1LOE A;  2CV6 A;  4M4R A;  4ZS3 A;  3ZFF A;  4MYE A;  1MZ6 A;  2PHR A;  2D5F A;  2XWB B;  2J22 A;  1JZ5 A;  3WXP A;  4CA9 A;  3VL9 A;  2XVL A;  1UZZ A;  1VRH 3;  4QPW A;  5F2S A;  1H2L A;  3S7E A;  3SXW A;  1N1V A;  3MFC A;  3T4H B;  2EIG A;  1FMD 3;  2OS2 A;  3OUJ A;  4NHY A;  4ERO A;  5FYU A;  1SLA A;  1W6O A;  1WW5 A;  2ZML A;  2D93 A;  1YIP A;  1SFN A;  4UFH A;  2G19 A;  1DQ4 A;  4XMI A;  2XWJ B;  5FP9 A;  2LRP A;  2IFR A;  5EHD A;  3WNX A;  4D69 A;  3WP5 A;  2YRO A;  2NMO A;  3AZW A;  3NJZ A;  4Q2F A;  4Z82 A;  4A41 A;  3I54 A;  1JN2 P;  1NE6 A;  2V4A A;  1ZM1 A;  2DBI A;  1AL2 3;  3AP7 A;  4LUL A;  2XUE A;  2VUD A;  4OUS A;  4WM8 C;  3SH3 A;  4OMC A;  3SLI A;  1RHI 1;  4AHY A;  4PBP A;  4QPI C;  2C5D A;  1ST8 A;  1J1L A;  1YQ8 A;  3ZDV A;  4FI9 A;  1MVQ A;  3FLP A;  1S2E A;  4IEW A;  1MS4 A;  4RQP A;  5BNP C;  3QBQ A;  1TG7 A;  4CCL A;  5JPN B;  1OT5 A;  5GLV A;  4E27 A;  2BBA A;  1CAX A;  3ZSJ A;  3HT2 A;  4HKW A;  4Y20 A;  1MVE A;  4QKD A;  4RFR B;  1RVF 1;  3BGA A;  4LBJ A;  4AQ6 A;  1W2T A;  2ZX2 A;  1OA2 A;  1US2 A;  4QPI B;  3ZN4 A;  4LOR A;  1IG3 A;  1UKR A;  2R32 A;  5C7G A;  2VZR A;  1GMM A;  1ZBE 2;  2NPI A;  4JHZ A;  2A3X A;  4M3C F;  1RHI 3;  4Y22 B;  3S5A A;  4P9J A;  5BY5 A;  1C5H A;  4XQD A;  5BNP B;  2OXB A;  2DWR A;  3J8F 2;  1FPN 2;  1AX2 A;  4JGY C;  3WDT A;  5KXE A;  5IK7 A;  2XJU A;  3K2O A;  4QX2 A;  1LAJ A;  2CU5 A;  4PI2 A;  3HAG A;  1ZRR A;  1LR5 A;  2YFU A;  5C6C A;  1OFS A;  2Y26 A;  3T08 A;  5JIU A;  4PIY A;  2DF7 A;  4HET A;  4AGG A;  1OA4 A;  2X10 A;  1SPP B;  3GCX A;  4FQ4 A;  3O0W A;  3AC0 A;  4M4P A;  3KHB A;  3PTY A;  3DF0 A;  3POG A;  5LA9 A;  1RVF 3;  3ZSM A;  2IUW A;  3JCI A;  1DFQ A;  1Q43 A;  2JDN A;  4BME A;  1EV1 2;  3FBM A;  3K51 A;  5A3P A;  2ID4 A;  3B5L B;  2RM2 2;  2YGL A;  3Q8B A;  4JGY B;  3R4U A;  3WV6 A;  4LOT A;  5A3N A;  1U5I A;  4XFH A;  2ZGS A;  1J59 A;  2XB6 C;  3MW4 A;  4I01 A;  1W3X A;  1TEI A;  4AED C;  2WS9 2;  3EXU A;  5FJH A;  2HWC 1;  2ZGP A;  3I2G A;  2AR6 A;  1UZW A;  2PAM A;  2ZTN A;  4JCK A;  4ZPI A;  3J7H A;  4YZ2 A;  3K3O A;  4DZG A;  1FAY A;  1NQD A;  1QJY 3;  4LA2 A;  3HQR A;  4LHN A;  1TNF A;  3WVJ A;  2R04 2;  2QCS B;  3GZT B;  3KGZ A;  5FZG A;  3BOW A;  1UU5 A;  1O3Q A;  2VZP A;  2VVF A;  1ASJ 2;  5F37 A;  3VD9 A;  3DN7 A;  4Z2W A;  5E88 A;  2EAK A;  3IZO A;  4YVS C;  2EAA A;  4WM8 A;  1PZ8 A;  4AED B;  1Y9Q A;  1ZA7 A;  1BK0 A;  4JDO A;  4XBN A;  4KH9 A;  1O91 A;  4L8Q A;  4QPI A;  5A3O A;  3LB9 A;  4XIO A;  3ZPY A;  2CGO A;  4XFC A;  3LEI A;  2ZOE B;  1R09 2;  5I8S A;  2VOW A;  1IOA A;  4Y22 A;  2RMU 2;  4BXS V;  2FDF A;  1F4H A;  1UD1 A;  1XNT A;  2HWC 3;  5BNP A;  2ZAB A;  5EWS A;  2PHT A;  2NYY A;  1LNS A;  2A3W A;  1URX A;  3W58 A;  3WNP A;  4I0W B;  1YFW A;  5FBJ A;  1XND A;  4YW7 A;  5FY9 A;  4XW3 A;  1OD5 A;  4S2G A;  2WLQ A;  2XUM A;  4YVS B;  3AZV A;  4P00 B;  2ZHL A;  2ZX3 A;  3NRU A;  5F6L B;  1SPP A;  3N9M A;  5FMO L;  1UYX A;  1KDK A;  2JIJ A;  4ONU A;  5FZF A;  4N9H A;  5F6K A;  1REF A;  1IPK A;  1VAK A;  2YC0 A;  3BOP A;  3GBW A;  4QQP A;  2JEC A;  4LHS A;  4A4A A;  2D3S A;  1H6Y A;  