5FZOA

Crystal structure of the catalytic domain of human jmjd1c
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
343
structure length
338
Chain Sequence
MIPHSWICEKHILWLKDYKNSSNWKLFKECWKQGQPAVVSGVHKKMNISLWKAESISLDFGDHQADLLNCKDSIISNANVKEFWDGFEEVSKRQKETVVLKLKDWPSGEDFKTMMPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Catalytic Domain of Human Jmjd1C
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords PROBABLE JMJC DOMAIN-CONTAINING HISTONE DEMETHYLATION PROT E
total genus 99
structure length 338
sequence length 343
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fzoA01
5FZOB 5A3PA 3K2OA 4GD4A 4QXCA 2OT7A 2OQ7A 3ZPOA 5F3CA 5IVVA 2VD7A 4QX7A 4Y4RA 4D6RA 5FY7A 5FZEA 3PTRB 4Y33A 4UF0B 5FXVA 4CCKA 4D6QA 5FZ8A 3OPWA 3PUSA 5A3TA 3RVHA 3AVSA 5FUPA 4BXFA 5F5AA 5IVEA 5FYIA 5A7WB 5LWBA 2WWUA 5F32A 4BU2A 2W2IA 5FJKA 5FZ6A 2Q8CA 3LDBA 2OX0A 3UYJA 4TN7A 3PU8A 4EZ4A 5IVBA 3ZLIA 5FY0A 2PXJA 5FZOA 2YPDA 4LIUA 5IW0A 3N9OA 4BISA 5FZBA 5FYZA 5IVFA 4AAPA 4LITA 5FYSA 4IGOA 4DO0A 4V2VA 4HONA 4UF0A 5FY9A 5FYVA 4CSWA 3OPTA 5A3NA 5FYBA 3DXUA 3PDQA 4CCNA 5FYHA 5FYTA 4C8DA 4GJZA 5ANQA 5FY8A 5FYMA 5FY1A 4HOOA 5FZAA 5A7SA 4AI9A 3KV5A 4XDPA 4E4HA 5FPUA 4QXBA 5FP9A 5FZDA 5FXZA 2YBKA 5FPBA 5IVJA 2P5BA 2XUEA 5F3GA 4LIVA 5F37A 5F5IA 2YBSA 2OS2A 2WWJA 4LXLA 5IVCA 2YBPA 4Y3OA 4QX8A 3N9NA 3PUQA 5FJHA 5FYYA 5FXXA 4ASKA 3AL6A 5FZIA 3AVRA 5FZ1A 5E6HA 3KVAA 5F39A 5FZCA 5FZGA 5LY2A 4GJYA 3U4SA 4NUBA 5FBJA 5A3WA 5CEHA 2YU2A 2GP3A 5F3IA 5FZ7A 3U78A 5F5CA 5FZ3A 2YU1A 5F3EA 2OQ6A 4EYUA 5LW9A 3N9MA 5FY5A 1VRBA 5FP8A 5A1FA 5K4LA 3PU3A 2XDVA 5KR7A 5FV3A 4CUGA 5FZ0A 3DXTA 4XDOA 5FY4A 3NJYA 4EZHA 3N9LA 3KVBA 2XXZA 5A7QA 5FWJA 4DIQA 5FPVA 4QXHA 5IWFA 2GP5A 5F2WA 3KV6A 5FZLA 3N9QA 5FZKA 5A7OA 2Q8DA 5A1LA 5FP3A 5LY1A 4GAZA 4CCJA 3AL5A 5FZHA 4V2WA 5FZ9A 4D6SA 4QU1A 5A7NA 5FYCA 5FZ4A 5FXWA 5A7WA 3LD8A 2Q8EA 5FZMA 5FP7A 5FPLA 4CCOA 3PUAA 5FZFA 5FWEA 5F2SA 4CCLA 4CCMA 5IVYA 5FYUA 4IGQA 3N9PA 5FP4A 3K3OA 5A80A 5FPAA 5A7PA 3KV4A 4IGPA 5ISLA 3KV9A 4URAA 3PURA 2XMLA 4QWNA 3K3NA 5FUNA
chains in the Genus database with same CATH superfamily
4AVAA 1JYCA 4GD4A 4QXCA 4P9JA 5JUVA 2BNMA 2OQ7A 2DCZA 1JBCA 1W9WA 1UYYA 1YEWA 4Y4RA 3VDCA 1G7YA 2VOXA 3FBYA 4OZOA 1MQTC 5G05L 2D6PA 3PVNA 3WEZA 4Y33A 4CU9A 5HBAA 2D43A 2WLPA 3V0AB 4HVOA 1FMD1 1X33A 3VBFA 1SFYA 4FOVA 3GJAA 4FPHA 2VQ0A 1AYN1 4HK9A 2JG8B 2EA7A 5FYIA 5A33A 1QU0A 1XE7A 4AEDA 3HIFA 4Q8KA 1W2TA 2Y6GA 1LKNA 3UJQA 4EWEA 1YI7A 4EN0A 3PIGA 1N1YA 4NJ4A 4Y1ZA 2DVDA 3R0RA 1QQP3 4GH4A 2HWE1 1US3A 2Q1FA 2DBNA 2X5IC 4KU7A 2WDBA 1H1IA 2JDYA 2ZEXA 4RQPA 2BEOA 5GM0A 4SLIA 4GB31 2HWB3 1AYM3 4LITA 