5FZOA

Crystal structure of the catalytic domain of human jmjd1c
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
343
structure length
338
Chain Sequence
MIPHSWICEKHILWLKDYKNSSNWKLFKECWKQGQPAVVSGVHKKMNISLWKAESISLDFGDHQADLLNCKDSIISNANVKEFWDGFEEVSKRQKETVVLKLKDWPSGEDFKTMMPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROBABLE JMJC DOMAIN-CONTAINING HISTONE DEMETHYLATION PROT E
publication title Crystal Structure of the Catalytic Domain of Human Jmjd1C
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 99
structure length 338
sequence length 343
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fzoA01
5A80A 5IVVA 2Q8DA 3N9LA 4TN7A 5F39A 5FXXA 4Y4RA 5FY8A 5FYSA 5FZ7A 1VRBA 3PU8A 5IW0A 4ASKA 3LD8A 5FZ6A 5A7SA 5F3CA 5A3WA 2OS2A 3NJYA 5F3IA 5FBJA 5FWJA 3DXUA 5FP8A 5IVBA 5LY1A 4CCNA 5FZEA 4CCKA 4QXBA 5FZ9A 3N9NA 3N9PA 3UYJA 5FYHA 5FV3A 5FZFA 5F3EA 2OX0A 5FXWA 4XDOA 4CCLA 5FY1A 3OPWA 4LXLA 3ZLIA 5F2SA 5K4LA 5A1LA 3N9MA 5ANQA 2XXZA 2P5BA 4D6RA 3N9OA 3KV5A 3ZPOA 5FPBA 4EZ4A 5FP9A 3PDQA 4GJZA 5IVYA 5CEHA 4QX8A 5IVFA 5FXZA 5A3NA 4BISA 2W2IA 2YU1A 2YBKA 5FYVA 5A7QA 5F5AA 2YBSA 5FZBA 5FP4A 4QXHA 5FP7A 5FWEA 4BXFA 4EZHA 4LITA 4HONA 5FYIA 4LIUA 4GJYA 4IGOA 2OQ7A 4DO0A 4QX7A 5FYTA 4CCOA 3LDBA 5FUNA 5FY9A 5FZLA 4CCMA 4CUGA 5FZDA 4GD4A 4XDPA 4NUBA 2Q8EA 4AI9A 2OQ6A 5LW9A 5FPUA 5FYCA 5FZAA 5F5CA 3PUSA 5FY4A 3KVBA 5FZ8A 3U78A 4E4HA 5FUPA 5FPVA 5FZIA 5FZGA 5FYYA 4EYUA 2GP3A 3AL6A 5FY7A 4UF0A 4LIVA 5A3TA 5F3GA 5FPAA 5FZOA 2YPDA 5FYMA 5F37A 5FJHA 5IVJA 5A7OA 5A1FA 4UF0B 5FZ4A 5IVCA 5FYZA 3KV9A 4V2VA 5FZHA 3U4SA 4Y3OA 4CSWA 2Q8CA 3N9QA 3K2OA 2WWJA 3PUAA 5FZCA 5LY2A 3AVSA 5FY5A 2VD7A 4QWNA 5F5IA 5FXVA 5FZMA 5FJKA 4QU1A 5A7NA 3AVRA 4QXCA 5F2WA 5FPLA 4Y33A 4D6SA 5IWFA 5FZ0A 4AAPA 3KV6A 5FYUA 4BU2A 3AL5A 3PURA 5FZ1A 5A3PA 3PUQA 2XDVA 5FZKA 2XMLA 3KV4A 3K3NA 5KR7A 5LWBA 5ISLA 5A7PA 3OPTA 4IGQA 5F32A 4D6QA 3PTRB 3PU3A 2PXJA 4IGPA 3KVAA 4C8DA 5A7WA 4URAA 2OT7A 4HOOA 4DIQA 2WWUA 2YBPA 5FZ3A 5FYBA 5FZOB 5A7WB 5E6HA 4CCJA 2YU2A 2XUEA 4GAZA 4V2WA 3RVHA 3K3OA 3DXTA 2GP5A 5FP3A 5FY0A 5IVEA
chains in the Genus database with same CATH superfamily
2YC4A 3ZFFB 3C7EA 3WVJA 1HQLA 1UOBA 2UYBA 2XOMA 1NCQC 2Z69A 3JQXA 4Y1ZA 3URFA 1W9YA 3VBFC 2VC9A 3PU8A 1NAEA 1HB1A 4Z2WA 3WNOA 4E4DX 2BRTA 2EIEA 4WM8A 3J8F2 3LEMA 4R8HA 1LCLA 2YDEA 3OUJA 1X82A 4DRRA 3POYA 3J7LA 3POBA 2DFBA 3O1TA 4N7UA 2B46X 1FAYA 4N43C 4QXBA 4BCUA 3HNMA 4XF1A 4AFAA 1SLBA 3B7MA 3LOIA 4YG0A 3G7DA 3MBWA 4JGYC 1S0IA 5FXWA 1NUKA 4JGZB 3PJYA 1L7RA 1RUE2 3RZHA 1IS3A 4K1YA 3TBDA 3DN7A 2DCKA 2BWAA 4DUWA 1AJKA 4A2UA 2ARXA 1BVVA 3H9AA 4AGRA 2WT0A 1SEFA 1VBE1 2JDKA 4KH9A 1K42A 3I54A 1VBC3 4M4PA 1H8TB 4LQRA 5D2AA 2VCBA 1JZ8A 4WBBA 5DAQA 3U75A 3MF9A 2ZPXA 4I0AA 4GJYA 2BPA2 3QOPA 3CJIB 3RJRA 4QPIB 2J1VA 4OLLA 4CU7A 4CCMA 2NQYA 2UURA 4M3CE 3KWVA 2V4AA 2Z2SB 2RV9A 3JCIA 2R063 3EMRA 2P2KA 4P5HA 4ISRA 1QQP2 4YGCA 5FCCA 5FO9B 5IYYA 3ZR5A 1PX4A 5LW9A 3GJBA 5ABJB 2UY8A 1ZA4A 2J1AA 5FZ8A 4E4HA 2PHUA 3BVCA 1O59A 1UXZA 4JKKA 2R061 4IW3A 1LAJA 2CGPA 1C1LA 1DGLA 2W52A 3WDTA 1GWLA 1MVEA 2WZEA 1VMHA 4N53C 1W2OA 3W9AA 4LT5A 4MXWB 2AH2A 1JH5A 4UWDA 3J7NA 1UY3A 2GAUA 3NAPB 1QOOA 2WZR3 1U12A 2BQPA 3KV9A 4MOAA 1OKOA 1UW8A 1QJZA 3H3UA 4OMDA 3N9QA 4CSWA 2P17A 2D93A 4LUMA 4RSUA 3VBOB 3TNQA 4AFDA 1SPPB 4YW3A 5L7OB 3ZYJB 2ZMNA 2NMOA 2HYXA 1OVSA 1AL0G 1QH7A 2WO2A 3WF2A 2WZR1 5ACA3 1H9PA 2D44A 4EQVA 1GU3A 1RMU2 4ZS3A 1QJX2 4OQ9A 1AF9A 1TMF3 3GBFA 1AYM3 1YQ5A 3R6SA 1NYWA 4WVVA 2E6VA 4KU7A 5JI7A 4E2GA 3A0NA 4D6QA 1OF4A 4F8AA 2R043 1S2EA 1LGNA 3IKWA 4H3WA 1JHJA 1EPWA 2ZBJA 3JB8A 4CDUA 2PAEA 4GQ7A 5FYBA 1AYM1 4CP2A 1REFA 3QACA 1HXS3 3ZXLA 4RS5C 4AWDA 4AGGA 1JZ4A 2P3YA 2R041 2WAOA 3NQHA 4UFLA 5FFOC 5SV5A 3SKJE 1RUNA 3V0BA 2LM3A 4XBNA 2VULA 4CEYA 1HXS1 1C1FA 5B4NA 2D3RA 1CD3G 2ET1A 1SLAA 3U4XA 1W2AX 4AQSA 2NPIA 4CDWC 3LEKA 2DVGA 4EN0A 1W6PB 3ACLA 2LALA 2C9AA 1GKBA 2OX0A 1S0JA 2BU9A 2VUDA 3ZX7A 5F6KA 5CFCC 1CONA 4JV4A 1A3KA 5E88A 2QUOA 4NIDA 1EAH2 5DDJ3 4D6RA 3WP6A 3TAYA 2XJVA 3CBNA 1URXA 3PDQA 3WDUA 1QJU2 5IT6A 2VTXA 4L2NA 4PF1A 1MVQA 3U14A 2XUMA 1DZRA 5F7UA 3AB0A 2XLFA 3NO8A 5F5AA 5DAVA 3AYAA 1U5ZA 5LA9A 5DDJ1 4JCKA 1GOHA 2VM9A 2CSGA 3RYRA 3IDBB 5KXDA 4UXAA 1WW4A 2BP6A 3HJRA 5FWEA 2D5FA 3DGTA 4FPFA 4AI8A 1X8EA 1W9FA 4NHMA 4FI9A 1W6NA 4BA6A 3PL0A 5LA0A 2FZ2A 1KFUL 1O8PA 1OUXA 4RQPA 2VOVA 4XJ8A 5DN2A 1CPMA 1LHOA 1GWKA 4GD4A 3L2HA 3NV3A 4C1WA 1G9FA 5FK8A 5A6XA 4W6WA 3RZLA 4YVWA 1YO8A 1E5SA 4QX0A 4M0NA 3VHOA 3ZSLA 3H8RA 3WP3A 2VZUA 2BGPA 3VKFC 1RVF2 2IXHA 5I8TA 1EUTA 1AR73 1WWYA 5FZIA 5FZGA 1UQXA 4N9HA 4AFBA 1DYPA 1RUH2 3QH7A 4LHKA 3RJ2X 5A33B 1JUIA 3BTAA 3H42B 1D0HA 5C3PA 5IHRA 1UMHA 3HWJA 2YMZA 1QU0A 5DZFA 1AR71 5CBLA 1DU3D 1RGSA 1V9U3 2Q8CA 2ZAAA 1RUOA 4N43A 2RDNA 1U5IA 4D94A 5CFDC 1RIRA 5F2WA 4GMP1 2VNOA 4QXCA 1GZWA 2KR2A 3GGLA 4IESA 2JD4A 2JECA 1X7NA 4EN7B 3QH6A 4RR3A 5F8PA 3M8LA 3GZTB 1V9U1 2RDRA 1WD4A 4TLGA 2AEYA 4HN1A 5FTTC 4NE9A 4H7LA 3PUQA 4XF4A 4ARYA 3OCPA 5C8WA 3MUZ1 3K3NA 5JI9A 1VRH3 2G9FA 4X6QB 4A6OA 1JZ5A 4CCEA 4URTA 2VBBA 4MHRA 3NJZA 4G4FA 4E27A 5A7WA 3V64A 4NRMA 3HD8B 3BTZA 4NR1A 2FQPA 3NSTA 2BNNA 2QQMA 2OIIA 3RVHA 1F8VA 1VRH1 4GAZA 4XUOA 5K9YA 4DNYA 2DFCA 2JKBA 2VU9A 3NMBA 5FP3A 2VQUA 1V0AA 2PHFA 4XC9A 1RITA 2G4IA 4QAWA 4BLJA 3E1F1 2C24A 1RB8G 4Q4V3 1CAUB 1Q43A 3OEAA 5J1XA 4Q2FA 2XH6A 4LTAA 4QQLA 3WG4A 3FL7A 1EP0A 3EJKA 4H7MA 2UWCA 2BVBA 3AKTA 1QDCA 1WA4A 5IVBA 2RS33 4XDQA 3ACIA 3UL2A 4Q4V1 4ASLA 1MS3A 1UY0A 1OLMA 2BNMA 1V6IA 2WC2A 3BGAA 4IV1C 2DDUA 2W08A 3O0VA 3WV6A 3WNMA 3C7HA 4HVQA 4N53A 2DU0A 4WZFA 3ASIA 3E5UA 2GMPA 1JI6A 1JOPA 1LOCA 1VBB3 2RS31 1BEV3 5BNPB 2FBEA 1CJDA 1XYOA 1J84A 4IEWA 2IXCA 3D82A 4BHPA 2EIBA 3ABZA 3TWIA 2IUWA 1W3XA 4LBMA 1DZQA 3Q8AA 2HEWF 1W39A 2WA3A 4FPLA 1AYN2 3MV01 4YFZA 2YU1A 1CWPA 1IGOA 4GB33 3U37A 3CJXA 3GBGA 4YVSC 2A6WA 4GKYA 4P9XA 2VZPA 3ZYBA 1CN1A 2BBAA 2BV4A 3ORJA 4AVVA 4IEQA 3OSDA 4IGOA 1YFXA 1NOVA 2BNOA 2G9ZA 4W6XA 5HV4A 5IK8A 5FPZA 1VAMA 4NHKA 1QMJA 3USUA 5JSOA 1CAWA 2PLV3 2XONA 4DRVA 1OT5A 3AYDA 5FRAA 3AMHA 4HZFA 5A1AA 3RMYA 1FYUA 3HR9A 3ZPYA 5H9QA 1PGSA 2ES3A 4XFAA 4ZXKA 4AAXA 1OHFA 2ARAA 2I74A 4YGDA 5C9AA 2QQOA 2FCTA 1HB4A 2JG8A 1Y7BA 2WUHA 2ZX2A 3HT2A 4B1LA 1XNBA 3MLLA 3FFZA 3S57A 1LHNA 3KCCA 5CZKA 5FZOA 1HRI3 3OGSA 5A1FA 1AL23 1ST8A 1YJLA 2ZJCA 3IM0A 1RMU1 5AFEA 1X36A 4HL0A 1QXRA 3ZIXA 1JU4A 2Y60A 2WNEA 1D2QA 3INAA 4JDOA 5DUVA 3SMHA 5F5IA 4NIHA 3C7FA 5T55A 3RI9A 1V70A 1IQAA 3M7AA 3THTA 1D7PM 2AYHA 2XQXA 2QQPA 1HRI1 1AL21 4JHZA 1SBDA 1PM4A 1GZCA 1Y3TA 4BQ5A 2EXHA 1O3TA 3LA7A 1LHWA 1SFNA 2CAVA 4FPEA 4COVA 4HSJA 3OOXA 1G6NA 3A23A 1D4VB 3ELNA 3GDBA 4J25A 4QQPA 4KBZA 4PLNA 1ZBA2 1YNAA 5F32A 5BNNB 2E32A 3VKMA 4YM1A 3UNPA 4XILA 1U0AA 3AFGA 3BYWA 2ZCWA 4LPLA 2DUQA 1OSGA 5BUVA 1JHNA 1YCIA 4U36A 4V2WA 4MG2A 2BBVA 1ENQA 1R1A3 3ZFGC 5JSRA 3MEPA 3RZMA 2WFF3 1FNZA 1GLHA 4AI1A 5DAPA 2JDNA 3N7MA 1MS1A 1CR7A 1YEWA 2DVFA 1W6MA 3OYWB 1VMJA 1XYNA 2D7FA 3MPBA 1K5MB 1OBNA 5FZ7A 4DB5A 3S0MA 1PK6A 1SBEA 5IW0A 1PMHX 1R1A1 3OUIA 4I3GA 1W06A 4U2AA 5FLIA 4ASKA 4LKEA 4E9KA 2VL4A 4WVZA 3WF3A 1YLLA 2WFF1 3RWKX 5CNAA 1C8NA 5FMOS 1Q8VA 2W94A 2VMHA 4CCNA 3TEWA 2ZEYA 3CZJA 4TZDA 2BWCA 2GU9A 2Q4SA 4AEJA 3PJQA 3BTXA 1JYIA 1XU2A 4XIKA 1QJU1 1UU5A 3IDEA 1G9DA 4NAMA 3RGBA 3LAGA 5FZFA 1OA2A 2D3PA 5BYNA 3NKTA 5CIRA 2WIIB 5I0SA 3N9MA 1SDWA 1S55A 4IE5A 1MZEA 2WN2A 2RDQA 3LWCA 2Y6FA 3P1IA 2C5DA 1HN1A 4XZUG 2LUWA 2RS12 1N3OA 4GH4A 5CFDA 4XZPA 3KHBA 1KGYA 5DPNA 2HWE3 1HJGA 1K12A 1XJAA 3D8CA 2YBKA 2GH2A 3AC0A 1D4M3 3BN6A 4FO9A 2QNKA 2ZGOA 3ZXFA 3IBMA 3MFCA 1QNYA 3H7YA 1BXHA 1FV2A 3ZXGA 2E63A 5C3RA 2ETEA 1DGRN 4XIOA 4BQ3A 2GMMA 2HWE1 1GQGA 4QPGB 2P34A 2QDRA 3ETPA 5K0UC 3L2YA 2WLQA 4MYEA 5FUIA 2HKXA 3FHIB 4TTGA 2NLRA 1SLIA 1RUH1 4YPJA 3ZXAC 5BNOA 2WNUA 4IE0A 3RWNA 1ND2A 4OFGA 1JZ3A 5JMOA 4AI0A 2IVJA 4B7EA 4YARA 2B42B 1PIV3 1NKGA 4L8QA 5LEJA 4H2AA 1APNA 3ZN5A 4EN6B 4GWIA 3IWZA 4NVPA 5GLUA 1MS9A 1ULEA 3ACHA 3MZHA 3KF5A 5CKQA 3WF1A 2L9LA 1VR3A 4UF0B 2JE8A 1F35A 1JYVA 4GWMA 4PBOA 1LOFA 3AX4A 4R52A 3U4SA 1OURA 4HFSA 1MQTB 4Y1VA 3ZFFA 5J96B 2VD7A 4LOSA 4IV1A 4QWNA 4NPLA 2CHHA 4H55A 4QX1A 4E2SA 4FQ4A 4JKLA 2JG9B 1U5YA 2TBVA 1QEXA 1SDDB 4MGTA 2ZMLA 5LASA 4M0HA 4WM8C 4AFCA 4AEMA 2A3WA 1R093 4P02B 4AQTA 1H2MA 5F5QA 3WQBA 1SACA 4K8RB 3T2PA 4YM3A 2YGMA 3V56A 4XOGA 3ZDSA 1QWRA 1VBC2 1V00A 3RPQA 2HWB3 3AYCA 3KHCA 2XHNA 2C6SA 3NV1A 2OA2A 3H3LA 3N7KA 3AZYA 1IKQA 2BYVE 1R091 1RUD3 4JGZA 4JKMA 4URAA 4QD2A 1GICA 3W5MA 1J3RA 1J3QA 1YYNA 2H0VA 3K3OA 1UX6A 3TRSB 1RUC3 2GN7A 2GALA 2R062 3MI8A 1OQDA 2HWB1 4FFIA 1YI7A 3AZZA 4HK8A 1HDKA 3T1MA 4EWDA 2VZTA 3K51A 4AG4A 1V6KA 5JMCA 1CAXA 1I1EA 1W9SA 3C7OA 3OB8A 1REDA 1FI2A 5FY8A 3CIHA 5FYSA 4JC1A 4CU8A 1S1AA 3J7HA 4Q4X3 4RYDA 4CVUA 1UL9A 2D6OX 1QHDA 2E9QA 3DXUA 2R32A 4XUNA 5GZCA 3IDAA 3CJIA 2ZEXA 1DBNA 2XWBB 4Z1VA 5LZ6A 4OUEA 3KGLA 5GJ6A 3N9NA 2BGOA 4Q4X1 1COV3 2WZR2 4MX3A 5IFPA 5C4WB 3M2MA 5CG9A 4HKLA 3WHUA 2FDKA 3UT0A 1DYKA 4AL9A 2YZ4A 1KDKA 4R9CA 4CU9A 5ANQA 2XJUA 4E4ZA 4I01A 1N1YA 2ZEZA 4FOWA 1TG7A 4FOQA 3ZM8A 2YFZA 1COV1 1F4HA 3HQXA 3EHKA 4GJZA 5IVYA 4ZKTB 4RN5A 5ERLA 4JRLA 4DEVA 4FVVA 3TEZA 1IG0A 1OLME 1TMF2 2W2IA 1AYM2 1BK0A 1O4ZA 4MXWA 3MFAA 4AEDB 