5FZOA

Crystal structure of the catalytic domain of human jmjd1c
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
343
structure length
338
Chain Sequence
b'MIPHSWICEKHILWLKDYKNSSNWKLFKECWKQGQPAVVSGVHKKMNISLWKAESISLDFGDHQADLLNCKDSIISNANVKEFWDGFEEVSKRQKETVVLKLKDWPSGEDFKTMMPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROBABLE JMJC DOMAIN-CONTAINING HISTONE DEMETHYLATION PROT E
publication title Crystal Structure of the Catalytic Domain of Human Jmjd1C
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 99
structure length 338
sequence length 343
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fzoA01
4V2WA 2XMLA 4QXHA 4Y4RA 4IGQA 4CCLA 5FY4A 2OX0A 2OT7A 5FV3A 3KVBA 2W2IA 4QXCA 4CSWA 5KR7A 5F3IA 5FXZA 3N9NA 2WWJA 5FY9A 4QX7A 4Y3OA 5FZGA 2XUEA 3OPTA 5FZ8A 5FY8A 4DO0A 5A3TA 5FPBA 3K3NA 4V2VA 3U4SA 5FZCA 4ASKA 5IW0A 4GD4A 5FWEA 5FZ3A 3LD8A 5FP4A 5F39A 5F37A 3PUSA 1VRBA 4LITA 3N9LA 5A1LA 2YU1A 5FZOB 5FZEA 5FZOA 4CUGA 5FWJA 3PTRB 5FYVA 2Q8EA 5FP8A 5FXVA 5IVYA 5LWBA 5FZ9A 3OPWA 2OQ7A 2XDVA 4CCMA 4NUBA 2OS2A 4D6QA 5K4LA 5FYTA 2YBSA 5FXXA 5E6HA 3N9MA 5FZKA 3KVAA 5ISLA 5LY2A 3PUQA 4GAZA 2YBPA 5FZHA 5FXWA 5A80A 4AI9A 3KV5A 4GJZA 4TN7A 4C8DA 5IWFA 4QWNA 5FZ7A 5FZ6A 2Q8CA 4QXBA 2OQ6A 5FYBA 5FPLA 5IVJA 5FYMA 5F3EA 2YPDA 5F5AA 5F5IA 5A7SA 5ANQA 5FZBA 4D6RA 5IVFA 2Q8DA 5FZIA 5A3PA 5FY5A 5A3WA 5CEHA 5FYUA 5A7PA 3ZLIA 5A7OA 4DIQA 3AL6A 3N9OA 5FJHA 3PDQA 5FJKA 3DXUA 5FZ1A 4Y33A 4LXLA 5FYSA 3AL5A 2YU2A 2PXJA 4CCKA 3U78A 2P5BA 5FZMA 5FZ4A 4BU2A 4EZHA 3PU3A 3PURA 4LIUA 5F3GA 5FUPA 5FY0A 5FZLA 4IGOA 4QX8A 2GP5A 4HOOA 5A3NA 5FPAA 5FZAA 4GJYA 5F3CA 4URAA 4D6SA 4XDPA 2XXZA 3AVRA 4AAPA 5LW9A 3N9QA 5FYIA 4BISA 5FYYA 5F5CA 3PUAA 3KV9A 4QU1A 5FY1A 4CCNA 4UF0B 3ZPOA 4UF0A 3DXTA 4BXFA 5LY1A 4IGPA 3LDBA 3PU8A 5FBJA 5IVEA 5FPUA 5IVCA 4CCJA 5FPVA 2VD7A 4E4HA 4HONA 3K2OA 3NJYA 5FYHA 4XDOA 4LIVA 4EYUA 5IVVA 2WWUA 3AVSA 5FZ0A 4EZ4A 5IVBA 5A7WB 3KV6A 3KV4A 5FP7A 5FYCA 5A7WA 5F2SA 5F32A 2YBKA 3UYJA 4CCOA 5FUNA 3RVHA 5FY7A 2GP3A 5FP9A 5FZFA 5A1FA 5FP3A 5F2WA 5A7QA 3K3OA 3N9PA 5A7NA 5FZDA 5FYZA
chains in the Genus database with same CATH superfamily
4AR2A 4UI9L 1VBB2 4XHXA 2PA7A 1BEV1 2FCUA 1Z7S1 3BALA 5FRAA 3SMHA 5FY4A 4YFWA 5F8PA 1RTVA 2DCKA 3B94A 3IN9A 2B4KA 1PO22 3SXWA 1FX5A 3VD7A 4KBZA 5FIXA 2XQRA 3K4AA 4HN0A 4CSWA 4YGCA 4AHZA 3UK9A 1QOOA 4X6RB 4XF3A 1H1IA 1JUHA 1DHKB 1NLRA 3MEPA 3ZFFA 3VBUC 5IHRA 5K0UB 2WN3A 1QQP1 2BRTA 1QGLA 5E89A 5FWEA 2VZOA 2PHRA 1KJRA 2IFRA 4UW3A 5GLVA 3AX4A 2JE9A 2DTYA 4CEWA 5FZEA 2QQMA 3GDBA 1Q8SA 3WW4A 3VZOA 4EJRA 1X36A 1D4M1 2FHRA 2JD4A 5FCCA 3E6CC 3VZKA 2RDRA 1EAH1 3ES4A 3O1SA 1S2KA 4AF9A 2W87A 4MXWB 2D93A 4Q4V1 2E6VA 3ZYGA 5DAXA 5A80A 4OHYA 4LNVA 3ACFA 3AB0A 4FQ4A 3ZN5A 4LBLA 4MHUA 4Z2AA 4ZHNA 2Z42A 1WZXA 5JXGA 3T2TA 4I0AA 4C8DA 1XQNA 5A7NA 2VQTA 2J1AA 4Q4X2 4R9BA 4RR3C 4XCBA 2Y8KA 2HBTA 2KA3A 1OVSA 2W46A 2VAUA 1JU4A 1NY71 5FDBA 1UYPA 4GB33 1R081 3BGAA 3MO4A 5FZBA 5CB7A 5T5LA 2PAMA 2ZAHA 2GN3A 1CAUB 3ITQA 4HLTA 4Q4Y2 3T4HB 1SBEA 5EWSA 3VLBB 2VZPA 2Z69A 2A6XA 4XZPA 5JMCA 4MG2A 1POV3 2Y6LA 2IXKA 3AL6A 3N9OA 3AKSA 5KBFA 5AFEA 1CAXB 2MEV1 3ZKUA 3GBWA 1FMD1 2DV9A 3FC0A 4PHZA 2BNNA 1BEV3 3HN3A 1L3JA 5JSPA 1S4CA 1Z7S3 2ZGUA 4Q29A 4AW7A 2NP0A 1AR72 5C9AA 2P5BA 3RZJA 4EWAA 3UT0A 2WNOA 5GZFA 1D0GA 1DYPA 1EPZA 2QQLA 3E6DA 1QKQA 4ZKTB 1DIWA 4YW7A 3O7OA 2JEMA 5FZLA 3FHAA 5GALA 1AX1A 1N47A 1D2QA 2CV6A 3SNMA 5A3UA 1HXS1 1MS0A 2P6CA 1KGYA 1W6NB 2W1UA 3AYDA 4WM8C 3M3QA 4QPIB 1ZZBA 2E7QA 4L8QA 1NG0A 1QQP3 5BNNA 3LA2A 3VBSB 2Y26A 2GH2A 4PT6A 3VDDB 1H6YA 2BFUL 2TBVA 3U0ZA 4B1MA 3LDBA 2WS92 4F3JA 2TEPA 4JKMA 5I93A 1ND3A 5IVEA 2IWGB 2RM21 1XE7A 1U5XA 1D4M3 4XDOA 4LIVA 1RUD2 1EAH3 1DQ2A 2PHXA 3H7JA 4ZONA 5F32A 1Y9QA 4Q4V3 2Z4FA 3I2KA 5A32B 2BP6A 1GU3A 2BTVC 4M3CF 2FDHA 2YGMA 1UO9A 1V70A 3R4DB 2HWD1 5FP3A 5I0TA 1OQ1A 2A6ZA 2DDUA 4INDA 4IXLA 3QLQA 5ACA2 3KLSA 2ZACA 1OA4A 4FFGA 1TME1 2BUKA 2DTWA 3PMEA 2FBEA 1E57A 1R1ZA 3RZKA 3EHKA 4W50A 1DZTA 1L7LA 1MS1A 4ITCA 4W65A 3AZZA 3NNJA 1R083 2D97A 4QXKA 2P4EA 2ZEWA 1O91A 4XF4A 5FXZA 3JB4C 3M70A 5CKMA 1C8NA 4MHRA 3JU9A 2CU5A 3BU0A 5L9VA 3BOWA 4K20A 3ZFFB 3NW4A 1JU3A 5LB6A 1VE0A 5JLVA 5C7GA 2MEV3 3OUHA 1LHWA 1VRBA 2A3YA 1FMD3 4NPRA 5DZEA 2P1BA 4IE6A 5BNOC 1ULEA 4PIXA 2LALA 4EN9B 3B69A 3SHRA 1OC1A 3HN1A 2WJSA 4QKFA 4XUOA 4DRVA 1STMA 2HYKA 2LM3A 2YBSA 4IETA 4LHKA 4OI1A 2DUOA 2WSVA 3N9MA 1RJ8A 1CAWA 4MUVA 1HKDA 1AX2A 4CTEA 1WLWA 3LSDA 2AZ5A 3LAGA 2EIBA 5HV4A 3BUCA 1GFF2 2V4AA 3OCPA 2VC9A 2ZEXA 4QX1A 2ZGKA 4XCAA 4LLOA 5BV6A 1GNYA 2ENRA 4LTAA 4Q8KA 1VAKA 3FUQA 4XJZA 5EIYB 2VE1A 4LORA 3RZZA 2XJQA 1AXYA 2QVSB 2EF6A 3AP6A 2YFZA 5JCTA 2CNAA 2PMWB 2RM23 2ZA9A 3WNLA 3I3BA 1RC6A 1CPNA 3DPRA 3E5QA 1GP6A 5EHDA 3HNYM 5BNQA 1GOGA 2DU1A 1SLIA 5K8SA 2HWD3 4XEZA 2ETEA 3P6BA 3WG3A 1VP6A 3B9IA 2V5DA 4WVWA 1REFA 5JXJA 1TME3 5F7UA 2RMU3 4CCKA 3OTFA 5JR7B 5C9AB 4CCCA 4QAWA 2R072 4QPIC 4LBKA 2ZGRA 3M7AA 3I2OA 4CP1A 4FTBA 1V00A 2DCTA 2GP5A 3VBSC 2PLV1 3WLUA 2XJVA 1G8WA 3JZVA 3AZYA 3NO8A 4XF0A 1NQDA 3AVRA 5EXOA 2VW2A 2VG9A 2GZWA 4O7XA 1UWWA 4XQDA 1OLME 4Q4W1 3WDTA 2JG8C 3M1HA 5BNNB 3WT3A 4P00B 4XDQA 1LOBA 4E2SA 3EMRA 5EYYA 1WBFA 3M3IA 4HK8A 1OD3A 2DCJA 4KBBA 4B7EA 4NO4A 2Y33A 3EO6A 4AI0A 5DQ0A 2D6LX 1ND3B 2YC0A 1LTEA 1BBT2 1GYKA 1OLMA 1X9TA 2GDFA 2VNRA 3OY8A 5A33A 5FPVA 1SFYA 4X6QB 5JUVA 2DFCA 3T08A 1BCXA 5JMOA 2VTXA 1JYCA 2JDPA 2RE9A 3F2ZA 5FZ0A 4CE8A 3FLPA 3I97A 5L9BA 2VMFA 1H9WA 1CQ9A 5LA1A 1OH4A 3PTYA 1UOJA 4BK5A 5A1FA 1HW5A 4FT8A 2DVDA 3BPSA 1G9BA 1IOAA 4ONUA 4IGQA 1WUVA 4CCLA 1ODNA 2DCYA 1G86A 1SLCA 2P3JA 5FK8A 3ASIA 4LHLA 2OT7A 3WY6A 4FBFA 5BNPA 3N4MA 4K21A 4CEYC 2VMDA 1RYYA 2VMHA 4XFIA 3RPQA 2YV8A 1K5JA 2Q4SA 5CKQA 2VVFA 4QM9A 3I3EA 5I0UA 4SBVA 4UFLA 4ISRA 4XTMA 4AWDA 1QU0A 3FUOA 4Q8LA 1LOGA 1B35A 2AYHA 4XC9A 3H1YA 3N9LA 3B7MA 4XQWA 3ZIXA 5F5QA 1PVC2 5EFUA 4BB3A 3PTRB 5FYVA 4AK3A 4J1WA 5H9SA 4K1YA 4P5HA 4GB32 1WW6A 3OBRA 4PIYA 1POQA 2O1QA 4AVCA 1A78A 1Q5OA 1SQ4A 3IMMA 4R9AA 2PLV3 1JYWA 3BB6A 1CAWB 2VU9A 2XKOA 2VBBA 1H2NA 4XFGA 4E2GA 3OD4A 1OFNA 1UNBA 3TN93 4MV2A 2VOTA 4Q4W3 3PJYA 2ZGLA 3EQEA 3LPGA 1EYBA 1WCQA 1FV3A 3AMNA 4Y20A 1CGPA 4TN7A 1BEV2 3MI8A 3ALQA 2E32A 2OUJA 5JSRA 4LEJA 4HL0A 3R05A 4FOWA 1HRI1 5HXMA 5FYBA 1YO8A 4DNYA 5IATA 4A44A 1RMU1 4YVWA 5ANQA 2WNVA 3A7QA 2B45X 3U10A 3U07A 1ENXA 3DPRB 1VBD2 1FOD1 1QH6A 1XNTA 4ZU5A 4DINB 5JSOA 5KHIA 4DIQA 1AR81 2Q1MA 4N90A 4AZZA 2V73A 4COWA 3ZFGA 2ZGTA 2QBXA 5C5UA 3MDPA 4E4SA 2F6BA 2YU2A 4FOVA 3T2PA 4XBQA 4GZ9A 4BH9A 1GKBA 3RJ2X 3ACGA 3BYWA 3S6PA 4BU2A 1D4M2 1IKQA 1JOPA 1XYPA 5ERLA 5LBFA 4YARA 1PGW2 1UD1A 1VLNA 3OEBA 1ZVFA 3DEMA 3T4VA 1K3IA 5FZAA 4Q4V2 4ISQA 4KU8A 1U12A 3I2JA 1ASJ1 5A6YA 1ND3C 3WCRA 2KXLA 1SFNA 3M8LA 3WF0A 3M3EA 4W8JA 1HQLA 1GICA 3AZWA 4JGZC 1RXFA 2JKBA 2W1SA 4YG6A 1RJ7A 3LOIA 1DGLA 2CDPA 3QACA 3V65A 2R16A 5IK4A 2X5IC 3POEA 1JXNA 4RGGA 1QJY1 3OY8B 4WM7A 5A33B 1R082 4N7IA 4UFKA 2JG9C 3RRDA 2C0ZA 2ID4A 4J6GA 2WABA 4HONA 4LBQD 1XXNA 3W20A 4GKYA 1YHFA 4BMBA 1W8ZA 5A70A 3KV4A 2XWBB 5FYCA 1OLQA 5C8WA 2FD8A 2W1QA 2XB6C 5LBBA 2RG4A 4XYXA 4YW2A 4D0QA 1XBFA 3SCGA 3B02A 3JD71 5CG8A 4NIHA 2QQOA 3N9PA 2WIIB 4H7MA 3WNOA 3OBZA 4LKEA 2R7EB 4OFGA 1JYXA 4P9IA 3ES1A 4A6OA 2XWJB 4FP2A 4HG6B 4TZDA 5BNPB 2HLEA 1HRI3 3OOXA 3OB8A 1ONAA 1YIPA 3G6JB 5T5OA 4YM2A 3ZFEA 1JZ8A 1RMU3 2BFUS 2IXIA 2VBDA 3VKOA 1Q8QA 2W39A 4H14A 2GMMA 4QX7A 3VDAA 5FZ8A 4CXYA 1FOD3 4P9LA 3VKFC 3VD3A 3EYPA 4F83A 1ZBE2 2ZABA 1AR83 1O5UA 4IE7A 1DU3D 3U4SA 5C4WA 4A7KA 1AL21 1KXGA 2R30A 5CADA 1ODMA 1AYN1 1AZDA 5KXDA 1B35B 4AYUA 3ZXAC 2F4PA 2J1TA 1RUH1 1ZM1A 3W21A 4CXXA 1UKGA 3DYMA 4G4FA 3NMBA 1V6KA 2GNBA 1C4RA 5FKBA 2WINB 4CCMA 5C5TA 4NIAA 3CU7A 3RYKA 4COZA 3FX3A 1JBCA 1W3XA 3T3YA 4B1LA 1RUE2 1U5YA 4XMAA 3MF9A 4FPKA 4UFIA 1A8DA 3GCXA 5LA9A 3AYAA 1ASJ3 2VCAA 3AJYA 4Q26A 2FZ1A 4DS0A 2IXCA 2UWCA 4QGNA 4IV1B 2VUAA 4M01A 3O0WA 3LE0A 2HJIA 3R4UA 4GJZA 4Y20B 3WDYA 4FAHA 2ZMNA 1DZQA 2RMU2 3T0DA 2BVVA 3OYWA 4BPZA 1QJY3 2WO7A 1V9U1 5FO8B 4A7YA 2BOIA 2OQ6A 1S0BA 5FPZA 1F9KA 4YVWB 2WNVB 1EV11 5FZIA 1X8MA 5A3WA 3HVDA 2VOXA 1J58A 1LEMA 2Y6FA 2UY8A 1UZYA 4RN5A 3ZFGB 3O0XA 3JD73 5TSWA 5FJKA 2YROA 1PX3A 3ZXFA 2QQNA 3KT1A 3KT4A 5CFCC 2RJKA 1F5JA 2FQPA 2I45A 3VHRA 4AAXA 2PXJA 4XF9A 4XXAA 2DVFA 2D3SA 3OUIA 4A45A 1O4ZA 4YW4A 1ZRCA 2D98A 5FZ4A 1LJ7A 3PLQA 1CVNA 4GQ7A 4QB2A 1JOJA 3J26N 1MZEA 1ZREA 1OOPA 2LUWA 2EICA 3Q8AA 2VUDA 2VL4A 5EQUA 4BIOA 5JZGA 2D6KA 2A5ZA 3OBTA 3LF7A 2E7AA 4RFRB 4TSVA 5F1RA 2EIEA 1F5FA 4ZS3A 3H3ZA 1IS6A 3H3LA 3LB9A 3ZR6A 4DXRA 5L7OC 1AYN3 1ALYA 1AVBA 4L0PA 3KGLA 3KHBA 3NAPA 1RUH3 2Z79A 4K40A 2RDQA 5GLZA 2CSGA 4WVVA 4FOQA 4CDWC 4WM7B 1CJPA 1YFUA 5GKAC 2WL1A 4CDXA 3K77A 1W8NA 3T2OA 3J4UH 3C3VA 2XPJA 3J8F1 5IJRA 4MGTA 5HCAA 1O4YA 1NE4A 3PVBB 1W2TA 4KWLA 1Y9MA 2RS12 3WOGA 5IT6A 2BV4A 1UZWA 1BYHA 3AC0A 3G7DA 5J98B 4BM8A 4FPCA 2CYFA 2V72A 1E5HA 1VBC2 1Y3TA 3WG4A 5LRSA 5A7QA 3UESA 2W1WA 4Y22A 4FPFA 5FYZA 3MW2A 2XMLA 3WX5A 3JXSA 2MPFA 3ILRA 1W2NA 2EXHA 4DEQA 1I3HA 3I49A 1SLTA 1UU6A 3ZFEB 1VBA2 1KRIA 4CDQC 4C91A 1L7QA 1U5IA 1EV13 3KM5A 1BZWA 1F31A 3PUIA 4J25A 2VXRA 4HBNA 4JC1A 3TN92 2K46A 5C4WB 3A21A 4CXWA 1ZRFA 4ASKA 2WQZC 1OUXA 4AHXA 1VB2A 3H7YA 1T2XA 1V6LA 1TE1B 