4R9DA 1GZWA 4XQ4A 2BZDA 1O3SA 4Q4Y1 4IETA 4CP9B 5K0UC 2IFRA 3TAYA 4B1MA 1ZRDA 1RINA 3GNEA 1DF0A 3WG2A 4UFJA 5EHDA 4CCNA 4QKBA 1D4M1 3K75B 3RWNA 4C8DA 2LRPA 3J8F1 5FYMA 1HQWA 4K6BA 2ARCA 4ZHNA 2FMYA 2EXKA 1WLWA 3ZFFA 3AJZA 2RR11 4IEVA 4ZXEA 4ATEA 5FPBA 3VBUB 3O1OA 1POV3 5F3GA 4URTA 2DTWA 1OD5A 4E9KA 1BJQA 2A5ZA 4JHZA 2BBVA 1ZRFA 2XLGA 5BNPB 3ZDVA 2H6BA 2QBXA 4LUKA 4Q4W2 1BBT2 2G9GA 1SG3A 2W1UA 3I8TA 1R1A1 5D8AC 2VBPA 3CNAA 2IXKA 3MIDA 3BOWA 5I8TA 4PDWC 5AC93 3DPRC 2YU2A 3NV3A 5F5CA 5L9RA 1OLQA 1W2UA 1YQCA 2E7TA 2VZQA 1VRBA 2ZHNA 3WF0A 2E63A 3BODA 4GKYA 3OBTA 2ATFA 1Q43A 2D3RA 2YV8A 4DS0A 5JLVA 2XDVA 2VY0A 5JXHA 1HX6A 2VMCA 4HT1T 2VZOA 2MNGA 1MPXA 3WY6A 5FY4A 1H0BA 3EXUA 1UXZA 4N7UA 4FPCA 3SH5A 5C8CA 3SCFA 2YFUA 2XJRA 5IWFA 2BOIA 1H6YA 3KV6A 3PMSA 4OUEA 3ASIA 4B4RA 1UIKA 4NMIA 1W6OA 3N7JA 1WMXA 2NYYA 5EXOA 4CCJA 5IYYA 2WQ8A 1HRV1 5JVVA 3WUDA 4UW6A 1WBFA 3VLBB 4EV0A 4ES8A 3N7MA 3BTAA 4MZUA 4COZA 1L7QA 1J3PA 4CEYC 5T5PA 3IDAA 1Y7BA 2Y8KA 3RI9A 1VBE2 3D4KA 2GAUA 3AXEA 5CYYA 5HV4A 2R7EB 1UPIA 1W03A 4LBMA 4N53C 3DPRA 4H14A 1WGPA 5FPAA 5E16A 3AKRA 3KV4A 5E88A 1HRV3 3KV9A 2C26A 3SH4A 2A1XA 1YQ2A 1KFUL 1A8MA 4R9CA 2VOTA 1EV12 3KT4A 2B7YA 1RYYA 1DIWA 1XNBA 2V09A 3KF3A 4EE2A 4LHKA 2HEWF 5D2AA 2C9KA 2WT2A 2JJ6A 5FPZA 2I2SA 1NXMA 4HPKA 2HBTA 3IIIA 3M3EA 3ZN6B 5K7PA 1O4TA 1H30A 1AXZA 1IGOA 1OD3A 4BYYA 3ZFGB 3Q8BA 2UURA 3U11A 1KXGA 3RJ2X 1JU3A 5FMDA 1UZVA 4QGMA 4AVVA 4QQ2A 3OGRA 3TN91 2R16A 5JR7B 3ZYPA 4GWNA 2VL4A 4J1WA 4XW3A 2D97A 3I2DA 2JG9C 3JBG1 1L3JA 1ASJ2 1SLCA 4WM8C 1SEFA 1ZBE3 2XGXA 2LM3A 4Q4X1 1WMFA 1UD1A 4QDSA 3SKJE 1D4M2 2WBKA 2QFEA 3AMHA 5B4XA 1WMDA 4KL1A 5B2GB 1Z7S1 1A78A 2VW0A 4RR3C 1S2BA 4UF0A 2UWCA 3WP4A 3GHMA 1IKPA 1CIYA 3IM0A 2ZPXA 1RUF1 3CL1A 3WCRA 5BNOA 3THTA 5KXCA 1ZBA2 1D4M3 2DVGA 2KM2A 4M01A 3VKOA 1RXFA 2VW1A 2WT0A 5FZAA 4DXZA 4CEWB 4YM3A 2OYZA 1CN1A 2WO1A 4OUMA 5ACA3 4LTAA 1Z78A 1UMZA 3AZWA 4I30A 1EAH3 5JOXA 1LHUA 3AFKA 1SFNA 1DQ1A 5T54A 1ODNA 2HWB1 3EYPA 4EN7B 1LR5A 3MFCA 2YBSA 4P5HA 1YIPA 4MGZE 1IPSA 2QTWB 2XVGA 5A3MA 4E4DX 4IESA 2RE9A 1X9TA 2QZ2A 1QH7A 4G9SB 3I2GA 3AMNA 3VHPA 2DUPA 4ISQA 2WNUA 1S0IA 2VULA 1AXKA 3ZSKA 5FZIA 3TEXA 3WHUA 2ES3A 5FZ1A 4B4PA 3E1F1 4W6WA 5LY2A 2C24A 5JZGC 1LHVA 4OFGA 1EAH1 5CG8A 3U78A 2XWJB 1WW7A 2Y6KA 4GALA 5HI0A 2QQUA 4YARA 4FI9A 4IV3C 1GNYA 3MLJA 1SPPB 4CP0A 4EWDA 1DCSA 4BK4A 2VBBA 5A6QA 2PAMA 4YGCA 3CU7A 1OFNA 4NWVA 3KLSA 1LODA 3PTYA 4Y4YA 4QXKA 4AQSA 1DGRA 4LO4B 4BA6A 2ZGPA 4IE7A 3OF1A 5L9BA 2E6VA 3CIHA 1HB3A 1S1AA 4JC1A 1JZ4A 4NIGA 4XQDA 1YJKA 3OY8B 3SCGA 4GMP0 4Q0UA 3ZFGC 1GFF2 1C8NA 3O1SA 5FYCA 1UZ0A 4FPKA 4PQQA 5GLUA 4LO5B 3WXPA 1HQLA 3AYAA 