4CDXB 2P3JA 1MEC3 3NAPA 3DL3A 3IAPA 2Q1ZB 1X8MA 4MXVA 4P9IA 1HIXA 2R042 2WYSA 5JIUA 4FTBA 1WCDJ 4BYYA 1Q8OA 2X5IB 4IV3B 1RL3A 2E53A 1O6UA 3VBOA 4NPRA 4DO0A 1SPPA 2QQVA 5L7OA 2K9ZA 1ALYA 2HLEA 3MW2A 2IXIA 1HXS2 2MEV3 4BQ1A 3BODA 1MEC1 1GSLA 1O7FA 4D7SA 4F3JA 4LMFA 3ZYRA 5A32A 3WEZA 2HBTA 2DBIA 5FYCA 2VNGA 3HBKA 2ENRA 2VQ0A 3SLIA 2YGLA 2MEV1 1R64A 4MGIE 2IXJA 3VBUB 2OKXA 1VBD3 4NHLA 3OEBA 2GSYA 2GMEA 2VVDA 3H7JA 4LKSA 3RYKA 1OF3A 1T6GC 3A4UA 4O65A 4CDUC 3ZYGA 4L9BA 4LIVA 2JD9A 2OVUA 1POQA 2YPDA 2D3SA 5A7OA 2NM1A 2VCCA 1CX4A 3BKZA 1VBA3 1ONAA 1TME3 3RZKA 4MHUA 4LOTA 1VBD1 4YGBA 1WW5A 3AKRA 1S2BA 2XL9A 3PUHA 5FZHA 1PZ9A 4J1WA 2EIDA 1MR5A 3KT1A 1Y9QA 2Q8OA 5FJKA 1UY4A 5A7NA 4BB3A 3AVRA 1BYHA 5DDJ2 3H8OA 5KHJA 1MS5A 1LGCA 1VBA1 5FZ0A 1TME1 3SITA 4AAPA 4CXXA 4P9YA 5KXEA 3AL5A 2VUAA 4QB6A 4QKDA 1HW5A 1UF2C 4A44A 2ZHMA 5FMBA 1BLZA 3ZYFA 1VLNA 1W6PA 3THPA 4N90A 1N3QA 3UJQA 1NA1B 2I2SA 4UW6A 2DWRA 4A4AA 3VDAA 4Q8KA 1ZZ7A 3VZNA 3HVDA 3KVAA 1UOFA 4LHNA 4O9EA 2QZ2A 4RHV3 1Q56A 3VBSB 4BQ2A 5FLHA 2XVGA 1YXWA 5JOXA 3VDDB 5E6HA 3PIJA 2A6VA 1V6LA 2BTVC 3T0BA 1MZ6A 4TN7A 4RHV1 4BQXA 4BM8A 2FDHA 1ASJ3 4S2DA 5CA6A 3U0ZA 2XWJB 4LLOA 5LATA 3GJAA 4LBQD 1AR72 2BEOA 4GWJA 3HT1A 3MPPG 3WF4A 2Z4FA 4E2QA 2A3XA 5JR7B 1PZ7A 1ASJ1 1CIWA 4RQPC 1OVPA 2IFWA 3OF1A 3POGA 1UYXA 4HXCA 1D2SA 5CISA 4YVWC 1V9U2 3PTYA 1VALA 4LXLA 2ZTNA 4LLFA 1AXYA 4XACA 1W8NA 1BKZA 4XYXA 1OOPB 1O91A 3M3CA 2DVAA 1NXD1 2E7AA 5I0TA 5A33A 4M3CB 3ES4A 3WW3A 4BISA 4QB2A 4QKNA 2UWBA 4ZS2A 1JYTA 2VW1A 3MLJA 1VRH2 4E8DA 4UW3A 5BPXA 1F2NA 2RJ2A 2ZHLA 4QPWA 3IMNA 1QDOA 4AVTA 2XJRA 4DXZA 1RHI3 4XMIA 1GBGA 4AHYA 2ZHKA 4AI3A 3PNAA 1ULGA 1O8SA 4ISQA 3OG2A 4MGYE 3AMMA 1IHMA 3EB7A 3ATGA 4RR3C 2C9KA 4XDPA 3WW1A 5GZFA 5JZGB 1RHI1 1N1VA 4R9DA 5HCBA 5FPUA 4Q4V2 4XBQA 3ZYHA 5FY4A 4CPBD 1LESA 1STMA 4QX5A 1FV3A 1HQNA 3AFKA 3NV2A 4HN0A 4HMZA 4RD7A 2WS93 3SCHA 3WQ7A 3MIEA 4B4QA 2RS32 1L7LA 3FLPA 2WNVC 5F37A 1G9BA 4JRAA 4XQWA 3SQOA 4A3XA 3CMGA 5C3OA 2ZKLA 4LUKA 3ZYIB 1ZA7A 3GM8A 1B35B 5LY2A 3VBRB 5LRSA 5JXJA 3IN9A 1ND3B 2VOTA 2P4EA 2ZGQA 1VBB2 1CZVA 3BPZA 4GXLA 1BEV2 2BVVA 1VBC1 4ONUA 1KS4A 5FQ0B 4W8JA 3WLUA 1M4WA 2J42A 5FPLA 2WO1A 5CKMA 3UKVA 1QY4A 3VZJA 2XPJA 2VZ3A 5GM0A 2VBPA 2XKOA 1BK1A 4CDQC 3IPVB 4BU2A 4CUAA 4PT6A 4XE9A 5L19A 3J9SA 3PURA 4HBNA 5A6QA 1OA4A 4WVWA 4MH0E 1XSQA 4XABA 5AVAA 2E7TA 4GB32 4YW1A 4EV0A 2PHRA 4JDMA 2AC1A 5A6YA 2QZ3A 2PELA 1POV0 3PU3A 2PXJA 1O3SA 4C8DA 5LB6A 4ZHNA 5EXOA 4HOOA 2VR4A 2JEMA 3DV8A 4ITCA 4X8NA 4XJ9A 5BNPA 5HXVA 2YU2A 3NNGA 2NP0A 2VQAA 5CU1A 4Q4Y3 3RNSA 2PLV2 4META 3FX3A 3DKQA 1A8MA 3WW2A 4A41A 4J1XA 2QQNA 2C0ZA 2ZA9A 5A80A 2ZKNA 1WCUA 1JUHA 2OZJA 2ZGLA 4I0BA 1PO13 1OI6A 3L9JT 3N7LA 4OZOA 4YW5A 1W8HA 5IUQA 5AC93 2BJSA 3H0OA 3LD8A 2Q0AA 3PUIA 3I49A 1AHSA 2PQSA 3VB9A 4AHZA 4CRQA 3O1MA 2PFWA 2H0BA 2A1XA 2F4LA 5AVPA 1WCKA 3X29B 1PO11 2EXIA 4OUMA 5C33A 4FOYA 4MGZE 1HRI2 3SEPA 3VD3A 4PF5A 1AL22 5AC91 3WDYA 1FOD3 3D6EA 5ACA1 2Z79A 3OBAA 2CU5A 5FV3A 4COZA 5I0RA 1TMF1 2CDOA 3WNNA 1UU6A 2XJTA 2Y0OA 4XAAA 3WXPA 4XAEA 2OUHA 1DGWX 1GV9A 4K20A 3A7QA 4L0PA 5C6CA 1TVGA 2ZGMA 1FOD1 5C9AC 2FDJA 2FZ1A 1GNHA 2JG8C 1CPNA 5IVFA 3PVBB 3RSJA 4KI5M 3JZVA 4UFHA 5LBFA 5A3NA 3O1PA 3GXUA 2VZ1A 2ZHNA 3BU0A 4KG8A 2VMFA 3LPFA 2WZ8A 2FCVA 4HKOA 4IUGA 3TEXA 3RRDA 2Y38A 3VKNA 3P3NA 1H8VA 1RUI3 2W39A 3O1SA 4X6RB 4LO7A 3UGGA 5C8CB 4XQ4A 2AENA 4QB1A 1NLRA 4TLFA 5FMCA 4AQ2A 3MLKA 3LIHA 2R6QA 4CCOA 2ZGUA 2QQUA 3LFMA 4KL1A 3CQOA 1R1A2 3LDKA 1Q5OA 2ATFA 1YRZA 5BNQA 1UAIA 4K3UA 1RUI1 3HEIA 2WFF2 2X09A 3POFA 4CP9B 1QJFA 3R4SA 1C5HA 4HVRA 2LROA 2Z5WA 3UKTA 4PQ9A 3OPZA 1DQ4A 2HYKA 3B00A 2SBAA 3VHRA 3DPRB 1IS5A 1W8ZA 1JODA 2GH8A 2WJSA 3U1XA 1QXJA 2VZVA 1PVC3 5FPVA 2PYTA 5FPXA 3VDDC 5DG1A 1C57A 2GP3A 1C5IA 1WMEA 3POIA 4DEQA 3K48A 1ODNA 3HNYM 3P6BA 5D8AC 5IVJA 3D4KA 3ON7A 5IJRA 3MIBA 4K8FA 2ZX4A 3OY8B 3LOBA 3VDBA 2R0HA 2XQRA 2MNGA 3I3DA 4PDWB 1PVC1 3B9IA 2XJPA 4DUVA 3WR0A 4MADA 3K2OA 2WWJA 3LFIA 5K8SA 2BUKA 5FY5A 1ZYBA 5FXVA 3S7EA 1JYCA 4XFHA 3ZYPA 4C0HA 1O3RA 2AR6A 4IQPA 5FDBA 1PK6C 2ZEWA 3WF0A 1DZTA 1CIYA 5BY5A 4QM8A 2DVBA 1RYYA 4B1MA 2ZS6B 3CEWA 4QDQA 2HWE2 4B4PA 1W9WA 2GC3A 4ES8A 2XMLA 2WO3A 1D4M2 3SH3A 5FO7B 4GULA 2CWMA 1MPXA 2J1UA 1ULDA 4KWUA 4RGKA 2EA7A 1OKQA 2QKDA 2X8KA 3MIFA 4ZPIA 4DIQA 2A5ZA 4QHBA 4R9AA 2EVXA 1AR93 1NCRC 1WGPA 1OH4A 3I2IA 2A75A 4K40A 5BXXA 2GP5A 4HPKA 1L3JA 4GH4C 1YC61 3ZDVA 3K4ZA 3VZKA 5F39A 2WQ8A 4HG6B 1G8WA 1TNFA 1UN1A 3B93A 1ZRFA 3WCSA 1LU2A 2PHDA 4FQZA 4N7IA 2W5FA 1LR5A 2VUJA 2VBDA 2XB6C 2A70A 5A7SA 5DUXA 5A3WA 2JE7A 5F3CA 4UI9L 1QH6A 5FP8A 2AUYA 2JDHA 2Q5TA 1DGWA 2Y6LA 4FP2A 1ZRIA 3O5SA 2RMU3 5C5UA 2HEVF 5IFTA 4AI2A 3ES1A 5T50A 4DQAA 5BNOC 3TNPB 5F3EA 4Y1XA 3JB4C 4BE3A 2WNUC 4BQWA 1ND2C 2WNVA 3UV9A 4CCLA 4G9SB 2QJVA 1PHMA 3VV1A 2E26A 1F9KA 1W90A 2RMU1 2EICA 5EQUA 5LRRA 4OHZA 5JXGA 1RC6A 3MW3A 3RI8A 4GWNA 4IE7A 1GMMA 1R092 3ACFA 1UCXA 1MZ5A 2VZRA 3PVEA 2VTFA 2W0XA 3TOJA 4BMBA 4XCAA 4AE2A 4CDQA 3AYEA 3LF7A 4AVCA 1EV13 2IC1A 2HWB2 2Y26A 1LOFC 2PHXA 3FFQA 3JD73 4CYDA 3OBZA 4HONA 3IB3A 3ZFFC 1TZOA 1BMV1 1ZVFA 1RUD2 3ALQA 1EUUA 2OQ7A 4C90A 4EN9B 3IAQA 4XUQA 1JOJA 1X33A 2BFUL 1DHKB 2IXKA 3LDBA 4I3PA 4R4XA 4AOCA 2JG9A 4CUGA 4DXTA 5JR2A 4DZGA 4XFBA 3S5AA 1I5ZA 2JB8A 1UIKA 2W91A 3E5XA 3G6JB 2XGXA 2Q8EA 2WRAA 1PGW1 5FZAA 2ZX1A 2AZ5A 4Y26A 3RZJA 1H1MA 3HBZA 4OI2A 2ET7A 1LEMA 4Q4X2 5JOWA 4QGLA 3LQCA 1VBB1 4EYUA 1UYZA 5EP9A 1BEV1 2ZGPA 4JGZC 2R0FA 4Q0VA 5CB7A 5E89A 3GHMA 1GQPA 2V4VA 4COYA 1ZRDA 2NZ9A 5F3GA 1UD1A 2Y33A 3T4HB 2QE3A 5AFBA 3CO2A 3CZUA 4FXGB 4IETA 4YNIA 4CEWB 1COV2 1W28A 4NROA 4GB31 3ZMNA 1QQP3 2B7YA 1US3A 5KC5A 2Q1MA 3IDCB 4Y1UA 1X9PA 3KS7A 2ZOEB 2D6LX 3RDIA 1H8TC 3VBHB 3KV6A 1E57A 4Q0UA 1GANA 3CJIC 5A3PA 4QPIC 3ZFEB 5LCWL 2PLV1 2G9GA 1HRV3 4Q26A 3IT8A 3HN1A 3KSCA 3OPTA 1MEC2 4IGQA 4YG3A 3WQ0A 2QCSB 2VG9A 2R1BA 1W03A 4KGQA 5C4WA 4WVMB 4WM7B 4B7KA 2B9UA 3U10A 1Z7S3 4LKDA 1KD7A 1DLCA 3FHAA 1HRV1 1W8TA 2MEV2 4A7ZA 1ENRA 1U5XA 1SMVA 2QBXA 1F31A 4Y24A 5FY0A 4A45A 4DMIA 4D0QA 1DGRA 2Q8DA 1R1ZA 2EF6A 5FXXA 1DFQA 3WG1A 4BQYA 1NE4A 1WW7A 2QVSB 1GYKA 3J4UH 3O0XA 5EJ1B 1BZWA 3TYJA 3VZLA 4AEDA 3NAPC 2PHLA 4QU2A 4CDXA 2YY1A 4QM9A 2RDSA 4YW2A 1VBD2 3I2HA 4CEYB 5JXHA 1UXXX 3WD5A 3QBQA 2J7MA 3AK0A 3H3ZA 1ZM1A 2AREA 2X5IA 3LKJA 4IV3A 4OCTA 4ZU5A 5LA2A 3VBOC 5BV6A 5IK4A 5L7OC 1PNGA 2O8OA 3E6BA 2XBO3 4FAGA 3VLBB 5I91A 1UY2A 2DF7A 1VBA2 5G04L 1GP6A 1TME2 2Y6KA 3I97A 4GIQA 1OMIA 3ME2A 5EFUA 3SH4A 3USSA 3LA3A 1BVP1 1W99A 5D8AA 1NX9A 2XXZA 2PN5A 1FX5A 2P5BA 1VB2A 4DS0A 5FOJB 3N4MA 2XBO1 5FKCA 5GLZA 3VBUA 5C71A 2F4PA 4I02A 4HVOA 2V73A 3WDVA 2GNTA 2W3JA 5FO8B 4TWTA 4OULA 3RFRA 3FUQA 5EV7A 2X10A 3BIEA 1DF0A 4MSVA 2WQ4A 4FPYA 3E6CC 4Q8LA 4XETA 2YPJA 4W4ZA 3VKLA 5C3SA 1R083 4RHV2 2YC2A 4Z82A 4OI1A 3Q9OA 1XE7A 4QT6A 4OQ8A 3N35A 4FFFA 4JDNA 2V09A 4Y20B 3T09A 5F6LB 5LA1A 1ACCA 1QOTA 5EZWA 3NJVA 5L73A 3H8XA 5EYYA 4NO4A 4F83A 2PAKA 3A22A 3AP6A 2V5DA 1NCRA 3Q8EA 5H9RA 1LOEA 1W8FA 3U11A 4S2GA 3PMSA 1KJLA 1R081 3ZO0B 1S0BA 4Y1YA 4Q27A 4H14A 2WLPA 4Y22B 1ASJ2 3ITQA 5CVRA 3KVBA 1NA1A 4V1PA 1GNYA 1OC1A 2O1QA 3WOGA 1RJ8A 4PQQA 1ZRCA 4O7XA 3RMXA 3V0AB 1NCQB 1NG0A 4XF9A 2JICA 2EAKA 3MV11 4MGSA 1IS6A 3VBFB 3O1UA 4FOVA 1JOBA 4UBHA 3ILFA 4AQ6A 3H1WA 2J22A 3CF6E 1W6QB 2CYFA 5A3OA 4MVTA 3VD7A 2FDIA 3SH5A 1YWKA 1D4M1 2VOWA 4HT1T 1HX6A 5DQ0A 1MZFA 2VH9A 4FTSA 3J7MA 1WW6A 4N43B 1XOYA 4ATFA 1AX1A 2WWSA 1FXZA 1DQ1A 2D6NA 2YUEA 1UX7A 4JGYB 4QQ2A 5DXDA 3RS6A 4F7ZA 4K21A 4KQ7A 2RM23 3T2QA 3T0DA 5EWSA 4L11A 2BGCA 1XE0A 4XTPA 1ZX5A 3M1HA 3POSA 5A7PA 3UGFA 5T5JA 1XC6A 4PIYA 2H6BA 3GHNA 1LRHA 3NW4A 1ZZBA 1RHI2 1PIV1 3VL8A 2RM21 5A7WB 4GKXA 2ZX3A 3I8TA 1OOPA 5SV8A 2ZMKA 2GNBA 2JKXA 5APAA 3TN93 2GNDA 1W0PA 3JUUA 4N8MA 1WUVA 4XPVA 4NN0A 1L7QA 1YFYA 3HPNA 2I07B 4NHYA 1J83A 4OHVA 5E16A 2P3KA 3WDXA 3W59A 1W2TA 1S0DA 1POV3 3DYPA 4JHTA 2Y6GA 2B9VA 2W1WA 4FPCA 1TE1B 4UYBA 3TN91 5FWJA 3NJYA 1UKRA 4KGGA 5LY1A 3CU7A 2WS92 3ENRA 1N3PA 5T52A 1H1IA 1SBFA 5JPNB 3WNPA 5T5LA 1G9AA 5FKBA 4M3CF 1POV1 3UYJA 4GMP0 3VZOA 5EPAA 5L36A 3HNBM 3W58A 2VZSA 2AGSA 4KU8A 1SLCA 4N53B 3PMEA 3NNJA 1V6OA 1LHUA 5FREA 4C0BA 3RG0A 1A8DA 4K1ZA 3WUDA 3AP7A 1E5RA 1RUD1 4YM0A 3PVNA 4XXPA 2WBKA 3NWKA 2MPFA 1NQJA 4RA0A 1RXFA 1XYPA 3DKWA 2J1EA 5A7QA 1H8TA 1RUC1 5GZEA 5KXCA 2PTMA 1US2A 1ULPA 4C91A 1UMZA 3KM5A 1DQ0A 2QQLA 4QPIA 1B35A 3FBYA 1ZNPA 2TUNA 4IEYA 4LO4B 4Q1PA 1ND3A 3T4VA 1IQDC 5FQ0A 3WNXA 5FY9A 3K4DA 4AVBA 2E51A 4Q4Y2 5FZDA 2YG0A 3USUB 5ABJA 3DYOA 1PVXA 4CE8A 3IPVA 2W68A 2JENA 3UGHA 2OQ6A 2RVAA 2GN3A 3PIGA 4DPNA 1CJPA 1PO12 3IIAA 4I0WB 2JDYA 2UYAA 2JWPA 3WUCA 3LSDA 5AC92 3VD4A 5ACA2 4RS5B 4GA9A 2C26A 3MDPA 5T54A 2V5YA 4KWKA 4QGMA 3ZSMA 3N7JA 4AVSA 4EWAA 2W95A 5D21A 1GNZA 1UZVA 2RJLA 1ZZCA 2W1UA 5C9AB 5BNPC 1KQRA 2VXJA 4FPGA 4JZRA 5I0UA 3OBRA 1XNDA 3SCFA 1CX1A 1PM7A 3ZXEA 5C7GA 1FOD2 5IVCA 1ZZ9A 1IG3A 3OD0A 1AJOA 4EN8B 1KJRA 4XBLA 5DABA 3PUAA 3MW4A 5B4XA 3AXDA 4A42A 4UT5A 3PHMA 4NRPA 4CDWB 4ES9A 5JVVA 4EJRA 4QU1A 4M4RA 4FP3A 4LORA 1GZTA 4HK9A 4QQOA 4TYSA 4LBLA 4INDA 3I2FA 4IEPA 4X8PA 2D5HA 2XL7A 2IFRA 2BOIA 3B9CA 5CFCB 1HKDA 3POJA 4AW7A 5DUWA 1V6MA 1ZZ6A 3B01A 1UZYA 3KV4A 1OXCA 1W6OB 4CUCA 2HWC3 1O5LA 1H2NA 1WLTA 1SG3A 2HWF3 