4HSJA 1PVXA 4LITA 4ET7A 5JIUA 4AGVA 5FZOA 3BOPA 1DLCA 4FVVA 1YFWA 4EN8B 3FN9A 1ZNPA 4W4ZA 1GMMA 1A8MA 5LWBA 1NCQC 3ST7A 2OQ7A 4IV1C 2R1BA 2JICA 2YG0A 1DGRA 2YXSA 3B00A 3WD5A 1SFPA 5ISLA 2QQPA 4RS5C 3EBRA 4JAAA 3NKTA 4LO5B 4Q0VA 4QMAA 4JKLA 4CPBD 1F8VA 1H6XA 4I01A 4QQPA 5GZDA 3N7MA 1BLZA 2JB4A 4CVUA 2D7FA 5GZCA 3LDKA 4A2UA 1VRH1 3OYWB 4QX3A 1DZRA 5EP9A 1S0FA 3P1IA 4ZS2A 1W2AX 1IZ3A 2JDHA 3AFKA 1J83A 3CHXA 2IC1A 4YGEA 4OHWA 4AVTA 1BMV2 3GBGA 4GH4C 2X10A 5CEHA 2QDRA 1OMIA 4FFIA 1AR91 1GZCA 3ECQA 3VZJA 4QHOA 2RS51 1DFQA 1S0CA 3A0KA 3BTAA 3GCWA 3C8XA 1GWLA 1H8TC 4NRMA 3WF4A 5F6LB 3O1MA 1C8M1 2JECA 2VBPA 3GHNA 1DQ1A 3POBA 4ATEA 4BWOA 5ABJA 3VBOA 2BBAA 4FPEA 2AGSA 1LGNA 1WA4A 4MGZE 5CZKA 5HCHA 2ZKLA 2LS6A 3OBAA 2IUWA 4OYUA 1I1EA 3J9SA 1V6OA 1OOPB 2GC1A 3PHMA 5EPAA 2WAAA 4HOOA 2YDEA 3WW1A 5JZGB 5FPAA 3FHIB 2WO2A 1HJFA 1RHI1 3OGJA 4MH0E 1UXZA 4CDUA 4C1WA 1NAEA 4XBLA 4FP3A 4XBNA 1LOFA 1SLAA 3D82A 4P9XA 5H9PA 1ZA4A 5FYYA 3VB9A 3KV9A 3NAPB 3VD5A 2JXAA 5LZ6A 3PNAA 4OVEA 2ZJCA 1A6CA 1RVF1 4CDXB 4CCJA 2UYBA 4YG3A 4E27A 1K45A 1RMU2 2VD7A 2YHJA 4XIOA 3L2YA 2VZVA 3NV2A 1LAJA 1YQ5A 4XFBA 4KGQA 4DXZA 4RSUA 2O8QA 3WINE 2XL7A 3L2HA 3N7LA 2VQUA 3N3HA 4XILA 1ZRDA 4LBNA 4BQXA 3UYJA 2AREA 2RS32 2ZKNA 3CJIA 4JTOA 3B01A 2W92A 2ARXA 5I91A 4Y22B 3SCFA 2L9LA 4A6SA 4V2WA 3ZN6A 1VRH3 3RYPA 2C4XA 1BJQA 1C5HA 2VZUA 2PELA 3ZXEA 2DVGA 5DG1A 1CWPA 2Y6HA 4JRLA 3HNMA 4YGBA 4YNIA 1W06A 4HFSA 3H42B 3W5NA 4OI2A 3NJZA 1HQWA 2NZ9A 1PK6C 5A3OA 3U11A 1AR93 4V2VA 1MEC1 1QDOA 2RS53 3N7JA 4LR4A 3S7EA 4Y24A 4NPLA 3SKJE 2Q30A 4QKBA 4DQAA 3JBG1 1O3QA 1QMJA 2CAVA 2ZHMA 1QHDA 2HBUA 4D7SA 1Q56A 1C8M3 2J7MA 4N43A 4UW4A 3WNNA 1H9PA 5DXDA 2OA2A 1NA1C 4IEQA 5FZOB 4CEWC 2FCTA 4KQ7A 3I8TA 4LPLA 3RS6A 4YZ3A 4IERA 4KNCA 2VZ1A 3WQ0A 3BVCA 4C0HA 4D69A 2W08A 3AYEA 1OD5A 4NHYA 1J3RA 4IEVA 3DF0A 5FXXA 2DVBA 5E6HA 1RITA 1RHI3 4H7LA 5JDBA 4K9SA 2YBPA 2VH9A 4LO7A 4S2DA 1BVP1 1O7FA 4LJHA 1UMIA 1UU5A 2HKXA 2XG3A 4IEZA 4OULA 4L97A 2P34A 2VOWA 2VVDA 1RVF3 2EXJA 1ZBA1 5DDJ1 3AKPA 4LO8A 3MFAA 5IVJA 1LHOA 4AEDA 1JI6A 1WBLA 1MQTA 2G9ZA 2WT0A 3POIA 5IVFA 3I4IA 4PBOA 3URFA 4ARXA 5B2GB 3WUCA 4HZFA 2XHKA 2Y34A 5FYUA 4IV3C 4DZGA 2XJSA 3IDAA 1W2UA 1YQ8A 1CN1A 2XJPA 4P08A 3AMQA 5FK7A 3S0MA 3D0JA 3JUUA 1OOPC 3CL1A 2ARBA 1GZ9A 5ABJB 1RUJ2 1QJX2 1GP4A 3VBOB 5JZGC 2CGNA 1W9SA 4JV4A 2QDNA 2WO1A 2YC2A 1IS5A 2IVJA 4Q5OA 3UETA 3INAA 1LOEA 3LZZA 3O0VA 4IGOA 1KD7A 1MPXA 1W99A 3THDA 3I3MA 3IDEA 3GJBA 4NPMA 4CDUB 1QH7A 5KC6A 1MEC3 4BLIA 4XHBA 5GLUA 1VMHA 2Q8OA 5C8CC 3I59A 1LR5A 2XKPA 3CDZB 3JBG3 2A75A 2ZEYA 2WLPA 2YY1A 4YVSA 4LUMA 3LOBA 1X7NA 5DN2A 1ZZ6A 3V0AA 5GLTA 1MS9A 3M3CA 1RIRA 1DQ4A 3S7IA 3WQBA 2YC4A 3MIFA 4FTEA 2A73B 4IEOA 3CNAA 1EV12 1US3A 3PVEA 4JGYA 3ATGA 5E88A 4I3GA 3AZVA 3VKMA 5I0RA 3GGLA 1O59A 2BGOA 2ZX1A 4Z92B 3LIHA 3CJIB 3VBRC 1M06G 3CIHA 3CMGA 1K12A 4WZFA 4Q1RA 5FZDA 3BTYA 2VGDA 4Y5TA 4AE2A 3DL3A 3ZN6B 3GJAA 1FATA 3HQXA 2WA4A 1HX6A 2H0BA 4EWEA 1T6BX 1ZBA3 5DDJ3 4Z07A 3ZSLA 1JYNA 1CIYA 4QX2A 4BIFA 5KR7A 1KFUL 1W9WA 3N36A 4LE4A 2XUEA 1HB3A 2B7YA 4BQYA 1MS8A 3ZYIB 5LA2A 2FDFA 4OUEA 4WV8A 2IVIB 4BE3A 3RNSA 5B4XA 1UZ0A 1VAVA 2VJXA 4N43B 2HEVF 2DU0A 2W3JA 2XQXA 4YM1A 3ZDVA 1ENQA 4FPOB 4QT6A 4YM3A 2LTNA 1XSQA 2EIGA 2P3YA 1GLHA 2D6NA 5J37A 2VMCA 5C3SA 1SLLA 4GWNA 3H50A 1RL3A 2VMGA 2ZPXA 2BNOA 3BCWA 3ETPA 1SCRA 3DKWA 4LBJA 2FDJA 3ZYBA 5IYYA 2QQKA 5K0UC 2I07B 4MOAA 5BPXA 5IFPA 1BK0A 1REEA 5CFDA 3IMNA 3RZHA 3THPA 4AI9A 1SHWB 2D6OX 2OYZA 2R0HA 5HCBA 1VIWB 4NIGA 4IL7A 2GALA 5CNAA 3ILNA 2D44A 4BQ2A 2XOMA 4QM8A 1PM7A 1F2NA 1S0DA 2O8OA 2PYTA 2WFF2 4HKLA 5BY5A 1W28A 1OA2A 3MW3A 3WR0A 1QIQA 1WLCA 5JAXA 5JXIA 1FYUA 1ENSA 3MUZ1 4B7KA 4OI4A 3FL7A 5F5IA 4AEDB 1MQTB 5BYNA 3NV3A 2D5FA 4RQPA 1GOHA 1UAIA 4FFFA 5KHGA 2EIDA 4UXAA 3ZOIA 5APAA 1APNA 4XFFA 3IB3A 4FCAA 3NNMA 4HK9A 3N7KA 2YZ4A 4DEVA 4DFSA 5F6KA 1J3PA 3H1MA 4YLZA 4YG0A 3ZXGA 3ZSJA 1QOTA 5A1AA 5L36A 1HXS3 2WZR1 4CPBA 1OF3A 3RMXA 1Y4WA 2HEWF 1MACA 1ZA7A 3DYOA 4LBMA 2J42A 5D2AA 5FZMA 5G04L 2Q0AA 4YWAA 3S30A 2WFPA 5A3NA 4ZZ5A 5CVRA 2HWF2 2WDBA 1O8PA 4P9JA 5DZFA 5EJ3A 1UIKA 4D6SA 5JWPA 4RHV1 1DBNA 1COV1 3I59B 2W52A 3WNPA 3GZEA 3NSTA 4NHMA 1OBNA 3I2FA 2P37A 4CCEA 4FO9A 4YVSB 1VRH2 4S2FA 5FREA 4HPKA 5LY1A 4KWUA 3V0AB 2DBNA 1UYXA 2R041 1LOCA 1NKGA 2ADEA 2DF7A 2NYYA 2VY0A 4PLNA 3CZUA 1RUC2 3OGRA 2D5HA 4JQRA 4JGYB 3ABZA 2ZGMA 4YZ2A 5IVVA 1DP0A 1JUIA 3C2UA 1W90A 2AEYA 3GBFA 5D8AA 3KV6A 1PM4A 4B3NA 1LOAA 2Z5WA 4QX0A 4OI0A 3MIDA 5F2WA 2GC0A 3KMHA 3VDDC 1W04A 5AFBA 3VL9A 1TMF2 5FFOC 3IZOA 2QQJA 4CP9A 4N53A 3RWKX 3BPZA 1SG3A 2W0XA 2XR4A 4QQLA 2C9KA 3USUA 3RMYA 1PNFA 3C7FA 3CKHA 1S2BA 5JPMB 5F3IA 2VQAA 2FDGA 1ULFA 2CDOA 2DURA 4BDVB 5IAXA 4IE4A 4XAAA 5FZCA 3KD4A 5IW0A 3MLJA 1FPN1 3SQOA 4CA9A 5FP4A 5JOWA 5F37A 2XVLA 2AENA 2W95A 3LPFA 2LW8A 5A1LA 4F8AA 2IFWA 1HRV1 2BOJA 4QPGA 4LT5A 5G05L 3MPBA 3MIHA 1ENRA 1UYZA 5E1RA 4D6QA 1W3VA 3ZFFC 3J7MA 3TOJA 4JCKA 1BVVA 5CFDB 2HWC1 3PUQA 3VBHA 2CHHA 2QTWB 1LEDA 4JRAA 4RHV3 2Y6JA 2A71A 5FXWA 1ND2A 1COV3 1ULOA 3KB5A 5GZEA 2SBAA 4CUCA 3K46A 3O1OA 4QKNA 2JDUA 1HLCA 2GC2A 2VXJA 3HAGA 3ON7A 2FDKA 2G9FA 1ZZ7A 2R043 2VVEA 3NQHA 3I7DA 3ZM8A 5JIAA 3JCIA 3C7GA 5SV5A 3HQRA 2QCSB 1QDCA 2XGXA 4CZSA 4EROA 2NM1A 2DVAA 4RQPB 4GWJA 2AH2A 1UPIA 4H55A 2Q8DA 4E2QA 1F15A 1KFXL 4LHNA 3MICA 3C7HA 2XL9A 1MEC2 4I0WB 2G19A 2HWB1 5DAWA 4EQVA 3PDQA 3VZLA 3GYDA 2Q1ZB 3ORJA 5L9RA 1IPSA 3ZO0B 2E26A 3E1F1 1AYM1 1LNSA 4R52A 1Z7S2 4OQ8A 4MGIE 2YUEA 2E53A 2PTMA 2XLAA 3ZDSA 2JKXA 2WO3A 4YFZA 1PGL1 3VZMA 1VAMA 4BISA 3MW4A 1FPN3 3PL0A 5F5CA 5J09A 2G4IA 1YEWA 1PIV1 3JQWA 1QQP2 1LECA 1LKNA 1WA6X 2VM9A 4HPKB 5C9AC 1AJOA 5I8TA 4AHWA 1ZBA2 1UF2C 5DDJ2 4HVQA 3WQ7A 2OVUA 1RUOA 4MVTA 3AKRA 3MYXA 3QD6A 2SLIA 2ZTNA 1K5MA 3POWA 5D8AB 4AHYA 1UKRA 1Q43A 2P6HA 4BK4A 2QNKA 5BNNC 4CCOA 2HWC3 2PFWA 1EAH2 5FP9A 4WVZA 3Q8FA 4JVAA 1FI2A 3WP5A 4A3ZA 3DKQA 1W6OA 2Y60A 3KQRA 3PIJA 4OMCA 1W9TA 3MLLA 4CP9B 4N53B 3B9CA 4QXHA 4B4QA 1UMZA 1H1MA 5L73A 3PVNA 1QF3A 3USUB 3FMGA 1GWMA 5HV0A 2WNUA 2Y0OA 3V56A 1A34A 2Q5TA 4D94A 1YQ2A 5T55A 2JDAA 1RB8G 4KG0A 4DOUA 3IAQA 4N7UA 4KGGA 5FZGA 1NY72 5LEKA 4GMP0 3PVOA 2C26A 4FPHA 3A0NA 2A3WA 1NUKA 2A6YA 2RJLA 4O65A 2HWB3 4GD4A 5HPOA 5IK7A 4LKSA 4AVAA 1OSGA 4AL9A 2PHDA 1LHVA 4E4ZA 1WW5A 2Y6KA 4SLIA 5FLHA 2IXLA 4BQ4A 1JYIA 1XE8A 2MEV2 4QPGB 2RV9A 2ET7A 2VW0A 1FMD2 1LRHA 5DAQA 4NMIA 5D21A 4XUPA 1AYM3 3S5AA 1NQJA 1NCRA 2XJRA 4NAOA 3HWJA 3UKNA 3UNPA 3ILFA 3H0OA 3WP3A 1QNWA 1YJLA 4QB6A 1WWYA 3VBHB 4PLMA 5I0SA 2J1VA 5LCWL 1ND2B 1VBB1 2JDYA 3WDUA 1HXS2 5JR2A 4P5YA 4AQTA 4QPWA 2R49A 4PDWA 4FPGA 1PIV3 4MXVA 1JZ5A 5IK5A 2ZX0A 3MHZA 2WYSA 2RVAA 3LFMA 5IWFA 4M4RA 3ZSEA 1WMXA 2K0GA 3IAPA 5KXEA 4AFAA 3POGA 4XFHA 2YPDA 5GLWA 3RQ0A 3IDBB 1Q3EA 2XH6A 4MGSA 2OPKA 1XNBA 2RM22 4R9DA 5DG2A 1LU1A 1R1A1 3AP4A 3DYPA 3WUDA 2J1UA 3E5XA 2VTXJ 3VBFA 3WDVA 5FZ1A 4Q0PA 3AL5A 1YUDA 2HWD2 2B42B 1RGSA 2ZZJA 3U78A 3X29B 5J36A 4KWKA 2WWSA 1C3HA 1TME2 3WF2A 1NOVA 3DPRC 4LIUA 4AI2A 4S2GA 4GJYA 2BQPA 4BMEA 3KCYA 2XXZA 4XDPA 3POYA 5FYIA 4YZ5A 1JZ7A 2JENA 1HDKA 1JH5A 4H3WA 3SISA 1LU2A 2ZXQA 3WNXA 3WQ1A 3T1MA 1CD3G 4BXFA 3S57A 4MYEA 4B4PA 3CBNA 4Z82A 3CQOA 4XJWA 3DCQA 2BWAA 2XONA 3O1PA 1IKPA 1RUI1 4YRDA 1LHUA 5GZGA 2FCVA 1K5MB 3OF1A 1J84A 1I9RA 4BQ1A 1WLDA 5EJ1B 5T3NA 5JI9A 3BIEA 2CGPA 3LEGA 1AUYA 5FOJB 1DDLA 1DF0A 2KD7A 3SLIA 2ZAAA 3MUY1 1CAVA 4LK7A 4NIIA 3I3DA 2OKXA 1QWRA 3GXUA 5FY7A 1IS3A 5FZFA 1VBB3 1SEFA 4YGDA 5KHHA 3VBUA 1W6OB 3ZIWA 2QKDA 4LK6A 4C1XA 1AR71 2X05A 1AL23 1V0AA 1V6JA 4Y4RA 5DZGA 2JWPA 4TXWA 2WNUB 4AXOA 4AQSA 1N3OA 2ILMA 1NLSA 2EA7A 1KS4A 2ZGPA 1SLBA 1UOFA 4QXCA 5DABA 3W59A 4FPLA 2UURA 3VL8A 4I30A 4C90A 3OPTA 3ZYJB 1J1LA 3VD4A 4RHV2 4DO0A 3NNGA 4IEYA 4JQTA 2WKKA 3WHUA 1R1A3 4CU9A 1P8JA 1W6QA 2WS91 1TZOA 1N3PA 2B5HA 4GWMA 1HQNA 4QX5A 3ZYHA 5IUQA 2JDMA 5FR3A 3LGRA 2DFBA 2P3IA 2VO5A 3WVJA 5B4NA 2GNMA 1DLLA 1R091 5BNPC 1VJ2A 4UBGA 1RUD1 1SPPA 2PHWA 5FZ9A 4W6WA 2XDVA 1NCRB 3OD0A 2XBO1 4RR3A 4YYOA 4NUBA 3P5BA 4CU6A 5CISA 2J1RA 4AI1A 1OFSA 4HVOA 1V9U3 4QD2A 5FZKA 1ULCA 2BZDA 3HMYA 3NRUA 1HN0A 2C24A 4HVRA 4LE3A 4LUKA 4YW1A 1B35C 1GUIA 4GAZA 5LRRA 5ACA1 1W8FA 2PLV2 5LEJA 3POJA 5GM0A 3IPVA 3VZNA 4CUBA 4AI3A 1FNZA 4PDWB 4OHXA 2PQQA 2NLRA 2Z2SB 4Q4W2 3VDCA 5IAVA 1N1SA 2WRAA 3GALA 1W03A 4XE9A 2ADDA 4NWWA 3H3UA 1RUI3 5FYMA 4YSFA 1YWKA 3B5LB 1XU2A 1XRUA 1AR61 3IT8A 2WC2A 1UXXX 4HXCA 5C3QA 3BU7A 2WZEA 1Z78A 3AYCA 2VZRA 4M0NA 1X8EA 2PAEA 2QQWA 2BERA 2C1FA 4UAPA 4WM8A 3VBFB 1BHGA 5LASA 1DGWA 4GA9A 1QJFA 4Y1XA 4DUVA 4BA6A 1MVQA 1AR73 5FYSA 1MZ6A 1VBE1 5J1XA 1W9FA 4QQOA 4MGYE 4NHXA 1PNGA 1YXWA 2X09A 2WNVC 4YVWC 5FMDA 1NE6A 4EWDA 1UYYA 4MADA 3WG2A 4EZHA 1UCXA 5GJ6A 1JHNA 3PMSA 4RFT0 1H4HA 4HKWA 5F3CA 2P3KA 3ZXKA 3ZFGC 4DXSA 3EB7A 3J8F3 1O3TA 2JB8A 4FQZA 3POSA 4NWVA 3WXPA 1ZYBA 2WS93 4Y1VA 4E8CA 1O8SA 2YB7A 5LATA 4EE2A 3LQCA 4HSLA 1R093 2YGLA 1WCKA 5FPUA 3LWCA 4XURA 2E33A 2XBO3 1NLQA 2Y38A 5FYHA 2A70A 3N35A 1J1TA 2MNGA 1WMEA 4WZCA 2VQ0A 1UW8A 5DUUA 1OURA 2EALA 1DQ0A 2ET1A 4LULA 4OLLA 5A7WA 3TEWA 1CAVB 4QQ2A 2CAUA 5BXXA 2P2KA 2HWB2 5ACA3 4BOWA 2WNUC 4LHSA 4D7YA 2YPJA 2ZGOA 1GSLA 1V6NA 3C7OA 4GIQA 3UJQA 3VBUB 4E8DA 2WNEA 3TNQA 3WW2A 1JS9A 5KC5A 4WM7C 2E7TA 3FFQA 4NIDA 1UPSA 