5K0UA 2WRAA 1UCXA 3PUAA 1QJY1 2R063 5DABA 5F1RA 5IATA 4FPYA 1YXWA 2JXAA 4RD7A 3H8RA 3I59B 2NPIA 5DUXA 3BTZA 1MVEA 1WW5A 2WZR2 3IDBB 3PURA 1GWKA 3B94A 3UK9A 5KWRA 3VBFB 1JYTA 3WNMA 3I2IA 4ONUA 4RS5B 1HRI2 2JKXA 3MZHA 3ZPOA 2PELA 5D8AB 4CUAA 3MFAA 1W06A 4XF0A 1PO12 4I0BA 4AQTA 3LKJA 4H3WA 3ZX7A 3HR9A 5A33B 4CCKA 1G86A 4AEMA 3WNOA 1NZCA 2ET1A 1ENSA 2BW8A 3OPWA 1LOFC 4OI2A 5GLZA 3ZKUA 4A7ZA 4MLOA 1TMF1 3LDRA 4NO4A 3BCWA 5FUPA 2XG3A 5LBBA 1GQHA 2ZACA 5DQ0A 5I0RA 4FFGA 1LHOA 2H0VA 2RS13 3NMBA 1FMD3 1RC6A 5F32A 4BQXA 4FOWA 4DOUA 1C8M2 4LKDA 1LULA 4OZXA 3PU8A 1VBE3 3I7DA 1DQ6A 5IVBA 4IE5A 2ZCWA 2NLRA 4HFSA 3VDDC 3R4SA 3GF6A 5FY0A 4AFDA 4AHZA 4CDXA 5AFBA 5J1XA 3VN4A 2FHRA 1T6GC 2VJXA 1VBB1 4FQ4A 2DVAA 2VXJA 4KGQA 1E57A 1GYKA 4GA9A 5DXDA 4AI8A 5KHGA 2KA3A 4GWJA 3BI3A 3GXUA 3F95A 4HONA 5FIXA 5FY9A 4UAPA 3P3NA 1F9KA 3UGGA 3QOPA 1XE0A 3OSDA 1MEC1 3HOBA 1VR3A 4KQ7A 3S57A 2OA2A 3WP3A 4EWAA 2Z69A 5FY1A 4DB5A 4QKNA 4I2OA 2JX9A 4LBNA 2AEZA 2PLV2 3HQUA 4B3NA 1YJLA 4NN0A 4AI3A 1WLTA 2QKDA 4N53A 4FPLA 5F5IA 4DY3A 3R4UA 4UI9L 4UBGA 1RTVA 1NT0A 4BQ5A 1Q8QA 4K9SA 5CKNA 2V4VA 2Y33A 1QDCA 3M70A 1XNTA 5IK4A 1PK6A 1OURA 2D93A 4GWIA 4LO6B 4UYBA 1OH3A 1R081 2ET7A 1UY2A 2EXHA 2ZZQA 2A6VA 1NLQA 2ZABA 4UW5A 1CONA 2GP3A 2JECA 3PIJA 1NQDA 3N9MA 1LB2A 4JZRA 1UAIA 4Q0QA 2R0HA 2YC2A 1U5XA 2HWF1 3B5LB 3H3LA 4NROA 1XC6A 5C9AB 1B35B 5JXGA 4XDOA 1O4ZA 3CJXA 1L7RA 2K46A 1UPSA 3SKVA 2BGPA 4OCTA 3J26N 5AVPA 3DUIA 5A7QA 4ARXA 5KC6A 1RUD3 2YMZA 2ZAAA 4QPYA 4R4XA 5FUIA 1UOGA 4CDQB 5BPXA 3U37A 3SNMA 2UY9A 1ASJ1 3KB5A 5AC92 2JIJA 3GCXA 3AYEA 5C3RA 3FJSA 2ZA9A 4IW3A 2UYBA 2VVFA 5DAWA 5FRAA 5C5UA 3BOPA 5FOJB 2VNOA 4BM8A 4FPEA 1AL22 4CCMA 3MBWA 3HEIA 4CP9A 3CLPA 3IBMA 3GJBA 2VZUA 3VBRC 1YWKA 4CCDA 4LBQB 1DDLA 2GC1A 5EYXA 3AZZA 1QGLA 1FMD2 4XBQA 5A7PA 4AFCA 4EN9B 2A3YA 1ZRCA 3HNYM 3K48A 4ORFA 2BQPA 1QXJA 2W5FA 1W8HA 3ACLA 5FUNA 1DZRA 4AAXA 3VBUC 1Q56A 2P4EA 4A4AA 3NKTA 3ATGA 5AVAA 4ZU7A 1RUI3 1O3QA 2G1MA 3V56A 5T5JA 2XH6A 3MICA 3HNBM 4A41A 3C7FA 2WNUC 3DL3A 1XNKA 4K1YA 4BQ3A 1PIV1 4JCKA 2ZGRA 3K77A 4R9AA 1MZ6A 5FZ8A 4BXFA 1RUD2 1ND2C 1N1SA 2GSYA 4CDUB 2UU8A 5LWBA 3VZJA 4XBLA 4YVWC 1TQ5A 1JYWA 5D21A 3OGJA 1MS0A 1DYOA 4NHLA 2W39A 4NRQA 4CDWA 1LESA 1RMU1 2AREA 1KDKA 3I2FA 4PJYA 4Y1UA 1LHWA 4UW4A 3TBDA 3UESA 3CZJA 3VD5A 1ENQA 5C7GA 5JWPA 1RUF2 3H3UA 3O5SA 4QX1A 1LGCA 2ZEWA 4AEKA 4CSWA 2CL2A 1LGBA 2RDQA 3IKWA 5EYYA 5FYBA 3U14A 4P00B 1CAUA 1VBB2 5I0UA 2D6KA 5FCCA 2JD9A 1S2EA 1G8WA 2BWCA 5C3OA 3OUIA 1UIJA 2K9ZA 1GOGA 2BP6A 1COV3 1UF2C 4YWAA 3HMYA 4JQRA 1GV9A 1QY4A 3BYWA 2Y60A 2E7QA 1H2KA 3N36A 1LHNA 4FT8A 5AFEA 2YB7A 4BHPA 2P3JA 2ZKNA 5BYNA 3WDUA 5GLVA 