2RR13 1RUI2 4IGPA 3GZUC 4NOTA 4DXRA 4LBKA 3QD6A 1W8OA 2VUCA 1NY71 2ID4A 4IEUA 1O3QA 1LJ7A 2VJXA 4NWVA 4QX3A 1J59A 1MS0A 1WCQA 4J6GA 2HWC1 5I0DA 2A6YA 3I2DA 5KHGA 3POWA 5ANNA 2HWF1 2RR11 3GBWA 3T08A 4LHSA 5JUVA 1FPN3 2JDUA 4YW4A 4QHOA 3J26N 1PVC2 2DCJA 3Q8CA 4Q4W3 1I6XA 4UBGA 1C8M3 3WNLA 2GC1A 4QX2A 2VW2A 5T5OA 1NZIA 3ZN6B 4COWA 1GOGA 3BI3A 3KMHA 4LO5B 2VECA 3DCQA 4CCKA 2OPKA 4BIOA 3R4UA 1CGPA 3MF6A 2OUJA 3DYMA 1HV0A 3ECQA 4IE4A 5KHIA 3KT7A 1YHFA 2R073 3LZZA 2WT2A 2VW0A 3ZSEA 1C8M1 3ST7A 4CP9A 2UY9A 1H2KA 5A1LA 4Z07A 1LECA 1GOFA 3N9OA 3AKPA 2XHKA 4G3YC 3DPRA 4CU6A 3LGRA 5BNNC 4EZ4A 3I2OA 3WG3A 4IEZA 5CEHA 5JIAA 2R071 5FXZA 2FDFA 5CFDB 3GCWA 2P1BA 1PO23 2IWGB 3AMNA 1UIJA 3AZXA 3DUIA 3FE5A 3LDRA 1PNFA 3OY8A 4LULA 3V65A 4PDWA 1LOAA 1WLDA 3VD5A 2WKKA 3WNKA 1PMIA 1H4GA 2ARCA 5CYYA 1FMD3 2CY6A 1AR92 2D6KA 4QX7A 4XUTA 1K5MC 4P5YA 4DINB 5LK7B 1PO21 1S2KA 5FAXA 5KWRA 3BIWE 2PHTA 2LTNA 4CPBA 2VVEA 4P08A 2VNRA 3WHTA 1REEA 5KXBA 3MHZA 3JU9A 4A7KA 2QQJA 3N36A 1I3HA 1RUF3 2X05A 4NRQA 5GZDA 1A34A 2O14A 5G05L 4BZ4A 3R05A 3R4DB 1UNBA 2RS53 2VTXJ 2WO7A 2I45A 3K4AA 3AZWA 4A3ZA 1EPZA 2IZWA 2X53S 4LO6B 3AL6A 1N1SA 4AGVA 3LA2A 4MGKE 1W04A 1LNSA 1RUF1 2VMIA 3E5QA 5FYMA 2FHRA 4XEZA 4FSJA 2RMU2 2A71A 2RS51 1AXZA 1W2NA 3ZIWA 4O61A 4Y3OA 2LW8A 3ACGA 2FMDA 3W21A 2OZ6A 3AP9A 4QPYA 3W5NA 5HV0A 2FD8A 2YHJA 4AHWA 4Z8BA 3ILNA 2CGNA 4XVHA 4YM2A 1WMXA 1IKPA 2W1QA 3E97A 4IV1B 1VIWB 1Q3EA 5IWFA 1QKQA 2XLAA 1RUJ3 1VAVA 3AP5A 3H8UA 3KZ4C 2BERA 5HPOA 1DQ6A 3MICA 1NXMA 2LS6A 1BMV2 1UYPA 1M06G 4AYUA 3O1OA 4QPGC 3WP5A 4CUBA 5ISLA 1JN2P 3A21A 5KC6A 2F6BA 5HXMA 1HB3A 1ULFA 1DG6A 2AEZA 1EY2A 3QLQA 4LKFA 4UFJA 3HOBA 1EV12 3JD72 2PMWB 1BBT3 1RUJ1 2CV6A 5I8SA 5T5PA 4IXLA 1PGW2 2QDNA 4Y5Z0 5HBAA 4OMCA 1KS5A 4PI0A 4XURA 4Y5SA 4QDRA 2DURA 3O12A 2O0OA 4UFKA 4ASMB 5EHDA 1VBE3 2VVFA 4UW5A 4LE4A 4YVSB 1J1TA 2PAMA 3AP4A 4LE3A 4RL7A 2WS91 5TSWA 3SC7X 3ZR6A 4LA3A 3FLRA 1CAUA 5IVEA 5GLWA 1BBT1 4AF9A 1KRIA 1V6JA 1ULOA 3N9LA 4W65A 1SCSA 2FDGA 1LKNA 2DU1A 2HBUA 1OH3A 3E6DA 4KWLA 4W50A 3M3IA 2XVLA 4DOUA 1VP6A 2B8MA 4OHYA 1CAXB 5GZGA 4AHXA 5EIYB 1F15A 4OHWA 2K2SA 1HQWA 3QCWA 3VN4A 1YFUA 1UU4A 1MQTC 2OPWA 3EXUA 1X50A 5M0TA 4LJHA 4UFMA 1UZZA 2XG3A 3WG2A 2G1MA 2R7EB 4JQRA 1ZREA 2JG9C 5J98B 1N1TA 2ZGSA 2W47A 1W0OA 1Q8QA 1JYXA 2CGOA 4XDOA 2RHPA 5HCAA 4XFIA 3B02A 3OPWA 3ZLIA 4LBJA 2D97A 4DY3A 1OFSA 2D98A 1J1LA 3Q8FA 2VPVA 1RJ7A 1JTZX 1YQ6A 1GP5A 1I9RA 1QF3A 2B4KA 2EXJA 4LK7A 4M00A 5FR3A 1JBCA 5J48A 2WABA 1OLQA 3AMPA 1KFXL 1AR63 3FBMA 1UPSA 4QKBA 5FYVA 1UMIA 4Q4Y1 4ZXEA 2Q1FA 1HRV2 4QXKA 4IEOA 1H4HA 1QXPA 4ZY9A 1QJY3 2A6XA 3B5LB 1UKGA 5FP7A 1VE0A 4CEWA 1SQ4A 1D0GA 1UYYA 1PMJX 2VNVA 1AR61 1Z7S2 3NVCA 3CHXA 4MUVA 1DP0A 5DZEA 5T3NA 1W3VA 4D8MA 3WQ1A 4HANA 3VBHA 1GZ9A 3B3QE 3I3BA 2DUOA 1QJY1 2VCAA 4UFIA 1OA3A 5LK5A 4BIFA 2KD7A 2DV9A 3KD4A 4AI9A 4OI0A 3ZFEA 1RTVA 4YZ3A 5A32B 1YFWA 2QQWA 4LBQB 3WSOA 3U78A 5J09A 3M70A 3ZFGB 3KCYA 4NIIA 1UZ0A 3WY6A 5C4WC 5JCTA 5FYYA 1UZWA 4WVMA 4WM7A 5J3UA 1LOGA 1RUG3 4PLMA 5E1RA 3H50A 4KG0A 5FMDA 1XNCA 1RXGA 2BZDA 3HQRA 5LBCA 2XBO2 5FZ4A 4YRDA 4DFSA 3FLTA 4A6SA 3F2ZA 2ZAHA 4BJ0A 3I59B 4BOWA 2XLGA 2N7GA 1PGL1 1RUG1 3T30A 3GF6A 4OI4A 4XJUA 2SLIA 2TNFA 4AEDC 3D0JA 4CDXC 2WZPP 1K3IA 2CL2A 3I2GA 1QJEA 1LEDA 4IEXA 2XR4A 5CKNA 2OW4A 2VGDA 2X5IC 2JDZA 4IV3C 2WDBA 4XF0A 3TEYA 5BNNA 4NJ4A 3THCA 5DAXA 1ZBE3 1WZXA 3F95A 2DUPA 4NIGA 2W92A 1BCXA 3NNLA 1E5HA 3AZVA 3LEGA 4XHBA 5CG8A 1YQ8A 2DBNA 1R082 2XJQA 5I93A 1W8UA 2CDPA 4FBFA 1T6BX 1ULCA 2IXLA 2WT1A 3CKHA 2QFEA 3VBUC 2D40A 4QMAA 2BOJA 1ZBE1 4YW6A 5IVVA 3OYWA 2NN8A 1CQ9A 3LIGA 1K5MA 4LO8A 1CAVB 2GC2A 2GC0A 3M3OA 4RFRB 4E8CA 1NT0A 5K0UB 1GQHA 4B8EA 5A3MA 3TB0A 2XVKA 1SLTA 2OS2A 1SHWB 1LODA 2JIJA 2ZX0A 4NIAA 5D1IA 5IAVA 4Y20A 4ET7A 2JE9A 3AJZA 2KM2A 3SXWA 5FYHA 4YZ5A 2C4XA 2WYFA 2HWD3 4XFGA 3EO6A 1AX0A 4XJAA 1H2LA 4Y22A 3JBG3 3ZKYA 1NA1C 1W9TA 3I3QA 5I8YA 4PI2A 4CCDA 3P5BA 4WZCA 1XXNA 3VDCA 4PJYA 4BH9A 2ZGKA 3JQWA 1AR91 2R49A 4JX0A 2YXSA 2HWD1 2JXAA 1PIV2 1PX3A 4L97A 3VBSC 3V0AA 1NCQA 2RM22 1XPWA 3CDZB 2JIGA 3MO4A 4Q0QA 3C7GA 1YJKA 4FFHA 3JBG1 3S5QA 5LEKA 1C4RA 3VBFA 4FPKA 1AR83 3O1VA 3HIFA 4GMP3 1IOAA 1GR3A 2V72A 1B09A 4QPGA 4WM8B 4CP0A 1W6QA 5FYIA 1Z78A 2F17A 4LIUA 1HJFA 3AKSA 5E8AA 5DUUA 3FWEA 1UOJA 2TEPA 4AK3A 1KDMA 3SCGA 5B2GB 4BXSV 2O8QA 3KLSA 1AR81 3TN92 2VE1A 3PLQA 4JGYA 5F9TA 2WR9A 3OBTA 4D69A 5H9SA 2CWSA 1IPKA 4XQDA 3APBA 4R9BA 4LR4A 2HEYF 1K45A 1WKYA 1WMFA 1ENSA 5L9BA 2VAUA 4FXKB 4DUXA 3J8F3 1YIPA 4FT8A 4RFT0 1SFYA 5HCFA 2WSVA 1T2XA 4OHXA 4UF0A 1IS4A 3EBRA 5A3TA 5HI0A 3MGUA 4N9IA 2A7AA 5FJHA 4PCRA 1OOPC 5JXIA 2B5HA 3SISA 1MQTA 1VJ2A 5L9RA 3H1MA 2E33A 3J8F1 2FCUA 4FFGA 1RUE3 3BOPA 1I5PA 4AEKA 5FZMA 2HH9A 1C3HA 1RUC2 2Z42A 4TXWA 1O4YA 1EV11 2VY0A 3GYDA 3JD71 4Y33A 1BHGA 1G86A 3RYPA 1G9CA 4UOJA 2R30A 1DDLA 1J58A 5C70A 3I4IA 4NHXA 1KITA 3FMGA 3ZKUA 5GLVA 1RUE1 4PIXA 1S0FA 5IATA 2VOKA 2WA4A 2XDVA 2HJIA 4JTOA 5KR7A 5LWBA 4ZU4A 2ADDA 2BFUS 2ARBA 3B94A 5DMYA 4JQTA 1JMUB 1ODMA 1JZ7A 4JVAA 4OYUA 1S0EA 2J1TA 5JZGC 3ZN4A 1LULA 4IDZA 4NWWA 1DCSA 1SFPA 3ZSKA 5DAWA 1NLSA 4D6SA 4RGAA 2VCMA 4KWJA 5J7MA 2XUEA 2Y6HA 5A70A 5A6ZA 3S30A 4CA9A 2OXBA 3CLPA 2AACA 2BDRA 2GNMA 2XKPA 4CTEA 2E31A 3K75B 1JYWA 3WDWA 2JJ6A 2B45X 4QKFA 2ZGTA 1VRBA 2ERFA 2QQKA 1F5FA 3I2KA 5FZ6A 1QQP1 3P3PA 4W6YA 3VBRC 1B35C 1FNYA 1ND3C 5FOBB 4LNVA 4YYOA 2PQQA 2ZABA 2DCYA 5K7PA 3ETQA 3T2OA 4JTNA 3SNMA 3MIGA 4XXAA 2EIGA 2ZXQA 1S4CA 5ABJC 3DF0A 4XHXA 4Q29A 1F5JA 5FY1A 4CDUB 3NNFA 1FATA 2P6HA 1OQ1A 4Q5OA 3M3QA 5A3UA 1NE6A 1WCSA 4HKWA 4FAHA 4RS5A 1ZZ8A 3WINE 5FP9A 3I7DA 3D5OA 1GP4A 2QTWB 1RMU3 1Z7S1 3V0BB 3LB9A 5HCHA 1QJX3 4LBOA 1NY72 3KB5A 3VKOA 3B69A 1JZ2A 3KQ4B 3DECA 3BALA 2KA3A 5FP4A 4ZU7A 5JWPA 3VUOA 2WN3A 3FC0A 2HWC2 1LU1A 2A73B 2HWF2 2RR12 4ORFA 1HB2A 4MZUA 1QJX1 3SHRA 4CDWA 3K77A 1O4TA 1E5IA 4HETA 4XFCA 5FZLA 1JU3A 5GALA 4FPHA 5J37A 4KNCA 3VGIA 5J36A 1V6NA 1JW6A 4Z92B 4UAPA 4GALA 4ZZ8A 3THDA 4LA2A 1S0CA 1FPN2 5CFCA 2D6MA 2DVDA 1VPHA 1OPOA 2VXRA 2PA7A 2A6ZA 1YQ2A 2P3IA 1G7YA 4P9GA 4XUPA 4YGEA 5F5CA 1Q8PA 2MHFA 3SKVA 5C3QA 1W6OA 4ZZ5A 2H6CA 4UW4A 4B29A 3BU7A 2W87A 3LE0A 2YROA 4Q4W2 1CZTA 2Y0IA 1OUSA 4L92A 1C8M2 2WQZC 3BCWA 5FIXA 4R4ZA 3LCPA 5FPAA 4Z2AA 3KQRA 2K46A 3HQUA 2DCZA 1BJQA 4YZ4A 2VZQA 1HN0A 1XB9A 2ZZJA 3C2UA 4GZ9A 3VZMA 3MIDA 2UU8A 2R072 5FMOL 4XW3A 3SEEA 1KEXA 3D3AA 1W6NB 2D6PA 3UK9A 1NLQA 2X29A 3LPGA 4LBNA 1EAH3 1F4AA 3FN9A 1LHVA 4OUSA 4BLIA 3C8XA 3I3EA 4RQPB 3C3VA 1XNAA 4XMAA 5EJZB 4L99A 2YYOA 4BDVB 1LB2A 1H9WA 1QJU3 3FJSA 2WSUA 4CXYA 1WA6X 4XF3A 4YVWB 3T1LA 3OUHA 5FZ1A 3ZN6A 5FK7A 5C8CC 2ADEA 4YW7A 5IK7A 3MUY1 4FTEA 4NAOA 5FZKA 2Q30A 2DTWA 1EAH1 3ZOIA 1PO22 3RZGA 1XNTA 1SCRA 2CNAA 2J1SA 3BB6A 4XTMA 4PLOA 3VBSA 3POEA 4SLIA 3VDDA 2YBPA 3HMYA 2EAAA 2VMDA 1FMD2 4AR2A 3ZXDA 1N47A 5KBFA 3AMQA 1OQEA 3DPRC 4YWAA 4HSLA 1OD3A 3T2TA 1TNRA 3ILRA 2Y6JA 1H0BA 2VMGA 2WL1A 3VL9A 4YZ2A 5EYXA 1GWMA 3K46A 4HPKB 4YG6A 1DIWA 2YB7A 3IMMA 4Y4RA 1RUF2 3NRUA 1RVF3 3N3HA 2K0GA 1IPJA 1GZWB 2NYYA 2RS52 2JDAA 4K7JA 4Y5TA 3T3YA 4PDWC 4DY5A 4A7YA 4RR3B 5FBJA 1RUH3 2PHWA 2Y64A 4BWOA 3JXSA 5FZEA 5GKAC 1VB4A 1RVF1 1NZCA 3WT3A 4NPMA 4K6BA 3N9PA 4EE2A 4QQHA 3FZ3A 1UOGA 1WBLA 1A6CA 3EQEA 3OJBA 4IE6A 3WP4A 1DYOA 5K4LA 3AKQA 1SZBA 1FT9A 2WNVB 1Y43B 2WINB 2A3YA 4B4RA 2OYZA 4BQ4A 4ZONA 5A3LA 1KXGA 1XRUA 5FPBA 4M3CA 5DZGA 1RUJ2 2VOXA 4LHLA 1X9TA 1K5JA 3NNMA 2DYCA 2GZWA 2VQTA 3GZAA 3KF3A 3T0AA 3UESA 4E4SA 5CADA 3OGGA 1XSRA 2YBSA 5FZBA 3WX5A 1H1AA 4Q0SA 3GNEA 4ARXA 4IERA 4QXHA 1RINA 2CAUA 3OTFA 1OD5A 2WAAA 1BBT2 2VZOA 4CDQB 1YI9A 4EZHA 1Y9MA 2VO5A 4P9JA 2DCTA 1H6XA 1UPIA 4JAAA 2CTVA 3M3EA 3D0SA 1GUIA 2IVIB 3WW4A 1VBE2 5JZGA 1AUYA 1XQNA 2E7QA 2YC0A 2KXLA 3AJYA 4XFFA 3O7OA 3PUSA 4CCCA 2FMYA 2VMEA 4OVEA 4YSFA 3ROUA 1OLRA 5LBEA 5FUPA 5FBZA 4KBBA 3R0RA 1IZ3A 4I09A 2UWAA 3MYXA 1Z0HA 3AM2A 1XBFA 4XJZA 4BK4A 3BOWA 1JZ6A 1YIFA 1WLWA 1DLLA 4FCAA 1TQ5A 4YVSA 3A0KA 4YFWA 4IEVA 3VBRA 5F1RA 5FYZA 2W46A 4QDSA 1JYNA 5FZCA 4FPOB 3AVSA 2JX9A 3NKGA 2RE9A 2GDFA 2YFUA 2R16A 1UY1A 1S0GA 3PVOA 4COUA 3BTYA 4I2OA 1CAWB 4AFMA 2ZGRA 1CZSA 2P6CA 5KHKA 3M4FA 5JOZA 1AYN3 4XCBA 4HLTA 1AR62 2EALA 2XJSA 2NMNA 3IZOA 4P9WA 3O0WA 4AVAA 4BK5A 1LENA 4P00B 4PHZA 1QNWA 1J3PA 3PTRB 1QJY2 2RJKA 1DQ5A 2JG8B 3UETA 2OT7A 3S6PA 1LGBA 2WWUA 1H30A 5FZ3A 1AYN1 3LEIA 5FZOB 4NMIA 2ILMA 4QGNA 1Y4WA 4CCJA 4Q1RA 4MGQA 5DG2A 4ATEA 3NL1A 4P14A 1BQPA 2WNOA 1QGLA 1VAKA 1YUDA 4CXWA 5JAXA 5H9PA 3ZMOA 4DXSA 1NQDA 1MACA 4MLOA 4RGGA 2ZACA 4FPJA 3HAGA 4CEWC 4K9SA 1AZDA 1WMDA 5F3IA 2ORZA 1W0NA 1MS4A 3CL1A 1H6YA 1PGL2 1RUG2 3W20A 1CESA 3NJXA 1VMFA 2Y8KA 4I30A 5JOYA 1AVBA 3OGRA 3NV4A 5EJ3A 4D7YA 3WCRA 2YV8A 4QHZA 1XU1A 5FZ9A 3VBHC 3UKNA 1SLLA 3S7IA 2ORXA 1IPSA 3OGVA 1OFNA 1W8WA 5CAZA 1MS8A 2C1FA 5F2SA 3ZFEC 2B39A 5D8AB 3FUOA 1OPMA 3KV5A 4LBQA 1GFF2 4BMEA 2VMCA 3ZFGA 3ZPOA 4EWEA 4MV2A 4Q0PA 4TSVA 3KT4A 4QX8A 4WM7C 3U07A 3KCXA 1LTEA 3BPSA 4OZXA 1W6MB 3IIIA 4O9GA 3HN3A 2WFPA 1PK6B 1W05A 1ZBA3 1XNKA 4S2HA 1ZBE2 3GALA 1FPN1 5C8CA 4BXFA 3I59A 4LITA 1PZ8A 4C1XA 3VD9A 3OGJA 1LOBA 2G19A 1UWWA 3H1YA 5L9VA 1W2UA 4AXOA 5FYTA 5FUNA 1C28A 2P37A 4Q4W1 2RG4A 3Q8BA 1ZBA1 4PIZA 2JDPA 1CVNA 2D43A 4CEYC 4NUBA 4XJWA 3EYPA 4LEJA 3ZVXA 4LK6A 2DTYA 1WLCA 1NCRB 4WV8A 5GLTA 1Q8SA 1A78A 1TEIA 2W1SA 5C5TA 1DQ2A 1HV1A 4Y4YA 4GH4B 4M01A 1HLCA 3ZXJA 1Y9GA 3O1RA 5FY7A 1O5UA 3DEMA 2QQIA 1JS9A 3I2JA 3KGZA 2J1RA 4MO3M 4YZ1A 2BW8A 3RQ0A 5FLJA 3BUCA 2LRPA 3I3MA 3OD4A 4V2VA 3FHQA 1AX2A 3CNAA 5JLVA 2HWD2 1YQCA 3VHNA 2R1DA 1CAVA 5K0UA 1P8JA 4D7TA 3JBG2 5LBBA 3ZSJA 5JSPA 1WBFA 3GZEA 2W9XA 5BNOB 2EXKA 2RS13 3ZXKA 4P9LA 5FYUA 2WNUB 1FMD1 1ND2B 3GCXA 4CP1A 4BPZA 4KMQA 5KHHA 4YLZA 1QOSA 5JDBA 1JXNA 5JPMB 1AR82 3MIHA 5IAXA 1QIQA 2RS11 3AXEA 3VHPA 3LSEA 4PBPA 1AXKA 2JB4A 2Y34A 3WZ1A 4D3WA 5IK5A 2ZZQA 4EROA 2JDMA 4SBVA 4S2FA 4B3NA 1ENXA 2ZGNA 1ZRRA 1UO9A 1WD3A 3DXTA 1EYBA 3UJOA 3O14A 1XE8A 3RZZA 4AZZA 4IL7A 4CZSA