1W8WA 1XJAA 1TNFA 1YRZA 2BJSA 1X9PA 3HBZA 1AYM2 2OIIA 5BNOA 4L9BA 4Q2FA 1U0AA 5FV3A 3UV9A 2PAKA 4PI0A 3VUOA 5CU1A 5T50A 1AR63 2G1MA 2PHTA 3ZKYA 2DCZA 1HRI2 1W0OA 4LBOA 3C7EA 1MZFA 3K3NA 2RDSA 4GALA 4U36A 4UOJA 2XHNA 3IKWA 4E9KA 1FOD2 1W6QB 3LD8A 1AR82 4YW6A 1BBT1 2GN7A 3RZLA 1VBE3 1WKYA 4AFBA 1SDDB 4FXGB 5FWJA 3GHMA 2JE7A 2CY6A 2Q8EA 3ZFEC 1O6UA 1F4AA 1D0HA 1SPPB 1W8UA 2O14A 2ZOEB 3ZR5A 4GXLA 4ATFA 4RR3B 2BU9A 1S1AA 1N1VA 5LK7B 3GZAA 3O1RA 4B4RA 3ROUA 4AGRA 3UL2A 5C4WC 3MBWA 2H6BA 4MO3M 5LY2A 4QQHA 3DECA 3LA3A 3IPVB 1BQPA 3AMMA 3WHTA 4LBQA 1JZ2A 1ASJ2 4NAMA 1ULPA 1YCIA 4Q27A 3WEZA 1D2SA 1LENA 3R0RA 1IQDC 1W6MA 4EN7B 2A1XA 4QXBA 3O1UA 2AUYA 5T5JA 1QJY2 1YFXA 4QDQA 3T1LA 1D7PM 1HIXA 2QE3A 4D3WA 3ACIA 4NHLA 4UYBA 3IDCB 1H4GA 1LGCA 4WM8B 5JOYA 2OUHA 2WAOA 4U2AA 1PVC1 3ZSMA 2ZHNA 2R061 3OGGA 4XMIA 3RDIA 4LLFA 2JG8A 4IW3A 1QOSA 3I2IA 3JD72 5FMOL 1AHSA 1YFYA 3POFA 4K6BA 4YPJA 3KT7A 1E5SA 5LK5A 1UIJA 5FLIA 4COVA 3ZX7A 1OH3A 2H6CA 3FHQA 4QU2A 2W47A 3CF6E 1S2EA 2AEZA 5JPNB 4FSJA 1VR3A 3ZVXA 5J7MA 3WNKA 4XZUG 5CBLA 5C33A 2GU9A 1S55A 2WQ8A 3N9QA 1SZBA 2VMEA 1RINA 3IWZA 1XE0A 4LKFA 2ZBJA 4XFAA 3LEMA 1G9CA 4QU1A 3HT2A 1BBT3 1PO11 1AL22 1XPWA 1ZRIA 4NRPA 1AYN2 3DXTA 1DQ6A 2Y0IA 4ASLA 4I3PA 1RUF1 2JIGA 2WT2A 1H2KA 4LKDA 1CZVA 1RUH2 4L2NA 3NKGA 1HB1A 1VBD1 4YZ4A 4PCRA 2E9QA 3ZMNA 2E31A 2ZGNA 1US2A 4HN1A 5IVBA 4CEYA 1Y43B 5A7WB 1WCSA 5FP7A 3O1TA 3BTXA 1R1A2 3AFGA 4P02B 2P17A 1GQGA 3NAPC 2VCMA 1XNCA 1GZTA 3D3AA 2ORXA 3S5QA 5DUWA 1KJLA 1JODA 1NZCA 5LBCA 2NQYA 1JMUB 4CDXC 2WBKA 3T09A 1PGW1 5BNOB 3RZMA 2OX0A 5ANNA 4BJ0A 1PMHX 4JDMA 4QDSA 1UY3A 1QXJA 1H0BA 1H2LA 1OHFA 1V9U2 3N9NA 5T52A 1W0PA 2XUMA 5HI0A 1JOBA 4P14A 3D5OA 3WW3A 4FPYA 1N3QA 2ORZA 3ME2A 5CYYA 4H2AA 3AM2A 4FXKB 1CJDA 5FZ3A 3RG0A 3VN4A 3T0BA 3AP5A 1PVC3 3ZXLA 1O3SA 1U5ZA 2R063 3J7LA 4XF1A 1EPWA 4HANA 1IQAA 3AXEA 3I2GA 3V0BA 2D6PA 2KM2A 5FAXA 3ZYRA 2UYAA 4NOTA 5IK8A 3TYJA 1VMFA 1RUI2 1XB9A 2FZ2A 3R6SA 3WNMA 5HBAA 1AJKA 5FYTA 4HETA 3H1WA 5T54A 3NJXA 4OCTA 1PGSA 2AACA 3RWNA 4IEXA 2VR4A 5J48A 1WGPA 1S0EA 2R1DA 3BI3A 5FZHA 4B29A 1CR7A 3NWKA 3PUHA 4BLJA 4IEUA 4LBQB 1V6MA 2HH9A 4O61A 3MIGA 3FFZA 4AQ6A 1HV0A 1QXRA 4IEPA 4A7ZA 1PO13 2JDKA 3EJKA 2VPVA 1W6MB 5FMBA 1RUF3 4ES8A 4IE0A 4QWNA 3P3NA 5FZ6A 4LMFA 3K51A 3LEIA 4ES9A 2Q8CA 4OHZA 3RI9A 1VBD3 3BKZA 3QCWA 5F3EA 1Q8VA 1ZBE1 3KF5A 4Y1UA 3H8RA 1G6NA 1LB2A 1NXMA 1Q8PA 4BQWA 3J8F2 4PF1A 1UL9A 2YYOA 4XTPA 1DGRN 5FBZA 5A6ZA 4Q1PA 2VZSA 3QH6A 5H9RA 3D4KA 3KCCA 2VUCA 4NJ4A 4ZY9A 5FJHA 4L92A 5DPNA 4LQRA 3MV11 2JG8B 4LXLA 5AVAA 1KDMA 3APBA 4JGZA 3FWEA 1T6GC 4LA3A 1TVGA 1R092 1SBDA 4QHZA 2BW8A 2ZGSA 2B39A 2QUOA 4DUWA 1B09A 3LDRA 2X5IA 4KWJA 3I2DA 2XBO2 4YW3A 1RUE1 1K42A 2ARCA 5F3GA 2HYXA 1YLLA 1UQXA 4QX8A 2JG9A 4S2HA 2WR9A 4DPNA 5M0TA 3AP9A 3WV6A 1UZZA 3TBDA 5FO9B 2ZGQA 3DV8A 4JHTA 3Q8BA 5ABJC 2RMU1 1GWKA 4EN6B 3VBOC 2F4LA 4KH9A 1C5IA 1I5PA 4HT1T 4XOGA 4BHPA 4BQ3A 2J1SA 1AF9A 4KU7A 4QKDA 2QQVA 1IG3A 4DRRA 3TNPB 2JIJA 4Z2WA 2JX9A 2PN5A 1W6PA 3AKQA 2D40A 3L9JT 1AR62 2X29A 4E4HA 1LCLA 4XABA 4ARYA 1AL0G 4CDUC 4CEYB 2K2SA 1JTZX 1LOFC 3F95A 4R4XA 2VOKA 3DUIA 5FUNA 5L19A 1LHNA 4FOYA 2VNGA 4PLOA 2A3XA 3K3OA 4K3UA 3D0SA 5FOBB 1VBE2 5E8AA 3BIWE 1YQ6A 2BNMA 3WDWA 1HB2A 2ZX4A 2DWRA 2J22A 3GF6A 2VW1A 3HNBM 4QDRA 3U75A 3H8OA 2Y6GA 4DY3A 2PHFA 1UU4A 3KVBA 3TEZA 1ZBE3 5AC91 4IEWA 3VDBA 1HJGA 3I2HA 5FY9A 4Y3OA 3NV4A 3CJIC 4XXPA 3HBKA 2LROA 1QJU1 3ELNA 2OW4A 5HCFA 4XQ4A 3E97A 2GC3A 2WZ8A 4G3YC 1AR92 4V1PA 5F39A 2RS52 3K48A 5JI7A 2BBVA 4XUTA 2UU8A 4ZPIA 2W9XA 2YU1A 4OQ9A 3SEEA 1TNRA 3V0BB 4GKXA 1OUSA 1WLTA 1C8M2 1PMJX 5FXVA 3H8UA 1PZ9A 2VZTA 2RS11 3TB0A 1RUE3 3AMPA 4QGLA 4Y4YA 3WZ1A 5C3PA 1REDA 3E5UA 2PHUA 3T0AA 3TAYA 4Q0QA 1G9DA 1QJZA 1VBC1 3LKJA 1GQHA 4XJ9A 4XW3A 5FUIA 1BXHA 4AEMA 4N43C 3SC7X 1RUG1 5FTTC 2RR11 1RHI2 4X8PA 3D6EA 1IGOA 1IG0A 1CPMA 1PX4A 1AX0A 3WF1A 2GMEA 3ACHA 4PF5A 1VBA1 3KWVA 1S0JA 1QY4A 4B8EA 1XNKA 5CFCA 4TLFA 1WD3A 1WW7A 2B9VA 2RHPA 2WZR3 4UW5A 4JDOA 4XIKA 2JDZA 1IPKA 1GV9A 1RVF2 4RD7A 3TN91 4PIZA 2VMIA 5A3PA 3IM0A 1FXZA 4IQPA 1TG7A 3MFCA 4LA2A 2E63A 2UWAA 4AQ2A 5A7OA 4CRQA 3MF6A 5CG9A 3O14A 4EN0A 2VCBA 4D7TA 2ZHKA 4RA0A 5L7OA 1YNAA 1XC6A 3OG2A 2EXIA 4JGZB 1UOGA 1KITA 2BPA2 2EAAA 5EZWA 1KQRA 3TEYA 4TLGA 3MIEA 3ZMOA 2X5IB 4AEDC 1MQTC 1IHMA 3MGUA 3WG1A 4CDWA 4NR1A 2XVKA 3PURA 3SH4A 4FTSA 1W0NA 5AC93 4GULA 3VHPA 2JG9B 3WP6A 1XYNA 4META 1OLRA 4BZ4A 2B8MA 1E5RA 1QJU3 1Z0HA 1XYOA 1GOFA 2BWCA 3UKVA 3V64A 5E16A 4CCDA 1HN1A 3I54A 4XPVA 3JQXA 3HJRA 5I0DA 2DBIA 4KG8A 2HWE1 3B3QE 1JHJA 1OPOA 2QFEA 3JBG2 2A6VA 2GMPA 4IGPA 4ZXEA 2WZPP 4CYDA 4WBBA 5FBJA 1BMV1 4NROA 1W6PB 3AJZA 5DAPA 1G7YA 2RS13 1Y7BA 4UWDA 2H0VA 4Y1ZA 5FMOS 1MS4A 3NJYA 4JKKA 3JB8A 5F9TA 1VBC3 2NMNA 2X53S 4CDQA 4A42A 4COYA 5CA6A 3VD9A 3HOBA 4AGGA 4M4PA 4ZU4A 2I2SA 3J7NA 1IS4A 3AKTA 4XJAA 1RUG3 3LEKA 3WP4A 2R062 2RR13 4M00A 4YVSC 3SKVA 3LCPA 4EV0A 1NYWA 3FZ3A 4ZZ8A 3WDXA 2CGOA 4Y5SA 3H8XA 5DUXA 1UMHA 1VBA3 3RGBA 3A23A 4FFHA 5T5PA 4M0HA 3ACLA 3ZYFA 5KWRA 4JGYC 3KSCA 4JTNA 1QNYA 5A6XA 4MZUA 1HRV3 1NCQA 3Q9OA 2EVXA 3E6BA 2BEOA 3A4UA 4IV1A 4R8HA 5FY8A 4UT5A 3RYRA 3VHOA 3ZPYA 5BUVA 3U37A 1AXZA 2D3PA 4NN0A 2QJVA 4RS5A 5J3UA 1PO12 3GZUC 4KI5M 3LIGA 3NJVA 1RUF2 4CUGA 2F17A 3H9AA 1VALA 4XJ8A 1WCUA 5FP8A 5IVYA 1W9YA 1FAYA 1CZTA 4C0BA 3OPWA 1J59A 4I2OA 5K4LA 1YIFA 2RS31 1VPHA 5JVVA 2WUHA 2VTFA 4GH4A 4OZXA 4DB5A 4FPJA 3FLRA 1JZ4A 2D3RA 3KV5A 1GNHA 1CESA 2QQUA 2JE8A 4D8MA 4W6XA 3QOPA 1H8TA 2HWE3 1QEXA 4P9GA 3TRSB 1O3RA 3VV1A 1FNYA 1SBFA 5CFCB 2VECA 1HV1A 3AXDA 4AI8A 2N7GA 3T2QA 3K4ZA 4DY5A 1ST8A 2TNFA 3RSJA 3MIBA 5AVPA 2XJUA 2VZ3A 3O1VA 2V4VA 5CIRA 5CFDC 3FBYA 2ERFA 3QBQA 1CZSA 1Q8OA 4I09A 3VKLA 1W8OA 3FBMA 2IXJA 4JZRA 3UKTA 3MPPG 4NE9A 4NHKA 4O9GA 4MGQA 4AVSA 4P9WA 4Y33A 2FMDA 4TYSA 5L7OB 1WMFA 1GQPA 1DCSA 4A4AA 2BYVE 2WQ4A 4CUAA 5FQ0A 4BQ5A 4GMP1 2VNOA 1AXKA 3CZJA 3HR9A 4RQPC 4CDWB 4AFDA 3PU3A 4BYYA 1V6IA 1KEXA 1PO21 5I8SA 1EY2A 1WD4A 1WCDJ 1L7RA 1UZVA 2ZX3A 1J3QA 3AK0A 3AP7A 2K9ZA 2ZZQA 1C28A 1ZZ9A 2DUPA 1DG6A 1MR5A 3PJQA 3NNLA 2VCCA 1EUTA 3ZPOA 1GP5A 4UF0A 5KHKA 5CAZA 4JX0A 2LRPA 3WF3A 3K75B 2CTVA 2D6MA 1YYNA 1ZZ8A 2FMYA 1Y9GA 4ZXKA 1DGWX 4GWIA 5C3OA 1WMDA 2RS33 2R0FA 3M3OA 4EZ4A 4CDQB 1MS3A 1YJKA 3GZTB 4AVVA 4XUQA 4XVHA 1VMJA 1H8VA 2YBKA 4R4ZA 5F2SA 3SITA 2ZHLA 3OGSA 5EYXA 1PK6A 1FV2A 1QJX1 1RUJ1 1OQEA 3LFIA 4RL7A 1GNZA 4XETA 2J1EA 3U14A 3FLTA 4M3CE 4RGKA 4K7JA 2ZS6B 3RI8A 1UY2A 3FJSA 5IFTA 4NRQA 3ZSKA 2A7AA 3D8CA 4YW5A 3LSEA 5KHJA 1N1TA 3KCXA 1NA1A 1MS5A 3FE5A 4Q4X1 4L11A 2ZMLA 1YI9A 3IIIA 4M3CA 1H2MA 1LODA 2V5YA 4MX3A 2X8KA 5D8AC 5A3LA 1UOBA 5FKCA 5J96B 1NCQB 1QXPA 2VNVA 1X82A 2BVBA 2WWJA 3ETQA 4HKOA 3OEAA 5A3TA 1F35A 4Q4Y1 5FPBA 1JYTA 5LA0A 4TWTA 5C70A 2W91A 4P9YA 4O9EA 4RS5B 3HT1A 1EUUA 1GBGA 4UW6A 3UJOA 3CO2A 2QZ2A 2RJ2A 4N53C 4AOCA 3PUSA 2NPIA 2OPWA 1XU1A 2RDNA 3BODA 3MV01 4GMP3 3O5SA 5A3MA 2WZR2 3M2MA 1JZ6A 5DAVA 1A3KA 4A41A 2DYCA 2OS2A 1PO23 2MHFA 1BKZA 1ZRRA 4IE5A 1UN1A 1ULDA 2JDNA 4YM0A 1LULA 4GH4B 3W58A 4MSVA 4PQQA 1SACA 1YC61 4AVBA 2OXBA 1CIWA 1OI6A 3NV1A 3O12A 4IV3A 5JOXA 5CKNA 3K4DA 1S0IA 1H8TB 2UWBA 4QPGC 1OF4A 4XUNA 4QPYA 1W2OA 4OMDA 2VULA 1COV2 1LGBA 3VGIA 3ZYPA 4LO6B 3HPNA 3OUJA 4Q0UA 2JJ6A 4Q0SA 3OJBA 5FZ7A 4MGKE 2VOVA 5FPLA 4K8RB 5AC92 3UGFA 2R042 3J7HA 5F5AA 2XLGA 5H9QA 4D6RA 3VBHC 1QJEA 1TEIA 3B93A 2WLQA 3KHCA 2VUJA 3OPZA 1ND2C 5A7PA 1F4HA 1QJU2 2CWSA 3ZLIA 4ASMB 4MLOA 1UX7A 1OT5A 3SCHA 1RUJ3 1PZ8A 1QJX3 2KR2A 1X33A 1YI7A 1SDWA 4UBHA 4J1XA 1OKQA 5I8YA 5FQ0B 5C8CA 5KXBA 4LO4B 2QZ3A 4E4DX 3SH3A 4FAGA 1OPMA 4I0BA 1XNAA 4Q4X3 4N9HA 2R6QA 4BCUA 1I6XA 5D1IA 1WW4A 3RJRA 1VB4A 3LA7A 4IUGA 2G9GA 4IDZA 1CX1A 1BK1A 3HD8B 4Q4Y3 1NZIA 4PQ9A 1RUG2 4PBPA 2RR12 4KL1A 3U1XA 3W5MA 4AG4A 3VBRA 1I5ZA 2IZWA 2WFF1 3ENRA 2UY9A 1URXA 4UFMA 4UF0B 5FY1A 4CCNA 4F7ZA 3USSA 2O0OA 1FPN2 3NL1A 3IBMA 2BGPA 4K8FA 2NN8A 4FI9A 5IVCA 2QQIA 4WVMA 1KDKA 1HRV2 3R4SA 3K2OA 4EYUA 1R64A 3KGZA 1X50A 1OKOA 2WWUA 1D4VB 3AVSA 3CEWA 3Q8EA 4CP2A 4CU8A 2W5FA 2TUNA 2WT1A 3W9AA 1GZWA 1DQ5A 3I3QA 4CP0A 4A3XA 5JXHA 1PK6B 2VZQA 3GM8A 4Y5Z0 5C6CA 3A22A 3ZN4A 2D43A 2IXHA 1NT0A 4Z8BA 2HWC2 4AEKA 4HMZA 2FDIA 2AR6A 2W68A 2ZEZA 3DGTA 3KZ4C 3PIGA 1NA1B 1RUNA 4NVPA 1FT9A 4OUSA 4M3CB 2ZCWA 4URTA 4CEWB 2NMOA 3QH7A 1K5MC 3OGVA 2HWF1 2W2IA 1SCSA 2C5DA 3HIFA 2WSUA 2DUQA 3OSDA 2GH8A 4JHZA 4PJYA 4Y26A 3TWIA 1RUD3 3BTZA 2BGCA 5FMCA 4OUMA 1N1YA 1W39A 2XVGA 5K0UA 2W94A 1O4TA 4X8NA 5C71A 2HWE2 4IESA 1EP0A 3DN7A 3ZXJA 3NNFA 2XJTA 4I02A 3MZHA 1XOYA 1RUC1 1XNDA 4COUA 2GNTA 4N8MA 2OZ6A 4CU7A 4XFCA 1CX4A 3BN6A 4DMIA 4XACA 2R071 3AMHA 4AEJA 2WA3A 4QGMA 1NX9A 1OXCA 2BDRA 2GAUA 2PHLA 3HEIA 5SV8A 1PZ7A 1DYKA 2E51A 2PQSA 4XAEA 3KVAA 1ACCA 1ZZCA 4LOTA 3RFRA 3THCA 1HB4A 4MXWA 1UX6A 2GSYA 1TMF1 4IV3B 1ULGA 2ATFA 1GANA 2C6SA 2WYFA 3CLPA 2WFF3 3SH5A 2GNDA 1PGL2 4R9CA 1O5LA 2WN2A 3HQUA 4RYDA 4AFCA 1NCRC 1PIV2 1TQ5A 1YQCA 2B9UA 1C57A 5HXVA 4AFMA 4DXTA 5DMYA 3WSOA 3SEPA 3ZXDA 1G9FA 4Z1VA 1GR3A 2JD9A 5A7SA 1SMVA 3RZGA 1OA3A 5FLJA 5A6QA 1KS5A 3VHNA 4UFHA 5FY5A 1CAUA 3EXUA 2I74A 1G9AA 4UFJA 4DUXA 2V09A 4PDWC 2EXKA 4N9IA 2CL2A 1CAXA 3DXUA 3KF3A 5C8CB 4RGAA 2XLFA 5FO7B 4LOSA 3IIAA 3THTA 3CJXA 5EJZB 1NXD1 4W6YA 5KXCA 3MLKA 1PMIA 1M4WA 2HWF3 1W05A 1UY1A 1IPJA 1JW6A 1PHMA 2YFUA 5FUPA 1MZ5A 1JN2P 1UY4A 5DUVA 2Q1FA 5FY0A 3UGHA 1E5IA 2C9AA 3VKNA 1POV0 2ZX2A 3KQ4B 4OHVA 5EV7A 5LBEA 1CONA 4URAA 5K9YA 1DYOA 3UGGA 1UY0A 3VBFC 4AAPA 1W6NA 1XSRA 2OZJA 5LW9A 4PI2A 2AC1A 4K1ZA 4L99A 1S0GA 4QPIA 4XJUA 1ZX5A 3VBRB 2ARAA 4YZ1A 3PUAA 4ZU7A 4OZOA 3GNEA 3VBSA 1MVEA 1JYVA 2HEYF 3VDDA 4TTGA 1RUC3 1W8TA 1W8HA 1C1LA 2Y64A 3PU8A 3T30A 1OQDA 2R32A 1C1FA 4JDNA 4WVMB 4KMQA 2R073 4GB31 2CWMA 4Y1YA 1OVPA 2B46X 3KS7A 4BXSV 5JOZA 3TEXA 3WCSA 3P3PA 1RXGA 4QB1A 5C3RA 2YMZA 1GZWB 5FPXA 2ZMKA 1POV1 4G9SB 1TMF3 1H1AA 3M4FA 2GP3A 3NVCA 3Q8CA 2EAKA 4ORFA 3RVHA 5A32A 5K7PA 1H30A 4QHBA 1JZ3A 3U4XA 2ES3A 1LESA 2A6WA 3AZXA