3D82A 2RJKA 2X5IB 3T0DA 1TG7A 4GMP3 2XWBB 5DAQA 4FCAA 3AVRA 3V64A 1CPNA 4XDQA 4Q1PA 2BBAA 3N3HA 1C1FA 3FFQA 4Q4V2 3KHBA 1AYM2 3H42B 5CEHA 1GBGA 1RUG2 1HLCA 3KT7A 3LE0A 3OY8A 1S0BA 4IV1A 4LO7A 1F2NA 1OA3A 4QX5A 5FZ3A 5IT6A 1AX1A 1J83A 2H6CA 1GSLA 2OPWA 4UBHA 4UT5A 3S5QA 3VKNA 3NAPC 1NE6A 4NIIA 3PU3A 3IB3A 1NX9A 1OT5A 4QKFA 3URFA 1L7LA 4AEJA 3N4MA 1BQPA 4LE4A 3VDDB 2GNMA 3WF4A 1MQTA 4TSVA 2FDGA 3QH6A 4L9BA 4XJWA 2RM23 5T55A 1OC1A 4DIQA 1OLMA 1WUVA 2WYFA 2P3KA 2WNVC 1J3RA 4RHV3 3RPQA 3IDCB 1MS1A 3LA3A 2WS91 4IL7A 2W94A 2K0GA 1LNSA 5DN2A 1CZTA 1JMUB 1UU4A 1W2OA 1Y9MA 4J25A 1A3KA 1GZ9A 1RVF3 1V6LA 1YFXA 2FBEA 3MIFA 4WVVA 4AFMA 4D6SA 3TWIA 3ELNA 1Z0HA 3NNMA 4XTMA 1O5UA 4XAEA 3O1UA 5I91A 3I4IA 5A32B 4H2AA 3HT2A 2CDOA 4P9YA 4S2FA 4W8JA 1H9WA 1K3IA 3I3EA 3APBA 5G04L 3ILRA 4INDA 4FBFA 1YNAA 5B4NA 3U75A 4OI1A 2CYFA 1JZ6A 3ZXAC 3NV1A 1RUE1 1U5YA 2B39A 2XMLA 3K3NA 4BOWA 1PO11 3IPVB 1N1TA 3WV6A 5H9RA 4JGZC 1GQGA 4OHWA 1ZZCA 5BNQA 1CAXB 5HXMA 2WSVA 3UKTA 1PM7A 1AJOA 3AP7A 1QJU3 4LBKA 3I59A 5FXVA 2ZGOA 4YYOA 3HN1A 1H8TC 1JOBA 4QQLA 4Q27A 5LBFA 4A6SA 5J3UA 1BXHA 1QHDA 2WWSA 4N9IA 3WT3A 2BERA 3DN7A 5FKCA 4FSJA 2CWMA 1D0HA 2WWUA 4L8QA 2XB6C 3TN93 4DXTA 1JUIA 1D2SA 1YC61 3GZTB 3H3ZA 2A6WA 1QJU1 2BU9A 3POJA 2CWSA 2DFBA 2IXIA 2E26A 4KMQA 5DZEA 3TYJA 2P1BA 3MUZ1 2WIIB 3JQXA 5C8WA 2QQIA 4JDOA 3KQ4B 4AFAA 3IPVA 1MEC2 3QD6A 4LR4A 4MOAA 4PIYA 2DDUA 1XXNA 1WMEA 2HEVF 2VECA 1RUJ2 3W9AA 4Y24A 4E2SA 1W6QA 4DUVA 2EAKA 1PGSA 4QQPA 3K46A 5JSOA 4WM7A 2I74A 1XNCA 4BQ1A 3UGFA 2EIGA 4HOOA 3KHCA 3WLUA 4BWOA 1DU3D 4M3CE 4MGYE 3UV9A 5FP9A 4JDNA 4CUCA 4Q8LA 1AR81 1LCLA 3Q8FA 3V0BB 3JUUA 5CFCB 4Z2WA 1D4VB 1PVC2 4OMDA 4NE9A 2MEV1 4Y3OA 2JG9B 3ZPYA 1TMF2 5CFDA 1CAVB 3ZFEA 1AYN2 3WINE 4CP2A 4QM9A 2MHFA 5FJHA 3OEBA 4NWWA 1H2MA 2XBO3 4U2AA 2V4AA 4XBNA 1LEDA 1ZA7A 2QNKA 3GZEA 3D0SA 3BIEA 1CJDA 2HWF2 3KGLA 5IUQA 1O3RA 3KS7A 2VBDA 1EPWA 5E1RA 2V73A 4P08A 4QHZA 3ZMNA 5I0DA 2PAKA 1OQ1A 3H9AA 5IK7A 2YC0A 1OA4A 2WR9A 1K42A 4RGKA 3GZUC 1W8ZA 1Y9GA 4HK8A 4M4PA 4XUOA 1JOJA 5IK8A 2VUCA 4AK3A 2JB4A 1NA1C 1V6MA 2Y38A 2IXCA 1S4CA 2RM21 1NCQB 1ZRRA 1ZZ6A 1ULCA 1W8FA 2EIDA 3ES4A 3MHZA 2VVEA 1NG0A 3N9QA 2BRTA 4Y22B 5JSRA 5KHKA 4IV1C 5I0SA 1C1LA 2XJSA 4QPIB 1SQ4A 1T6BX 4YW3A 1PO23 2IVJA 4XJ8A 1G9CA 3LB9A 4QU1A 3TNPB 1SFPA 4AVBA 1OPMA 5JI9A 2XHKA 3POFA 4AYUA 4CCOA 3RZGA 3OG2A 3LPGA 5ERLA 2RMU1 4W6YA 1ULFA 3N7LA 2GDFA 4LHLA 1ZREA 1AYN3 2WFF3 5DDJ1 4I3GA 5FMBA 4LORA 4AI0A 1HDKA 1NAEA 2AACA 2Q5TA 2QQWA 2RJ2A 3M1HA 2A7AA 4QQHA 4F7ZA 3O14A 5A3PA 1W28A 1EPZA 4OHVA 3T3YA 4LT5A 2AYHA 4XURA 3ZYIB 3Q8AA 4N90A 5GZCA 1AYM1 1RXGA 1IQDC 2GN3A 4YM0A 3THDA 1HJGA 1AR83 