chains in the Genus database with same CATH topology
5A80A 5IVVA 2Q8DA 3N9LA 4TN7A 5F39A 5FXXA 4Y4RA 5FY8A 5FYSA 5FZ7A 1VRBA 3PU8A 5IW0A 4ASKA 3LD8A 5FZ6A 5A7SA 5F3CA 5A3WA 2OS2A 3NJYA 5F3IA 5FBJA 5FWJA 3DXUA 5FP8A 5IVBA 5LY1A 4CCNA 5FZEA 4CCKA 4QXBA 5FZ9A 3N9NA 3N9PA 3UYJA 5FYHA 5FV3A 5FZFA 5F3EA 2OX0A 5FXWA 4XDOA 4CCLA 5FY1A 3OPWA 4LXLA 3ZLIA 5F2SA 5K4LA 5A1LA 3N9MA 5ANQA 2XXZA 2P5BA 4D6RA 3N9OA 3KV5A 3ZPOA 5FPBA 4EZ4A 5FP9A 3PDQA 4GJZA 5IVYA 5CEHA 4QX8A 5IVFA 5FXZA 5A3NA 4BISA 2W2IA 2YU1A 2YBKA 5FYVA 5A7QA 5F5AA 2YBSA 5FZBA 5FP4A 4QXHA 5FP7A 5FWEA 4BXFA 4EZHA 4LITA 4HONA 5FYIA 4LIUA 4GJYA 4IGOA 2OQ7A 4DO0A 4QX7A 5FYTA 4CCOA 3LDBA 5FUNA 5FY9A 5FZLA 4CCMA 4CUGA 5FZDA 4GD4A 4XDPA 4NUBA 2Q8EA 4AI9A 2OQ6A 5LW9A 5FPUA 5FYCA 5FZAA 5F5CA 3PUSA 5FY4A 3KVBA 5FZ8A 3U78A 4E4HA 5FUPA 5FPVA 5FZIA 5FZGA 5FYYA 4EYUA 2GP3A 3AL6A 5FY7A 4UF0A 4LIVA 5A3TA 5F3GA 5FPAA 5FZOA 2YPDA 5FYMA 5F37A 5FJHA 5IVJA 5A7OA 5A1FA 4UF0B 5FZ4A 5IVCA 5FYZA 3KV9A 4V2VA 5FZHA 3U4SA 4Y3OA 4CSWA 2Q8CA 3N9QA 3K2OA 2WWJA 3PUAA 5FZCA 5LY2A 3AVSA 5FY5A 2VD7A 4QWNA 5F5IA 5FXVA 5FZMA 5FJKA 4QU1A 5A7NA 3AVRA 4QXCA 5F2WA 5FPLA 4Y33A 4D6SA 5IWFA 5FZ0A 4AAPA 3KV6A 5FYUA 4BU2A 3AL5A 3PURA 5FZ1A 5A3PA 3PUQA 2XDVA 5FZKA 2XMLA 3KV4A 3K3NA 5KR7A 5LWBA 5ISLA 5A7PA 3OPTA 4IGQA 5F32A 4D6QA 3PTRB 3PU3A 2PXJA 4IGPA 3KVAA 4C8DA 5A7WA 4URAA 2OT7A 4HOOA 4DIQA 2WWUA 2YBPA 5FZ3A 5FYBA 5FZOB 5A7WB 5E6HA 4CCJA 2YU2A 2XUEA 4GAZA 4V2WA 3RVHA 3K3OA 3DXTA 2GP5A 5FP3A 5FY0A 5IVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A80 A;  5IVV A;  2Q8D A;  3N9L A;  4TN7 A;  5F39 A;  5FXX A;  4Y4R A;  5FY8 A;  5FYS A;  5FZ7 A;  1VRB A;  3PU8 A;  5IW0 A;  4ASK A;  3LD8 A;  5FZ6 A;  5A7S A;  5F3C A;  5A3W A;  2OS2 A;  3NJY A;  5F3I A;  5FBJ A;  5FWJ A;  3DXU A;  5FP8 A;  5IVB A;  5LY1 A;  4CCN A;  5FZE A;  4CCK A;  4QXB A;  5FZ9 A;  3N9N A;  3N9P A;  3UYJ A;  5FYH A;  5FV3 A;  5FZF A;  5F3E A;  2OX0 A;  5FXW A;  4XDO A;  4CCL A;  5FY1 A;  3OPW A;  4LXL A;  3ZLI A;  5F2S A;  5K4L A;  5A1L A;  3N9M A;  5ANQ A;  2XXZ A;  2P5B A;  4D6R A;  3N9O A;  3KV5 A;  3ZPO A;  5FPB A;  4EZ4 A;  5FP9 A;  3PDQ A;  4GJZ A;  5IVY A;  5CEH A;  4QX8 A;  5IVF A;  5FXZ A;  5A3N A;  4BIS A;  2W2I A;  2YU1 A;  2YBK A;  5FYV A;  5A7Q A;  5F5A A;  2YBS A;  5FZB A;  5FP4 A;  4QXH A;  5FP7 A;  5FWE A;  4BXF A;  4EZH A;  4LIT A;  4HON A;  5FYI A;  4LIU A;  4GJY A;  4IGO A;  2OQ7 A;  4DO0 A;  4QX7 A;  5FYT A;  4CCO A;  3LDB A;  5FUN A;  5FY9 A;  5FZL A;  4CCM A;  4CUG A;  5FZD A;  4GD4 A;  4XDP A;  4NUB A;  2Q8E A;  4AI9 A;  2OQ6 A;  5LW9 A;  5FPU A;  5FYC A;  5FZA A;  5F5C A;  3PUS A;  5FY4 A;  3KVB A;  5FZ8 A;  3U78 A;  4E4H A;  5FUP A;  5FPV A;  5FZI A;  5FZG A;  5FYY A;  4EYU A;  2GP3 A;  3AL6 A;  5FY7 A;  4UF0 A;  4LIV A;  5A3T A;  5F3G A;  5FPA A;  5FZO A;  2YPD A;  5FYM A;  5F37 A;  5FJH A;  5IVJ A;  5A7O A;  5A1F A;  4UF0 B;  5FZ4 A;  5IVC A;  5FYZ A;  3KV9 A;  4V2V A;  5FZH A;  3U4S A;  4Y3O A;  4CSW A;  2Q8C A;  3N9Q A;  3K2O A;  2WWJ A;  3PUA A;  5FZC A;  5LY2 A;  3AVS A;  5FY5 A;  2VD7 A;  4QWN A;  5F5I A;  5FXV A;  5FZM A;  5FJK A;  4QU1 A;  5A7N A;  3AVR A;  4QXC A;  5F2W A;  5FPL A;  4Y33 A;  4D6S A;  5IWF A;  5FZ0 A;  4AAP A;  3KV6 A;  5FYU A;  4BU2 A;  3AL5 A;  3PUR A;  5FZ1 A;  5A3P A;  3PUQ A;  2XDV A;  5FZK A;  2XML A;  3KV4 A;  3K3N A;  5KR7 A;  5LWB A;  5ISL A;  5A7P A;  3OPT A;  4IGQ A;  5F32 A;  4D6Q A;  3PTR B;  3PU3 A;  2PXJ A;  4IGP A;  3KVA A;  4C8D A;  5A7W A;  4URA A;  2OT7 A;  4HOO A;  4DIQ A;  2WWU A;  2YBP A;  5FZ3 A;  5FYB A;  5FZO B;  5A7W B;  5E6H A;  4CCJ A;  2YU2 A;  2XUE A;  4GAZ A;  4V2W A;  3RVH A;  3K3O A;  3DXT A;  2GP5 A;  5FP3 A;  5FY0 A;  5IVE A; 
#chains in the Genus database with same CATH topology
 2YC4 A;  3ZFF B;  3C7E A;  3WVJ A;  1HQL A;  1UOB A;  2UYB A;  2XOM A;  1NCQ C;  2Z69 A;  3JQX A;  4Y1Z A;  3URF A;  1W9Y A;  3VBF C;  2VC9 A;  3PU8 A;  1NAE A;  1HB1 A;  4Z2W A;  3WNO A;  4E4D X;  2BRT A;  2EIE A;  4WM8 A;  3J8F 2;  3LEM A;  4R8H A;  1LCL A;  2YDE A;  3OUJ A;  1X82 A;  4DRR A;  3POY A;  3J7L A;  3POB A;  2DFB A;  3O1T A;  4N7U A;  2B46 X;  1FAY A;  4N43 C;  4QXB A;  4BCU A;  3HNM A;  4XF1 A;  4AFA A;  1SLB A;  3B7M A;  3LOI A;  4YG0 A;  3G7D A;  3MBW A;  4JGY C;  1S0I A;  5FXW A;  1NUK A;  4JGZ B;  3PJY A;  1L7R A;  1RUE 2;  3RZH A;  1IS3 A;  4K1Y A;  3TBD A;  3DN7 A;  2DCK A;  2BWA A;  4DUW A;  1AJK A;  4A2U A;  2ARX A;  1BVV A;  3H9A A;  4AGR A;  2WT0 A;  1SEF A;  1VBE 1;  2JDK A;  4KH9 A;  1K42 A;  3I54 A;  1VBC 3;  4M4P A;  1H8T B;  4LQR A;  5D2A A;  2VCB A;  1JZ8 A;  4WBB A;  5DAQ A;  3U75 A;  3MF9 A;  2ZPX A;  4I0A A;  4GJY A;  2BPA 2;  3QOP A;  3CJI B;  3RJR A;  4QPI B;  2J1V A;  4OLL A;  4CU7 A;  4CCM A;  2NQY A;  2UUR A;  4M3C E;  3KWV A;  2V4A A;  2Z2S B;  2RV9 A;  3JCI A;  2R06 3;  3EMR A;  2P2K A;  4P5H A;  4ISR A;  1QQP 2;  4YGC A;  5FCC A;  5FO9 B;  5IYY A;  3ZR5 A;  1PX4 A;  5LW9 A;  3GJB A;  5ABJ B;  2UY8 A;  1ZA4 A;  2J1A A;  5FZ8 A;  4E4H A;  2PHU A;  3BVC A;  1O59 A;  1UXZ A;  4JKK A;  2R06 1;  4IW3 A;  1LAJ A;  2CGP A;  1C1L A;  1DGL A;  2W52 A;  3WDT A;  1GWL A;  1MVE A;  2WZE A;  1VMH A;  4N53 C;  1W2O A;  3W9A A;  4LT5 A;  4MXW B;  2AH2 A;  1JH5 A;  4UWD A;  3J7N A;  1UY3 A;  2GAU A;  3NAP B;  1QOO A;  2WZR 3;  1U12 A;  2BQP A;  3KV9 A;  4MOA A;  1OKO A;  1UW8 A;  1QJZ A;  3H3U A;  4OMD A;  3N9Q A;  4CSW A;  2P17 A;  2D93 A;  4LUM A;  4RSU A;  3VBO B;  3TNQ A;  4AFD A;  1SPP B;  4YW3 A;  5L7O B;  3ZYJ B;  2ZMN A;  2NMO A;  2HYX A;  1OVS A;  1AL0 G;  1QH7 A;  2WO2 A;  3WF2 A;  2WZR 1;  5ACA 3;  1H9P A;  2D44 A;  4EQV A;  1GU3 A;  1RMU 2;  4ZS3 A;  1QJX 2;  4OQ9 A;  1AF9 A;  1TMF 3;  3GBF A;  1AYM 3;  1YQ5 A;  3R6S A;  1NYW A;  4WVV A;  2E6V A;  4KU7 A;  5JI7 A;  4E2G A;  3A0N A;  4D6Q A;  1OF4 A;  4F8A A;  2R04 3;  1S2E A;  1LGN A;  3IKW A;  4H3W A;  1JHJ A;  1EPW A;  2ZBJ A;  3JB8 A;  4CDU A;  2PAE A;  4GQ7 A;  5FYB A;  1AYM 1;  4CP2 A;  1REF A;  3QAC A;  1HXS 3;  3ZXL A;  4RS5 C;  4AWD A;  4AGG A;  1JZ4 A;  2P3Y A;  2R04 1;  2WAO A;  3NQH A;  4UFL A;  5FFO C;  5SV5 A;  3SKJ E;  1RUN A;  3V0B A;  2LM3 A;  4XBN A;  2VUL A;  4CEY A;  1HXS 1;  1C1F A;  5B4N A;  2D3R A;  1CD3 G;  2ET1 A;  1SLA A;  3U4X A;  1W2A X;  4AQS A;  2NPI A;  4CDW C;  3LEK A;  2DVG A;  4EN0 A;  1W6P B;  3ACL A;  2LAL A;  2C9A A;  1GKB A;  2OX0 A;  1S0J A;  2BU9 A;  2VUD A;  3ZX7 A;  5F6K A;  5CFC C;  1CON A;  4JV4 A;  1A3K A;  5E88 A;  2QUO A;  4NID A;  1EAH 2;  5DDJ 3;  4D6R A;  3WP6 A;  3TAY A;  2XJV A;  3CBN A;  1URX A;  3PDQ A;  3WDU A;  1QJU 2;  5IT6 A;  2VTX A;  4L2N A;  4PF1 A;  1MVQ A;  3U14 A;  2XUM A;  1DZR A;  5F7U A;  3AB0 A;  2XLF A;  3NO8 A;  5F5A A;  5DAV A;  3AYA A;  1U5Z A;  5LA9 A;  5DDJ 1;  4JCK A;  1GOH A;  2VM9 A;  2CSG A;  3RYR A;  3IDB B;  5KXD A;  4UXA A;  1WW4 A;  2BP6 A;  3HJR A;  5FWE A;  2D5F A;  3DGT A;  4FPF A;  4AI8 A;  1X8E A;  1W9F A;  4NHM A;  4FI9 A;  1W6N A;  4BA6 A;  3PL0 A;  5LA0 A;  2FZ2 A;  1KFU L;  1O8P A;  1OUX A;  4RQP A;  2VOV A;  4XJ8 A;  5DN2 A;  1CPM A;  1LHO A;  1GWK A;  4GD4 A;  3L2H A;  3NV3 A;  4C1W A;  1G9F A;  5FK8 A;  5A6X A;  4W6W A;  3RZL A;  4YVW A;  1YO8 A;  1E5S A;  4QX0 A;  4M0N A;  3VHO A;  3ZSL A;  3H8R A;  3WP3 A;  2VZU A;  2BGP A;  3VKF C;  1RVF 2;  2IXH A;  5I8T A;  1EUT A;  1AR7 3;  1WWY A;  5FZI A;  5FZG A;  1UQX A;  4N9H A;  4AFB A;  1DYP A;  1RUH 2;  3QH7 A;  4LHK A;  3RJ2 X;  5A33 B;  1JUI A;  3BTA A;  3H42 B;  1D0H A;  5C3P A;  5IHR A;  1UMH A;  3HWJ A;  2YMZ A;  1QU0 A;  5DZF A;  1AR7 1;  5CBL A;  1DU3 D;  1RGS A;  1V9U 3;  2Q8C A;  2ZAA A;  1RUO A;  4N43 A;  2RDN A;  1U5I A;  4D94 A;  5CFD C;  1RIR A;  5F2W A;  4GMP 1;  2VNO A;  4QXC A;  1GZW A;  2KR2 A;  3GGL A;  4IES A;  2JD4 A;  2JEC A;  1X7N A;  4EN7 B;  3QH6 A;  4RR3 A;  5F8P A;  3M8L A;  3GZT B;  1V9U 1;  2RDR A;  1WD4 A;  4TLG A;  2AEY A;  4HN1 A;  5FTT C;  4NE9 A;  4H7L A;  3PUQ A;  4XF4 A;  4ARY A;  3OCP A;  5C8W A;  3MUZ 1;  3K3N A;  5JI9 A;  1VRH 3;  2G9F A;  4X6Q B;  4A6O A;  1JZ5 A;  4CCE A;  4URT A;  2VBB A;  4MHR A;  3NJZ A;  4G4F A;  4E27 A;  5A7W A;  3V64 A;  4NRM A;  3HD8 B;  3BTZ A;  4NR1 A;  2FQP A;  3NST A;  2BNN A;  2QQM A;  2OII A;  3RVH A;  1F8V A;  1VRH 1;  4GAZ A;  4XUO A;  5K9Y A;  4DNY A;  2DFC A;  2JKB A;  2VU9 A;  3NMB A;  5FP3 A;  2VQU A;  1V0A A;  2PHF A;  4XC9 A;  1RIT A;  2G4I A;  4QAW A;  4BLJ A;  3E1F 1;  