chains in the Genus database with same CATH topology
4V2WA 2XMLA 4QXHA 4Y4RA 4IGQA 4CCLA 5FY4A 2OX0A 2OT7A 5FV3A 3KVBA 2W2IA 4QXCA 4CSWA 5KR7A 5F3IA 5FXZA 3N9NA 2WWJA 5FY9A 4QX7A 4Y3OA 5FZGA 2XUEA 3OPTA 5FZ8A 5FY8A 4DO0A 5A3TA 5FPBA 3K3NA 4V2VA 3U4SA 5FZCA 4ASKA 5IW0A 4GD4A 5FWEA 5FZ3A 3LD8A 5FP4A 5F39A 5F37A 3PUSA 1VRBA 4LITA 3N9LA 5A1LA 2YU1A 5FZOB 5FZEA 5FZOA 4CUGA 5FWJA 3PTRB 5FYVA 2Q8EA 5FP8A 5FXVA 5IVYA 5LWBA 5FZ9A 3OPWA 2OQ7A 2XDVA 4CCMA 4NUBA 2OS2A 4D6QA 5K4LA 5FYTA 2YBSA 5FXXA 5E6HA 3N9MA 5FZKA 3KVAA 5ISLA 5LY2A 3PUQA 4GAZA 2YBPA 5FZHA 5FXWA 5A80A 4AI9A 3KV5A 4GJZA 4TN7A 4C8DA 5IWFA 4QWNA 5FZ7A 5FZ6A 2Q8CA 4QXBA 2OQ6A 5FYBA 5FPLA 5IVJA 5FYMA 5F3EA 2YPDA 5F5AA 5F5IA 5A7SA 5ANQA 5FZBA 4D6RA 5IVFA 2Q8DA 5FZIA 5A3PA 5FY5A 5A3WA 5CEHA 5FYUA 5A7PA 3ZLIA 5A7OA 4DIQA 3AL6A 3N9OA 5FJHA 3PDQA 5FJKA 3DXUA 5FZ1A 4Y33A 4LXLA 5FYSA 3AL5A 2YU2A 2PXJA 4CCKA 3U78A 2P5BA 5FZMA 5FZ4A 4BU2A 4EZHA 3PU3A 3PURA 4LIUA 5F3GA 5FUPA 5FY0A 5FZLA 4IGOA 4QX8A 2GP5A 4HOOA 5A3NA 5FPAA 5FZAA 4GJYA 5F3CA 4URAA 4D6SA 4XDPA 2XXZA 3AVRA 4AAPA 5LW9A 3N9QA 5FYIA 4BISA 5FYYA 5F5CA 3PUAA 3KV9A 4QU1A 5FY1A 4CCNA 4UF0B 3ZPOA 4UF0A 3DXTA 4BXFA 5LY1A 4IGPA 3LDBA 3PU8A 5FBJA 5IVEA 5FPUA 5IVCA 4CCJA 5FPVA 2VD7A 4E4HA 4HONA 3K2OA 3NJYA 5FYHA 4XDOA 4LIVA 4EYUA 5IVVA 2WWUA 3AVSA 5FZ0A 4EZ4A 5IVBA 5A7WB 3KV6A 3KV4A 5FP7A 5FYCA 5A7WA 5F2SA 5F32A 2YBKA 3UYJA 4CCOA 5FUNA 3RVHA 5FY7A 2GP3A 5FP9A 5FZFA 5A1FA 5FP3A 5F2WA 5A7QA 3K3OA 3N9PA 5A7NA 5FZDA 5FYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V2W A;  2XML A;  4QXH A;  4Y4R A;  4IGQ A;  4CCL A;  5FY4 A;  2OX0 A;  2OT7 A;  5FV3 A;  3KVB A;  2W2I A;  4QXC A;  4CSW A;  5KR7 A;  5F3I A;  5FXZ A;  3N9N A;  2WWJ A;  5FY9 A;  4QX7 A;  4Y3O A;  5FZG A;  2XUE A;  3OPT A;  5FZ8 A;  5FY8 A;  4DO0 A;  5A3T A;  5FPB A;  3K3N A;  4V2V A;  3U4S A;  5FZC A;  4ASK A;  5IW0 A;  4GD4 A;  5FWE A;  5FZ3 A;  3LD8 A;  5FP4 A;  5F39 A;  5F37 A;  3PUS A;  1VRB A;  4LIT A;  3N9L A;  5A1L A;  2YU1 A;  5FZO B;  5FZE A;  5FZO A;  4CUG A;  5FWJ A;  3PTR B;  5FYV A;  2Q8E A;  5FP8 A;  5FXV A;  5IVY A;  5LWB A;  5FZ9 A;  3OPW A;  2OQ7 A;  2XDV A;  4CCM A;  4NUB A;  2OS2 A;  4D6Q A;  5K4L A;  5FYT A;  2YBS A;  5FXX A;  5E6H A;  3N9M A;  5FZK A;  3KVA A;  5ISL A;  5LY2 A;  3PUQ A;  4GAZ A;  2YBP A;  5FZH A;  5FXW A;  5A80 A;  4AI9 A;  3KV5 A;  4GJZ A;  4TN7 A;  4C8D A;  5IWF A;  4QWN A;  5FZ7 A;  5FZ6 A;  2Q8C A;  4QXB A;  2OQ6 A;  5FYB A;  5FPL A;  5IVJ A;  5FYM A;  5F3E A;  2YPD A;  5F5A A;  5F5I A;  5A7S A;  5ANQ A;  5FZB A;  4D6R A;  5IVF A;  2Q8D A;  5FZI A;  5A3P A;  5FY5 A;  5A3W A;  5CEH A;  5FYU A;  5A7P A;  3ZLI A;  5A7O A;  4DIQ A;  3AL6 A;  3N9O A;  5FJH A;  3PDQ A;  5FJK A;  3DXU A;  5FZ1 A;  4Y33 A;  4LXL A;  5FYS A;  3AL5 A;  2YU2 A;  2PXJ A;  4CCK A;  3U78 A;  2P5B A;  5FZM A;  5FZ4 A;  4BU2 A;  4EZH A;  3PU3 A;  3PUR A;  4LIU A;  5F3G A;  5FUP A;  5FY0 A;  5FZL A;  4IGO A;  4QX8 A;  2GP5 A;  4HOO A;  5A3N A;  5FPA A;  5FZA A;  4GJY A;  5F3C A;  4URA A;  4D6S A;  4XDP A;  2XXZ A;  3AVR A;  4AAP A;  5LW9 A;  3N9Q A;  5FYI A;  4BIS A;  5FYY A;  5F5C A;  3PUA A;  3KV9 A;  4QU1 A;  5FY1 A;  4CCN A;  4UF0 B;  3ZPO A;  4UF0 A;  3DXT A;  4BXF A;  5LY1 A;  4IGP A;  3LDB A;  3PU8 A;  5FBJ A;  5IVE A;  5FPU A;  5IVC A;  4CCJ A;  5FPV A;  2VD7 A;  4E4H A;  4HON A;  3K2O A;  3NJY A;  5FYH A;  4XDO A;  4LIV A;  4EYU A;  5IVV A;  2WWU A;  3AVS A;  5FZ0 A;  4EZ4 A;  5IVB A;  5A7W B;  3KV6 A;  3KV4 A;  5FP7 A;  5FYC A;  5A7W A;  5F2S A;  5F32 A;  2YBK A;  3UYJ A;  4CCO A;  5FUN A;  3RVH A;  5FY7 A;  2GP3 A;  5FP9 A;  5FZF A;  5A1F A;  5FP3 A;  5F2W A;  5A7Q A;  3K3O A;  3N9P A;  5A7N A;  5FZD A;  5FYZ A; 
#chains in the Genus database with same CATH topology
 4AR2 A;  4UI9 L;  1VBB 2;  4XHX A;  2PA7 A;  1BEV 1;  2FCU A;  1Z7S 1;  3BAL A;  5FRA A;  3SMH A;  5FY4 A;  4YFW A;  5F8P A;  1RTV A;  2DCK A;  3B94 A;  3IN9 A;  2B4K A;  1PO2 2;  3SXW A;  1FX5 A;  3VD7 A;  4KBZ A;  5FIX A;  2XQR A;  3K4A A;  4HN0 A;  4CSW A;  4YGC A;  4AHZ A;  3UK9 A;  1QOO A;  4X6R B;  4XF3 A;  1H1I A;  1JUH A;  1DHK B;  1NLR A;  3MEP A;  3ZFF A;  3VBU C;  5IHR A;  5K0U B;  2WN3 A;  1QQP 1;  2BRT A;  1QGL A;  5E89 A;  5FWE A;  2VZO A;  2PHR A;  1KJR A;  2IFR A;  4UW3 A;  5GLV A;  3AX4 A;  2JE9 A;  2DTY A;  4CEW A;  5FZE A;  2QQM A;  3GDB A;  1Q8S A;  3WW4 A;  3VZO A;  4EJR A;  1X36 A;  1D4M 1;  2FHR A;  2JD4 A;  5FCC A;  3E6C C;  3VZK A;  2RDR A;  1EAH 1;  3ES4 A;  3O1S A;  1S2K A;  4AF9 A;  2W87 A;  4MXW B;  2D93 A;  4Q4V 1;  2E6V A;  3ZYG A;  5DAX A;  5A80 A;  4OHY A;  4LNV A;  3ACF A;  3AB0 A;  4FQ4 A;  3ZN5 A;  4LBL A;  4MHU A;  4Z2A A;  4ZHN A;  2Z42 A;  1WZX A;  5JXG A;  3T2T A;  4I0A A;  4C8D A;  1XQN A;  5A7N A;  2VQT A;  2J1A A;  4Q4X 2;  4R9B A;  4RR3 C;  4XCB A;  2Y8K A;  2HBT A;  2KA3 A;  1OVS A;  2W46 A;  2VAU A;  1JU4 A;  1NY7 1;  5FDB A;  1UYP A;  4GB3 3;  1R08 1;  3BGA A;  3MO4 A;  5FZB A;  5CB7 A;  5T5L A;  2PAM A;  2ZAH A;  2GN3 A;  1CAU B;  3ITQ A;  4HLT A;  4Q4Y 2;  3T4H B;  1SBE A;  5EWS A;  3VLB B;  2VZP A;  2Z69 A;  2A6X A;  4XZP A;  5JMC A;  4MG2 A;  1POV 3;  2Y6L A;  2IXK A;  3AL6 A;  3N9O A;  3AKS A;  5KBF A;  5AFE A;  1CAX B;  2MEV 1;  3ZKU A;  3GBW A;  1FMD 1;  2DV9 A;  3FC0 A;  4PHZ A;  2BNN A;  1BEV 3;  3HN3 A;  1L3J A;  5JSP A;  1S4C A;  1Z7S 3;  2ZGU A;  4Q29 A;  4AW7 A;  2NP0 A;  1AR7 2;  5C9A A;  2P5B A;  3RZJ A;  4EWA A;  3UT0 A;  2WNO A;  5GZF A;  1D0G A;  1DYP A;  1EPZ A;  2QQL A;  3E6D A;  1QKQ A;  4ZKT B;  1DIW A;  4YW7 A;  3O7O A;  2JEM A;  5FZL A;  3FHA A;  5GAL A;  1AX1 A;  1N47 A;  1D2Q A;  2CV6 A;  3SNM A;  5A3U A;  1HXS 1;  1MS0 A;  2P6C A;  1KGY A;  1W6N B;  2W1U A;  3AYD A;  4WM8 C;  3M3Q A;  4QPI B;  1ZZB A;  2E7Q A;  4L8Q A;  1NG0 A;  1QQP 3;  5BNN A;  3LA2 A;  3VBS B;  2Y26 A;  2GH2 A;  4PT6 A;  3VDD B;  1H6Y A;  2BFU L;  2TBV A;  3U0Z A;  4B1M A;  3LDB A;  2WS9 2;  4F3J A;  2TEP A;  4JKM A;  5I93 A;  1ND3 A;  5IVE A;  2IWG B;  2RM2 1;  1XE7 A;  1U5X A;  1D4M 3;  4XDO A;  4LIV A;  1RUD 2;  1EAH 3;  1DQ2 A;  2PHX A;  3H7J A;  4ZON A;  5F32 A;  1Y9Q A;  4Q4V 3;  2Z4F A;  3I2K A;  5A32 B;  2BP6 A;  1GU3 A;  2BTV C;  4M3C F;  2FDH A;  2YGM A;  1UO9 A;  1V70 A;  3R4D B;  2HWD 1;  5FP3 A;  5I0T A;  1OQ1 A;  2A6Z A;  2DDU A;  4IND A;  4IXL A;  3QLQ A;  5ACA 2;  3KLS A;  2ZAC A;  1OA4 A;  4FFG A;  1TME 1;  2BUK A;  2DTW A;  3PME A;  2FBE A;  1E57 A;  1R1Z A;  3RZK A;  3EHK A;  4W50 A;  1DZT A;  1L7L A;  1MS1 A;  4ITC A;  4W65 A;  3AZZ A;  3NNJ A;  1R08 3;  2D97 A;  4QXK A;  2P4E A;  2ZEW A;  1O91 A;  4XF4 A;  5FXZ A;  3JB4 C;  3M70 A;  5CKM A;  1C8N A;  4MHR A;  3JU9 A;  2CU5 A;  3BU0 A;  5L9V A;  3BOW A;  4K20 A;  3ZFF B;  3NW4 A;  1JU3 A;  5LB6 A;  1VE0 A;  5JLV A;  5C7G A;  2MEV 3;  3OUH A;  1LHW A;  1VRB A;  2A3Y A;  1FMD 3;  4NPR A;  5DZE A;  2P1B A;  4IE6 A;  5BNO C;  1ULE A;  4PIX A;  2LAL A;  4EN9 B;  3B69 A;  3SHR A;  1OC1 A;  3HN1 A;  2WJS A;  4QKF A;  4XUO A;  4DRV A;  1STM A;  2HYK A;  2LM3 A;  2YBS A;  4IET A;  4LHK A;  4OI1 A;  2DUO A;  2WSV A;  3N9M A;  1RJ8 A;  1CAW A;  4MUV A;  1HKD A;  1AX2 A;  4CTE A;  1WLW A;  3LSD A;  2AZ5 A;  3LAG A;  2EIB A;  5HV4 A;  3BUC A;  1GFF 2;  2V4A A;  3OCP A;  2VC9 A;  2ZEX A;  4QX1 A;  2ZGK A;  4XCA A;  4LLO A;  5BV6 A;  1GNY A;  2ENR A;  4LTA A;  4Q8K A;  1VAK A;  3FUQ A;  4XJZ A;  5EIY B;  2VE1 A;  4LOR A;  3RZZ A;  2XJQ A;  1AXY A;  2QVS B;  2EF6 A;  3AP6 A;  2YFZ A;  5JCT A;  2CNA A;  2PMW B;  2RM2 3;  2ZA9 A;  3WNL A;  3I3B A;  1RC6 A;  1CPN A;  3DPR A;  3E5Q A;  1GP6 A;  5EHD A;  3HNY M;  5BNQ A;  1GOG A;  2DU1 A;  1SLI A;  5K8S A;  2HWD 3;  4XEZ A;  2ETE A;  3P6B A;  3WG3 A;  1VP6 A;  3B9I A;  2V5D A;  4WVW A;  1REF A;  5JXJ A;  1TME 3;  5F7U A;  2RMU 3;  4CCK A;  3OTF A;  5JR7 B;  5C9A B;  4CCC A;  4QAW A;  2R07 2;  4QPI C;  4LBK A;  2ZGR A;  3M7A A;  3I2O A;  4CP1 A;  4FTB A;  1V00 A;  2DCT A;  2GP5 A;  3VBS C;  2PLV 1;  3WLU A;  2XJV A;  1G8W A;  3JZV A;  3AZY A;  3NO8 A;  4XF0 A;  1NQD A;  3AVR A;  5EXO A;  2VW2 A;  2VG9 A;  2GZW A;  4O7X A;  1UWW A;  4XQD A;  1OLM E;  4Q4W 1;  3WDT A;  2JG8 C;  3M1H A;  5BNN B;  3WT3 A;  4P00 B;  4XDQ A;  1LOB A;  4E2S A;  3EMR A;  5EYY A;  1WBF A;  3M3I A;  4HK8 A;  1OD3 A;  2DCJ A;  4KBB A;  4B7E A;  4NO4 A;  2Y33 A;  3EO6 A;  4AI0 A;  5DQ0 A;  2D6L X;  1ND3 B;  2YC0 A;  1LTE A;  1BBT 2;  1GYK A;  1OLM A;  1X9T A;  