1O6U A;  3VHO A;  1W2A X;  3AXD A;  1NLS A;  2JEM A;  5CFD C;  1RUH 2;  2VZ3 A;  1LHO A;  3BCW A;  4JGY A;  3JQX A;  4K9S A;  4ES9 A;  3H8U A;  4AVS A;  1LGN A;  1RL3 A;  4K6B A;  2RJK A;  3WF3 A;  4GXL A;  5FYT A;  1ZVF A;  2VVE A;  1GNZ A;  2BU9 A;  3URF A;  4E9K A;  4UFK A;  1ENX A;  3OY8 B;  1ND3 C;  2RHP A;  3GHN A;  1KS5 A;  5F3G A;  4K1Y A;  5ACA 2;  1GYK A;  4DMI A;  4UOJ A;  4B8E A;  5EZW A;  2VOK A;  5FZO B;  2XOM A;  4W6X A;  3OUH A;  4YM0 A;  1QJX 1;  4UFL A;  1B35 C;  3I3E A;  3WW2 A;  5CFD B;  4RHV 1;  4XEZ A;  3W21 A;  3H8O A;  1CWP A;  3AP6 A;  4E8D A;  4BYY A;  2GMM A;  2G1M A;  2IVI B;  4AED A;  2XHN A;  3FN9 A;  4LKD A;  3VB9 A;  4DIQ A;  1V9U 2;  2PHU A;  2Z2S B;  4MXV A;  2VGD A;  4RGK A;  2XML A;  3HNM A;  2FDK A;  4XQ4 A;  1JU4 A;  1NXD 1;  2DCT A;  1AYN 2;  2Z42 A;  3DV8 A;  4XTM A;  5C3R A;  3H1Y A;  1E5S A;  4ITC A;  2VG9 A;  2VZQ A;  4BOW A;  5LK7 B;  2GSY A;  3KV6 A;  4QDS A;  5F3I A;  4R4Z A;  1OXC A;  3WDY A;  3ENR A;  1EP0 A;  3NST A;  3B94 A;  1QJX 3;  2YBS A;  1BBT 2;  2JG8 B;  4JDN A;  4YVS A;  1W39 A;  1GIC A;  4FOQ A;  4RHV 3;  5JXH A;  3S57 A;  3VUO A;  3C7F A;  1O4Z A;  5FY5 A;  2BGC A;  3PVN A;  3ZM8 A;  4ZU5 A;  1ZZ9 A;  5FZL A;  2I74 A;  3ZMO A;  1PHM A;  1SFP A;  3K4Z A;  2E26 A;  3JBG 2;  1UZY A;  3UGH A;  1H30 A;  1PZ9 A;  5AVP A;  1NXM A;  5HXV A;  1LEC A;  1UNB A;  3KSC A;  4TLG A;  4QHZ A;  3UKT A;  2VO5 A;  3ZXE A;  2J7M A;  3H8X A;  1CPM A;  1W8U A;  4I0B A;  1QOT A;  1O7F A;  5H9S A;  4AVC A;  2RJL A;  4BQ2 A;  1COV 1;  1CN1 A;  1H8V A;  4FOY A;  4FPY A;  1PZ7 A;  1Q8V A;  4TXW A;  1RUE 2;  2AEZ A;  3AVS A;  3OY8 A;  3AKQ A;  2R1B A;  2VBB A;  3AKS A;  1ONA A;  2RS3 1;  4Y5T A;  1OLM E;  2J1S A;  3LFI A;  1WLW A;  3M2M A;  2PQS A;  4RFT 0;  5SV8 A;  3RZG A;  4K8F A;  1JI6 A;  5JLV A;  4FCA A;  5BUV A;  2O14 A;  2PFW A;  5CFD A;  2AC1 A;  2W52 A;  2QFE A;  5HI0 A;  2QQK A;  3GM8 A;  1PGL 1;  1AUY A;  4NN0 A;  2VZU A;  1AYM 2;  2HKX A;  1UAI A;  2W87 A;  4GWN A;  4MZU A;  4R4X A;  5FBZ A;  2Q1M A;  2QDR A;  1AR6 1;  2QNK A;  2YYO A;  1JHJ A;  4GB3 2;  4AHX A;  1ND3 A;  5FYV A;  3AMH A;  1E5I A;  2TNF A;  5FO7 B;  5JIA A;  1COV 3;  4Q8K A;  2VCM A;  5FZM A;  1VJ2 A;  5FJK A;  5JR2 A;  5AFB A;  2GZW A;  4XF9 A;  1B35 A;  1BYH A;  2DVG A;  3I7D A;  3TB0 A;  3MPP G;  4GIQ A;  3WCR A;  3KT1 A;  1W99 A;  1VRH 2;  1R1Z A;  2QQU A;  3O0V A;  1RUG 1;  3A7Q A;  2ZHN A;  4Q1P A;  1HW5 A;  4QHO A;  5HCB A;  5KHH A;  3VZO A;  5LCW L;  1FMD 2;  1X9T A;  2A73 B;  1ZYB A;  3OPT A;  3IDC B;  5KXB A;  2Y33 A;  1NE4 A;  5KWR A;  3LD8 A;  3VKN A;  3V56 A;  3MLL A;  1OF3 A;  4OHY A;  3JUU A;  1JHN A;  1NCQ C;  1VBA 1;  3WF1 A;  1UOJ A;  2HWD 2;  4MGI E;  5GJ6 A;  2VL4 A;  3UJO A;  1H9W A;  2QJV A;  2PYT A;  1AR6 3;  3K75 B;  3S7I A;  5JMO A;  5F5C A;  1N1T A;  3HWJ A;  2YV8 A;  1RJ8 A;  2OZJ A;  3LA7 A;  4C91 A;  1RUN A;  1AL2 2;  5FO8 B;  3E5Q A;  4WBB A;  1C8M 3;  2R16 A;  2FZ2 A;  3U07 A;  4YM1 A;  2E7A A;  3LWC A;  4N53 C;  3S6P A;  1OVP A;  5DG1 A;  2VBP A;  4A7Y A;  3VKL A;  1VBC 1;  2VD7 A;  4RSU A;  4J1W A;  1NCQ B;  3OBZ A;  4Q26 A;  5JUV