2C24 A;  1RB8 G;  4Q4V 3;  1CAU B;  1Q43 A;  3OEA A;  5J1X A;  4Q2F A;  2XH6 A;  4LTA A;  4QQL A;  3WG4 A;  3FL7 A;  1EP0 A;  3EJK A;  4H7M A;  2UWC A;  2BVB A;  3AKT A;  1QDC A;  1WA4 A;  5IVB A;  2RS3 3;  4XDQ A;  3ACI A;  3UL2 A;  4Q4V 1;  4ASL A;  1MS3 A;  1UY0 A;  1OLM A;  2BNM A;  1V6I A;  2WC2 A;  3BGA A;  4IV1 C;  2DDU A;  2W08 A;  3O0V A;  3WV6 A;  3WNM A;  3C7H A;  4HVQ A;  4N53 A;  2DU0 A;  4WZF A;  3ASI A;  3E5U A;  2GMP A;  1JI6 A;  1JOP A;  1LOC A;  1VBB 3;  2RS3 1;  1BEV 3;  5BNP B;  2FBE A;  1CJD A;  1XYO A;  1J84 A;  4IEW A;  2IXC A;  3D82 A;  4BHP A;  2EIB A;  3ABZ A;  3TWI A;  2IUW A;  1W3X A;  4LBM A;  1DZQ A;  3Q8A A;  2HEW F;  1W39 A;  2WA3 A;  4FPL A;  1AYN 2;  3MV0 1;  4YFZ A;  2YU1 A;  1CWP A;  1IGO A;  4GB3 3;  3U37 A;  3CJX A;  3GBG A;  4YVS C;  2A6W A;  4GKY A;  4P9X A;  2VZP A;  3ZYB A;  1CN1 A;  2BBA A;  2BV4 A;  3ORJ A;  4AVV A;  4IEQ A;  3OSD A;  4IGO A;  1YFX A;  1NOV A;  2BNO A;  2G9Z A;  4W6X A;  5HV4 A;  5IK8 A;  5FPZ A;  1VAM A;  4NHK A;  1QMJ A;  3USU A;  5JSO A;  1CAW A;  2PLV 3;  2XON A;  4DRV A;  1OT5 A;  3AYD A;  5FRA A;  3AMH A;  4HZF A;  5A1A A;  3RMY A;  1FYU A;  3HR9 A;  3ZPY A;  5H9Q A;  1PGS A;  2ES3 A;  4XFA A;  4ZXK A;  4AAX A;  1OHF A;  2ARA A;  2I74 A;  4YGD A;  5C9A A;  2QQO A;  2FCT A;  1HB4 A;  2JG8 A;  1Y7B A;  2WUH A;  2ZX2 A;  3HT2 A;  4B1L A;  1XNB A;  3MLL A;  3FFZ A;  3S57 A;  1LHN A;  3KCC A;  5CZK A;  5FZO A;  1HRI 3;  3OGS A;  5A1F A;  1AL2 3;  1ST8 A;  1YJL A;  2ZJC A;  3IM0 A;  1RMU 1;  5AFE A;  1X36 A;  4HL0 A;  1QXR A;  3ZIX A;  1JU4 A;  2Y60 A;  2WNE A;  1D2Q A;  3INA A;  4JDO A;  5DUV A;  3SMH A;  5F5I A;  4NIH A;  3C7F A;  5T55 A;  3RI9 A;  1V70 A;  1IQA A;  3M7A A;  3THT A;  1D7P M;  2AYH A;  2XQX A;  2QQP A;  1HRI 1;  1AL2 1;  4JHZ A;  1SBD A;  1PM4 A;  1GZC A;  1Y3T A;  4BQ5 A;  2EXH A;  1O3T A;  3LA7 A;  1LHW A;  1SFN A;  2CAV A;  4FPE A;  4COV A;  4HSJ A;  3OOX A;  1G6N A;  3A23 A;  1D4V B;  3ELN A;  3GDB A;  4J25 A;  4QQP A;  4KBZ A;  4PLN A;  1ZBA 2;  1YNA A;  5F32 A;  5BNN B;  2E32 A;  3VKM A;  4YM1 A;  3UNP A;  4XIL A;  1U0A A;  3AFG A;  3BYW A;  2ZCW A;  4LPL A;  2DUQ A;  1OSG A;  5BUV A;  1JHN A;  1YCI A;  4U36 A;  4V2W A;  4MG2 A;  2BBV A;  1ENQ A;  1R1A 3;  3ZFG C;  5JSR A;  3MEP A;  3RZM A;  2WFF 3;  1FNZ A;  1GLH A;  4AI1 A;  5DAP A;  2JDN A;  3N7M A;  1MS1 A;  1CR7 A;  1YEW A;  2DVF A;  1W6M A;  3OYW B;  1VMJ A;  1XYN A;  2D7F A;  3MPB A;  1K5M B;  1OBN A;  5FZ7 A;  4DB5 A;  3S0M A;  1PK6 A;  1SBE A;  5IW0 A;  1PMH X;  1R1A 1;  3OUI A;  4I3G A;  1W06 A;  4U2A A;  5FLI A;  4ASK A;  4LKE A;  4E9K A;  2VL4 A;  4WVZ A;  3WF3 A;  1YLL A;  2WFF 1;  3RWK X;  5CNA A;  1C8N A;  5FMO S;  1Q8V A;  2W94 A;  2VMH A;  4CCN A;  3TEW A;  2ZEY A;  3CZJ A;  4TZD A;  2BWC A;  2GU9 A;  2Q4S A;  4AEJ A;  3PJQ A;  3BTX A;  1JYI A;  1XU2 A;  4XIK A;  1QJU 1;  1UU5 A;  3IDE A;  1G9D A;  4NAM A;  3RGB A;  3LAG A;  5FZF A;  1OA2 A;  2D3P A;  5BYN A;  3NKT A;  5CIR A;  2WII B;  5I0S A;  3N9M A;  1SDW A;  1S55 A;  4IE5 A;  1MZE A;  2WN2 A;  2RDQ A;  3LWC A;  2Y6F A;  3P1I A;  2C5D A;  1HN1 A;  4XZU G;  2LUW A;  2RS1 2;  1N3O A;  4GH4 A;  5CFD A;  4XZP A;  3KHB A;  1KGY A;  5DPN A;  2HWE 3;  1HJG A;  1K12 A;  1XJA A;  3D8C A;  2YBK A;  2GH2 A;  3AC0 A;  1D4M 3;  3BN6 A;  4FO9 A;  2QNK A;  2ZGO A;  3ZXF A;  3IBM A;  3MFC A;  1QNY A;  3H7Y A;  1BXH A;  1FV2 A;  3ZXG A;  2E63 A;  5C3R A;  2ETE A;  1DGR N;  4XIO A;  4BQ3 A;  2GMM A;  2HWE 1;  1GQG A;  4QPG B;  2P34 A;  2QDR A;  3ETP A;  5K0U C;  3L2Y A;  2WLQ A;  4MYE A;  5FUI A;  2HKX A;  3FHI B;  4TTG A;  2NLR A;  1SLI A;  1RUH 1;  4YPJ A;  3ZXA C;  5BNO A;  2WNU A;  4IE0 A;  3RWN A;  1ND2 A;  4OFG A;  1JZ3 A;  5JMO A;  4AI0 A;  2IVJ A;  4B7E A;  4YAR A;  2B42 B;  1PIV 3;  1NKG A;  4L8Q A;  5LEJ A;  4H2A A;  1APN A;  3ZN5 A;  4EN6 B;  4GWI A;  3IWZ A;  4NVP A;  5GLU A;  1MS9 A;  1ULE A;  3ACH A;  3MZH A;  3KF5 A;  5CKQ A;  3WF1 A;  2L9L A;  1VR3 A;  4UF0 B;  2JE8 A;  1F35 A;  1JYV A;  4GWM A;  4PBO A;  1LOF A;  3AX4 A;  4R52 A;  3U4S A;  1OUR A;  4HFS A;  1MQT B;  4Y1V A;  3ZFF A;  5J96 B;  2VD7 A;  4LOS A;  4IV1 A;  4QWN A;  4NPL A;  2CHH A;  4H55 A;  4QX1 A;  4E2S A;  4FQ4 A;  4JKL A;  2JG9 B;  1U5Y A;  2TBV A;  1QEX A;  1SDD B;  4MGT A;  2ZML A;  5LAS A;  4M0H A;  4WM8 C;  4AFC A;  4AEM A;  2A3W A;  1R09 3;  4P02 B;  4AQT A;  1H2M A;  5F5Q A;  3WQB A;  1SAC A;  4K8R B;  3T2P A;  4YM3 A;  2YGM A;  3V56 A;  4XOG A;  3ZDS A;  1QWR A;  1VBC 2;  1V00 A;  3RPQ A;  2HWB 3;  3AYC A;  3KHC A;  2XHN A;  2C6S A;  3NV1 A;  2OA2 A;  3H3L A;  3N7K A;  3AZY A;  1IKQ A;  2BYV E;  1R09 1;  1RUD 3;  4JGZ A;  4JKM A;  4URA A;  4QD2 A;  1GIC A;  3W5M A;  1J3R A;  1J3Q A;  1YYN A;  2H0V A;  3K3O A;  1UX6 A;  3TRS B;  1RUC 3;  2GN7 A;  2GAL A;  2R06 2;  3MI8 A;  1OQD A;  2HWB 1;  4FFI A;  1YI7 A;  3AZZ A;  4HK8 A;  1HDK A;  3T1M A;  4EWD A;  2VZT A;  3K51 A;  4AG4 A;  1V6K A;  5JMC A;  1CAX A;  1I1E A;  1W9S A;  3C7O A;  3OB8 A;  1RED A;  1FI2 A;  5FY8 A;  3CIH A;  5FYS A;  4JC1 A;  4CU8 A;  1S1A A;  3J7H A;  4Q4X 3;  4RYD A;  4CVU A;  1UL9 A;  2D6O X;  1QHD A;  2E9Q A;  3DXU A;  2R32 A;  4XUN A;  5GZC A;  3IDA A;  3CJI A;  2ZEX A;  1DBN A;  2XWB B;  4Z1V A;  5LZ6 A;  4OUE A;  3KGL A;  5GJ6 A;  3N9N A;  2BGO A;  4Q4X 1;  1COV 3;  2WZR 2;  4MX3 A;  5IFP A;  5C4W B;  3M2M A;  5CG9 A;  4HKL A;  3WHU A;  2FDK A;  3UT0 A;  1DYK A;  4AL9 A;  2YZ4 A;  1KDK A;  4R9C A;  4CU9 A;  5ANQ A;  2XJU A;  4E4Z A;  4I01 A;  1N1Y A;  2ZEZ A;  4FOW A;  1TG7 A;  4FOQ A;  3ZM8 A;  2YFZ A;  1COV 1;  1F4H A;  3HQX A;  3EHK A;  4GJZ A;  5IVY A;  4ZKT B;  4RN5 A;  5ERL A;  4JRL A;  4DEV A;  4FVV A;  3TEZ A;  1IG0 A;  1OLM E;  1TMF 2;  2W2I A;  1AYM 2;  1BK0 A;  1O4Z A;  4MXW A;  3MFA A;  4AED B;  4CDX B;  2P3J A;  1MEC 3;  3NAP A;  3DL3 A;  3IAP A;  2Q1Z B;  1X8M A;  4MXV A;  4P9I A;  1HIX A;  2R04 2;  2WYS A;  5JIU A;  4FTB A;  1WCD J;  4BYY A;  1Q8O A;  2X5I B;  4IV3 B;  1RL3 A;  2E53 A;  1O6U A;  3VBO A;  4NPR A;  4DO0 A;  1SPP A;  2QQV A;  5L7O A;  2K9Z A;  1ALY A;  2HLE A;  3MW2 A;  2IXI A;  1HXS 2;  2MEV 3;  4BQ1 A;  3BOD A;  1MEC 1;  1GSL A;  1O7F A;  4D7S A;  4F3J A;  4LMF A;  3ZYR A;  5A32 A;  3WEZ A;  2HBT A;  2DBI A;  5FYC A;  2VNG A;  3HBK A;  2ENR A;  2VQ0 A;  3SLI A;  2YGL A;  2MEV 1;  1R64 A;  4MGI E;  2IXJ A;  3VBU B;  2OKX A;  1VBD 3;  4NHL A;  3OEB A;  2GSY A;  2GME A;  2VVD A;  3H7J A;  4LKS A;  3RYK A;  1OF3 A;  1T6G C;  3A4U A;  4O65 A;  4CDU C;  3ZYG A;  4L9B A;  4LIV A;  2JD9 A;  2OVU A;  1POQ A;  2YPD A;  2D3S A;  5A7O A;  2NM1 A;  2VCC A;  1CX4 A;  3BKZ A;  1VBA 3;  1ONA A;  1TME 3;  3RZK A;  4MHU A;  4LOT A;  1VBD 1;  4YGB A;  1WW5 A;  3AKR A;  1S2B A;  2XL9 A;  3PUH A;  5FZH A;  1PZ9 A;  4J1W A;  2EID A;  1MR5 A;  3KT1 A;  1Y9Q A;  2Q8O A;  5FJK A;  1UY4 A;  5A7N A;  4BB3 A;  3AVR A;  1BYH A;  5DDJ 2;  3H8O A;  5KHJ A;  1MS5 A;  1LGC A;  1VBA 1;  5FZ0 A;  1TME 1;  3SIT A;  4AAP A;  4CXX A;  4P9Y A;  5KXE A;  3AL5 A;  2VUA A;  4QB6 A;  4QKD A;  1HW5 A;  1UF2 C;  4A44 A;  2ZHM A;  5FMB A;  1BLZ A;  3ZYF A;  1VLN A;  1W6P A;  3THP A;  4N90 A;  1N3Q A;  3UJQ A;  1NA1 B;  2I2S A;  4UW6 A;  2DWR A;  4A4A A;  3VDA A;  4Q8K A;  1ZZ7 A;  3VZN A;  3HVD A;  3KVA A;  1UOF A;  4LHN A;  4O9E A;  2QZ2 A;  4RHV 3;  1Q56 A;  3VBS B;  4BQ2 A;  5FLH A;  2XVG A;  1YXW A;  5JOX A;  3VDD B;  5E6H A;  3PIJ A;  2A6V A;  1V6L A;  2BTV C;  3T0B A;  1MZ6 A;  4TN7 A;  4RHV 1;  4BQX A;  4BM8 A;  2FDH A;  1ASJ 3;  4S2D A;  5CA6 A;  3U0Z A;  2XWJ B;  4LLO A;  5LAT A;  3GJA A;  4LBQ D;  1AR7 2;  2BEO A;  4GWJ A;  3HT1 A;  3MPP G;  3WF4 A;  2Z4F A;  4E2Q A;  2A3X A;  5JR7 B;  1PZ7 A;  1ASJ 1;  1CIW A;  4RQP C;  1OVP A;  2IFW A;  3OF1 A;  3POG A;  1UYX A;  4HXC A;  1D2S A;  5CIS A;  4YVW C;  1V9U 2;  3PTY A;  1VAL A;  4LXL A;  2ZTN A;  4LLF A;  1AXY A;  4XAC A;  1W8N A;  1BKZ A;  4XYX A;  1OOP B;  1O91 A;  3M3C A;  2DVA A;  1NXD 1;  2E7A A;  5I0T A;  5A33 A;  4M3C B;  3ES4 A;  3WW3 A;  4BIS A;  4QB2 A;  4QKN A;  2UWB A;  4ZS2 A;  1JYT A;  2VW1 A;  3MLJ A;  1VRH 2;  4E8D A;  4UW3 A;  5BPX A;  1F2N A;  2RJ2 A;  2ZHL A;  4QPW A;  3IMN A;  1QDO A;  4AVT A;  2XJR A;  4DXZ A;  1RHI 3;  4XMI A;  1GBG A;  4AHY A;  2ZHK A;  4AI3 A;  3PNA A;  1ULG A;  1O8S A;  4ISQ A;  3OG2 A;  4MGY E;  3AMM A;  1IHM A;  3EB7 A;  3ATG A;  4RR3 C;  2C9K A;  4XDP A;  3WW1 A;  5GZF A;  5JZG B;  1RHI 1;  1N1V A;  4R9D A;  5HCB A;  5FPU A;  4Q4V 2;  4XBQ A;  3ZYH A;  5FY4 A;  4CPB D;  1LES A;  1STM A;  4QX5 A;  1FV3 A;  1HQN A;  3AFK A;  3NV2 A;  4HN0 A;  4HMZ A;  4RD7 A;  2WS9 3;  3SCH A;  3WQ7 A;  3MIE A;  4B4Q A;  2RS3 2;  1L7L A;  3FLP A;  2WNV C;  5F37 A;  1G9B A;  4JRA A;  4XQW A;  3SQO A;  4A3X A;  3CMG A;  5C3O A;  2ZKL A;  4LUK A;  3ZYI B;  1ZA7 A;  3GM8 A;  1B35 B;  5LY2 A;  3VBR B;  5LRS A;  5JXJ A;  3IN9 A;  1ND3 B;  2VOT A;  2P4E A;  2ZGQ A;  1VBB 2;  1CZV A;  3BPZ A;  4GXL A;  1BEV 2;  2BVV A;  1VBC 1;  4ONU A;  1KS4 A;  5FQ0 B;  4W8J A;  3WLU A;  1M4W A;  2J42 A;  5FPL A;  2WO1 A;  5CKM A;  3UKV A;  1QY4 A;  3VZJ A;  2XPJ A;  2VZ3 