2GDF A;  2VNR A;  3OY8 A;  5A33 A;  5FPV A;  1SFY A;  4X6Q B;  5JUV A;  2DFC A;  3T08 A;  1BCX A;  5JMO A;  2VTX A;  1JYC A;  2JDP A;  2RE9 A;  3F2Z A;  5FZ0 A;  4CE8 A;  3FLP A;  3I97 A;  5L9B A;  2VMF A;  1H9W A;  1CQ9 A;  5LA1 A;  1OH4 A;  3PTY A;  1UOJ A;  4BK5 A;  5A1F A;  1HW5 A;  4FT8 A;  2DVD A;  3BPS A;  1G9B A;  1IOA A;  4ONU A;  4IGQ A;  1WUV A;  4CCL A;  1ODN A;  2DCY A;  1G86 A;  1SLC A;  2P3J A;  5FK8 A;  3ASI A;  4LHL A;  2OT7 A;  3WY6 A;  4FBF A;  5BNP A;  3N4M A;  4K21 A;  4CEY C;  2VMD A;  1RYY A;  2VMH A;  4XFI A;  3RPQ A;  2YV8 A;  1K5J A;  2Q4S A;  5CKQ A;  2VVF A;  4QM9 A;  3I3E A;  5I0U A;  4SBV A;  4UFL A;  4ISR A;  4XTM A;  4AWD A;  1QU0 A;  3FUO A;  4Q8L A;  1LOG A;  1B35 A;  2AYH A;  4XC9 A;  3H1Y A;  3N9L A;  3B7M A;  4XQW A;  3ZIX A;  5F5Q A;  1PVC 2;  5EFU A;  4BB3 A;  3PTR B;  5FYV A;  4AK3 A;  4J1W A;  5H9S A;  4K1Y A;  4P5H A;  4GB3 2;  1WW6 A;  3OBR A;  4PIY A;  1POQ A;  2O1Q A;  4AVC A;  1A78 A;  1Q5O A;  1SQ4 A;  3IMM A;  4R9A A;  2PLV 3;  1JYW A;  3BB6 A;  1CAW B;  2VU9 A;  2XKO A;  2VBB A;  1H2N A;  4XFG A;  4E2G A;  3OD4 A;  1OFN A;  1UNB A;  3TN9 3;  4MV2 A;  2VOT A;  4Q4W 3;  3PJY A;  2ZGL A;  3EQE A;  3LPG A;  1EYB A;  1WCQ A;  1FV3 A;  3AMN A;  4Y20 A;  1CGP A;  4TN7 A;  1BEV 2;  3MI8 A;  3ALQ A;  2E32 A;  2OUJ A;  5JSR A;  4LEJ A;  4HL0 A;  3R05 A;  4FOW A;  1HRI 1;  5HXM A;  5FYB A;  1YO8 A;  4DNY A;  5IAT A;  4A44 A;  1RMU 1;  4YVW A;  5ANQ A;  2WNV A;  3A7Q A;  2B45 X;  3U10 A;  3U07 A;  1ENX A;  3DPR B;  1VBD 2;  1FOD 1;  1QH6 A;  1XNT A;  4ZU5 A;  4DIN B;  5JSO A;  5KHI A;  4DIQ A;  1AR8 1;  2Q1M A;  4N90 A;  4AZZ A;  2V73 A;  4COW A;  3ZFG A;  2ZGT A;  2QBX A;  5C5U A;  3MDP A;  4E4S A;  2F6B A;  2YU2 A;  4FOV A;  3T2P A;  4XBQ A;  4GZ9 A;  4BH9 A;  1GKB A;  3RJ2 X;  3ACG A;  3BYW A;  3S6P A;  4BU2 A;  1D4M 2;  1IKQ A;  1JOP A;  1XYP A;  5ERL A;  5LBF A;  4YAR A;  1PGW 2;  1UD1 A;  1VLN A;  3OEB A;  1ZVF A;  3DEM A;  3T4V A;  1K3I A;  5FZA A;  4Q4V 2;  4ISQ A;  4KU8 A;  1U12 A;  3I2J A;  1ASJ 1;  5A6Y A;  1ND3 C;  3WCR A;  2KXL A;  1SFN A;  3M8L A;  3WF0 A;  3M3E A;  4W8J A;  1HQL A;  1GIC A;  3AZW A;  4JGZ C;  1RXF A;  2JKB A;  2W1S A;  4YG6 A;  1RJ7 A;  3LOI A;  1DGL A;  2CDP A;  3QAC A;  3V65 A;  2R16 A;  5IK4 A;  2X5I C;  3POE A;  1JXN A;  4RGG A;  1QJY 1;  3OY8 B;  4WM7 A;  5A33 B;  1R08 2;  4N7I A;  4UFK A;  2JG9 C;  3RRD A;  2C0Z A;  2ID4 A;  4J6G A;  2WAB A;  4HON A;  4LBQ D;  1XXN A;  3W20 A;  4GKY A;  1YHF A;  4BMB A;  1W8Z A;  5A70 A;  3KV4 A;  2XWB B;  5FYC A;  1OLQ A;  5C8W A;  2FD8 A;  2W1Q A;  2XB6 C;  5LBB A;  2RG4 A;  4XYX A;  4YW2 A;  4D0Q A;  1XBF A;  3SCG A;  3B02 A;  3JD7 1;  5CG8 A;  4NIH A;  2QQO A;  3N9P A;  2WII B;  4H7M A;  3WNO A;  3OBZ A;  4LKE A;  2R7E B;  4OFG A;  1JYX A;  4P9I A;  3ES1 A;  4A6O A;  2XWJ B;  4FP2 A;  4HG6 B;  4TZD A;  5BNP B;  2HLE A;  1HRI 3;  3OOX A;  3OB8 A;  1ONA A;  1YIP A;  3G6J B;  5T5O A;  4YM2 A;  3ZFE A;  1JZ8 A;  1RMU 3;  2BFU S;  2IXI A;  2VBD A;  3VKO A;  1Q8Q A;  2W39 A;  4H14 A;  2GMM A;  4QX7 A;  3VDA A;  5FZ8 A;  4CXY A;  1FOD 3;  4P9L A;  3VKF C;  3VD3 A;  3EYP A;  4F83 A;  1ZBE 2;  2ZAB A;  1AR8 3;  1O5U A;  4IE7 A;  1DU3 D;  3U4S A;  5C4W A;  4A7K A;  1AL2 1;  1KXG A;  2R30 A;  5CAD A;  1ODM A;  1AYN 1;  1AZD A;  5KXD A;  1B35 B;  4AYU A;  3ZXA C;  2F4P A;  2J1T A;  1RUH 1;  1ZM1 A;  3W21 A;  4CXX A;  1UKG A;  3DYM A;  4G4F A;  3NMB A;  1V6K A;  2GNB A;  1C4R A;  5FKB A;  2WIN B;  4CCM A;  5C5T A;  4NIA A;  3CU7 A;  3RYK A;  4COZ A;  3FX3 A;  1JBC A;  1W3X A;  3T3Y A;  4B1L A;  1RUE 2;  1U5Y A;  4XMA A;  3MF9 A;  4FPK A;  4UFI A;  1A8D A;  3GCX A;  5LA9 A;  3AYA A;  1ASJ 3;  2VCA A;  3AJY A;  4Q26 A;  2FZ1 A;  4DS0 A;  2IXC A;  2UWC A;  4QGN A;  4IV1 B;  2VUA A;  4M01 A;  3O0W A;  3LE0 A;  2HJI A;  3R4U A;  4GJZ A;  4Y20 B;  3WDY A;  4FAH A;  2ZMN A;  1DZQ A;  2RMU 2;  3T0D A;  2BVV A;  3OYW A;  4BPZ A;  1QJY 3;  2WO7 A;  1V9U 1;  5FO8 B;  4A7Y A;  2BOI A;  2OQ6 A;  1S0B A;  5FPZ A;  1F9K A;  4YVW B;  2WNV B;  1EV1 1;  5FZI A;  1X8M A;  5A3W A;  3HVD A;  2VOX A;  1J58 A;  1LEM A;  2Y6F A;  2UY8 A;  1UZY A;  4RN5 A;  3ZFG B;  3O0X A;  3JD7 3;  5TSW A;  5FJK A;  2YRO A;  1PX3 A;  3ZXF A;  2QQN A;  3KT1 A;  3KT4 A;  5CFC C;  2RJK A;  1F5J A;  2FQP A;  2I45 A;  3VHR A;  4AAX A;  2PXJ A;  4XF9 A;  4XXA A;  2DVF A;  2D3S A;  3OUI A;  4A45 A;  1O4Z A;  4YW4 A;  1ZRC A;  2D98 A;  5FZ4 A;  1LJ7 A;  3PLQ A;  1CVN A;  4GQ7 A;  4QB2 A;  1JOJ A;  3J26 N;  1MZE A;  1ZRE A;  1OOP A;  2LUW A;  2EIC A;  3Q8A A;  2VUD A;  2VL4 A;  5EQU A;  4BIO A;  5JZG A;  2D6K A;  2A5Z A;  3OBT A;  3LF7 A;  2E7A A;  4RFR B;  4TSV A;  5F1R A;  2EIE A;  1F5F A;  4ZS3 A;  3H3Z A;  1IS6 A;  3H3L A;  3LB9 A;  3ZR6 A;  4DXR A;  5L7O C;  1AYN 3;  1ALY A;  1AVB A;  4L0P A;  3KGL A;  3KHB A;  3NAP A;  1RUH 3;  2Z79 A;  4K40 A;  2RDQ A;  5GLZ A;  2CSG A;  4WVV A;  4FOQ A;  4CDW C;  4WM7 B;  1CJP A;  1YFU A;  5GKA C;  2WL1 A;  4CDX A;  3K77 A;  1W8N A;  3T2O A;  3J4U H;  3C3V A;  2XPJ A;  3J8F 1;  5IJR A;  4MGT A;  5HCA A;  1O4Y A;  1NE4 A;  3PVB B;  1W2T A;  4KWL A;  1Y9M A;  2RS1 2;  3WOG A;  5IT6 A;  2BV4 A;  1UZW A;  1BYH A;  3AC0 A;  3G7D A;  5J98 B;  4BM8 A;  4FPC A;  2CYF A;  2V72 A;  1E5H A;  1VBC 2;  1Y3T A;  3WG4 A;  5LRS A;  5A7Q A;  3UES A;  2W1W A;  4Y22 A;  4FPF A;  5FYZ A;  3MW2 A;  2XML A;  3WX5 A;  3JXS A;  2MPF A;  3ILR A;  1W2N A;  2EXH A;  4DEQ A;  1I3H A;  3I49 A;  1SLT A;  1UU6 A;  3ZFE B;  1VBA 2;  1KRI A;  4CDQ C;  4C91 A;  1L7Q A;  1U5I A;  1EV1 3;  3KM5 A;  1BZW A;  1F31 A;  3PUI A;  4J25 A;  2VXR A;  4HBN A;  4JC1 A;  3TN9 2;  2K46 A;  5C4W B;  3A21 A;  4CXW A;  1ZRF A;  4ASK A;  2WQZ C;  1OUX A;  4AHX A;  1VB2 A;  3H7Y A;  1T2X A;  1V6L A;  1TE1 B;  4HSJ A;  1PVX A;  4LIT A;  4ET7 A;  5JIU A;  4AGV A;  5FZO A;  3BOP A;  1DLC A;  4FVV A;  1YFW A;  4EN8 B;  3FN9 A;  1ZNP A;  4W4Z A;  1GMM A;  1A8M A;  5LWB A;  1NCQ C;  3ST7 A;  2OQ7 A;  4IV1 C;  2R1B A;  2JIC A;  2YG0 A;  1DGR A;  2YXS A;  3B00 A;  3WD5 A;  1SFP A;  5ISL A;  2QQP A;  4RS5 C;  3EBR A;  4JAA A;  3NKT A;  4LO5 B;  4Q0V A;  4QMA A;  4JKL A;  4CPB D;  1F8V A;  1H6X A;  4I01 A;  4QQP A;  5GZD A;  3N7M A;  1BLZ A;  2JB4 A;  4CVU A;  2D7F A;  5GZC A;  3LDK A;  4A2U A;  1VRH 1;  3OYW B;  4QX3 A;  1DZR A;  5EP9 A;  1S0F A;  3P1I A;  4ZS2 A;  1W2A X;  1IZ3 A;  2JDH A;  3AFK A;  1J83 A;  3CHX A;  2IC1 A;  4YGE A;  4OHW A;  4AVT A;  1BMV 2;  3GBG A;  4GH4 C;  2X10 A;  5CEH A;  2QDR A;  1OMI A;  4FFI A;  1AR9 1;  1GZC A;  3ECQ A;  3VZJ A;  4QHO A;  2RS5 1;  1DFQ A;  1S0C A;  3A0K A;  3BTA A;  3GCW A;  3C8X A;  1GWL A;  1H8T C;  4NRM A;  3WF4 A;  5F6L B;  3O1M A;  1C8M 1;  2JEC A;  2VBP A;  3GHN A;  1DQ1 A;  3POB A;  4ATE A;  4BWO A;  5ABJ A;  3VBO A;  2BBA A;  4FPE A;  2AGS A;  1LGN A;  1WA4 A;  4MGZ E;  5CZK A;  5HCH A;  2ZKL A;  2LS6 A;  3OBA A;  2IUW A;  4OYU A;  1I1E A;  3J9S A;  1V6O A;  1OOP B;  2GC1 A;  3PHM A;  5EPA A;  2WAA A;  4HOO A;  2YDE A;  3WW1 A;  5JZG B;  5FPA A;  3FHI B;  2WO2 A;  1HJF A;  1RHI 1;  3OGJ A;  4MH0 E;  1UXZ A;  4CDU A;  4C1W A;  1NAE A;  4XBL A;  4FP3 A;  4XBN A;  1LOF A;  1SLA A;  3D82 A;  4P9X A;  5H9P A;  1ZA4 A;  5FYY A;  3VB9 A;  3KV9 A;  3NAP B;  3VD5 A;  2JXA A;  5LZ6 A;  3PNA A;  4OVE A;  2ZJC A;  1A6C A;  1RVF 1;  4CDX B;  4CCJ A;  2UYB A;  4YG3 A;  4E27 A;  1K45 A;  1RMU 2;  2VD7 A;  2YHJ A;  4XIO A;  3L2Y A;  2VZV A;  3NV2 A;  1LAJ A;  1YQ5 A;  4XFB A;  4KGQ A;  4DXZ A;  4RSU A;  2O8Q A;  3WIN E;  2XL7 A;  3L2H A;  3N7L A;  2VQU A;  3N3H A;  4XIL A;  1ZRD A;  4LBN A;  4BQX A;  3UYJ A;  2ARE A;  2RS3 2;  2ZKN A;  3CJI A;  4JTO A;  3B01 A;  2W92 A;  2ARX A;  5I91 A;  4Y22 B;  3SCF A;  2L9L A;  4A6S A;  4V2W A;  3ZN6 A;  1VRH 3;  3RYP A;  2C4X A;  1BJQ A;  1C5H A;  2VZU A;  2PEL A;  3ZXE A;  2DVG A;  5DG1 A;  1CWP A;  2Y6H A;  4JRL A;  3HNM A;  4YGB A;  4YNI A;  1W06 A;  4HFS A;  3H42 B;  3W5N A;  4OI2 A;  3NJZ A;  1HQW A;  2NZ9 A;  1PK6 C;  5A3O A;  3U11 A;  1AR9 3;  4V2V A;  1MEC 1;  1QDO A;  2RS5 3;  3N7J A;  4LR4 A;  3S7E A;  4Y24 A;  4NPL A;  3SKJ E;  2Q30 A;  4QKB A;  4DQA A;  3JBG 1;  1O3Q A;  1QMJ A;  2CAV A;  2ZHM A;  1QHD A;  2HBU A;  4D7S A;  1Q56 A;  1C8M 3;  2J7M A;  4N43 A;  4UW4 A;  3WNN A;  1H9P A;  5DXD A;  2OA2 A;  1NA1 C;  4IEQ A;  5FZO B;  4CEW C;  2FCT A;  4KQ7 A;  3I8T A;  4LPL A;  3RS6 A;  4YZ3 A;  4IER A;  4KNC A;  2VZ1 A;  3WQ0 A;  3BVC A;  4C0H A;  4D69 A;  2W08 A;  3AYE A;  1OD5 A;  4NHY A;  1J3R A;  4IEV A;  3DF0 A;  5FXX A;  2DVB A;  5E6H A;  1RIT A;  1RHI 3;  4H7L A;  5JDB A;  4K9S A;  2YBP A;  2VH9 A;  4LO7 A;  4S2D A;  1BVP 1;  1O7F A;  4LJH A;  1UMI A;  1UU5 A;  2HKX A;  2XG3 A;  4IEZ A;  4OUL A;  4L97 A;  2P34 A;  2VOW A;  2VVD A;  1RVF 3;  2EXJ A;  1ZBA 1;  5DDJ 1;  3AKP A;  4LO8 A;  3MFA A;  5IVJ A;  1LHO A;  4AED A;  1JI6 A;  1WBL A;  1MQT A;  2G9Z A;  2WT0 A;  3POI A;  5IVF A;  3I4I A;  4PBO A;  3URF A;  4ARX A;  5B2G B;  3WUC A;  4HZF A;  2XHK A;  2Y34 A;  5FYU A;  4IV3 C;  4DZG A;  2XJS A;  3IDA A;  1W2U A;  1YQ8 A;  1CN1 A;  2XJP A;  4P08 