1W04A 1DLLA 1VBC1 4NHXA 1VAVA 2JDZA 5KHHA 3MDPA 3VHNA 4D6QA 5I93A 4UW3A 2J7MA 2JE8A 4B29A 1V6JA 3THPA 1WW4A 2GC0A 1V6KA 1V00A 4ASLA 4TLGA 1W2NA 3LFMA 3WQ0A 1MZ5A 2RDSA 4LUMA 4CXYA 4NIAA 2J1AA 3NL1A 4FP3A 2VMIA 5JZGA 4Z92B 2IZWA 3WP5A 4NIHA 3BPSA 2ID4A 3POWA 1GUIA 4CCEA 3VKMA 4XFHA 4AHXA 2WFPA 5C33A 3DPRB 3DYMA 4E27A 4X8PA 3LWCA 1H2NA 2E9QA 4KWUA 4OHXA 1AR62 1RUH1 1N47A 1BZWA 4LULA 2YC4A 5CVRA 3VBRA 5L19A 1OA2A 3AB0A 3DKWA 3IIAA 4DRRA 5ABJC 1GICA 3WF3A 4XDPA 3OJBA 1NA1B 4WVMA 3WUCA 5C5TA 5FMOS 1I9RA 4MV2A 3AJYA 2P5BA 2WZR3 4D8MA 2TEPA 1VRH1 2TUNA 4MGQA 2ZGMA 4YGEA 4IEWA 4M3CA 3PVEA 4BJ0A 3MIHA 4YGDA 4Z07A 4QHOA 1Z7S3 3R05A 1K45A 1X8MA 1ULOA 1RJ8A 4N8MA 1HB1A 2R073 1LAJA 2ZOEB 2R0FA 4LHNA 4CEYB 2D44A 2XUMA 1PMJX 2WNUB 4JKKA 3J7LA 2DVBA 1GNHA 4Q0VA 4WZFA 3TNQA 1ULDA 1VIWB 4M3CB 1BVVA 2XBO2 1LU2A 4XAAA 2W46A 4JVAA 5BNNA 1SLTA 2OUHA 1RUJ1 2V5YA 3ACFA 1ZZ9A 3NQHA 1S0DA 4Z8BA 1BEV2 2XXZA 3UKNA 5BNNC 1O59A 5IHRA 2LTNA 3CQOA 4CUBA 1FOD1 3N35A 1Q5OA 1U0AA 2RMU2 4V1PA 4XUTA 3J7HA 1HXS2 5FMOL 2RS11 2F17A 2VW2A 1VMJA 2D3SA 5K0UB 2O0OA 1KRIA 5CADA 1PMHX 3MV11 1DGWA 4XFCA 2RS33 3LD8A 2VNRA 2X53S 4D7SA 1U5ZA 2WO2A 5FZMA 2L9LA 3AP6A 4BQWA 4CPBA 3WF2A 2QUOA 1QIQA 3POIA 1NE4A 3VBHA 3KT1A 4CCLA 4I02A 5FBZA 3K3OA 3PJYA 3OD4A 1LOEA 4IEXA 4KNCA 4LPLA 2CTVA 2XVLA 4I09A 4QD2A 3VBSC 3WP6A 1RVF1 5CNAA 1W6QB 5DAXA 5CU1A 1PX4A 2VMEA 4HSLA 1X7NA 4IE6A 1C8M3 1GP5A 4XC9A 4Q2FA 4QU2A 2R1DA 3RWKX 4BK5A 3H50A 2HWE2 1HQNA 3HNMA 2R041 1BHGA 4D6RA 5LK7B 5LATA 1ND3C 3U1XA 1AR63 1OHFA 2YZ4A 2QQVA 1COV1 5H9SA 1REEA 2E53A 5KHJA 2WFF1 5JPMB 1JZ2A 4AWDA 1IS5A 1YO8A 1TMF3 5D1IA 5IVEA 5SV8A 1PVC3 2VTFA 4AHYA 4CTEA 1DQ5A 4XF1A 5EWSA 5FZ6A 4E8DA 1VBC2 4IEQA 3E97A 1JU4A 1WD4A 3J4UH 5C4WA 1I6XA 3ETQA 5ABJB 3WNKA 4R8HA 4Z82A 3HT1A 3I54A 2PLV1 2PA7A 2A73B 3LDKA 2Y34A 1XYOA 1ULPA 4P9XA 1KITA 1BVP1 4QPIC 4Y1YA 4BISA 5KBFA 4BMBA 1UY3A 3A4UA 4XZUG 5IVFA 4E4ZA 2NP0A 2EVXA 5JI7A 2G9ZA 4NOTA 3ZN6A 1VBD1 1DYPA 1GWMA 3J7MA 1AR91 3RMYA 1QXRA 2FZ1A 2YDEA 5LB6A 3NWKA 1UZWA 3DXUA 4Y22A 1S2KA 5LA2A 1WLCA 2WZPP 1XJAA 5C6CA 5DAVA 1VP6A 3QBQA 1F15A 2B45X 4E4HA 1W6PB 5A6ZA 3RYPA 2LS6A 1IHMA 2YBKA 3RZLA 1AL0G 1SLBA 4BIOA 1R082 4JTNA 3TN92 3L9JT 4E2GA 1LJ7A 4RGGA 2ENRA 5ANNA 3RZZA 5FFOC 4S2GA 2WYSA 1FNYA 2YHJA 5CG9A 3S7EA 3MIGA 1PIV2 3BKZA 1DQ0A 5FZGA 3VD7A 1V6NA 2VQUA 1UMHA 4GH4C 1H1AA 4NUBA 3W5MA 1RUF3 2YXSA 2J1UA 1PO22 2EAAA 3AYDA 1CAWB 4BLJA 2PHDA 3FUQA 3KCXA 1PZ8A 1K12A 3PL0A 1CAVA 3ZFEB 1IPKA 5DZFA 3O1PA 2WINB 2C1FA 4XF3A 3UT0A 3EJKA 3PJQA 5FV3A 3WHTA 3VGIA 3U0ZA 1CGPA 2WO3A 1JXNA 2X05A 5FOBB 4M3CF 2DBIA 1YI9A 4O9EA 2ZAHA 2JDPA 2X8KA 5FWJA 3VBHC 1W6PA 