A;  4XCB A;  3ZR5 A;  3WQB A;  3KCC A;  3E6B A;  4FOV A;  2XPJ A;  2JDM A;  3ILF A;  2P34 A;  3S0M A;  2JDA A;  3TNP B;  1VBA 3;  5BNN C;  3O1S A;  2VUJ A;  3VZL A;  1UPS A;  5LK5 A;  4CEW C;  3ZMN A;  4KMQ A;  2BEO A;  4YGC A;  2GN7 A;  4N53 B;  5C8W A;  1QWR A;  5D21 A;  4I02 A;  1UYZ A;  3MW2 A;  2GNB A;  1RHI 2;  2ATF A;  4QB6 A;  1VPH A;  4C0H A;  3IMM A;  3SCG A;  2HEV F;  3WQ0 A;  1IPS A;  1PO1 1;  3C7G A;  1C57 A;  3DXU A;  4XVH A;  1UYY A;  4O9E A;  1VBC 3;  2O0O A;  4HLT A;  2VXJ A;  2VEC A;  3EJK A;  4NRO A;  5BNN B;  2R0F A;  2VE1 A;  1W2U A;  1OH4 A;  5BPX A;  4CEW B;  1SCR A;  1S2B A;  1GOF A;  1F5F A;  1PK6 B;  4I30 A;  1WA4 A;  3D82 A;  1K5M B;  1KS4 A;  1RVF 2;  3U4X A;  5GLZ A;  4B4R A;  5CYY A;  3NNF A;  2ZPX A;  3WG3 A;  3TRS B;  4QKF A;  2ZGU A;  3J4U H;  4BH9 A;  3M4F A;  5E8A A;  5EP9 A;  3EYP A;  4IE7 A;  4ARX A;  4LUK A;  3N9O A;  1DGL A;  4H7L A;  1PO1 3;  2GU9 A;  4O9G A;  1V6N A;  4XFG A;  5EJ3 A;  1KFU L;  3T2O A;  4UF0 B;  4I0A A;  5FZ9 A;  4D0Q A;  4E4H A;  4RR3 C;  2YDE A;  3FMG A;  4PT6 A;  5FTT C;  3U4S A;  4M0N A;  3GBF A;  2IZW A;  5LA1 A;  1QJY 2;  2B9U A;  2W1S A;  1VAV A;  3CJX A;  5C70 A;  1UWW A;  4B1L A;  1NCQ A;  1WW4 A;  5DAW A;  3KV4 A;  1YNA A;  1A8D A;  1R64 A;  2VCC A;  3O1U A;  1EY2 A;  4W6W A;  4K8R B;  1WLD A;  1HRI 2;  1U12 A;  1OHF A;  3N9N A;  3PMS A;  4FPJ A;  5TSW A;  1NY7 2;  5BYN A;  3OGS A;  3BAL A;  1NCR B;  2UY8 A;  4LO7 A;  4OI4 A;  4XE9 A;  4CP9 B;  2F4L A;  1JOB A;  1HDK A;  5J1X A;  3I8T A;  3BPS A;  4N53 A;  1FX5 A;  4LEJ A;  5IVY A;  5GLT A;  4AYU A;  5C3P A;  5GKA C;  2NM1 A;  2H0B A;  3ETQ A;  2W68 A;  1UQX A;  2HWC 2;  4L92 A;  2DCK A;  1DBN A;  4AFB A;  4Y5Z 0;  4AAP A;  1H2M A;  1YWK A;  1IHM A;  2WNO A;  2FZ1 A;  3AZZ A;  3L2H A;  1JZ7 A;  1ZZC A;  3DEM A;  2W95 A;  4YSF A;  4URA A;  1YUD A;  3H3Z A;  1NG0 A;  1RUD 2;  2FMY A;  2V5D A;  4NAO A;  4DEV A;  3III A;  5BNN A;  1DGW A;  4WVV A;  4GWI A;  2L9L A;  3U11 A;  4CEW A;  2ZX1 A;  4Q4V 1;  4LO4 B;  3TYJ A;  5E6H A;  1JS9 A;  4XFA A;  1NLQ A;  3DXT A;  1UW8 A;  1PIV 1;  4MGT A;  2GC0 A;  3RZZ A;  5T5O A;  2MEV 2;  1BK1 A;  2RM2 1;  5A7N A;  2IXJ A;  3E6D A;  4A42 A;  2PAE A;  5J36 A;  4NVP A;  5DMY A;  4K40 A;  1FNZ A;  3U37 A;  1QDC A;  1NLR A;  2R1D A;  2CYF A;  4HPK A;  4KI5 M;  3P5B A;  4RGA A;  3I4I A;  4UF0 A;  2E51 A;  1VRB A;  3LDR A;  2E53 A;  1AZD A;  1QJU 1;  1GUI A;  2OZ6 A;  4XDP A;  4HOO A;  2R04 1;  3RZM A;  5IVF A;  4W6Y A;  2VXR A;  4Q4V 3;  1YEW A;  4R9D A;  4U2A A;  5T3N A;  1W8T A;  2JD9 A;  4DB5 A;  5G05 L;  3GGL A;  1J84 A;  4B4P A;  4BQY A;  2GN3 A;  1PIV 3;  2DVF A;  2EF6 A;  1J1T A;  2Q0A A;  1APN A;  2ZKL A;  2DDU A;  4O65 A;  4Q4X 1;  3SNM A;  3WQ7 A;  2ZZJ A;  3O1T A;  1HX6 A;  3ON7 A;  5GAL A;  3USS A;  3ZLI A;  5A3M A;  1DYP A;  4C1W A;  3MHZ A;  4CP9 A;  2QE3 A;  1RGS A;  1XU1 A;  3MLJ A;  4AR2 A;  3ACH A;  3VD3 A;  4V1P A;  3ZYB A;  2JKX A;  2P17 A;  3FUQ A;  4RR3 A;  3BTY A;  2RMU 1;  2XKP A;  2BJS A;  2XON A;  3GNE A;  5J98 B;  4AQT A;  2C26 A;  3I2I A;  3AP5 A;  4LHL A;  5GZD A;  1J3Q A;  2UYA A;  1KJR A;  2GC2 A;  2OII