A;  3AMQ A;  5FK7 A;  3S0M A;  3D0J A;  3JUU A;  1OOP C;  3CL1 A;  2ARB A;  1GZ9 A;  5ABJ B;  1RUJ 2;  1QJX 2;  1GP4 A;  3VBO B;  5JZG C;  2CGN A;  1W9S A;  4JV4 A;  2QDN A;  2WO1 A;  2YC2 A;  1IS5 A;  2IVJ A;  4Q5O A;  3UET A;  3INA A;  1LOE A;  3LZZ A;  3O0V A;  4IGO A;  1KD7 A;  1MPX A;  1W99 A;  3THD A;  3I3M A;  3IDE A;  3GJB A;  4NPM A;  4CDU B;  1QH7 A;  5KC6 A;  1MEC 3;  4BLI A;  4XHB A;  5GLU A;  1VMH A;  2Q8O A;  5C8C C;  3I59 A;  1LR5 A;  2XKP A;  3CDZ B;  3JBG 3;  2A75 A;  2ZEY A;  2WLP A;  2YY1 A;  4YVS A;  4LUM A;  3LOB A;  1X7N A;  5DN2 A;  1ZZ6 A;  3V0A A;  5GLT A;  1MS9 A;  3M3C A;  1RIR A;  1DQ4 A;  3S7I A;  3WQB A;  2YC4 A;  3MIF A;  4FTE A;  2A73 B;  4IEO A;  3CNA A;  1EV1 2;  1US3 A;  3PVE A;  4JGY A;  3ATG A;  5E88 A;  4I3G A;  3AZV A;  3VKM A;  5I0R A;  3GGL A;  1O59 A;  2BGO A;  2ZX1 A;  4Z92 B;  3LIH A;  3CJI B;  3VBR C;  1M06 G;  3CIH A;  3CMG A;  1K12 A;  4WZF A;  4Q1R A;  5FZD A;  3BTY A;  2VGD A;  4Y5T A;  4AE2 A;  3DL3 A;  3ZN6 B;  3GJA A;  1FAT A;  3HQX A;  2WA4 A;  1HX6 A;  2H0B A;  4EWE A;  1T6B X;  1ZBA 3;  5DDJ 3;  4Z07 A;  3ZSL A;  1JYN A;  1CIY A;  4QX2 A;  4BIF A;  5KR7 A;  1KFU L;  1W9W A;  3N36 A;  4LE4 A;  2XUE A;  1HB3 A;  2B7Y A;  4BQY A;  1MS8 A;  3ZYI B;  5LA2 A;  2FDF A;  4OUE A;  4WV8 A;  2IVI B;  4BE3 A;  3RNS A;  5B4X A;  1UZ0 A;  1VAV A;  2VJX A;  4N43 B;  2HEV F;  2DU0 A;  2W3J A;  2XQX A;  4YM1 A;  3ZDV A;  1ENQ A;  4FPO B;  4QT6 A;  4YM3 A;  2LTN A;  1XSQ A;  2EIG A;  2P3Y A;  1GLH A;  2D6N A;  5J37 A;  2VMC A;  5C3S A;  1SLL A;  4GWN A;  3H50 A;  1RL3 A;  2VMG A;  2ZPX A;  2BNO A;  3BCW A;  3ETP A;  1SCR A;  3DKW A;  4LBJ A;  2FDJ A;  3ZYB A;  5IYY A;  2QQK A;  5K0U C;  2I07 B;  4MOA A;  5BPX A;  5IFP A;  1BK0 A;  1REE A;  5CFD A;  3IMN A;  3RZH A;  3THP A;  4AI9 A;  1SHW B;  2D6O X;  2OYZ A;  2R0H A;  5HCB A;  1VIW B;  4NIG A;  4IL7 A;  2GAL A;  5CNA A;  3ILN A;  2D44 A;  4BQ2 A;  2XOM A;  4QM8 A;  1PM7 A;  1F2N A;  1S0D A;  2O8O A;  2PYT A;  2WFF 2;  4HKL A;  5BY5 A;  1W28 A;  1OA2 A;  3MW3 A;  3WR0 A;  1QIQ A;  1WLC A;  5JAX A;  5JXI A;  1FYU A;  1ENS A;  3MUZ 1;  4B7K A;  4OI4 A;  3FL7 A;  5F5I A;  4AED B;  1MQT B;  5BYN A;  3NV3 A;  2D5F A;  4RQP A;  1GOH A;  1UAI A;  4FFF A;  5KHG A;  2EID A;  4UXA A;  3ZOI A;  5APA A;  1APN A;  4XFF A;  3IB3 A;  4FCA A;  3NNM A;  4HK9 A;  3N7K A;  2YZ4 A;  4DEV A;  4DFS A;  5F6K A;  1J3P A;  3H1M A;  4YLZ A;  4YG0 A;  3ZXG A;  3ZSJ A;  1QOT A;  5A1A A;  5L36 A;  1HXS 3;  2WZR 1;  4CPB A;  1OF3 A;  3RMX A;  1Y4W A;  2HEW F;  1MAC A;  1ZA7 A;  3DYO A;  4LBM A;  2J42 A;  5D2A A;  5FZM A;  5G04 L;  2Q0A A;  4YWA A;  3S30 A;  2WFP A;  5A3N A;  4ZZ5 A;  5CVR A;  2HWF 2;  2WDB A;  1O8P A;  4P9J A;  5DZF A;  5EJ3 A;  1UIK A;  4D6S A;  5JWP A;  4RHV 1;  1DBN A;  1COV 1;  3I59 B;  2W52 A;  3WNP A;  3GZE A;  3NST A;  4NHM A;  1OBN A;  3I2F A;  2P37 A;  4CCE A;  4FO9 A;  4YVS B;  1VRH 2;  4S2F A;  5FRE A;  4HPK A;  5LY1 A;  4KWU A;  3V0A B;  2DBN A;  1UYX A;  2R04 1;  1LOC A;  1NKG A;  2ADE A;  2DF7 A;  2NYY A;  2VY0 A;  4PLN A;  3CZU A;  1RUC 2;  3OGR A;  2D5H A;  4JQR A;  4JGY B;  3ABZ A;  2ZGM A;  4YZ2 A;  5IVV A;  1DP0 A;  1JUI A;  3C2U A;  1W90 A;  2AEY A;  3GBF A;  5D8A A;  3KV6 A;  1PM4 A;  4B3N A;  1LOA A;  2Z5W A;  4QX0 A;  4OI0 A;  3MID A;  5F2W A;  2GC0 A;  3KMH A;  3VDD C;  1W04 A;  5AFB A;  3VL9 A;  1TMF 2;  5FFO C;  3IZO A;  2QQJ A;  4CP9 A;  4N53 A;  3RWK X;  3BPZ A;  1SG3 A;  2W0X A;  2XR4 A;  4QQL A;  2C9K A;  3USU A;  3RMY A;  1PNF A;  3C7F A;  3CKH A;  1S2B A;  5JPM B;  5F3I A;  2VQA A;  2FDG A;  1ULF A;  2CDO A;  2DUR A;  4BDV B;  5IAX A;  4IE4 A;  4XAA A;  5FZC A;  3KD4 A;  5IW0 A;  3MLJ A;  1FPN 1;  3SQO A;  4CA9 A;  5FP4 A;  5JOW A;  5F37 A;  2XVL A;  2AEN A;  2W95 A;  3LPF A;  2LW8 A;  5A1L A;  4F8A A;  2IFW A;  1HRV 1;  2BOJ A;  4QPG A;  4LT5 A;  5G05 L;  3MPB A;  3MIH A;  1ENR A;  1UYZ A;  5E1R A;  4D6Q A;  1W3V A;  3ZFF C;  3J7M A;  3TOJ A;  4JCK A;  1BVV A;  5CFD B;  2HWC 1;  3PUQ A;  3VBH A;  2CHH A;  2QTW B;  1LED A;  4JRA A;  4RHV 3;  2Y6J A;  2A71 A;  5FXW A;  1ND2 A;  1COV 3;  1ULO A;  3KB5 A;  5GZE A;  2SBA A;  4CUC A;  3K46 A;  3O1O A;  4QKN A;  2JDU A;  1HLC A;  2GC2 A;  2VXJ A;  3HAG A;  3ON7 A;  2FDK A;  2G9F A;  1ZZ7 A;  2R04 3;  2VVE A;  3NQH A;  3I7D A;  3ZM8 A;  5JIA A;  3JCI A;  3C7G A;  5SV5 A;  3HQR A;  2QCS B;  1QDC A;  2XGX A;  4CZS A;  4ERO A;  2NM1 A;  2DVA A;  4RQP B;  4GWJ A;  2AH2 A;  1UPI A;  4H55 A;  2Q8D A;  4E2Q A;  1F15 A;  1KFX L;  4LHN A;  3MIC A;  3C7H A;  2XL9 A;  1MEC 2;  4I0W B;  2G19 A;  2HWB 1;  5DAW A;  4EQV A;  3PDQ A;  3VZL A;  3GYD A;  2Q1Z B;  3ORJ A;  5L9R A;  1IPS A;  3ZO0 B;  2E26 A;  3E1F 1;  1AYM 1;  1LNS A;  4R52 A;  1Z7S 2;  4OQ8 A;  4MGI E;  2YUE A;  2E53 A;  2PTM A;  2XLA A;  3ZDS A;  2JKX A;  2WO3 A;  4YFZ A;  1PGL 1;  3VZM A;  1VAM A;  4BIS A;  3MW4 A;  1FPN 3;  3PL0 A;  5F5C A;  5J09 A;  2G4I A;  1YEW A;  1PIV 1;  3JQW A;  1QQP 2;  1LEC A;  1LKN A;  1WA6 X;  2VM9 A;  4HPK B;  5C9A C;  1AJO A;  5I8T A;  4AHW A;  1ZBA 2;  1UF2 C;  5DDJ 2;  4HVQ A;  3WQ7 A;  2OVU A;  1RUO A;  4MVT A;  3AKR A;  3MYX A;  3QD6 A;  2SLI A;  2ZTN A;  1K5M A;  3POW A;  5D8A B;  4AHY A;  1UKR A;  1Q43 A;  2P6H A;  4BK4 A;  2QNK A;  5BNN C;  4CCO A;  2HWC 3;  2PFW A;  1EAH 2;  5FP9 A;  4WVZ A;  3Q8F A;  4JVA A;  1FI2 A;  3WP5 A;  4A3Z A;  3DKQ A;  1W6O A;  2Y60 A;  3KQR A;  3PIJ A;  4OMC A;  1W9T A;  3MLL A;  4CP9 B;  4N53 B;  3B9C A;  4QXH A;  4B4Q A;  1UMZ A;  1H1M A;  5L73 A;  3PVN A;  1QF3 A;  3USU B;  3FMG A;  1GWM A;  5HV0 A;  2WNU A;  2Y0O A;  3V56 A;  1A34 A;  2Q5T A;  4D94 A;  1YQ2 A;  5T55 A;  2JDA A;  1RB8 G;  4KG0 A;  4DOU A;  3IAQ A;  4N7U A;  4KGG A;  5FZG A;  1NY7 2;  5LEK A;  4GMP 0;  3PVO A;  2C26 A;  4FPH A;  3A0N A;  2A3W A;  1NUK A;  2A6Y A;  2RJL A;  4O65 A;  2HWB 3;  4GD4 A;  5HPO A;  5IK7 A;  4LKS A;  4AVA A;  1OSG A;  4AL9 A;  2PHD A;  1LHV A;  4E4Z A;  1WW5 A;  2Y6K A;  4SLI A;  5FLH A;  2IXL A;  4BQ4 A;  1JYI A;  1XE8 A;  2MEV 2;  4QPG B;  2RV9 A;  2ET7 A;  2VW0 A;  1FMD 2;  1LRH A;  5DAQ A;  4NMI A;  5D21 A;  4XUP A;  1AYM 3;  3S5A A;  1NQJ A;  1NCR A;  2XJR A;  4NAO A;  3HWJ A;  3UKN A;  3UNP A;  3ILF A;  3H0O A;  3WP3 A;  1QNW A;  1YJL A;  4QB6 A;  1WWY A;  3VBH B;  4PLM A;  5I0S A;  2J1V A;  5LCW L;  1ND2 B;  1VBB 1;  2JDY A;  3WDU A;  1HXS 2;  5JR2 A;  4P5Y A;  4AQT A;  4QPW A;  2R49 A;  4PDW A;  4FPG A;  1PIV 3;  4MXV A;  1JZ5 A;  5IK5 A;  2ZX0 A;  3MHZ A;  2WYS A;  2RVA A;  3LFM A;  5IWF A;  4M4R A;  3ZSE A;  1WMX A;  2K0G A;  3IAP A;  5KXE A;  4AFA A;  3POG A;  4XFH A;  2YPD A;  5GLW A;  3RQ0 A;  3IDB B;  1Q3E A;  2XH6 A;  4MGS A;  2OPK A;  1XNB A;  2RM2 2;  4R9D A;  5DG2 A;  1LU1 A;  1R1A 1;  3AP4 A;  3DYP A;  3WUD A;  2J1U A;  3E5X A;  2VTX J;  3VBF A;  3WDV A;  5FZ1 A;  4Q0P A;  3AL5 A;  1YUD A;  2HWD 2;  2B42 B;  1RGS A;  2ZZJ A;  3U78 A;  3X29 B;  5J36 A;  4KWK A;  2WWS A;  1C3H A;  1TME 2;  3WF2 A;  1NOV A;  3DPR C;  4LIU A;  4AI2 A;  4S2G A;  4GJY A;  2BQP A;  4BME A;  3KCY A;  2XXZ A;  4XDP A;  3POY A;  5FYI A;  4YZ5 A;  1JZ7 A;  2JEN A;  1HDK A;  1JH5 A;  4H3W A;  3SIS A;  1LU2 A;  2ZXQ A;  3WNX A;  3WQ1 A;  3T1M A;  1CD3 G;  4BXF A;  3S57 A;  4MYE A;  4B4P A;  3CBN A;  4Z82 A;  3CQO A;  4XJW A;  3DCQ A;  2BWA A;  2XON A;  3O1P A;  1IKP A;  1RUI 1;  4YRD A;  1LHU A;  5GZG A;  2FCV A;  1K5M B;  3OF1 A;  1J84 A;  1I9R A;  4BQ1 A;  1WLD A;  5EJ1 B;  5T3N A;  5JI9 A;  3BIE A;  2CGP A;  3LEG A;  1AUY A;  5FOJ B;  1DDL A;  1DF0 A;  2KD7 A;  3SLI A;  2ZAA A;  3MUY 1;  1CAV A;  4LK7 A;  4NII A;  3I3D A;  2OKX A;  1QWR A;  3GXU A;  5FY7 A;  1IS3 A;  5FZF A;  1VBB 3;  1SEF A;  4YGD A;  5KHH A;  3VBU A;  1W6O B;  3ZIW A;  2QKD A;  4LK6 A;  4C1X A;  1AR7 1;  2X05 A;  1AL2 3;  1V0A A;  1V6J A;  4Y4R A;  5DZG A;  2JWP A;  4TXW A;  2WNU B;  4AXO A;  4AQS A;  1N3O A;  2ILM A;  1NLS A;  2EA7 A;  1KS4 A;  2ZGP A;  1SLB A;  1UOF A;  4QXC A;  5DAB A;  3W59 A;  4FPL A;  2UUR A;  3VL8 A;  4I30 A;  4C90 A;  3OPT A;  3ZYJ B;  1J1L A;  3VD4 A;  4RHV 2;  4DO0 A;  3NNG A;  4IEY A;  4JQT A;  2WKK A;  3WHU A;  1R1A 3;  4CU9 A;  1P8J A;  1W6Q A;  2WS9 1;  1TZO A;  1N3P A;  2B5H A;  4GWM A;  1HQN A;  4QX5 A;  3ZYH A;  5IUQ A;  2JDM A;  5FR3 A;  3LGR A;  2DFB A;  2P3I A;  2VO5 A;  3WVJ A;  5B4N A;  2GNM A;  1DLL A;  1R09 1;  5BNP C;  1VJ2 A;  4UBG A;  1RUD 1;  1SPP A;  2PHW A;  5FZ9 A;  4W6W A;  2XDV A;  1NCR B;  3OD0 A;  2XBO 1;  4RR3 A;  4YYO A;  4NUB A;  3P5B A;  4CU6 A;  5CIS A;  2J1R A;  4AI1 A;  1OFS A;  4HVO A;  1V9U 3;  4QD2 A;  5FZK A;  1ULC A;  2BZD A;  3HMY A;  3NRU A;  1HN0 A;  2C24 A;  4HVR A;  4LE3 A;  4LUK A;  4YW1 A;  1B35 C;  1GUI A;  4GAZ A;  5LRR A;  5ACA 1;  1W8F A;  2PLV 2;  5LEJ A;  3POJ A;  5GM0 A;  3IPV A;  3VZN A;  4CUB A;  4AI3 A;  1FNZ A;  4PDW B;  4OHX A;  2PQQ A;  2NLR A;  2Z2S B;  4Q4W 2;  3VDC A;  5IAV A;  1N1S A;  2WRA A;  3GAL A;  1W03 A;  4XE9 A;  2ADD A;  4NWW A;  3H3U A;  1RUI 3;  5FYM A;  4YSF A;  1YWK A;  3B5L B;  1XU2 A;  1XRU A;  1AR6 1;  3IT8 A;  2WC2 A;  1UXX X;  4HXC A;  5C3Q A;  