A;  5GM0 A;  2VBP A;  2XKO A;  1BK1 A;  4CDQ C;  3IPV B;  4BU2 A;  4CUA A;  4PT6 A;  4XE9 A;  5L19 A;  3J9S A;  3PUR A;  4HBN A;  5A6Q A;  1OA4 A;  4WVW A;  4MH0 E;  1XSQ A;  4XAB A;  5AVA A;  2E7T A;  4GB3 2;  4YW1 A;  4EV0 A;  2PHR A;  4JDM A;  2AC1 A;  5A6Y A;  2QZ3 A;  2PEL A;  1POV 0;  3PU3 A;  2PXJ A;  1O3S A;  4C8D A;  5LB6 A;  4ZHN A;  5EXO A;  4HOO A;  2VR4 A;  2JEM A;  3DV8 A;  4ITC A;  4X8N A;  4XJ9 A;  5BNP A;  5HXV A;  2YU2 A;  3NNG A;  2NP0 A;  2VQA A;  5CU1 A;  4Q4Y 3;  3RNS A;  2PLV 2;  4MET A;  3FX3 A;  3DKQ A;  1A8M A;  3WW2 A;  4A41 A;  4J1X A;  2QQN A;  2C0Z A;  2ZA9 A;  5A80 A;  2ZKN A;  1WCU A;  1JUH A;  2OZJ A;  2ZGL A;  4I0B A;  1PO1 3;  1OI6 A;  3L9J T;  3N7L A;  4OZO A;  4YW5 A;  1W8H A;  5IUQ A;  5AC9 3;  2BJS A;  3H0O A;  3LD8 A;  2Q0A A;  3PUI A;  3I49 A;  1AHS A;  2PQS A;  3VB9 A;  4AHZ A;  4CRQ A;  3O1M A;  2PFW A;  2H0B A;  2A1X A;  2F4L A;  5AVP A;  1WCK A;  3X29 B;  1PO1 1;  2EXI A;  4OUM A;  5C33 A;  4FOY A;  4MGZ E;  1HRI 2;  3SEP A;  3VD3 A;  4PF5 A;  1AL2 2;  5AC9 1;  3WDY A;  1FOD 3;  3D6E A;  5ACA 1;  2Z79 A;  3OBA A;  2CU5 A;  5FV3 A;  4COZ A;  5I0R A;  1TMF 1;  2CDO A;  3WNN A;  1UU6 A;  2XJT A;  2Y0O A;  4XAA A;  3WXP A;  4XAE A;  2OUH A;  1DGW X;  1GV9 A;  4K20 A;  3A7Q A;  4L0P A;  5C6C A;  1TVG A;  2ZGM A;  1FOD 1;  5C9A C;  2FDJ A;  2FZ1 A;  1GNH A;  2JG8 C;  1CPN A;  5IVF A;  3PVB B;  3RSJ A;  4KI5 M;  3JZV A;  4UFH A;  5LBF A;  5A3N A;  3O1P A;  3GXU A;  2VZ1 A;  2ZHN A;  3BU0 A;  4KG8 A;  2VMF A;  3LPF A;  2WZ8 A;  2FCV A;  4HKO A;  4IUG A;  3TEX A;  3RRD A;  2Y38 A;  3VKN A;  3P3N A;  1H8V A;  1RUI 3;  2W39 A;  3O1S A;  4X6R B;  4LO7 A;  3UGG A;  5C8C B;  4XQ4 A;  2AEN A;  4QB1 A;  1NLR A;  4TLF A;  5FMC A;  4AQ2 A;  3MLK A;  3LIH A;  2R6Q A;  4CCO A;  2ZGU A;  2QQU A;  3LFM A;  4KL1 A;  3CQO A;  1R1A 2;  3LDK A;  1Q5O A;  2ATF A;  1YRZ A;  5BNQ A;  1UAI A;  4K3U A;  1RUI 1;  3HEI A;  2WFF 2;  2X09 A;  3POF A;  4CP9 B;  1QJF A;  3R4S A;  1C5H A;  4HVR A;  2LRO A;  2Z5W A;  3UKT A;  4PQ9 A;  3OPZ A;  1DQ4 A;  2HYK A;  3B00 A;  2SBA A;  3VHR A;  3DPR B;  1IS5 A;  1W8Z A;  1JOD A;  2GH8 A;  2WJS A;  3U1X A;  1QXJ A;  2VZV A;  1PVC 3;  5FPV A;  2PYT A;  5FPX A;  3VDD C;  5DG1 A;  1C57 A;  2GP3 A;  1C5I A;  1WME A;  3POI A;  4DEQ A;  3K48 A;  1ODN A;  3HNY M;  3P6B A;  5D8A C;  5IVJ A;  3D4K A;  3ON7 A;  5IJR A;  3MIB A;  4K8F A;  2ZX4 A;  3OY8 B;  3LOB A;  3VDB A;  2R0H A;  2XQR A;  2MNG A;  3I3D A;  4PDW B;  1PVC 1;  3B9I A;  2XJP A;  4DUV A;  3WR0 A;  4MAD A;  3K2O A;  2WWJ A;  3LFI A;  5K8S A;  2BUK A;  5FY5 A;  1ZYB A;  5FXV A;  3S7E A;  1JYC A;  4XFH A;  3ZYP A;  4C0H A;  1O3R A;  2AR6 A;  4IQP A;  5FDB A;  1PK6 C;  2ZEW A;  3WF0 A;  1DZT A;  1CIY A;  5BY5 A;  4QM8 A;  2DVB A;  1RYY A;  4B1M A;  2ZS6 B;  3CEW A;  4QDQ A;  2HWE 2;  4B4P A;  1W9W A;  2GC3 A;  4ES8 A;  2XML A;  2WO3 A;  1D4M 2;  3SH3 A;  5FO7 B;  4GUL A;  2CWM A;  1MPX A;  2J1U A;  1ULD A;  4KWU A;  4RGK A;  2EA7 A;  1OKQ A;  2QKD A;  2X8K A;  3MIF A;  4ZPI A;  4DIQ A;  2A5Z A;  4QHB A;  4R9A A;  2EVX A;  1AR9 3;  1NCR C;  1WGP A;  1OH4 A;  3I2I A;  2A75 A;  4K40 A;  5BXX A;  2GP5 A;  4HPK A;  1L3J A;  4GH4 C;  1YC6 1;  3ZDV A;  3K4Z A;  3VZK A;  5F39 A;  2WQ8 A;  4HG6 B;  1G8W A;  1TNF A;  1UN1 A;  3B93 A;  1ZRF A;  3WCS A;  1LU2 A;  2PHD A;  4FQZ A;  4N7I A;  2W5F A;  1LR5 A;  2VUJ A;  2VBD A;  2XB6 C;  2A70 A;  5A7S A;  5DUX A;  5A3W A;  2JE7 A;  5F3C A;  4UI9 L;  1QH6 A;  5FP8 A;  2AUY A;  2JDH A;  2Q5T A;  1DGW A;  2Y6L A;  4FP2 A;  1ZRI A;  3O5S A;  2RMU 3;  5C5U A;  2HEV F;  5IFT A;  4AI2 A;  3ES1 A;  5T50 A;  4DQA A;  5BNO C;  3TNP B;  5F3E A;  4Y1X A;  3JB4 C;  4BE3 A;  2WNU C;  4BQW A;  1ND2 C;  2WNV A;  3UV9 A;  4CCL A;  4G9S B;  2QJV A;  1PHM A;  3VV1 A;  2E26 A;  1F9K A;  1W90 A;  2RMU 1;  2EIC A;  5EQU A;  5LRR A;  4OHZ A;  5JXG A;  1RC6 A;  3MW3 A;  3RI8 A;  4GWN A;  4IE7 A;  1GMM A;  1R09 2;  3ACF A;  1UCX A;  1MZ5 A;  2VZR A;  3PVE A;  2VTF A;  2W0X A;  3TOJ A;  4BMB A;  4XCA A;  4AE2 A;  4CDQ A;  3AYE A;  3LF7 A;  4AVC A;  1EV1 3;  2IC1 A;  2HWB 2;  2Y26 A;  1LOF C;  2PHX A;  3FFQ A;  3JD7 3;  4CYD A;  3OBZ A;  4HON A;  3IB3 A;  3ZFF C;  1TZO A;  1BMV 1;  1ZVF A;  1RUD 2;  3ALQ A;  1EUU A;  2OQ7 A;  4C90 A;  4EN9 B;  3IAQ A;  4XUQ A;  1JOJ A;  1X33 A;  2BFU L;  1DHK B;  2IXK A;  3LDB A;  4I3P A;  4R4X A;  4AOC A;  2JG9 A;  4CUG A;  4DXT A;  5JR2 A;  4DZG A;  4XFB A;  3S5A A;  1I5Z A;  2JB8 A;  1UIK A;  2W91 A;  3E5X A;  3G6J B;  2XGX A;  2Q8E A;  2WRA A;  1PGW 1;  5FZA A;  2ZX1 A;  2AZ5 A;  4Y26 A;  3RZJ A;  1H1M A;  3HBZ A;  4OI2 A;  2ET7 A;  1LEM A;  4Q4X 2;  5JOW A;  4QGL A;  3LQC A;  1VBB 1;  4EYU A;  1UYZ A;  5EP9 A;  1BEV 1;  2ZGP A;  4JGZ C;  2R0F A;  4Q0V A;  5CB7 A;  5E89 A;  3GHM A;  1GQP A;  2V4V A;  4COY A;  1ZRD A;  2NZ9 A;  5F3G A;  1UD1 A;  2Y33 A;  3T4H B;  2QE3 A;  5AFB A;  3CO2 A;  3CZU A;  4FXG B;  4IET A;  4YNI A;  4CEW B;  1COV 2;  1W28 A;  4NRO A;  4GB3 1;  3ZMN A;  1QQP 3;  2B7Y A;  1US3 A;  5KC5 A;  2Q1M A;  3IDC B;  4Y1U A;  1X9P A;  3KS7 A;  2ZOE B;  2D6L X;  3RDI A;  1H8T C;  3VBH B;  3KV6 A;  1E57 A;  4Q0U A;  1GAN A;  3CJI C;  5A3P A;  4QPI C;  3ZFE B;  5LCW L;  2PLV 1;  2G9G A;  1HRV 3;  4Q26 A;  3IT8 A;  3HN1 A;  3KSC A;  3OPT A;  1MEC 2;  4IGQ A;  4YG3 A;  3WQ0 A;  2QCS B;  2VG9 A;  2R1B A;  1W03 A;  4KGQ A;  5C4W A;  4WVM B;  4WM7 B;  4B7K A;  2B9U A;  3U10 A;  1Z7S 3;  4LKD A;  1KD7 A;  1DLC A;  3FHA A;  1HRV 1;  1W8T A;  2MEV 2;  4A7Z A;  1ENR A;  1U5X A;  1SMV A;  2QBX A;  1F31 A;  4Y24 A;  5FY0 A;  4A45 A;  4DMI A;  4D0Q A;  1DGR A;  2Q8D A;  1R1Z A;  2EF6 A;  5FXX A;  1DFQ A;  3WG1 A;  4BQY A;  1NE4 A;  1WW7 A;  2QVS B;  1GYK A;  3J4U H;  3O0X A;  5EJ1 B;  1BZW A;  3TYJ A;  3VZL A;  4AED A;  3NAP C;  2PHL A;  4QU2 A;  4CDX A;  2YY1 A;  4QM9 A;  2RDS A;  4YW2 A;  1VBD 2;  3I2H A;  4CEY B;  5JXH A;  1UXX X;  3WD5 A;  3QBQ A;  2J7M A;  3AK0 A;  3H3Z A;  1ZM1 A;  2ARE A;  2X5I A;  3LKJ A;  4IV3 A;  4OCT A;  4ZU5 A;  5LA2 A;  3VBO C;  5BV6 A;  5IK4 A;  5L7O C;  1PNG A;  2O8O A;  3E6B A;  2XBO 3;  4FAG A;  3VLB B;  5I91 A;  1UY2 A;  2DF7 A;  1VBA 2;  5G04 L;  1GP6 A;  1TME 2;  2Y6K A;  3I97 A;  4GIQ A;  1OMI A;  3ME2 A;  5EFU A;  3SH4 A;  3USS A;  3LA3 A;  1BVP 1;  1W99 A;  5D8A A;  1NX9 A;  2XXZ A;  2PN5 A;  1FX5 A;  2P5B A;  1VB2 A;  4DS0 A;  5FOJ B;  3N4M A;  2XBO 1;  5FKC A;  5GLZ A;  3VBU A;  5C71 A;  2F4P A;  4I02 A;  4HVO A;  2V73 A;  3WDV A;  2GNT A;  2W3J A;  5FO8 B;  4TWT A;  4OUL A;  3RFR A;  3FUQ A;  5EV7 A;  2X10 A;  3BIE A;  1DF0 A;  4MSV A;  2WQ4 A;  4FPY A;  3E6C C;  4Q8L A;  4XET A;  2YPJ A;  4W4Z A;  3VKL A;  5C3S A;  1R08 3;  4RHV 2;  2YC2 A;  4Z82 A;  4OI1 A;  3Q9O A;  1XE7 A;  4QT6 A;  4OQ8 A;  3N35 A;  4FFF A;  4JDN A;  2V09 A;  4Y20 B;  3T09 A;  5F6L B;  5LA1 A;  1ACC A;  1QOT A;  5EZW A;  3NJV A;  5L73 A;  3H8X A;  5EYY A;  4NO4 A;  4F83 A;  2PAK A;  3A22 A;  3AP6 A;  2V5D A;  1NCR A;  3Q8E A;  5H9R A;  1LOE A;  1W8F A;  3U11 A;  4S2G A;  3PMS A;  1KJL A;  1R08 1;  3ZO0 B;  1S0B A;  4Y1Y A;  4Q27 A;  4H14 A;  2WLP A;  4Y22 B;  1ASJ 2;  3ITQ A;  5CVR A;  3KVB A;  1NA1 A;  4V1P A;  1GNY A;  1OC1 A;  2O1Q A;  3WOG A;  1RJ8 A;  4PQQ A;  1ZRC A;  4O7X A;  3RMX A;  3V0A B;  1NCQ B;  1NG0 A;  4XF9 A;  2JIC A;  2EAK A;  3MV1 1;  4MGS A;  1IS6 A;  3VBF B;  3O1U A;  4FOV A;  1JOB A;  4UBH A;  3ILF A;  4AQ6 A;  3H1W A;  2J22 A;  3CF6 E;  1W6Q B;  2CYF A;  5A3O A;  4MVT A;  3VD7 A;  2FDI A;  3SH5 A;  1YWK A;  1D4M 1;  2VOW A;  4HT1 T;  1HX6 A;  5DQ0 A;  1MZF A;  2VH9 A;  4FTS A;  3J7M A;  1WW6 A;  4N43 B;  1XOY A;  4ATF A;  1AX1 A;  2WWS A;  1FXZ A;  1DQ1 A;  2D6N A;  2YUE A;  1UX7 A;  4JGY B;  4QQ2 A;  5DXD A;  3RS6 A;  4F7Z A;  4K21 A;  4KQ7 A;  2RM2 3;  3T2Q A;  3T0D A;  5EWS A;  4L11 A;  2BGC A;  1XE0 A;  4XTP A;  1ZX5 A;  3M1H A;  3POS A;  5A7P A;  3UGF A;  5T5J A;  1XC6 A;  4PIY A;  2H6B A;  3GHN A;  1LRH A;  3NW4 A;  1ZZB A;  1RHI 2;  1PIV 1;  3VL8 A;  2RM2 1;  5A7W B;  4GKX A;  2ZX3 A;  3I8T A;  1OOP A;  5SV8 A;  2ZMK A;  2GNB A;  2JKX A;  5APA A;  3TN9 3;  2GND A;  1W0P A;  3JUU A;  4N8M A;  1WUV A;  4XPV A;  4NN0 A;  1L7Q A;  1YFY A;  3HPN A;  2I07 B;  4NHY A;  1J83 A;  4OHV A;  5E16 A;  2P3K A;  3WDX A;  3W59 A;  1W2T A;  1S0D A;  1POV 3;  3DYP A;  4JHT A;  2Y6G A;  2B9V A;  2W1W A;  4FPC A;  1TE1 B;  4UYB A;  3TN9 1;  5FWJ A;  3NJY A;  1UKR A;  4KGG A;  5LY1 A;  3CU7 A;  2WS9 2;  3ENR A;  1N3P A;  5T52 A;  1H1I A;  1SBF A;  5JPN B;  3WNP A;  5T5L A;  1G9A A;  5FKB A;  4M3C F;  1POV 1;  3UYJ A;  4GMP 0;  3VZO A;  5EPA A;  5L36 A;  3HNB M;  3W58 A;  2VZS A;  2AGS A;  4KU8 A;  1SLC A;  4N53 B;  3PME A;  3NNJ A;  1V6O A;  1LHU A;  5FRE A;  4C0B A;  3RG0 A;  1A8D A;  4K1Z A;  3WUD A;  3AP7 A;  1E5R A;  1RUD 1;  4YM0 A;  3PVN A;  4XXP A;  2WBK A;  3NWK A;  2MPF A;  1NQJ A;  4RA0 A;  1RXF A;  1XYP A;  3DKW A;  2J1E A;  5A7Q A;  1H8T A;  1RUC 1;  5GZE A;  5KXC A;  2PTM A;  1US2 A;  1ULP A;  4C91 A;  1UMZ A;  3KM5 A;  1DQ0 A;  2QQL A;  4QPI A;  1B35 A;  3FBY A;  1ZNP A;  2TUN A;  4IEY A;  