5FO7B 3AZVA 2CGPA 1NCRB 4JGYB 1GP6A 1KJLA 2E7AA 3CEWA 3MO4A 3GDBA 2GP5A 3ILFA 5F2WA 5FPVA 1IS3A 5FZLA 5LA9A 1Q8VA 3VBSA 2WUHA 1OVPA 4P9GA 4Q29A 1SBFA 1WZXA 2BFUL 2SBAA 3PUHA 3ZXEA 3IDEA 5BUVA 1TME2 2LUWA 2ZZJA 4L0PA 4YFZA 4K1ZA 4HXCA 2WLQA 5CKMA 2GMPA 3NKGA 2CSGA 5CB7A 3T2OA 2RMU3 4HN0A 2HH9A 4CEWC 2A3WA 5GZEA 4OI4A 2VMHA 2LROA 4GWMA 3N9PA 2OPKA 3OBAA 5A80A 3RZMA 1OLRA 4ZKTB 2B5HA 2A6YA 2XJUA 2AUYA 5CFDC 3H0OA 4AW7A 3X29B 3ZIXA 1AL23 2ADDA 2XBO1 3LEKA 1YHFA 3NV4A 3VD4A 2OW4A 3BIWE 1RUG1 3JB8A 5JZGB 5FZEA 2OUJA 5I8YA 2VGDA 4UF0B 1ONAA 1J1LA 2FCVA 1JI6A 4JDMA 4AI1A 4LKFA 1Y3TA 2UYAA 4AE2A 4HSJA 3S0MA 5C4WC 4YM1A 3GBFA 1UYXA 2QQNA 4PDWB 5A3TA 3AVSA 2BFUS 1BK1A 5DPNA 2RHPA 4DPNA 3QACA 4DMIA 3WQBA 3MEPA 5H9PA 1N3OA 5FLHA 2ZGUA 2Q4SA 3M3OA 1JYXA 1COV2 2WL1A 2WQZC 4YW4A 3SITA 4LO8A 4ZZ5A 3OBRA 3HJRA 4AQ6A 1TME1 4EZ4A 3FFZA 1ND3A 4LNVA 1O7FA 2JKBA 2RS12 5FZOA 1UU6A 2GMEA 1VBB3 2B4KA 1CX1A 1CZSA 3AXDA 1S0CA 5FMCA 1R093 1YCIA 2HWF3 3W58A 2VC9A 2CY6A 3BPZA 4EROA 1EUTA 1RVF2 4IGOA 4NPMA 4D7TA 1W0NA 5BV6A 1PK6C 3I3BA 5HXVA 2WNVA 2R30A 3A23A 4RHV2 3RS6A 1O6UA 1WCSA 1RUNA 1WA6X 2K2SA 5IAVA 1Y9QA 1H8TA 1TZOA 3I97A 2C5DA 1BEV3 1SDDB 5ANQA 5FY8A 1SLIA 3IWZA 1ENXA 1MR5A 1NLSA 2NQYA 4HBNA 3ZSMA 5K9YA 4YZ3A 4TLFA 1GZCA 2ADEA 4OHYA 2UY8A 5IVJA 2X5IA 2WAAA 1ST8A 3FLTA 2PHWA 2VG9A 4L99A 5IVCA 2J22A 4P02B 4BZ4A 1HB4A 1KJRA 5T3NA 1MS4A 4DFSA 4G3YC 1RUD1 1QH6A 1ND3B 1IOAA 1VAKA 3AL6A 1M4WA 1XNAA 2OKXA 3D0JA 1J58A 4LA2A 2P2KA 1CVNA 1RUE3 3AX4A 1MEC3 3VBOC 2LW8A 2JDHA 2CGOA 1K5MA 2R042 2B8MA 4FPFA 3VBRB 2VMGA 4LBLA 4FAHA 1W90A 3LEMA 5IFTA 3S5AA 3MGUA 3OOXA 4JGZA 4TTGA 1EP0A 1YRZA 3JQWA 4BQ4A 4ISRA 1AXYA 1GMMA 1R1A3 1UOBA 3BUCA 3NJZA 4Q4W1 1UU5A 5A3UA 3ZKYA 2VU9A 3A7QA 4DRVA 4DEVA 3M3CA 5FZKA 2Q8DA 1N3QA 2HWC1 5C70A 3VUOA 2EIBA 1OXCA 1KEXA 3AYCA 1RHI3 3RG0A 1UWWA 2ZX2A 4MGKE 4Y20B 3RZHA 3HQRA 5FREA 4K20A 4RR3B 1Q3EA 4H7MA 2LALA 4ZS2A 4AR2A 4CPBD 4O65A 4XMAA 2CAVA 1XPWA 4XHBA 2KD7A 4A44A 5EQUA 4EJRA 1PZ9A 3INAA 4PF1A 1K5MB 2PTMA 1FV2A 4MHUA 4YW7A 1XSRA 4URAA 2ZMLA 4CXWA 2HWD2 4K8FA 1XBFA 1QJX1 4UFMA 4FVVA 1RUH3 1PVXA 3ME2A 4B7KA 3T4VA 4KWKA 3BU0A 1JZ8A 3OEAA 4FO9A 4GH4B 1QJY3 2HWD1 4L97A 2VO5A 4CP1A 3ZSJA 3TOJA 1LOFA 2FCUA 5DDJ3 3L2YA 3ZFEC 3THCA 3OTFA 4YPJA 3C3VA 4FTBA 4CU8A 2IXJA 4KBBA 1A6CA 2JIGA 4IV3B 4RGAA 2PFWA 5ABJA 4NAMA 3V0AA 1ALYA 4N53B 1HKDA 2CDPA 2DCTA 2PLV3 3ACIA 3FMGA 4M0NA 4TN7A 5I8SA 3VZKA 3WD5A 3WNNA 2CNAA 4HN1A 5EJZB 3ZLIA 1ULEA 1X82A 5BNNB 1E5IA 2R6QA 1GOHA 1S0GA 5H9QA 4IUGA 3AZYA 3J8F2 3L2HA 4BDVB 1XYPA 2XLAA 1STMA 1ZYBA 1W8NA 5GLTA 4YVSC 1LTEA 4DNYA 1ND2A 2J42A 1KQRA 1SZBA 2BWAA 4OLLA 1CAWA 1OFSA 