3BU7 A;  2WZE A;  1Z78 A;  3AYC A;  2VZR A;  4M0N A;  1X8E A;  2PAE A;  2QQW A;  2BER A;  2C1F A;  4UAP A;  4WM8 A;  3VBF B;  1BHG A;  5LAS A;  1DGW A;  4GA9 A;  1QJF A;  4Y1X A;  4DUV A;  4BA6 A;  1MVQ A;  1AR7 3;  5FYS A;  1MZ6 A;  1VBE 1;  5J1X A;  1W9F A;  4QQO A;  4MGY E;  4NHX A;  1PNG A;  1YXW A;  2X09 A;  2WNV C;  4YVW C;  5FMD A;  1NE6 A;  4EWD A;  1UYY A;  4MAD A;  3WG2 A;  4EZH A;  1UCX A;  5GJ6 A;  1JHN A;  3PMS A;  4RFT 0;  1H4H A;  4HKW A;  5F3C A;  2P3K A;  3ZXK A;  3ZFG C;  4DXS A;  3EB7 A;  3J8F 3;  1O3T A;  2JB8 A;  4FQZ A;  3POS A;  4NWV A;  3WXP A;  1ZYB A;  2WS9 3;  4Y1V A;  4E8C A;  1O8S A;  2YB7 A;  5LAT A;  4EE2 A;  3LQC A;  4HSL A;  1R09 3;  2YGL A;  1WCK A;  5FPU A;  3LWC A;  4XUR A;  2E33 A;  2XBO 3;  1NLQ A;  2Y38 A;  5FYH A;  2A70 A;  3N35 A;  1J1T A;  2MNG A;  1WME A;  4WZC A;  2VQ0 A;  1UW8 A;  5DUU A;  1OUR A;  2EAL A;  1DQ0 A;  2ET1 A;  4LUL A;  4OLL A;  5A7W A;  3TEW A;  1CAV B;  4QQ2 A;  2CAU A;  5BXX A;  2P2K A;  2HWB 2;  5ACA 3;  4BOW A;  2WNU C;  4LHS A;  4D7Y A;  2YPJ A;  2ZGO A;  1GSL A;  1V6N A;  3C7O A;  4GIQ A;  3UJQ A;  3VBU B;  4E8D A;  2WNE A;  3TNQ A;  3WW2 A;  1JS9 A;  5KC5 A;  4WM7 C;  2E7T A;  3FFQ A;  4NID A;  1UPS A;  1W8W A;  1XJA A;  1TNF A;  1YRZ A;  2BJS A;  1X9P A;  3HBZ A;  1AYM 2;  2OII A;  5BNO A;  4L9B A;  4Q2F A;  1U0A A;  5FV3 A;  3UV9 A;  2PAK A;  4PI0 A;  3VUO A;  5CU1 A;  5T50 A;  1AR6 3;  2G1M A;  2PHT A;  3ZKY A;  2DCZ A;  1HRI 2;  1W0O A;  4LBO A;  3C7E A;  1MZF A;  3K3N A;  2RDS A;  4GAL A;  4U36 A;  4UOJ A;  2XHN A;  3IKW A;  4E9K A;  1FOD 2;  1W6Q B;  3LD8 A;  1AR8 2;  4YW6 A;  1BBT 1;  2GN7 A;  3RZL A;  1VBE 3;  1WKY A;  4AFB A;  1SDD B;  4FXG B;  5FWJ A;  3GHM A;  2JE7 A;  2CY6 A;  2Q8E A;  3ZFE C;  1O6U A;  1F4A A;  1D0H A;  1SPP B;  1W8U A;  2O14 A;  2ZOE B;  3ZR5 A;  4GXL A;  4ATF A;  4RR3 B;  2BU9 A;  1S1A A;  1N1V A;  5LK7 B;  3GZA A;  3O1R A;  4B4R A;  3ROU A;  4AGR A;  3UL2 A;  5C4W C;  3MBW A;  2H6B A;  4MO3 M;  5LY2 A;  4QQH A;  3DEC A;  3LA3 A;  3IPV B;  1BQP A;  3AMM A;  3WHT A;  4LBQ A;  1JZ2 A;  1ASJ 2;  4NAM A;  1ULP A;  1YCI A;  4Q27 A;  3WEZ A;  1D2S A;  1LEN A;  3R0R A;  1IQD C;  1W6M A;  4EN7 B;  2A1X A;  4QXB A;  3O1U A;  2AUY A;  5T5J A;  1QJY 2;  1YFX A;  4QDQ A;  3T1L A;  1D7P M;  1HIX A;  2QE3 A;  4D3W A;  3ACI A;  4NHL A;  4UYB A;  3IDC B;  1H4G A;  1LGC A;  4WM8 B;  5JOY A;  2OUH A;  2WAO A;  4U2A A;  1PVC 1;  3ZSM A;  2ZHN A;  2R06 1;  3OGG A;  4XMI A;  3RDI A;  4LLF A;  2JG8 A;  4IW3 A;  1QOS A;  3I2I A;  3JD7 2;  5FMO L;  1AHS A;  1YFY A;  3POF A;  4K6B A;  4YPJ A;  3KT7 A;  1E5S A;  5LK5 A;  1UIJ A;  5FLI A;  4COV A;  3ZX7 A;  1OH3 A;  2H6C A;  3FHQ A;  4QU2 A;  2W47 A;  3CF6 E;  1S2E A;  2AEZ A;  5JPN B;  4FSJ A;  1VR3 A;  3ZVX A;  5J7M A;  3WNK A;  4XZU G;  5CBL A;  5C33 A;  2GU9 A;  1S55 A;  2WQ8 A;  3N9Q A;  1SZB A;  2VME A;  1RIN A;  3IWZ A;  1XE0 A;  4LKF A;  2ZBJ A;  4XFA A;  3LEM A;  1G9C A;  4QU1 A;  3HT2 A;  1BBT 3;  1PO1 1;  1AL2 2;  1XPW A;  1ZRI A;  4NRP A;  1AYN 2;  3DXT A;  1DQ6 A;  2Y0I A;  4ASL A;  4I3P A;  1RUF 1;  2JIG A;  2WT2 A;  1H2K A;  4LKD A;  1CZV A;  1RUH 2;  4L2N A;  3NKG A;  1HB1 A;  1VBD 1;  4YZ4 A;  4PCR A;  2E9Q A;  3ZMN A;  2E31 A;  2ZGN A;  1US2 A;  4HN1 A;  5IVB A;  4CEY A;  1Y43 B;  5A7W B;  1WCS A;  5FP7 A;  3O1T A;  3BTX A;  1R1A 2;  3AFG A;  4P02 B;  2P17 A;  1GQG A;  3NAP C;  2VCM A;  1XNC A;  1GZT A;  3D3A A;  2ORX A;  3S5Q A;  5DUW A;  1KJL A;  1JOD A;  1NZC A;  5LBC A;  2NQY A;  1JMU B;  4CDX C;  2WBK A;  3T09 A;  1PGW 1;  5BNO B;  3RZM A;  2OX0 A;  5ANN A;  4BJ0 A;  1PMH X;  4JDM A;  4QDS A;  1UY3 A;  1QXJ A;  1H0B A;  1H2L A;  1OHF A;  1V9U 2;  3N9N A;  5T52 A;  1W0P A;  2XUM A;  5HI0 A;  1JOB A;  4P14 A;  3D5O A;  3WW3 A;  4FPY A;  1N3Q A;  2ORZ A;  3ME2 A;  5CYY A;  4H2A A;  3AM2 A;  4FXK B;  1CJD A;  5FZ3 A;  3RG0 A;  3VN4 A;  3T0B A;  3AP5 A;  1PVC 3;  3ZXL A;  1O3S A;  1U5Z A;  2R06 3;  3J7L A;  4XF1 A;  1EPW A;  4HAN A;  1IQA A;  3AXE A;  3I2G A;  3V0B A;  2D6P A;  2KM2 A;  5FAX A;  3ZYR A;  2UYA A;  4NOT A;  5IK8 A;  3TYJ A;  1VMF A;  1RUI 2;  1XB9 A;  2FZ2 A;  3R6S A;  3WNM A;  5HBA A;  1AJK A;  5FYT A;  4HET A;  3H1W A;  5T54 A;  3NJX A;  4OCT A;  1PGS A;  2AAC A;  3RWN A;  4IEX A;  2VR4 A;  5J48 A;  1WGP A;  1S0E A;  2R1D A;  3BI3 A;  5FZH A;  4B29 A;  1CR7 A;  3NWK A;  3PUH A;  4BLJ A;  4IEU A;  4LBQ B;  1V6M A;  2HH9 A;  4O61 A;  3MIG A;  3FFZ A;  4AQ6 A;  1HV0 A;  1QXR A;  4IEP A;  4A7Z A;  1PO1 3;  2JDK A;  3EJK A;  2VPV A;  1W6M B;  5FMB A;  1RUF 3;  4ES8 A;  4IE0 A;  4QWN A;  3P3N A;  5FZ6 A;  4LMF A;  3K51 A;  3LEI A;  4ES9 A;  2Q8C A;  4OHZ A;  3RI9 A;  1VBD 3;  3BKZ A;  3QCW A;  5F3E A;  1Q8V A;  1ZBE 1;  3KF5 A;  4Y1U A;  3H8R A;  1G6N A;  1LB2 A;  1NXM A;  1Q8P A;  4BQW A;  3J8F 2;  4PF1 A;  1UL9 A;  2YYO A;  4XTP A;  1DGR N;  5FBZ A;  5A6Z A;  4Q1P A;  2VZS A;  3QH6 A;  5H9R A;  3D4K A;  3KCC A;  2VUC A;  4NJ4 A;  4ZY9 A;  5FJH A;  4L92 A;  5DPN A;  4LQR A;  3MV1 1;  2JG8 B;  4LXL A;  5AVA A;  1KDM A;  3APB A;  4JGZ A;  3FWE A;  1T6G C;  4LA3 A;  1TVG A;  1R09 2;  1SBD A;  4QHZ A;  2BW8 A;  2ZGS A;  2B39 A;  2QUO A;  4DUW A;  1B09 A;  3LDR A;  2X5I A;  4KWJ A;  3I2D A;  2XBO 2;  4YW3 A;  1RUE 1;  1K42 A;  2ARC A;  5F3G A;  2HYX A;  1YLL A;  1UQX A;  4QX8 A;  2JG9 A;  4S2H A;  2WR9 A;  4DPN A;  5M0T A;  3AP9 A;  3WV6 A;  1UZZ A;  3TBD A;  5FO9 B;  2ZGQ A;  3DV8 A;  4JHT A;  3Q8B A;  5ABJ C;  2RMU 1;  1GWK A;  4EN6 B;  3VBO C;  2F4L A;  4KH9 A;  1C5I A;  1I5P A;  4HT1 T;  4XOG A;  4BHP A;  4BQ3 A;  2J1S A;  1AF9 A;  4KU7 A;  4QKD A;  2QQV A;  1IG3 A;  4DRR A;  3TNP B;  2JIJ A;  4Z2W A;  2JX9 A;  2PN5 A;  1W6P A;  3AKQ A;  2D40 A;  3L9J T;  1AR6 2;  2X29 A;  4E4H A;  1LCL A;  4XAB A;  4ARY A;  1AL0 G;  4CDU C;  4CEY B;  2K2S A;  1JTZ X;  1LOF C;  3F95 A;  4R4X A;  2VOK A;  3DUI A;  5FUN A;  5L19 A;  1LHN A;  4FOY A;  2VNG A;  4PLO A;  2A3X A;  3K3O A;  4K3U A;  3D0S A;  5FOB B;  1VBE 2;  5E8A A;  3BIW E;  1YQ6 A;  2BNM A;  3WDW A;  1HB2 A;  2ZX4 A;  2DWR A;  2J22 A;  3GF6 A;  2VW1 A;  3HNB M;  4QDR A;  3U75 A;  3H8O A;  2Y6G A;  4DY3 A;  2PHF A;  1UU4 A;  3KVB A;  3TEZ A;  1ZBE 3;  5AC9 1;  4IEW A;  3VDB A;  1HJG A;  3I2H A;  5FY9 A;  4Y3O A;  3NV4 A;  3CJI C;  4XXP A;  3HBK A;  2LRO A;  1QJU 1;  3ELN A;  2OW4 A;  5HCF A;  4XQ4 A;  3E97 A;  2GC3 A;  2WZ8 A;  4G3Y C;  1AR9 2;  4V1P A;  5F39 A;  2RS5 2;  3K48 A;  5JI7 A;  2BBV A;  4XUT A;  2UU8 A;  4ZPI A;  2W9X A;  2YU1 A;  4OQ9 A;  3SEE A;  1TNR A;  3V0B B;  4GKX A;  1OUS A;  1WLT A;  1C8M 2;  1PMJ X;  5FXV A;  3H8U A;  1PZ9 A;  2VZT A;  2RS1 1;  3TB0 A;  1RUE 3;  3AMP A;  4QGL A;  4Y4Y A;  3WZ1 A;  5C3P A;  1RED A;  3E5U A;  2PHU A;  3T0A A;  3TAY A;  4Q0Q A;  1G9D A;  1QJZ A;  1VBC 1;  3LKJ A;  1GQH A;  4XJ9 A;  4XW3 A;  5FUI A;  1BXH A;  4AEM A;  4N43 C;  3SC7 X;  1RUG 1;  5FTT C;  2RR1 1;  1RHI 2;  4X8P A;  3D6E A;  1IGO A;  1IG0 A;  1CPM A;  1PX4 A;  1AX0 A;  3WF1 A;  2GME A;  3ACH A;  4PF5 A;  1VBA 1;  3KWV A;  1S0J A;  1QY4 A;  4B8E A;  1XNK A;  5CFC A;  4TLF A;  1WD3 A;  1WW7 A;  2B9V A;  2RHP A;  2WZR 3;  4UW5 A;  4JDO A;  4XIK A;  2JDZ A;  1IPK A;  1GV9 A;  1RVF 2;  4RD7 A;  3TN9 1;  4PIZ A;  2VMI A;  5A3P A;  3IM0 A;  1FXZ A;  4IQP A;  1TG7 A;  3MFC A;  4LA2 A;  2E63 A;  2UWA A;  4AQ2 A;  5A7O A;  4CRQ A;  3MF6 A;  5CG9 A;  3O14 A;  4EN0 A;  2VCB A;  4D7T A;  2ZHK A;  4RA0 A;  5L7O A;  1YNA A;  1XC6 A;  3OG2 A;  2EXI A;  4JGZ B;  1UOG A;  1KIT A;  2BPA 2;  2EAA A;  5EZW A;  1KQR A;  3TEY A;  4TLG A;  3MIE A;  3ZMO A;  2X5I B;  4AED C;  1MQT C;  1IHM A;  3MGU A;  3WG1 A;  4CDW A;  4NR1 A;  2XVK A;  3PUR A;  3SH4 A;  4FTS A;  1W0N A;  5AC9 3;  4GUL A;  3VHP A;  2JG9 B;  3WP6 A;  1XYN A;  4MET A;  1OLR A;  4BZ4 A;  2B8M A;  1E5R A;  1QJU 3;  1Z0H A;  1XYO A;  1GOF A;  2BWC A;  3UKV A;  3V64 A;  5E16 A;  4CCD A;  1HN1 A;  3I54 A;  4XPV A;  3JQX A;  3HJR A;  5I0D A;  2DBI A;  4KG8 A;  2HWE 1;  3B3Q E;  1JHJ A;  1OPO A;  2QFE A;  3JBG 2;  2A6V A;  2GMP A;  4IGP A;  4ZXE A;  2WZP P;  4CYD A;  4WBB A;  5FBJ A;  1BMV 1;  4NRO A;  1W6P B;  3AJZ A;  5DAP A;  1G7Y A;  2RS1 3;  1Y7B A;  4UWD A;  2H0V A;  4Y1Z A;  5FMO S;  1MS4 A;  3NJY A;  4JKK A;  3JB8 A;  5F9T A;  1VBC 3;  2NMN A;  2X53 S;  4CDQ A;  4A42 A;  4COY A;  5CA6 A;  3VD9 A;  3HOB A;  4AGG A;  4M4P A;  4ZU4 A;  2I2S A;  3J7N A;  1IS4 A;  3AKT A;  4XJA A;  1RUG 3;  3LEK A;  3WP4 A;  2R06 2;  2RR1 3;  4M00 A;  4YVS C;  3SKV A;  3LCP A;  4EV0 A;  1NYW A;  3FZ3 A;  4ZZ8 A;  3WDX A;  2CGO A;  4Y5S A;  3H8X A;  5DUX A;  1UMH A;  1VBA 3;  3RGB A;  3A23 A;  4FFH A;  5T5P A;  4M0H A;  3ACL A;  3ZYF A;  5KWR A;  4JGY C;  3KSC A;  4JTN A;  1QNY A;  5A6X A;  4MZU A;  1HRV 3;  1NCQ A;  3Q9O A;  2EVX A;  3E6B A;  2BEO A;  3A4U A;  4IV1 A;  4R8H A;  5FY8 A;  4UT5 A;  3RYR A;  3VHO A;  3ZPY A;  5BUV A;  3U37 A;  1AXZ A;  2D3P A;  4NN0 A;  2QJV A;  4RS5 A;  5J3U A;  1PO1 2;  3GZU C;  4KI5 M;  3LIG A;  3NJV A;  1RUF 2;  4CUG A;  2F17 A;  3H9A A;  1VAL A;  4XJ8 A;  1WCU A;  5FP8 A;  5IVY A;  1W9Y A;  1FAY A;  1CZT