4LO4 B;  4Q1P A;  1ND3 A;  3T4V A;  1IQD C;  5FQ0 A;  3WNX A;  5FY9 A;  3K4D A;  4AVB A;  2E51 A;  4Q4Y 2;  5FZD A;  2YG0 A;  3USU B;  5ABJ A;  3DYO A;  1PVX A;  4CE8 A;  3IPV A;  2W68 A;  2JEN A;  3UGH A;  2OQ6 A;  2RVA A;  2GN3 A;  3PIG A;  4DPN A;  1CJP A;  1PO1 2;  3IIA A;  4I0W B;  2JDY A;  2UYA A;  2JWP A;  3WUC A;  3LSD A;  5AC9 2;  3VD4 A;  5ACA 2;  4RS5 B;  4GA9 A;  2C26 A;  3MDP A;  5T54 A;  2V5Y A;  4KWK A;  4QGM A;  3ZSM A;  3N7J A;  4AVS A;  4EWA A;  2W95 A;  5D21 A;  1GNZ A;  1UZV A;  2RJL A;  1ZZC A;  2W1U A;  5C9A B;  5BNP C;  1KQR A;  2VXJ A;  4FPG A;  4JZR A;  5I0U A;  3OBR A;  1XND A;  3SCF A;  1CX1 A;  1PM7 A;  3ZXE A;  5C7G A;  1FOD 2;  5IVC A;  1ZZ9 A;  1IG3 A;  3OD0 A;  1AJO A;  4EN8 B;  1KJR A;  4XBL A;  5DAB A;  3PUA A;  3MW4 A;  5B4X A;  3AXD A;  4A42 A;  4UT5 A;  3PHM A;  4NRP A;  4CDW B;  4ES9 A;  5JVV A;  4EJR A;  4QU1 A;  4M4R A;  4FP3 A;  4LOR A;  1GZT A;  4HK9 A;  4QQO A;  4TYS A;  4LBL A;  4IND A;  3I2F A;  4IEP A;  4X8P A;  2D5H A;  2XL7 A;  2IFR A;  2BOI A;  3B9C A;  5CFC B;  1HKD A;  3POJ A;  4AW7 A;  5DUW A;  1V6M A;  1ZZ6 A;  3B01 A;  1UZY A;  3KV4 A;  1OXC A;  1W6O B;  4CUC A;  2HWC 3;  1O5L A;  1H2N A;  1WLT A;  1SG3 A;  2HWF 3;  2RR1 3;  1RUI 2;  4IGP A;  3GZU C;  4NOT A;  4DXR A;  4LBK A;  3QD6 A;  1W8O A;  2VUC A;  1NY7 1;  2ID4 A;  4IEU A;  1O3Q A;  1LJ7 A;  2VJX A;  4NWV A;  4QX3 A;  1J59 A;  1MS0 A;  1WCQ A;  4J6G A;  2HWC 1;  5I0D A;  2A6Y A;  3I2D A;  5KHG A;  3POW A;  5ANN A;  2HWF 1;  2RR1 1;  3GBW A;  3T08 A;  4LHS A;  5JUV A;  1FPN 3;  2JDU A;  4YW4 A;  4QHO A;  3J26 N;  1PVC 2;  2DCJ A;  3Q8C A;  4Q4W 3;  1I6X A;  4UBG A;  1C8M 3;  3WNL A;  2GC1 A;  4QX2 A;  2VW2 A;  5T5O A;  1NZI A;  3ZN6 B;  4COW A;  1GOG A;  3BI3 A;  3KMH A;  4LO5 B;  2VEC A;  3DCQ A;  4CCK A;  2OPK A;  4BIO A;  3R4U A;  1CGP A;  3MF6 A;  2OUJ A;  3DYM A;  1HV0 A;  3ECQ A;  4IE4 A;  5KHI A;  3KT7 A;  1YHF A;  2R07 3;  3LZZ A;  2WT2 A;  2VW0 A;  3ZSE A;  1C8M 1;  3ST7 A;  4CP9 A;  2UY9 A;  1H2K A;  5A1L A;  4Z07 A;  1LEC A;  1GOF A;  3N9O A;  3AKP A;  2XHK A;  4G3Y C;  3DPR A;  4CU6 A;  3LGR A;  5BNN C;  4EZ4 A;  3I2O A;  3WG3 A;  4IEZ A;  5CEH A;  5JIA A;  2R07 1;  5FXZ A;  2FDF A;  5CFD B;  3GCW A;  2P1B A;  1PO2 3;  2IWG B;  3AMN A;  1UIJ A;  3AZX A;  3DUI A;  3FE5 A;  3LDR A;  1PNF A;  3OY8 A;  4LUL A;  3V65 A;  4PDW A;  1LOA A;  1WLD A;  3VD5 A;  2WKK A;  3WNK A;  1PMI A;  1H4G A;  2ARC A;  5CYY A;  1FMD 3;  2CY6 A;  1AR9 2;  2D6K A;  4QX7 A;  4XUT A;  1K5M C;  4P5Y A;  4DIN B;  5LK7 B;  1PO2 1;  1S2K A;  5FAX A;  5KWR A;  3BIW E;  2PHT A;  2LTN A;  4CPB A;  2VVE A;  4P08 A;  2VNR A;  3WHT A;  1REE A;  5KXB A;  3MHZ A;  3JU9 A;  4A7K A;  2QQJ A;  3N36 A;  1I3H A;  1RUF 3;  2X05 A;  4NRQ A;  5GZD A;  1A34 A;  2O14 A;  5G05 L;  4BZ4 A;  3R05 A;  3R4D B;  1UNB A;  2RS5 3;  2VTX J;  2WO7 A;  2I45 A;  3K4A A;  3AZW A;  4A3Z A;  1EPZ A;  2IZW A;  2X53 S;  4LO6 B;  3AL6 A;  1N1S A;  4AGV A;  3LA2 A;  4MGK E;  1W04 A;  1LNS A;  1RUF 1;  2VMI A;  3E5Q A;  5FYM A;  2FHR A;  4XEZ A;  4FSJ A;  2RMU 2;  2A71 A;  2RS5 1;  1AXZ A;  1W2N A;  3ZIW A;  4O61 A;  4Y3O A;  2LW8 A;  3ACG A;  2FMD A;  3W21 A;  2OZ6 A;  3AP9 A;  4QPY A;  3W5N A;  5HV0 A;  2FD8 A;  2YHJ A;  4AHW A;  4Z8B A;  3ILN A;  2CGN A;  4XVH A;  4YM2 A;  1WMX A;  1IKP A;  2W1Q A;  3E97 A;  4IV1 B;  1VIW B;  1Q3E A;  5IWF A;  1QKQ A;  2XLA A;  1RUJ 3;  1VAV A;  3AP5 A;  3H8U A;  3KZ4 C;  2BER A;  5HPO A;  1DQ6 A;  3MIC A;  1NXM A;  2LS6 A;  1BMV 2;  1UYP A;  1M06 G;  4AYU A;  3O1O A;  4QPG C;  3WP5 A;  4CUB A;  5ISL A;  1JN2 P;  3A21 A;  5KC6 A;  2F6B A;  5HXM A;  1HB3 A;  1ULF A;  1DG6 A;  2AEZ A;  1EY2 A;  3QLQ A;  4LKF A;  4UFJ A;  3HOB A;  1EV1 2;  3JD7 2;  2PMW B;  1BBT 3;  1RUJ 1;  2CV6 A;  5I8S A;  5T5P A;  4IXL A;  1PGW 2;  2QDN A;  4Y5Z 0;  5HBA A;  4OMC A;  1KS5 A;  4PI0 A;  4XUR A;  4Y5S A;  4QDR A;  2DUR A;  3O12 A;  2O0O A;  4UFK A;  4ASM B;  5EHD A;  1VBE 3;  2VVF A;  4UW5 A;  4LE4 A;  4YVS B;  1J1T A;  2PAM A;  3AP4 A;  4LE3 A;  4RL7 A;  2WS9 1;  5TSW A;  3SC7 X;  3ZR6 A;  4LA3 A;  3FLR A;  1CAU A;  5IVE A;  5GLW A;  1BBT 1;  4AF9 A;  1KRI A;  1V6J A;  1ULO A;  3N9L A;  4W65 A;  1SCS A;  2FDG A;  1LKN A;  2DU1 A;  2HBU A;  1OH3 A;  3E6D A;  4KWL A;  4W50 A;  3M3I A;  2XVL A;  4DOU A;  1VP6 A;  2B8M A;  4OHY A;  1CAX B;  5GZG A;  4AHX A;  5EIY B;  1F15 A;  4OHW A;  2K2S A;  1HQW A;  3QCW A;  3VN4 A;  1YFU A;  1UU4 A;  1MQT C;  2OPW A;  3EXU A;  1X50 A;  5M0T A;  4LJH A;  4UFM A;  1UZZ A;  2XG3 A;  3WG2 A;  2G1M A;  2R7E B;  4JQR A;  1ZRE A;  2JG9 C;  5J98 B;  1N1T A;  2ZGS A;  2W47 A;  1W0O A;  1Q8Q A;  1JYX A;  2CGO A;  4XDO A;  2RHP A;  5HCA A;  4XFI A;  3B02 A;  3OPW A;  3ZLI A;  4LBJ A;  2D97 A;  4DY3 A;  1OFS A;  2D98 A;  1J1L A;  3Q8F A;  2VPV A;  1RJ7 A;  1JTZ X;  1YQ6 A;  1GP5 A;  1I9R A;  1QF3 A;  2B4K A;  2EXJ A;  4LK7 A;  4M00 A;  5FR3 A;  1JBC A;  5J48 A;  2WAB A;  1OLQ A;  3AMP A;  1KFX L;  1AR6 3;  3FBM A;  1UPS A;  4QKB A;  5FYV A;  1UMI A;  4Q4Y 1;  4ZXE A;  2Q1F A;  1HRV 2;  4QXK A;  4IEO A;  1H4H A;  1QXP A;  4ZY9 A;  1QJY 3;  2A6X A;  3B5L B;  1UKG A;  5FP7 A;  1VE0 A;  4CEW A;  1SQ4 A;  1D0G A;  1UYY A;  1PMJ X;  2VNV A;  1AR6 1;  1Z7S 2;  3NVC A;  3CHX A;  4MUV A;  1DP0 A;  5DZE A;  5T3N A;  1W3V A;  4D8M A;  3WQ1 A;  4HAN A;  3VBH A;  1GZ9 A;  3B3Q E;  3I3B A;  2DUO A;  1QJY 1;  2VCA A;  4UFI A;  1OA3 A;  5LK5 A;  4BIF A;  2KD7 A;  2DV9 A;  3KD4 A;  4AI9 A;  4OI0 A;  3ZFE A;  1RTV A;  4YZ3 A;  5A32 B;  1YFW A;  2QQW A;  4LBQ B;  3WSO A;  3U78 A;  5J09 A;  3M70 A;  3ZFG B;  3KCY A;  4NII A;  1UZ0 A;  3WY6 A;  5C4W C;  5JCT A;  5FYY A;  1UZW A;  4WVM A;  4WM7 A;  5J3U A;  1LOG A;  1RUG 3;  4PLM A;  5E1R A;  3H50 A;  4KG0 A;  5FMD A;  1XNC A;  1RXG A;  2BZD A;  3HQR A;  5LBC A;  2XBO 2;  5FZ4 A;  4YRD A;  4DFS A;  3FLT A;  4A6S A;  3F2Z A;  2ZAH A;  4BJ0 A;  3I59 B;  4BOW A;  2XLG A;  2N7G A;  1PGL 1;  1RUG 1;  3T30 A;  3GF6 A;  4OI4 A;  4XJU A;  2SLI A;  2TNF A;  4AED C;  3D0J A;  4CDX C;  2WZP P;  1K3I A;  2CL2 A;  3I2G A;  1QJE A;  1LED A;  4IEX A;  2XR4 A;  5CKN A;  2OW4 A;  2VGD A;  2X5I C;  2JDZ A;  4IV3 C;  2WDB A;  4XF0 A;  3TEY A;  5BNN A;  4NJ4 A;  3THC A;  5DAX A;  1ZBE 3;  1WZX A;  3F95 A;  2DUP A;  4NIG A;  2W92 A;  1BCX A;  3NNL A;  1E5H A;  3AZV A;  3LEG A;  4XHB A;  5CG8 A;  1YQ8 A;  2DBN A;  1R08 2;  2XJQ A;  5I93 A;  1W8U A;  2CDP A;  4FBF A;  1T6B X;  1ULC A;  2IXL A;  2WT1 A;  3CKH A;  2QFE A;  3VBU C;  2D40 A;  4QMA A;  2BOJ A;  1ZBE 1;  4YW6 A;  5IVV A;  3OYW A;  2NN8 A;  1CQ9 A;  3LIG A;  1K5M A;  4LO8 A;  1CAV B;  2GC2 A;  2GC0 A;  3M3O A;  4RFR B;  4E8C A;  1NT0 A;  5K0U B;  1GQH A;  4B8E A;  5A3M A;  3TB0 A;  2XVK A;  1SLT A;  2OS2 A;  1SHW B;  1LOD A;  2JIJ A;  2ZX0 A;  4NIA A;  5D1I A;  5IAV A;  4Y20 A;  4ET7 A;  2JE9 A;  3AJZ A;  2KM2 A;  3SXW A;  5FYH A;  4YZ5 A;  2C4X A;  2WYF A;  2HWD 3;  4XFG A;  3EO6 A;  1AX0 A;  4XJA A;  1H2L A;  4Y22 A;  3JBG 3;  3ZKY A;  1NA1 C;  1W9T A;  3I3Q A;  5I8Y A;  4PI2 A;  4CCD A;  3P5B A;  4WZC A;  1XXN A;  3VDC A;  4PJY A;  4BH9 A;  2ZGK A;  3JQW A;  1AR9 1;  2R49 A;  4JX0 A;  2YXS A;  2HWD 1;  2JXA A;  1PIV 2;  1PX3 A;  4L97 A;  3VBS C;  3V0A A;  1NCQ A;  2RM2 2;  1XPW A;  3CDZ B;  2JIG A;  3MO4 A;  4Q0Q A;  3C7G A;  1YJK A;  4FFH A;  3JBG 1;  3S5Q A;  5LEK A;  1C4R A;  3VBF A;  4FPK A;  1AR8 3;  3O1V A;  3HIF A;  4GMP 3;  1IOA A;  1GR3 A;  2V72 A;  1B09 A;  4QPG A;  4WM8 B;  4CP0 A;  1W6Q A;  5FYI A;  1Z78 A;  2F17 A;  4LIU A;  1HJF A;  3AKS A;  5E8A A;  5DUU A;  3FWE A;  1UOJ A;  2TEP A;  4AK3 A;  1KDM A;  3SCG A;  5B2G B;  4BXS V;  2O8Q A;  3KLS A;  1AR8 1;  3TN9 2;  2VE1 A;  3PLQ A;  4JGY A;  5F9T A;  2WR9 A;  3OBT A;  4D69 A;  5H9S A;  2CWS A;  1IPK A;  4XQD A;  3APB A;  4R9B A;  4LR4 A;  2HEY F;  1K45 A;  1WKY A;  1WMF A;  1ENS A;  5L9B A;  2VAU A;  4FXK B;  4DUX A;  3J8F 3;  1YIP A;  4FT8 A;  4RFT 0;  1SFY A;  5HCF A;  2WSV A;  1T2X A;  4OHX A;  4UF0 A;  1IS4 A;  3EBR A;  5A3T A;  5HI0 A;  3MGU A;  4N9I A;  2A7A A;  5FJH A;  4PCR A;  1OOP C;  5JXI A;  2B5H A;  3SIS A;  1MQT A;  1VJ2 A;  5L9R A;  3H1M A;  2E33 A;  3J8F 1;  2FCU A;  4FFG A;  1RUE 3;  3BOP A;  1I5P A;  4AEK A;  5FZM A;  2HH9 A;  1C3H A;  1RUC 2;  2Z42 A;  4TXW A;  1O4Y A;  1EV1 1;  2VY0 A;  3GYD A;  3JD7 1;  4Y33 A;  1BHG A;  1G86 A;  3RYP A;  1G9C A;  4UOJ A;  2R30 A;  1DDL A;  1J58 A;  5C70 A;  3I4I A;  4NHX A;  1KIT A;  3FMG A;  3ZKU A;  5GLV A;  1RUE 1;  4PIX A;  1S0F A;  5IAT A;  2VOK A;  2WA4 A;  2XDV A;  2HJI A;  4JTO A;  5KR7 A;  5LWB A;  4ZU4 A;  2ADD A;  2BFU S;  2ARB A;  3B94 A;  5DMY A;  4JQT A;  1JMU B;  1ODM A;  1JZ7 A;  4JVA A;  4OYU A;  1S0E A;  2J1T A;  5JZG C;  3ZN4 A;  1LUL A;  4IDZ A;  4NWW A;  1DCS A;  1SFP A;  3ZSK A;  5DAW A;  1NLS A;  4D6S A;  4RGA A;  2VCM A;  4KWJ A;  5J7M A;  2XUE A;  2Y6H A;  5A70 A;  5A6Z A;  3S30 A;  4CA9 A;  2OXB A;  3CLP A;  2AAC A;  2BDR A;  2GNM A;  2XKP A;  4CTE A;  2E31 A;  3K75 B;  1JYW A;  3WDW A;  2JJ6 A;  2B45 X;  4QKF A;  2ZGT A;  1VRB A;  2ERF A;  2QQK A;  1F5F A;  3I2K