A;  3D8C A;  4FTB A;  1QJU 3;  5FIX A;  3V0A A;  4I3P A;  2QQO A;  4CCO A;  1QKQ A;  2OUH A;  3B7M A;  5A7W B;  5C71 A;  3MIF A;  5IW0 A;  1QJX 2;  1P8J A;  4RHV 2;  2WZE A;  4HK8 A;  4Q4X 3;  1G7Y A;  2F4P A;  4XF4 A;  3RZH A;  1O5U A;  2ZMN A;  4JKL A;  4XHX A;  4AE2 A;  4NRQ A;  4XXA A;  4L97 A;  1LRH A;  2KXL A;  2VW1 A;  1ODM A;  2WWJ A;  4YG0 A;  1K45 A;  5E16 A;  4QX7 A;  1BHG A;  4XUQ A;  1RIN A;  3KMH A;  2C9A A;  5L9V A;  2BVB A;  1VB2 A;  3K4D A;  4UXA A;  2IXI A;  4EN6 B;  1ULG A;  5L36 A;  1H1I A;  5LBC A;  2ZGO A;  1V6J A;  2WRA A;  5FPA A;  4LJH A;  5DN2 A;  3HNY M;  3X29 B;  2UWB A;  5FKC A;  5A32 B;  5FWE A;  1QOS A;  5FZH A;  5ACA 1;  5FUI A;  2OQ6 A;  2R30 A;  1ZX5 A;  3LEK A;  4FPF A;  3VD7 A;  4M00 A;  1FV2 A;  3VLB B;  2R06 3;  1OKQ A;  1QOO A;  2YU1 A;  1S0G A;  2K46 A;  4MV2 A;  1D0H A;  3WCS A;  4GAZ A;  4BZ4 A;  5A3U A;  3O1R A;  3I2O A;  2CGP A;  4QQL A;  3HQX A;  3HJR A;  2W9X A;  3GJA A;  1W28 A;  1WD3 A;  3RFR A;  2VQ0 A;  1AX0 A;  2W46 A;  1WMF A;  5AFE A;  5DPN A;  1V9U 1;  4B4Q A;  4KBB A;  4M3C B;  1YC6 1;  1OD3 A;  2XLG A;  5FYS A;  5KBF A;  3DPR C;  2P5B A;  2YY1 A;  3C3V A;  3NO8 A;  4H2A A;  4XJ9 A;  1K42 A;  1AYN 1;  2XVK A;  4LLO A;  1Y7B A;  1VLN A;  1COV 2;  4LE3 A;  1GFF 2;  3HD8 B;  4AI0 A;  5JZG C;  4NHX A;  3LFM A;  4AAX A;  2QDN A;  3AP4 A;  4MXW B;  3KV5 A;  3OGJ A;  4CUG A;  3KQ4 B;  3H1M A;  2YMZ A;  1BBT 1;  2BNM A;  5A7W A;  5FYI A;  4HK9 A;  4S2H A;  4ATF A;  3J7N A;  4QPG C;  5A6Z A;  3DPR B;  1PGL 2;  4DPN A;  1W8Z A;  3ITQ A;  3N7L A;  3OGR A;  1GP5 A;  2VME A;  2XJT A;  2ZMK A;  3TAY A;  3VD5 A;  1Q8O A;  1SHW B;  1YHF A;  1HN1 A;  4ASK A;  3P3N A;  3ZIX A;  1S4C A;  5JZG B;  1AR6 2;  4IW3 A;  2Q8E A;  1MZE A;  3VDC A;  4CCE A;  3WEZ A;  3IB3 A;  3B3Q E;  4LXL A;  2XJQ A;  2XQR A;  3ZYF A;  1C8M 2;  4RL7 A;  2GND A;  4JC1 A;  4CCM A;  5FLI A;  4DRV A;  2OUJ A;  1ENS A;  5I91 A;  1W9S A;  2GNM A;  2WT0 A;  1W8N A;  1BXH A;  2JJ6 A;  1AR9 3;  3LSE A;  3W20 A;  1SLT A;  1K5J A;  2EIB A;  3M3Q A;  3OF1 A;  4FPO B;  4MET A;  2VR4 A;  4QPG B;  3RI8 A;  4TTG A;  2Y6L A;  2XHK A;  4HL0 A;  1GQG A;  4JZR A;  3ZFG C;  5CVR A;  1WBL A;  2W92 A;  2Y0I A;  3MUY 1;  4AFD A;  2CHH A;  1IS3 A;  2OT7 A;  1ULO A;  4V2W A;  1SCS A;  1VBA 2;  2B39 A;  1AYM 1;  1LHU A;  1SFY A;  4BQW A;  2BYV E;  2O8Q A;  5FY8 A;  5I8T A;  4CP2 A;  4CUC A;  2ET7 A;  2BBV A;  1PMH X;  4XJA A;  4M3C A;  2DU0 A;  1TNR A;  5FMB A;  2WR9 A;  1SDD B;  4NHL A;  4YWA A;  1RUJ 1;  2YXS A;  4P08 A;  4A6S A;  3T0B A;  3SIT A;  4FBF A;  1Q3E A;  4K3U A;  1G8W A;  1S0D A;  1Z78 A;  2ZS6 B;  4GUL A;  4OVE A;  4XF1 A;  1TMF 2;  1L7L A;  2B46 X;  1VRH 1;  1VBC 2;  4LBN A;  5FUN A;  5FQ0 B;  2VMH A;  3HEI A;  1HB1 A;  4R9A A;  3MPB A;  2I45 A;  5T5P A;  1ULP A;  1WCK A;  1DU3 D;  1ALY A;  3QH7 A;  2VZT A;  3CJI C;  4RYD A;  1XRU A;  3LEG A;  1DQ6 A;  4URT A;  3DPR A;  3ILR A;  1STM A;  2HWD 1;  3VHN A;  1VIW B;  1W6N B;  1W04 A;  2DVA A;  1UZV A;  4CPB A;  1RUJ 3;  5JZG A;  1XB9 A;  3OGV A;  1O3T A;  3QLQ A;  3O5S A;  2ZHK A;  4XYX A;  4CXY A;  1D2S A;  1J83 A;  2YUE A;  1DP0 