2GU9A 4XJAA 5J7MA 2XOMA 3OUHA 1RB8G 2D6NA 4KG8A 4LBQA 3FHAA 3WSOA 1C28A 5JMOA 2XJPA 4Q5OA 1DP0A 3ETPA 3ZSEA 2XVKA 1OOPC 4OULA 4FFHA 1POQA 4KI5M 1XU1A 4MUVA 3LGRA 1W05A 5JMCA 1CIWA 1OUXA 1JUHA 1EAH2 1XE8A 2WZEA 3DYPA 3V65A 1C8M1 1F5JA 1HRV2 1XU2A 4OYUA 3VBSB 4MGIE 5F37A 1ODMA 4FP2A 4NRPA 1RIRA 4PIXA 1H4GA 4GULA 2D5HA 4QB6A 3FLPA 2RS51 1ZZ7A 1UX7A 5CKQA 1O5LA 5FXXA 5CFCA 1D0GA 3BTYA 3JU9A 5FKBA 5T50A 5E6HA 1W8UA 3A22A 3ZYRA 5KXDA 2JEMA 4JQTA 2YPJA 5C8CB 2P17A 1ND2B 2ZX3A 3LSEA 5FZ7A 1CAUB 1REDA 4QM8A 1DLCA 1XB9A 2C4XA 3G6JB 1ZBA1 4FXGB 1UZYA 1GOFA 5FPXA 1TNRA 3MF9A 1VB4A 1SLLA 5EJ3A 3U07A 3KVBA 1RUC2 4Q26A 3ZIWA 4O61A 5L7OB 4HZFA 2JB8A 5BY5A 4QGNA 2F6BA 1E5HA 4YM2A 3T1LA 5A7OA 3U4XA 2DCKA 3JCIA 4O9GA 1QWRA 3AKTA 4COUA 3VZNA 5APAA 1T2XA 3BTXA 1ZA4A 3O0VA 4XFGA 3WNLA 1HW5A 1SCRA 5A7NA 1OLME 5A7WA 3V0BA 4XJUA 1F4AA 2JG8C 2ZX4A 3MPPG 1OUSA 2DWRA 2IVIB 4MXWB 2HWC2 1F35A 3H8OA 4DY5A 1JODA 3C7OA 1C4RA 1DGLA 2BNNA 5J96B 5FO8B 4YG3A 5IVYA 1NY72 2Y6LA 3LF7A 1PGW1 1W3XA 1BCXA 2XR4A 4JRLA 1ASJ3 1P8JA 2B9UA 1H8VA 2AENA 2VH9A 3POYA 5DUWA 5BXXA 4XOGA 2OT7A 2RS53 4K3UA 4XXPA 3O7OA 4Q4X3 3SMHA 4CCCA 1W9SA 2QVSB 5EP9A 3W20A 5LBCA 3WW4A 4XFIA 2ORZA 5FY7A 4BB3A 5CBLA 3PTRB 1W99A 3AK0A 4XQWA 1POV1 2Z79A 1GKBA 2QCSB 4CDWB 2VMDA 2VTXA 3IAPA 2VTXJ 4YFWA 4PLOA 3VV1A 1KS4A 3AZXA 2ZKLA 3ZXKA 4BXSV 2NMNA 3O12A 2WQ4A 1VBE1 3J8F3 1SLAA 2PHTA 1HV0A 2XLFA 4BU2A 2ZX1A 2Z5WA 4R4ZA 3LDBA 1OSGA 2JE9A 3Q8EA 3SC7X 1GR3A 3QLQA 4CEWA 5L73A 1BKZA 2ZEZA 3HWJA 4KWJA 3IZOA 5F9TA 4META 4UXAA 4FFFA 1U12A 2VCBA 3HAGA 3AM2A 3N9OA 5D8AA 2J1VA 1BMV1 4RS5C 1FT9A 4B4QA 3TEYA 4A42A 1AR92 4XIOA 4YW5A 1OKOA 4GMP1 4XJZA 2AZ5A 2J1SA 4CEYA 1BBT3 4HKOA 4IEYA 1AF9A 3OPTA 1BMV2 3H8UA 5FLJA 3G7DA 3T08A 1UY1A 3FN9A 4NR1A 3T30A 3DF0A 2AR6A 4FPGA 2A6ZA 3WNXA 4LOTA 1W6NA 3KM5A 3VDDA 4QPWA 3RSJA 5A6XA 3GCWA 1ZZ8A 1LEMA 1RUC3 4JGZB 2IUWA 5IK5A 3T2PA 2ZGKA 2YBPA 3ZYFA 1OF4A 1RUOA 2B9VA 3E6DA 2FDJA 1PNGA 2QQLA 3AMQA 1QKQA 3WG4A 5BNOB 1A34A 2DUQA 3KVAA 4Y5Z0 1YFUA 2KR2A 3AKSA 4YVSA 4A7YA 4A6OA 1W6MB 2D6MA 2RR12 3D5OA 5CAZA 5DMYA 5KC5A 1X8EA 2ZHLA 5F3CA 2OQ6A 2JDKA 1RMU3 2DF7A 4AGGA 4FOYA 1VBA2 5A70A 4A45A 1QQP2 5K4LA 3VHRA 3AKQA 4LK7A 3D8CA 5DAPA 3UJOA 2E51A 3WR0A 4B1LA 3BVCA 4HLTA 1DYKA 3ZYHA 4Y5TA 4AQ2A 2HYXA 3MW2A 4NPRA 1NLRA 4CYDA 3I3MA 2VVDA 1R1A2 3ACHA 2MPFA 2JD4A 4AGRA 1D2QA 4ZU4A 3M3IA 4PT6A 4XEZA 4AEDC 2JDAA 2VUJA 2VQAA 4HKWA 4BMEA 4PI2A 1R1ZA 5FP3A 1QJX3 1FXZA 4RR3A 1W6MA 1PVC1 3CF6E 5FR3A 1Q8OA 2WZ8A 4YZ4A 5FZ9A 2W3JA 4S2HA 1MZEA 2OIIA 4C1WA 4XF9A 1RL3A 1VJ2A 4YSFA 1YQ8A 1SMVA 4I3PA 5GJ6A 5J98B 2FDIA 4LK6A 4X6QB 1W3VA 3HN3A 4NIDA 3RNSA 3AMMA 3KWVA 