A;  4C0B A;  3OPW A;  1J59 A;  4I2O A;  5K4L A;  1YIF A;  2RS3 1;  1VPH A;  5JVV A;  2WUH A;  2VTF A;  4GH4 A;  4OZX A;  4DB5 A;  4FPJ A;  3FLR A;  1JZ4 A;  2D3R A;  3KV5 A;  1GNH A;  1CES A;  2QQU A;  2JE8 A;  4D8M A;  4W6X A;  3QOP A;  1H8T A;  2HWE 3;  1QEX A;  4P9G A;  3TRS B;  1O3R A;  3VV1 A;  1FNY A;  1SBF A;  5CFC B;  2VEC A;  1HV1 A;  3AXD A;  4AI8 A;  2N7G A;  3T2Q A;  3K4Z A;  4DY5 A;  1ST8 A;  2TNF A;  3RSJ A;  3MIB A;  5AVP A;  2XJU A;  2VZ3 A;  3O1V A;  2V4V A;  5CIR A;  5CFD C;  3FBY A;  2ERF A;  3QBQ A;  1CZS A;  1Q8O A;  4I09 A;  3VKL A;  1W8O A;  3FBM A;  2IXJ A;  4JZR A;  3UKT A;  3MPP G;  4NE9 A;  4NHK A;  4O9G A;  4MGQ A;  4AVS A;  4P9W A;  4Y33 A;  2FMD A;  4TYS A;  5L7O B;  1WMF A;  1GQP A;  1DCS A;  4A4A A;  2BYV E;  2WQ4 A;  4CUA A;  5FQ0 A;  4BQ5 A;  4GMP 1;  2VNO A;  1AXK A;  3CZJ A;  3HR9 A;  4RQP C;  4CDW B;  4AFD A;  3PU3 A;  4BYY A;  1V6I A;  1KEX A;  1PO2 1;  5I8S A;  1EY2 A;  1WD4 A;  1WCD J;  1L7R A;  1UZV A;  2ZX3 A;  1J3Q A;  3AK0 A;  3AP7 A;  2K9Z A;  2ZZQ A;  1C28 A;  1ZZ9 A;  2DUP A;  1DG6 A;  1MR5 A;  3PJQ A;  3NNL A;  2VCC A;  1EUT A;  3ZPO A;  1GP5 A;  4UF0 A;  5KHK A;  5CAZ A;  4JX0 A;  2LRP A;  3WF3 A;  3K75 B;  2CTV A;  2D6M A;  1YYN A;  1ZZ8 A;  2FMY A;  1Y9G A;  4ZXK A;  1DGW X;  4GWI A;  5C3O A;  1WMD A;  2RS3 3;  2R0F A;  3M3O A;  4EZ4 A;  4CDQ B;  1MS3 A;  1YJK A;  3GZT B;  4AVV A;  4XUQ A;  4XVH A;  1VMJ A;  1H8V A;  2YBK A;  4R4Z A;  5F2S A;  3SIT A;  2ZHL A;  3OGS A;  5EYX A;  1PK6 A;  1FV2 A;  1QJX 1;  1RUJ 1;  1OQE A;  3LFI A;  4RL7 A;  1GNZ A;  4XET A;  2J1E A;  3U14 A;  3FLT A;  4M3C E;  4RGK A;  4K7J A;  2ZS6 B;  3RI8 A;  1UY2 A;  3FJS A;  5IFT A;  4NRQ A;  3ZSK A;  2A7A A;  3D8C A;  4YW5 A;  3LSE A;  5KHJ A;  1N1T A;  3KCX A;  1NA1 A;  1MS5 A;  3FE5 A;  4Q4X 1;  4L11 A;  2ZML A;  1YI9 A;  3III A;  4M3C A;  1H2M A;  1LOD A;  2V5Y A;  4MX3 A;  2X8K A;  5D8A C;  5A3L A;  1UOB A;  5FKC A;  5J96 B;  1NCQ B;  1QXP A;  2VNV A;  1X82 A;  2BVB A;  2WWJ A;  3ETQ A;  4HKO A;  3OEA A;  5A3T A;  1F35 A;  4Q4Y 1;  5FPB A;  1JYT A;  5LA0 A;  4TWT A;  5C70 A;  2W91 A;  4P9Y A;  4O9E A;  4RS5 B;  3HT1 A;  1EUU A;  1GBG A;  4UW6 A;  3UJO A;  3CO2 A;  2QZ2 A;  2RJ2 A;  4N53 C;  4AOC A;  3PUS A;  2NPI A;  2OPW A;  1XU1 A;  2RDN A;  3BOD A;  3MV0 1;  4GMP 3;  3O5S A;  5A3M A;  2WZR 2;  3M2M A;  1JZ6 A;  5DAV A;  1A3K A;  4A41 A;  2DYC A;  2OS2 A;  1PO2 3;  2MHF A;  1BKZ A;  1ZRR A;  4IE5 A;  1UN1 A;  1ULD A;  2JDN A;  4YM0 A;  1LUL A;  4GH4 B;  3W58 A;  4MSV A;  4PQQ A;  1SAC A;  1YC6 1;  4AVB A;  2OXB A;  1CIW A;  1OI6 A;  3NV1 A;  3O12 A;  4IV3 A;  5JOX A;  5CKN A;  3K4D A;  1S0I A;  1H8T B;  2UWB A;  4QPG C;  1OF4 A;  4XUN A;  4QPY A;  1W2O A;  4OMD A;  2VUL A;  1COV 2;  1LGB A;  3VGI A;  3ZYP A;  4LO6 B;  3HPN A;  3OUJ A;  4Q0U A;  2JJ6 A;  4Q0S A;  3OJB A;  5FZ7 A;  4MGK E;  2VOV A;  5FPL A;  4K8R B;  5AC9 2;  3UGF A;  2R04 2;  3J7H A;  5F5A A;  2XLG A;  5H9Q A;  4D6R A;  3VBH C;  1QJE A;  1TEI A;  3B93 A;  2WLQ A;  3KHC A;  2VUJ A;  3OPZ A;  1ND2 C;  5A7P A;  1F4H A;  1QJU 2;  2CWS A;  3ZLI A;  4ASM B;  4MLO A;  1UX7 A;  1OT5 A;  3SCH A;  1RUJ 3;  1PZ8 A;  1QJX 3;  2KR2 A;  1X33 A;  1YI7 A;  1SDW A;  4UBH A;  4J1X A;  1OKQ A;  5I8Y A;  5FQ0 B;  5C8C A;  5KXB A;  4LO4 B;  2QZ3 A;  4E4D X;  3SH3 A;  4FAG A;  1OPM A;  4I0B A;  1XNA A;  4Q4X 3;  4N9H A;  2R6Q A;  4BCU A;  1I6X A;  5D1I A;  1WW4 A;  3RJR A;  1VB4 A;  3LA7 A;  4IUG A;  2G9G A;  4IDZ A;  1CX1 A;  1BK1 A;  3HD8 B;  4Q4Y 3;  1NZI A;  4PQ9 A;  1RUG 2;  4PBP A;  2RR1 2;  4KL1 A;  3U1X A;  3W5M A;  4AG4 A;  3VBR A;  1I5Z A;  2IZW A;  2WFF 1;  3ENR A;  2UY9 A;  1URX A;  4UFM A;  4UF0 B;  5FY1 A;  4CCN A;  4F7Z A;  3USS A;  2O0O A;  1FPN 2;  3NL1 A;  3IBM A;  2BGP A;  4K8F A;  2NN8 A;  4FI9 A;  5IVC A;  2QQI A;  4WVM A;  1KDK A;  1HRV 2;  3R4S A;  3K2O A;  4EYU A;  1R64 A;  3KGZ A;  1X50 A;  1OKO A;  2WWU A;  1D4V B;  3AVS A;  3CEW A;  3Q8E A;  4CP2 A;  4CU8 A;  2W5F A;  2TUN A;  2WT1 A;  3W9A A;  1GZW A;  1DQ5 A;  3I3Q A;  4CP0 A;  4A3X A;  5JXH A;  1PK6 B;  2VZQ A;  3GM8 A;  4Y5Z 0;  5C6C A;  3A22 A;  3ZN4 A;  2D43 A;  2IXH A;  1NT0 A;  4Z8B A;  2HWC 2;  4AEK A;  4HMZ A;  2FDI A;  2AR6 A;  2W68 A;  2ZEZ A;  3DGT A;  3KZ4 C;  3PIG A;  1NA1 B;  1RUN A;  4NVP A;  1FT9 A;  4OUS A;  4M3C B;  2ZCW A;  4URT A;  4CEW B;  2NMO A;  3QH7 A;  1K5M C;  3OGV A;  2HWF 1;  2W2I A;  1SCS A;  2C5D A;  3HIF A;  2WSU A;  2DUQ A;  3OSD A;  2GH8 A;  4JHZ A;  4PJY A;  4Y26 A;  3TWI A;  1RUD 3;  3BTZ A;  2BGC A;  5FMC A;  4OUM A;  1N1Y A;  1W39 A;  2XVG A;  5K0U A;  2W94 A;  1O4T A;  4X8N A;  5C71 A;  2HWE 2;  4IES A;  1EP0 A;  3DN7 A;  3ZXJ A;  3NNF A;  2XJT A;  4I02 A;  3MZH A;  1XOY A;  1RUC 1;  1XND A;  4COU A;  2GNT A;  4N8M A;  2OZ6 A;  4CU7 A;  4XFC A;  1CX4 A;  3BN6 A;  4DMI A;  4XAC A;  2R07 1;  3AMH A;  4AEJ A;  2WA3 A;  4QGM A;  1NX9 A;  1OXC A;  2BDR A;  2GAU A;  2PHL A;  3HEI A;  5SV8 A;  1PZ7 A;  1DYK A;  2E51 A;  2PQS A;  4XAE A;  3KVA A;  1ACC A;  1ZZC A;  4LOT A;  3RFR A;  3THC A;  1HB4 A;  4MXW A;  1UX6 A;  2GSY A;  1TMF 1;  4IV3 B;  1ULG A;  2ATF A;  1GAN A;  2C6S A;  2WYF A;  3CLP A;  2WFF 3;  3SH5 A;  2GND A;  1PGL 2;  4R9C A;  1O5L A;  2WN2 A;  3HQU A;  4RYD A;  4AFC A;  1NCR C;  1PIV 2;  1TQ5 A;  1YQC A;  2B9U A;  1C57 A;  5HXV A;  4AFM A;  4DXT A;  5DMY A;  3WSO A;  3SEP A;  3ZXD A;  1G9F A;  4Z1V A;  1GR3 A;  2JD9 A;  5A7S A;  1SMV A;  3RZG A;  1OA3 A;  5FLJ A;  5A6Q A;  1KS5 A;  3VHN A;  4UFH A;  5FY5 A;  1CAU A;  3EXU A;  2I74 A;  1G9A A;  4UFJ A;  4DUX A;  2V09 A;  4PDW C;  2EXK A;  4N9I A;  2CL2 A;  1CAX A;  3DXU A;  3KF3 A;  5C8C B;  4RGA A;  2XLF A;  5FO7 B;  4LOS A;  3IIA A;  3THT A;  3CJX A;  5EJZ B;  1NXD 1;  4W6Y A;  5KXC A;  3MLK A;  1PMI A;  1M4W A;  2HWF 3;  1W05 A;  1UY1 A;  1IPJ A;  1JW6 A;  1PHM A;  2YFU A;  5FUP A;  1MZ5 A;  1JN2 P;  1UY4 A;  5DUV A;  2Q1F A;  5FY0 A;  3UGH A;  1E5I A;  2C9A A;  3VKN A;  1POV 0;  2ZX2 A;  3KQ4 B;  4OHV A;  5EV7 A;  5LBE A;  1CON A;  4URA A;  5K9Y A;  1DYO A;  3UGG A;  1UY0 A;  3VBF C;  4AAP A;  1W6N A;  1XSR A;  2OZJ A;  5LW9 A;  4PI2 A;  2AC1 A;  4K1Z A;  4L99 A;  1S0G A;  4QPI A;  4XJU A;  1ZX5 A;  3VBR B;  2ARA A;  4YZ1 A;  3PUA A;  4ZU7 A;  4OZO A;  3GNE A;  3VBS A;  1MVE A;  1JYV A;  2HEY F;  3VDD A;  4TTG A;  1RUC 3;  1W8T A;  1W8H A;  1C1L A;  2Y64 A;  3PU8 A;  3T30 A;  1OQD A;  2R32 A;  1C1F A;  4JDN A;  4WVM B;  4KMQ A;  2R07 3;  4GB3 1;  2CWM A;  4Y1Y A;  1OVP A;  2B46 X;  3KS7 A;  4BXS V;  5JOZ A;  3TEX A;  3WCS A;  3P3P A;  1RXG A;  4QB1 A;  5C3R A;  2YMZ A;  1GZW B;  5FPX A;  2ZMK A;  1POV 1;  4G9S B;  1TMF 3;  1H1A A;  3M4F A;  2GP3 A;  3NVC A;  3Q8C A;  2EAK A;  4ORF A;  3RVH A;  5A32 A;  5K7P A;  1H30 A;  4QHB A;  1JZ3 A;  3U4X A;  2ES3 A;  1LES A;  2A6W A;  3AZX A; 
#chains in the Genus database with same CATH homology
 4V2W A;  2XML A;  4QXH A;  4Y4R A;  4IGQ A;  4CCL A;  5FY4 A;  2OX0 A;  2OT7 A;  5FV3 A;  3KVB A;  2W2I A;  4QXC A;  4CSW A;  5KR7 A;  5F3I A;  5FXZ A;  3N9N A;  2WWJ A;  5FY9 A;  4QX7 A;  4Y3O A;  5FZG A;  2XUE A;  3OPT A;  5FZ8 A;  5FY8 A;  4DO0 A;  5A3T A;  5FPB A;  3K3N A;  4V2V A;  3U4S A;  5FZC A;  4ASK A;  5IW0 A;  4GD4 A;  5FWE A;  5FZ3 A;  3LD8 A;  5FP4 A;  5F39 A;  5F37 A;  3PUS A;  1VRB A;  4LIT A;  3N9L A;  5A1L A;  2YU1 A;  5FZO B;  5FZE A;  5FZO A;  4CUG A;  5FWJ A;  3PTR B;  5FYV A;  2Q8E A;  5FP8 A;  5FXV A;  5IVY A;  5LWB A;  5FZ9 A;  3OPW A;  2OQ7 A;  2XDV A;  4CCM A;  4NUB A;  2OS2 A;  4D6Q A;  5K4L A;  5FYT A;  2YBS A;  5FXX A;  5E6H A;  3N9M A;  5FZK A;  3KVA A;  5ISL A;  5LY2 A;  3PUQ A;  4GAZ A;  2YBP A;  5FZH A;  5FXW A;  5A80 A;  4AI9 A;  3KV5 A;  4GJZ A;  4TN7 A;  4C8D A;  5IWF A;  4QWN A;  5FZ7 A;  5FZ6 A;  2Q8C A;  4QXB A;  2OQ6 A;  5FYB A;  5FPL A;  5IVJ A;  5FYM A;  5F3E A;  2YPD A;  5F5A A;  5F5I A;  5A7S A;  5ANQ A;  5FZB A;  4D6R A;  5IVF A;  2Q8D A;  5FZI A;  5A3P A;  5FY5 A;  5A3W A;  5CEH A;  5FYU A;  5A7P A;  3ZLI A;  5A7O A;  4DIQ A;  3AL6 A;  3N9O A;  5FJH A;  3PDQ A;  5FJK A;  3DXU A;  5FZ1 A;  4Y33 A;  4LXL A;  5FYS A;  3AL5 A;  2YU2 A;  2PXJ A;  4CCK A;  3U78 A;  2P5B A;  5FZM A;  5FZ4 A;  4BU2 A;  4EZH A;  3PU3 A;  3PUR A;  4LIU A;  5F3G A;  5FUP A;  5FY0 A;  5FZL A;  4IGO A;  4QX8 A;  2GP5 A;  4HOO A;  5A3N A;  5FPA A;  5FZA A;  4GJY A;  5F3C A;  4URA A;  4D6S A;  4XDP A;  2XXZ A;  3AVR A;  4AAP A;  5LW9 A;  3N9Q A;  5FYI A;  4BIS A;  5FYY A;  5F5C A;  3PUA A;  3KV9 A;  4QU1 A;  5FY1 A;  4CCN A;  4UF0 B;  3ZPO A;  4UF0 A;  3DXT A;  4BXF A;  5LY1 A;  4IGP A;  3LDB A;  3PU8 A;  5FBJ A;  5IVE A;  5FPU A;  5IVC A;  4CCJ A;  5FPV A;  2VD7 A;  4E4H A;  4HON A;  3K2O A;  3NJY A;  5FYH A;  4XDO A;  4LIV A;  4EYU A;  5IVV A;  2WWU A;  3AVS A;  5FZ0 A;  4EZ4 A;  5IVB A;  5A7W B;  3KV6 A;  3KV4 A;  5FP7 A;  5FYC A;  5A7W A;  5F2S A;  5F32 A;  2YBK A;  3UYJ A;  4CCO A;  5FUN A;  3RVH A;  5FY7 A;  2GP3 A;  5FP9 A;  5FZF A;  5A1F A;  5FP3 A;  5F2W A;  5A7Q A;  3K3O A;  3N9P A;  5A7N A;  5FZD A;  5FYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...