A;  3JD7 1;  1PO1 2;  1QJE A;  1NX9 A;  3SC7 X;  4IE5 A;  3W9A A;  1JZ3 A;  1A3K A;  1LOD A;  3AMM A;  4CDW C;  3CJI B;  1DGR N;  1MQT C;  4QAW A;  3N9P A;  5CIR A;  1QY4 A;  1ZBA 1;  5EYX A;  3WF2 A;  1MPX A;  4QPG A;  2VAU A;  5A1A A;  2QQN A;  3AM2 A;  1VBB 1;  5KHI A;  1G9D A;  1ZRC A;  1ULC A;  4QX1 A;  5A6X A;  3ZXA C;  2HWD 3;  4LR4 A;  5FAX A;  4LKF A;  3VZN A;  3OBT A;  2ARC A;  4XJ8 A;  5KC6 A;  1KD7 A;  4Q4Y 3;  2EVX A;  5CZK A;  5H9R A;  1JOJ A;  1XE0 A;  3WR0 A;  4ZU7 A;  4IEZ A;  1PGW 2;  4CDW B;  5FZ3 A;  5FZ8 A;  2HBT A;  3WDU A;  1MQT B;  4Y1V A;  4K21 A;  3QD6 A;  3THT A;  1DG6 A;  3CF6 E;  3NJY A;  5FPU A;  1AR7 2;  2ADE A;  3Q8E A;  2WT2 A;  3JD7 3;  4XUN A;  1X8M A;  3AB0 A;  5C33 A;  3POS A;  2IFW A;  3DUI A;  1ZBA 3;  3IIA A;  4JHT A;  4JTN A;  4NO4 A;  3VBU C;  3ZFG A;  4QM9 A;  2ENR A;  4XJU A;  1CIW A;  3WUC A;  4COW A;  5FQ0 A;  3NNJ A;  2YGM A;  3RVH A;  2XLA A;  5JOW A;  1VBB 3;  5LAT A;  1H9P A;  2ZGK A;  2EA7 A;  5FYH A;  3I3Q A;  5F1R A;  2QQI A;  3J9S A;  4WM8 B;  1DQ1 A;  3HR9 A;  3PHM A;  5FYC A;  3ZXK A;  3K77 A;  1QXP A;  4MVT A;  4TZD A;  3ALQ A;  3KVB A;  1U0A A;  1QMJ A;  1KEX A;  1W6N A;  2RS5 1;  4FPL A;  5C8C C;  1GNY A;  2XVG A;  1EUU A;  5DUU A;  4ATE A;  3USU B;  1YJK A;  3VBU B;  3ROU A;  4F7Z A;  2P4E A;  2P3K A;  1MS5 A;  1AR8 1;  1ZZ6 A;  3ZYJ B;  1SDW A;  2OVU A;  2R7E B;  2G9Z A;  1AVB A;  5GM0 A;  4D94 A;  5A7Q A;  5C4W C;  4P14 A;  2HWB 1;  4NUB A;  3S5Q A;  2XR4 A;  2ZKN A;  3CJI A;  4M0H A;  2ZAA A;  4OCT A;  3UES A;  3BPZ A;  4Y3O A;  1QJY 1;  2EIC A;  3HNB M;  3ACI A;  2WZP P;  3RZL A;  3TNQ A;  4HN1 A;  1F8V A;  5FZ6 A;  4X6Q B;  2WLP A;  4PLN A;  4Q4V 2;  1W2O A;  1H8T C;  2EXI A;  4LBM A;  4C1X A;  1LHN A;  4CCJ A;  4ZHN A;  3AJY A;  3PU3 A;  5C8C B;  2RDS A;  5FOJ B;  2A6W A;  3I97 A;  1HRI 1;  1PIV 2;  4FPC A;  5AC9 1;  1NY7 1;  1IKQ A;  2FBE A;  1VMH A;  4XFI A;  4XUT A;  4OHZ A;  2RS5 3;  4XAC A;  1QEX A;  5DZF A;  1RXF A;  5C4W B;  4YVW C;  1VAL A;  4XAE A;  4EN9 B;  3BTZ A;  3FHI B;  1LU2 A;  3SCH A;  3WDX A;  3ZSL A;  4BE3 A;  1QDO A;  1RB8 G;  1XNB A;  3CKH A;  4CDW A;  2ARE A;  2NLR A;  5GZC A;  1MQT A;  4YZ3 A;  1AR8 3;  4I2O A;  3B00 A;  3UT0 A;  1W06 A;  3BU7 A;  1XPW A;  2DUP A;  2HWB 3;  1KIT A;  2JB4 A;  3RYR A;  4COU A;  1GP4 A;  4ZY9 A;  1O4T A;  1H8T B;  4K1Z A;  3NL1 A;  2WNU C;  4ZU4 A;  4QDQ A;  1QJU 2;  1RUD 1;  2WAO A;  1RUC 3;  4BU2 A;  4QPY A;  5KR7 A;  2XL9 A;  3UNP A;  1JH5 A;  1Q8P A;  2Q5T A;  3ES1 A;  4F3J A;  2CAU A;  1YXW A;  1KXG A;  2XJS A;  3HN1 A;  4P02 B;  4YVW B;  4F83 A;  1AF9 A;  3NW4 A;  5LA2 A;  1HRI 3;  4Q0P A;  3O14 A;  5AC9 3;  1ENQ A;  2GC3 A;  4Q4X 2;  2ZBJ A;  4IDZ A;  4ARY A;  1W6M A;  4C90 A;  4BM8 A;  3MLK A;  3KV9 A;  4AHW A;  5DAX A;  3ACG A;  2MEV 1;  3K46 A;  3O0X A;  1JYN A;  1UKG A;  2P37 A;  4QWN A;  5H9P A;  3H8R A;  3A21 A;  4AVA A;  2Y6G A;  3USU A;  3THP A;  3VBU A;  2WZ8 A;  1VB4 A;  3BVC A;  4CXW A;  1SLI A;  3HMY A;  3H3U A;  1OPM A;  1RUD 3;  2PHX A;  3GZE A;  4XZP A;  3ZXF A;  2ARA A;  1FOD 1;  4MGZ E;  4E4Z A;  1NUK A;  1O8P A;  3R6S A;  4X8N A;  