A;  5FZ6 A;  1QQP 1;  3P3P A;  4W6Y A;  3VBR C;  1B35 C;  1FNY A;  1ND3 C;  5FOB B;  4LNV A;  4YYO A;  2PQQ A;  2ZAB A;  2DCY A;  5K7P A;  3ETQ A;  3T2O A;  4JTN A;  3SNM A;  3MIG A;  4XXA A;  2EIG A;  2ZXQ A;  1S4C A;  5ABJ C;  3DF0 A;  4XHX A;  4Q29 A;  1F5J A;  5FY1 A;  4CDU B;  3NNF A;  1FAT A;  2P6H A;  1OQ1 A;  4Q5O A;  3M3Q A;  5A3U A;  1NE6 A;  1WCS A;  4HKW A;  4FAH A;  4RS5 A;  1ZZ8 A;  3WIN E;  5FP9 A;  3I7D A;  3D5O A;  1GP4 A;  2QTW B;  1RMU 3;  1Z7S 1;  3V0B B;  3LB9 A;  5HCH A;  1QJX 3;  4LBO A;  1NY7 2;  3KB5 A;  3VKO A;  3B69 A;  1JZ2 A;  3KQ4 B;  3DEC A;  3BAL A;  2KA3 A;  5FP4 A;  4ZU7 A;  5JWP A;  3VUO A;  2WN3 A;  3FC0 A;  2HWC 2;  1LU1 A;  2A73 B;  2HWF 2;  2RR1 2;  4ORF A;  1HB2 A;  4MZU A;  1QJX 1;  3SHR A;  4CDW A;  3K77 A;  1O4T A;  1E5I A;  4HET A;  4XFC A;  5FZL A;  1JU3 A;  5GAL A;  4FPH A;  5J37 A;  4KNC A;  3VGI A;  5J36 A;  1V6N A;  1JW6 A;  4Z92 B;  4UAP A;  4GAL A;  4ZZ8 A;  3THD A;  4LA2 A;  1S0C A;  1FPN 2;  5CFC A;  2D6M A;  2DVD A;  1VPH A;  1OPO A;  2VXR A;  2PA7 A;  2A6Z A;  1YQ2 A;  2P3I A;  1G7Y A;  4P9G A;  4XUP A;  4YGE A;  5F5C A;  1Q8P A;  2MHF A;  3SKV A;  5C3Q A;  1W6O A;  4ZZ5 A;  2H6C A;  4UW4 A;  4B29 A;  3BU7 A;  2W87 A;  3LE0 A;  2YRO A;  4Q4W 2;  1CZT A;  2Y0I A;  1OUS A;  4L92 A;  1C8M 2;  2WQZ C;  3BCW A;  5FIX A;  4R4Z A;  3LCP A;  5FPA A;  4Z2A A;  3KQR A;  2K46 A;  3HQU A;  2DCZ A;  1BJQ A;  4YZ4 A;  2VZQ A;  1HN0 A;  1XB9 A;  2ZZJ A;  3C2U A;  4GZ9 A;  3VZM A;  3MID A;  2UU8 A;  2R07 2;  5FMO L;  4XW3 A;  3SEE A;  1KEX A;  3D3A A;  1W6N B;  2D6P A;  3UK9 A;  1NLQ A;  2X29 A;  3LPG A;  4LBN A;  1EAH 3;  1F4A A;  3FN9 A;  1LHV A;  4OUS A;  4BLI A;  3C8X A;  3I3E A;  4RQP B;  3C3V A;  1XNA A;  4XMA A;  5EJZ B;  4L99 A;  2YYO A;  4BDV B;  1LB2 A;  1H9W A;  1QJU 3;  3FJS A;  2WSU A;  4CXY A;  1WA6 X;  4XF3 A;  4YVW B;  3T1L A;  3OUH A;  5FZ1 A;  3ZN6 A;  5FK7 A;  5C8C C;  2ADE A;  4YW7 A;  5IK7 A;  3MUY 1;  4FTE A;  4NAO A;  5FZK A;  2Q30 A;  2DTW A;  1EAH 1;  3ZOI A;  1PO2 2;  3RZG A;  1XNT A;  1SCR A;  2CNA A;  2J1S A;  3BB6 A;  4XTM A;  4PLO A;  3VBS A;  3POE A;  4SLI A;  3VDD A;  2YBP A;  3HMY A;  2EAA A;  2VMD A;  1FMD 2;  4AR2 A;  3ZXD A;  1N47 A;  5KBF A;  3AMQ A;  1OQE A;  3DPR C;  4YWA A;  4HSL A;  1OD3 A;  3T2T A;  1TNR A;  3ILR A;  2Y6J A;  1H0B A;  2VMG A;  2WL1 A;  3VL9 A;  4YZ2 A;  5EYX A;  1GWM A;  3K46 A;  4HPK B;  4YG6 A;  1DIW A;  2YB7 A;  3IMM A;  4Y4R A;  1RUF 2;  3NRU A;  1RVF 3;  3N3H A;  2K0G A;  1IPJ A;  1GZW B;  2NYY A;  2RS5 2;  2JDA A;  4K7J A;  4Y5T A;  3T3Y A;  4PDW C;  4DY5 A;  4A7Y A;  4RR3 B;  5FBJ A;  1RUH 3;  2PHW A;  2Y64 A;  4BWO A;  3JXS A;  5FZE A;  5GKA C;  1VB4 A;  1RVF 1;  1NZC A;  3WT3 A;  4NPM A;  4K6B A;  3N9P A;  4EE2 A;  4QQH A;  3FZ3 A;  1UOG A;  1WBL A;  1A6C A;  3EQE A;  3OJB A;  4IE6 A;  3WP4 A;  1DYO A;  5K4L A;  3AKQ A;  1SZB A;  1FT9 A;  2WNV B;  1Y43 B;  2WIN B;  2A3Y A;  4B4R A;  2OYZ A;  4BQ4 A;  4ZON A;  5A3L A;  1KXG A;  1XRU A;  5FPB A;  4M3C A;  5DZG A;  1RUJ 2;  2VOX A;  4LHL A;  1X9T A;  1K5J A;  3NNM A;  2DYC A;  2GZW A;  2VQT A;  3GZA A;  3KF3 A;  3T0A A;  3UES A;  4E4S A;  5CAD A;  3OGG A;  1XSR A;  2YBS A;  5FZB A;  3WX5 A;  1H1A A;  4Q0S A;  3GNE A;  4ARX A;  4IER A;  4QXH A;  1RIN A;  2CAU A;  3OTF A;  1OD5 A;  2WAA A;  1BBT 2;  2VZO A;  4CDQ B;  1YI9 A;  4EZH A;  1Y9M A;  2VO5 A;  4P9J A;  2DCT A;  1H6X A;  1UPI A;  4JAA A;  2CTV A;  3M3E A;  3D0S A;  1GUI A;  2IVI B;  3WW4 A;  1VBE 2;  5JZG A;  1AUY A;  1XQN A;  2E7Q A;  2YC0 A;  2KXL A;  3AJY A;  4XFF A;  3O7O A;  3PUS A;  4CCC A;  2FMY A;  2VME A;  4OVE A;  4YSF A;  3ROU A;  1OLR A;  5LBE A;  5FUP A;  5FBZ A;  4KBB A;  3R0R A;  1IZ3 A;  4I09 A;  2UWA A;  3MYX A;  1Z0H A;  3AM2 A;  1XBF A;  4XJZ A;  4BK4 A;  3BOW A;  1JZ6 A;  1YIF A;  1WLW A;  1DLL A;  4FCA A;  1TQ5 A;  4YVS A;  3A0K A;  4YFW A;  4IEV A;  3VBR A;  5F1R A;  5FYZ A;  2W46 A;  4QDS A;  1JYN A;  5FZC A;  4FPO B;  3AVS A;  2JX9 A;  3NKG A;  2RE9 A;  2GDF A;  2YFU A;  2R16 A;  1UY1 A;  1S0G A;  3PVO A;  4COU A;  3BTY A;  4I2O A;  1CAW B;  4AFM A;  2ZGR A;  1CZS A;  2P6C A;  5KHK A;  3M4F A;  5JOZ A;  1AYN 3;  4XCB A;  4HLT A;  1AR6 2;  2EAL A;  2XJS A;  2NMN A;  3IZO A;  4P9W A;  3O0W A;  4AVA A;  4BK5 A;  1LEN A;  4P00 B;  4PHZ A;  1QNW A;  1J3P A;  3PTR B;  1QJY 2;  2RJK A;  1DQ5 A;  2JG8 B;  3UET A;  2OT7 A;  3S6P A;  1LGB A;  2WWU A;  1H30 A;  5FZ3 A;  1AYN 1;  3LEI A;  5FZO B;  4NMI A;  2ILM A;  4QGN A;  1Y4W A;  4CCJ A;  4Q1R A;  4MGQ A;  5DG2 A;  4ATE A;  3NL1 A;  4P14 A;  1BQP A;  2WNO A;  1QGL A;  1VAK A;  1YUD A;  4CXW A;  5JAX A;  5H9P A;  3ZMO A;  4DXS A;  1NQD A;  1MAC A;  4MLO A;  4RGG A;  2ZAC A;  4FPJ A;  3HAG A;  4CEW C;  4K9S A;  1AZD A;  1WMD A;  5F3I A;  2ORZ A;  1W0N A;  1MS4 A;  3CL1 A;  1H6Y A;  1PGL 2;  1RUG 2;  3W20 A;  1CES A;  3NJX A;  1VMF A;  2Y8K A;  4I30 A;  5JOY A;  1AVB A;  3OGR A;  3NV4 A;  5EJ3 A;  4D7Y A;  3WCR A;  2YV8 A;  4QHZ A;  1XU1 A;  5FZ9 A;  3VBH C;  3UKN A;  1SLL A;  3S7I A;  2ORX A;  1IPS A;  3OGV A;  1OFN A;  1W8W A;  5CAZ A;  1MS8 A;  2C1F A;  5F2S A;  3ZFE C;  2B39 A;  5D8A B;  3FUO A;  1OPM A;  3KV5 A;  4LBQ A;  1GFF 2;  4BME A;  2VMC A;  3ZFG A;  3ZPO A;  4EWE A;  4MV2 A;  4Q0P A;  4TSV A;  3KT4 A;  4QX8 A;  4WM7 C;  3U07 A;  3KCX A;  1LTE A;  3BPS A;  4OZX A;  1W6M B;  3III A;  4O9G A;  3HN3 A;  2WFP A;  1PK6 B;  1W05 A;  1ZBA 3;  1XNK A;  4S2H A;  1ZBE 2;  3GAL A;  1FPN 1;  5C8C A;  4BXF A;  3I59 A;  4LIT A;  1PZ8 A;  4C1X A;  3VD9 A;  3OGJ A;  1LOB A;  2G19 A;  1UWW A;  3H1Y A;  5L9V A;  1W2U A;  4AXO A;  5FYT A;  5FUN A;  1C28 A;  2P37 A;  4Q4W 1;  2RG4 A;  3Q8B A;  1ZBA 1;  4PIZ A;  2JDP A;  1CVN A;  2D43 A;  4CEY C;  4NUB A;  4XJW A;  3EYP A;  4LEJ A;  3ZVX A;  4LK6 A;  2DTY A;  1WLC A;  1NCR B;  4WV8 A;  5GLT A;  1Q8S A;  1A78 A;  1TEI A;  2W1S A;  5C5T A;  1DQ2 A;  1HV1 A;  4Y4Y A;  4GH4 B;  4M01 A;  1HLC A;  3ZXJ A;  1Y9G A;  3O1R A;  5FY7 A;  1O5U A;  3DEM A;  2QQI A;  1JS9 A;  3I2J A;  3KGZ A;  2J1R A;  4MO3 M;  4YZ1 A;  2BW8 A;  3RQ0 A;  5FLJ A;  3BUC A;  2LRP A;  3I3M A;  3OD4 A;  4V2V A;  3FHQ A;  1AX2 A;  3CNA A;  5JLV A;  2HWD 2;  1YQC A;  3VHN A;  2R1D A;  1CAV A;  5K0U A;  1P8J A;  4D7T A;  3JBG 2;  5LBB A;  3ZSJ A;  5JSP A;  1WBF A;  3GZE A;  2W9X A;  5BNO B;  2EXK A;  2RS1 3;  3ZXK A;  4P9L A;  5FYU A;  2WNU B;  1FMD 1;  1ND2 B;  3GCX A;  4CP1 A;  4BPZ A;  4KMQ A;  5KHH A;  4YLZ A;  1QOS A;  5JDB A;  1JXN A;  5JPM B;  1AR8 2;  3MIH A;  5IAX A;  1QIQ A;  2RS1 1;  3AXE A;  3VHP A;  3LSE A;  4PBP A;  1AXK A;  2JB4 A;  2Y34 A;  3WZ1 A;  4D3W A;  5IK5 A;  2ZZQ A;  4ERO A;  2JDM A;  4SBV A;  4S2F A;  4B3N A;  1ENX A;  2ZGN A;  1ZRR A;  1UO9 A;  1WD3 A;  3DXT A;  1EYB A;  3UJO A;  3O14 A;  1XE8 A;  3RZZ A;  4AZZ A;  4IL7 A;  4CZS A; 
#chains in the Genus database with same CATH homology
 5A80 A;  5IVV A;  2Q8D A;  3N9L A;  4TN7 A;  5F39 A;  5FXX A;  4Y4R A;  5FY8 A;  5FYS A;  5FZ7 A;  1VRB A;  3PU8 A;  5IW0 A;  4ASK A;  3LD8 A;  5FZ6 A;  5A7S A;  5F3C A;  5A3W A;  2OS2 A;  3NJY A;  5F3I A;  5FBJ A;  5FWJ A;  3DXU A;  5FP8 A;  5IVB A;  5LY1 A;  4CCN A;  5FZE A;  4CCK A;  4QXB A;  5FZ9 A;  3N9N A;  3N9P A;  3UYJ A;  5FYH A;  5FV3 A;  5FZF A;  5F3E A;  2OX0 A;  5FXW A;  4XDO A;  4CCL A;  5FY1 A;  3OPW A;  4LXL A;  3ZLI A;  5F2S A;  5K4L A;  5A1L A;  3N9M A;  5ANQ A;  2XXZ A;  2P5B A;  4D6R A;  3N9O A;  3KV5 A;  3ZPO A;  5FPB A;  4EZ4 A;  5FP9 A;  3PDQ A;  4GJZ A;  5IVY A;  5CEH A;  4QX8 A;  5IVF A;  5FXZ A;  5A3N A;  4BIS A;  2W2I A;  2YU1 A;  2YBK A;  5FYV A;  5A7Q A;  5F5A A;  2YBS A;  5FZB A;  5FP4 A;  4QXH A;  5FP7 A;  5FWE A;  4BXF A;  4EZH A;  4LIT A;  4HON A;  5FYI A;  4LIU A;  4GJY A;  4IGO A;  2OQ7 A;  4DO0 A;  4QX7 A;  5FYT A;  4CCO A;  3LDB A;  5FUN A;  5FY9 A;  5FZL A;  4CCM A;  4CUG A;  5FZD A;  4GD4 A;  4XDP A;  4NUB A;  2Q8E A;  4AI9 A;  2OQ6 A;  5LW9 A;  5FPU A;  5FYC A;  5FZA A;  5F5C A;  3PUS A;  5FY4 A;  3KVB A;  5FZ8 A;  3U78 A;  4E4H A;  5FUP A;  5FPV A;  5FZI A;  5FZG A;  5FYY A;  4EYU A;  2GP3 A;  3AL6 A;  5FY7 A;  4UF0 A;  4LIV A;  5A3T A;  5F3G A;  5FPA A;  5FZO A;  2YPD A;  5FYM A;  5F37 A;  5FJH A;  5IVJ A;  5A7O A;  5A1F A;  4UF0 B;  5FZ4 A;  5IVC A;  5FYZ A;  3KV9 A;  4V2V A;  5FZH A;  3U4S A;  4Y3O A;  4CSW A;  2Q8C A;  3N9Q A;  3K2O A;  2WWJ A;  3PUA A;  5FZC A;  5LY2 A;  3AVS A;  5FY5 A;  2VD7 A;  4QWN A;  5F5I A;  5FXV A;  5FZM A;  5FJK A;  4QU1 A;  5A7N A;  3AVR A;  4QXC A;  5F2W A;  5FPL A;  4Y33 A;  4D6S A;  5IWF A;  5FZ0 A;  4AAP A;  3KV6 A;  5FYU A;  4BU2 A;  3AL5 A;  3PUR A;  5FZ1 A;  5A3P A;  3PUQ A;  2XDV A;  5FZK A;  2XML A;  3KV4 A;  3K3N A;  5KR7 A;  5LWB A;  5ISL A;  5A7P A;  3OPT A;  4IGQ A;  5F32 A;  4D6Q A;  3PTR B;  3PU3 A;  2PXJ A;  4IGP A;  3KVA A;  4C8D A;  5A7W A;  4URA A;  2OT7 A;  4HOO A;  4DIQ A;  2WWU A;  2YBP A;  5FZ3 A;  5FYB A;  5FZO B;  5A7W B;  5E6H A;  4CCJ A;  2YU2 A;  2XUE A;  4GAZ A;  4V2W A;  3RVH A;  3K3O A;  3DXT A;  2GP5 A;  5FP3 A;  5FY0 A;  5IVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...