3T0D A;  4ISQ A;  4W8J A;  2ZEW A;  3PNA A;  1Y4W A;  1UF2 C;  1LED A;  1NAE A;  3BTA A;  5A7S A;  1I3H A;  5H9Q A;  2R06 2;  2ZJC A;  1GWK A;  3WW1 A;  2A71 A;  5C8C A;  3FHA A;  4GJZ A;  2WJS A;  2HWE 1;  4MLO A;  1Y43 B;  2MEV 3;  4JQR A;  4OUE A;  4YG3 A;  4J25 A;  2OW4 A;  3AKP A;  1YQ6 A;  5CKM A;  2VMI A;  5C4W A;  1LB2 A;  3BI3 A;  2OYZ A;  2OPK A;  4XUR A;  4OQ8 A;  3WNK A;  3E97 A;  1C8N A;  4UFM A;  4CP1 A;  1C5I A;  2W1Q A;  4OI1 A;  3VHP A;  4AXO A;  3RZK A;  2BPA 2;  1A8M A;  1FOD 3;  1H8T A;  1W9F A;  1XC6 A;  1E5R A;  2VMD A;  1WUV A;  3VDA A;  4UYB A;  2FMD A;  1Y3T A;  3KCX A;  2FCT A;  3OUI A;  2AGS A;  3LGR A;  2BV4 A;  2ZCW A;  2EXJ A;  2AEY A;  3VKM A;  3NJV A;  4YVW A;  5J96 B;  3PIJ A;  1O5L A;  1WKY A;  1RMU 1;  5F2W A;  2HWE 3;  1UOF A;  4YFZ A;  4W50 A;  2ZGR A;  1UX7 A;  3NQH A;  4LBQ A;  3H3L A;  3M3O A;  4EWA A;  1G86 A;  2VZS A;  1ND3 B;  1LHV A;  1W8W A;  1OLR A;  1CX4 A;  2LUW A;  2RS1 1;  2BGO A;  2WNU A;  2BER A;  2YC2 A;  4CEY C;  2BUK A;  3BOD A;  1CZS A;  2ZAC A;  3P1I A;  1NA1 C;  1B35 B;  1SZB A;  1GLH A;  4MAD A;  4NE9 A;  4NIA A;  4LTA A;  1I9R A;  5HBA A;  5FYY A;  1AR9 2;  2YBK A;  1LEN A;  5A1F A;  4QB1 A;  3M3I A;  4CDQ C;  2G4I A;  3LDK A;  4IEX A;  4IE4 A;  3JU9 A;  5CNA A;  2W08 A;  4S2F A;  3UL2 A;  4L11 A;  4DNY A;  3RPQ A;  2CDP A;  4N7U A;  3EHK A;  1RMU 3;  4Y4R A;  4Q5O A;  3PUA A;  1KDM A;  4G4F A;  5HXM A;  3N9Q A;  1D0G A;  3N7J A;  3PVE A;  4CEY B;  1HIX A;  2EID A;  4XOG A;  4CPB D;  2ZEX A;  1NA1 B;  2VOV A;  1LEM A;  4A6O A;  5BNQ A;  2GP3 A;  2RS1 3;  2AEN A;  4QB2 A;  2R07 3;  1LOC A;  2FDJ A;  3ZXL A;  5BXX A;  1O3R A;  3GDB A;  4FFI A;  4CDQ B;  5DUX A;  2LRO A;  2VZ1 A;  4N8M A;  3VBS C;  2PHL A;  1X9P A;  1XYN A;  2Z69 A;  4BIO A;  1PO2 1;  5F8P A;  4FXK B;  4OFG A;  1IS5 A;  2YPJ A;  1MZF A;  4CDX C;  5M0T A;  3A4U A;  1UY3 A;  1IG0 A;  4XFB A;  3A0K A;  1A78 A;  4XF3 A;  2QZ2 A;  3TN9 3;  3N9L A;  1SEF A;  2WL1 A;  4FVV A;  1S0I A;  1TE1 B;  4SBV A;  3CNA A;  5JI7 A;  4AZZ A;  5LY1 A;  1CVN A;  1WW7 A;  1GQP A;  2D7F A;  4JRL A;  5FYB A;  5FY7 A;  5L9R A;  3VKO A;  1RUJ 2;  3AMP A;  3KGL A;  2GNT A;  1MR5 A;  3HT1 A;  1C8M 1;  5DAV A;  5KHK A;  2WAB A;  1H2N A;  2AZ5 A;  2Y0O A;  4LBO A;  4CDX B;  5EXO A;  2GAL A;  1WCU A;  3KHC A;  1EUT A;  5F5Q A;  1PO2 3;  3T2T A;  4XAA A;  1JMU B;  1CGP A;  5FLH A;  1BLZ A;  4ZKT B;  3FZ3 A;  1HV0 A;  2GAU A;  1Q8S A;  2AUY A;  1TQ5 A;  2TUN A;  4NPL A;  1X36 A;  1X7N A;  1UXZ A;  3NNG A;  3HOB A;  3IDB B;  3MIE A;  1E5H A;  3QCW A;  3RJR A;  3T1M A;  4A3Z A;  4A3X A;  3TOJ A;  4E8C A;  2QQP A;  1DGW X;  2RVA A;  4AEK A;  1R1A 3;  2D5H A;  4ORF A;  2GH2 A;  2WO7 A;  5LBB A;  3KLS A;  3RG0 A;  4CEY A;  3MYX A;  3DYP A;  5FXV A;  1NA1 A;  2PTM A;  4Q4Y 2;  1DZR A;  3THC A;  4COY A;  2ZX0 A;  1F35 A;  2BFU S;  1DQ5 A;  4ES8 A;  2J1A A;  2PHD A;  4COZ A;  4JRA A;  5JPM B;  4BDV B;  3ZDS A;  2BWC A;  2ERF A;  1ULD A;  4Y33 A;  4CDQ A;  2X53 S;  3VDB A;  1NOV A;  3JD7 2;  5FY1 A;  1NT0 A;  1UMI A;  3IMN A;  2Y6K A;  4QD2 A;  4FTE A;  4MX3 A;  3CIH A;  5C5U A;  1TMF 1;  3U78 A;  1S0C A;  1ZBA 2;  4QKN A;  1LHW A;  2Q8D A;  5FUP A;  5JXI A;  2SLI A;  4XTP A;  1WBF A;  1VBB 2;  3ZYH A;  5C5T A;  1HXS 3;  2WWS A;  2KM2 A;  3CHX A;  3P6B A;  4JVA A;  1Y9M A;  4OHW A;  3WNN A;  1VBE 1;  5T52 A;  4W4Z A;  4FP2 A;  1CQ9 A;  3CEW A;  5JXG A;  1UU6 A;  2AYH A;  2O8O A;  4GAL A;  1GBG A;  2D3P A;  2KD7 A;  2XGX A;  3CLP A;  3K48 A;  2WA4 A;  4IEY A;  3VBS A;  1SBD A;  2HBU A;  1PVX A;  1XSQ A;  3R4D B;  5IVJ A;  1JXN A;  3I2J A;  4JGZ C;  3QH6 A;  4TN7 A;  1SLL A;  2WYS A;  2KR2 A;  3GYD A;  2J42 A;  3LE0 A;  3NV2 A;  4CCC A;  4EWE A;  5JSR A;  5C9A C;  1VP6 A;  4CUB A;  1TMF 3;  4CDX A;  4L9B A;  1Z7S 1;  2HWF 1;  4PIX A;  3WG4 A;  2D6N A;  2PEL A;  2LTN A;  4QDR A;  3OOX A;  5LBF A;  1M06 G;  2VW2 A;  3B01 A;  4JDM A;  2HEY F;  3LDB A;  5FPL A;  5IUQ A;  1WGP A;  4BJ0 A;  5FDB A;  2BOI A;  3PUR A;  2PXJ A;  4Q8L A;  1QJF A;  5JXJ A;  1VBE 3;  3AMQ A;  1GKB A;  3ABZ A;  1W8F A;  2JDU A;  5JOY A;  1S0F A;  4GQ7 A;  1A6C A;  4UW5 A;  1YYN A;  4H3W A;  2RS5 2;  3VBF C;  3MGU A;  5C9A B;  3ZXD A;  2MNG A;  1PGW 1;  2B4K A;  4YNI A;  4MGQ A;  3RYK A;  2AAC A;  3WZ1 A;  1UXX X;  1X8E A;  4E2Q A;  1AR7 1;  3WSO A;  1AR8 2;  2EXH A;  4HPK B;  4KG8 A;  3R05 A;  1I1E A;  3U14 A;  3ACF A;  2HWB 2;  1DZT A;  1Z7S 3;  2HWF 3;  2GH8 A;  5A32 A;  3VN4 A;  2JDZ A;  2DBN A;  2P2K A;  2UYB A;  2ZGT A;  3MDP A;  2VTF A;  4FAH A;  1RUC 2;  2Z79 A;  3AK0 A;  3OBR A;  4GKX A;  3O1O A;  3CO2 A;  3WP4 A;  1JW6 A;  3VBF B;  3I49 A;  1HJF A;  1GV9 A;  2E33 A;  5IYY A;  3KD4 A;  4QQH A;  2DCZ A;  2RG4 A;  5AC9 2;  2F17 A;  1US3 A;  1DYO A;  4XJZ A;  4CZS A;  3RQ0 A;  3AXE A;  2VQA A;  5KC5 A;  3GF6 A;  2XL7 A;  1Z0H A;  1HB3 A;  2E6V A;  1MAC A;  3CZJ A;  4RR3 B;  5FR3 A;  4KGG A;  1RUO A;  1AR7 3;  1FAT A;  3T1L A;  5HV4 A;  4ZZ8 A;  1D4V B;  2ADD A;  4N7I A;  1U5Y A;  1XYP A;  4Q0Q A;  4FPE A;  1DLC A;  4ZXK A;  4NOT A;  2PN5 A;  4WVM A;  4AEM A;  3E1F 1;  4QX3 A;  3V65 A;  1WME A;  5J3U A;  3N35 A;  4QXK A;  5A1L A;  3SH5 A;  2BP6 A;  1N1Y A;  2OQ7 A;  3PIG A;  5T55 A;  3VL8 A;  1UPI A;  2W2I A;  4IES A;  1EPZ A;  1GOH A;  3WNO A;  1OUS A;  3DKW A;  4BMB A;  3WDW A;  5LEJ A;  3B9I A;  3VDD C;  4AK3 A;  4XIK A;  1JUI A;  3CQO A;  4JGZ A;  3VKF C;  2QQJ A;  4LHK A;  5FLJ A;  1SAC A;  2BWA A;  3AZY A;  3I59 B;  4YM3 A;  5IAX A;  5C9A A;  2YG0 A;  1KJL A;  3POJ A;  4QGN A;  2BRT A;  3PUQ A;  4QU2 A;  3RGB A;  3S30 A;  4IE6 A;  2Z5W A;  3PJQ A;  3APB A;  5FZ1 A;  1QHD A;  1W9W A;  3V0A B;  1OBN A;  1HLC A;  2BVV A;  4CRQ A;  1PVC 3;  5T50 A;  3DYO A;  4AI8 A;  3WUD A;  3TEW A;  1GSL A;  1BKZ A;  5CU1 A;  1FOD 2;  1ULF A;  4YPJ A;  4DRR A;  2WNV C;  2C0Z A;  3AVR A;  1F4A A;  1AXK A;  1OVS A;  5APA A;  2VPV A;  3VBF A;  3BIW E;  1QQP 1;  1LCL A;  2QZ3 A;  2XLF A;  2ARX A;  3FE5 A;  4NPR A;  4DO0 A;  5C3Q A;  5FO9 B;  3L2Y A;  2HWE 2;  3LCP A;  4L2N A;  3VV1 A;  1L3J A;  3FHQ A;  1WD4 A;  4IER A;  3ZYP A;  2W94 A;  5FZC A;  3RRD A;  3ZSE A;  2X5I A;  4BQ5 A;  4JTO A;  2B7Y A;  4N90 A;  4UFJ A;  5LY2 A;  4DS0 A;  3MIB A;  3VD4 A;  1G9A A;  1RUI 1;  1YJL A;  2WNV B;  2W1W A;  2XBO 1;  2WO2 A;  2W5F A;  3CMG A;  3AKT A;  4HKO A;  1BZW A;  1LGC A;  5L9B A;  5JOX A;  2HJI A;  5IWF A;  3LIG A;  1RUF 1;  3J7M A;  5JWP A;  1CZT A;  5JVV A;  1H0B A;  4MSV A;  4R9C A;  3PL0 A;  1C28 A;  2BZD A;  4CCD A;  3U0Z A;  2ORX A;  1Q8Q A;  3IKW A;  2R06 1;  3VHR A;  1QQP 3;  4PF1 A;  1W0P A;  1ZZ8 A;  1DLL A;  2JEN A;  2E63 A;  3PJY A;  1RMU 2;  4Y26 A;  3IT8 A;  1UY0 A;  3C8X A;  3F95 A;  4RGG A;  2VMF A;  3OD4 A;  5DAB A;  1JZ6 A;  1JYT A;  4L0P A;  3I59 A;  3B02 A;  3B9C A;  3OTF A;  4YW1 A;  3N36 A;  3WF4 A;  2K9Z A;  1RUI 3;  2RS1 2;  3VZM A;  2A70 A;  2R07 2;  5FXX A;  5GZG A;  2XBO 3;  2RV9 A;  4D6Q A;  2HEW F;  2DYC A;  4E2S A;  1RUF 3;  1J3R A;  3D0J A;  1L7R A;  1ZRF A;  3K3N A;  4H55 A;  5DUW A;  2PHW A;  3RJ2 X;  3SQO A;  2WA3 A;  5FZ0 A;  5LA0 A;  3VDD A;  5LZ6 A;  1QXR A;  2RR1 1;  2NN8 A;  3AYC A;  4TLF A;  5LB6 A;  1ENR A;  2CWM A; 
#chains in the Genus database with same CATH homology
 3K2O A;  4DIQ A;  2GP5 A;  2XML A;  5A3T A;  3RVH A;  4UF0 A;  4AI9 A;  1VRB A;  5F32 A;  4ASK A;  5ANQ A;  4XDP A;  4HOO A;  5A1L A;  5FYH A;  2Q8E A;  5IVF A;  5FXV A;  5IVB A;  2OQ7 A;  5A7O A;  4LXL A;  3KV6 A;  4LIV A;  2W2I A;  5FYC A;  5F3I A;  4CCM A;  4EZH A;  3KVB A;  5A3P A;  2YBS A;  2WWU A;  4GD4 A;  3PUS A;  4Y33 A;  4D6R A;  5FZO A;  5FY1 A;  5FPV A;  5A3N A;  3ZLI A;  3DXU A;  5FY5 A;  4QXH A;  4BXF A;  5F2W A;  3OPW A;  3U78 A;  4EZ4 A;  3PUQ A;  5FZL A;  5FJH A;  2Q8D A;  5FUP A;  5A7Q A;  4CCN A;  5FZ1 A;  4NUB A;  4HON A;  5F3E A;  2OT7 A;  4V2W A;  4IGQ A;  4IGO A;  5FYM A;  3K3O A;  4D6S A;  4Y3O A;  5K4L A;  2YU2 A;  5FY8 A;  5FP7 A;  5FZ6 A;  5FZG A;  4CCJ A;  3PU3 A;  5F5A A;  3PTR B;  4CCO A;  5F3C A;  3AVR A;  5F37 A;  5A7W B;  5IW0 A;  3AVS A;  5F39 A;  3PDQ A;  5FYY A;  2YBK A;  5A1F A;  5IVJ A;  5LW9 A;  4TN7 A;  4DO0 A;  5FXZ A;  3N9O A;  5F2S A;  4EYU A;  5FUN A;  4Y4R A;  4CCK A;  3PU8 A;  4UF0 B;  3PUA A;  2OS2 A;  2OX0 A;  5FZ9 A;  5FZI A;  4BIS A;  5FYU A;  5FZC A;  4E4H A;  3N9Q A;  4LIT A;  2WWJ A;  3U4S A;  5A80 A;  4LIU A;  4QX7 A;  5FZA A;  5LY2 A;  4QXB A;  5FY0 A;  5FZD A;  5F5I A;  3LDB A;  5FPL A;  3KV4 A;  2GP3 A;  5A7P A;  3AL6 A;  5FP9 A;  3PUR A;  4BU2 A;  2PXJ A;  5FBJ A;  5KR7 A;  4QX8 A;  5FPA A;  5FY9 A;  5FYV A;  5IWF A;  5FZE A;  5FWJ A;  3N9N A;  5FWE A;  4QU1 A;  5FZH A;  2Q8C A;  2OQ6 A;  5FZM A;  3N9M A;  5FJK A;  5FZF A;  2XUE A;  3KVA A;  2YU1 A;  2XDV A;  3KV9 A;  4GAZ A;  5IVY A;  3ZPO A;  5IVE A;  3OPT A;  3N9P A;  4QWN A;  5FP3 A;  3AL5 A;  5FYZ A;  3LD8 A;  4AAP A;  5IVV A;  5ISL A;  2XXZ A;  2YPD A;  3UYJ A;  5FYS A;  4CCL A;  4URA A;  5FYT A;  4QXC A;  2P5B A;  5FXW A;  5FXX A;  3N9L A;  5FP8 A;  5LY1 A;  4D6Q A;  5A3W A;  5F5C A;  4XDO A;  5FZ4 A;  5F3G A;  5FYB A;  5E6H A;  5FY7 A;  5FP4 A;  5FZ7 A;  5FZO B;  3DXT A;  3K3N A;  4V2V A;  3KV5 A;  5FZB A;  5A7S A;  5CEH A;  4CUG A;  5FZ0 A;  5IVC A;  5FZ3 A;  5FZ8 A;  5FV3 A;  2YBP A;  4CSW A;  5FZK A;  5LWB A;  4GJZ A;  5A7W A;  3NJY A;  5FPU A;  5FPB A;  5A7N A;  4C8D A;  5FY4 A;  4IGP A;  2VD7 A;  5FYI A;  4GJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...