4Q4Y3 1LENA 2FCTA 2Z4FA 1VBD3 3FL7A 4Y20A 2FDHA 1LGNA 4WM8B 2WA4A 3JZVA 1AR72 3H8XA 1JN2P 1AZDA 1VLNA 4PBPA 2W52A 2WAOA 3NVCA 4NAOA 5FAXA 3P3PA 3NJXA 1JZ3A 1W0OA 2XJVA 4MYEA 3UGHA 4CDQC 2D7FA 1PO21 1AUYA 3LZZA 4QPGA 3RQ0A 2ZHKA 5J48A 3PMEA 4JKMA 2BYVE 4PIZA 3OGVA 3FWEA 4XHXA 3MLKA 1AR93 2RS52 4LHSA 1YQ6A 3PUSA 5CISA 1F4HA 3RVHA 1G6NA 3T1MA 1QJY2 1DG6A 1H6XA 2JDUA 1YFWA 5BNPA 4ASMB 4MVTA 2BGCA 4ZONA 2WN2A 5L7OC 2VOKA 2OX0A 4I01A 3M4FA 2HWD3 2BV4A 3DECA 1CESA 3LAGA 2O8OA 3M8LA 4LBOA 5CFDB 1BK0A 1YLLA 4K40A 1D7PM 3O1RA 2YG0A 2ILMA 5FYZA 5F6KA 2WN3A 2XL7A 2A71A 3VBOA 2W47A 3AP5A 5T5LA 4AHWA 1FI2A 4LBQD 2BPA2 5FYVA 4PQ9A 5A3NA 3PDQA 4COVA 3B3QE 4E8CA 4RQPB 4Q4X2 4Y5SA 3AC0A 5J09A 4BQYA 2G4IA 1ACCA 3EMRA 3POGA 5FPUA 2XONA 2RG4A 3FX3A 5ACA2 1RHI1 2PAEA 3DGTA 4MGSA 3GYDA 3H1YA 2Q8OA 3B00A 3W59A 1S0JA 4QX8A 2XL9A 2A6XA 5L7OA 2EF6A 3T2QA 3C8XA 1J3QA 2BNOA 2ZBJA 2OZ6A 4IE4A 1BEV1 1K5JA 1HB2A 2EICA 3HBZA 4HANA 4MH0E 1JW6A 4G4FA 4A2UA 3OUJA 2DU1A 3MYXA 2RS31 2XHNA 1AX0A 5LW9A 3C7EA 4D7YA 4CVUA 3EB7A 1FV3A 2GC2A 5A1FA 4JX0A 1ZBE2 3LA7A 1QF3A 2ARBA 1NCRA 4HG6B 1RUH2 4JGYA 4MXWA 3WDWA 4BH9A 2W1WA 4RHV1 4UFHA 3DXTA 4CUGA 4EZHA 3NJVA 3VBFC 5FO9B 3TB0A 1E5SA 1IS4A 4AOCA 3ZR6A 4M4RA 1VMHA 4AL9A 4QXHA 4QX0A 2DV9A 3BGAA 3CKHA 1AL21 1MZFA 2FD8A 2PHUA 4FOQA 3W21A 3SHRA 1JOPA 4GAZA 2CV6A 2QQMA 4C90A 3WNPA 1UKGA 2O8QA 3DEMA 1CWPA 1RUI2 2QQKA 5JIUA 1W0PA 3ZO0B 1J1TA 1WW6A 2Q8EA 4CDQA 1JZ5A 4QT6A 1HN0A 1UZZA 2UWAA 5F2SA 4LKSA 3ZFGA 1CD3G 4LEJA 1ZNPA 4FPOB 4IGQA 1WCKA 4QGLA 5I0TA 3RYKA 1IS6A 5ISLA 4RYDA 1Y43B 4KWLA 3ITQA 3CBNA 3FC0A 3CJIA 3VD9A 4GKXA 1VE0A 3GHNA 2QZ3A 3J7NA 5F6LB 5FZOB 1FATA 2AGSA 4K8RB 1ZVFA 4CDUA 5IVVA 3LQCA 1C5HA 4BPZA 4IDZA 4GB33 4YLZA 5BNPC 1UY4A 2ZMKA 1WCDJ 1ZM1A 2RJLA 4MHRA 2DU0A 3CJIB 4B8EA 2E31A 3WDVA 1OMIA 4RQPC 2J1EA 1W9FA 3E5QA 3WX5A 3ZR5A 4D3WA 2R061 1LOCA 1QOSA 2YGLA 2GC3A 2VE1A 1AR73 5GZFA 3MW4A 5DG2A 2WNOA 1VRH2 3PVOA 2W2IA 3NV2A 3DYOA 3UETA 2Y26A 4IE0A 4DEQA 2PQSA 3WOGA 3SH3A 4WVWA 4R9BA 4D0QA 1Y4WA 3CHXA 3LFIA 5HCFA 2XPJA 4KG0A 2EXIA 1IPJA 2DUOA 1OVSA 2VZPA 2YPDA 1QOOA 4LIUA 3FHIB 1CAXA 2VZSA 4QPGC 3RRDA 3UL2A 1UKRA 4WVZA 2CHHA 3PVBB 3VZOA 1MACA 4IV1B 1GWLA 5DDJ2 4DUWA 2ZGSA 2IWGB 1PIV3 2V5DA 3ZFFC 3QCWA 3P5BA 1QJFA 3PHMA 2OVUA 2I07B 4Y1XA 3FBMA 3SXWA 5FYHA 3USUA 4HKLA 1MS3A 1B35C 2RV9A 2VZVA 1PHMA 2EXJA 3NNLA 4XACA 3RMXA 1C57A 4QXBA 1XQNA 4P9WA 3GALA 2CAUA 5FZDA 5FXZA 3VHOA 1FNZA 5HV0A 4LIVA 3MIEA 3MIBA 3S6PA 5M0TA 2AC1A 4E2QA 2TNFA 4LXLA 1UXXX 2R043 3ENRA 3I3QA 2RDNA 3LIHA 2QDRA 2WT1A 3VL9A 4AG4A 1NYWA 4CE8A 1TVGA 3B02A 2HBUA 4YZ5A 1S0EA 3DV8A 4X6RB 5HPOA 4S2DA 2VM9A 4IEZA 4IEPA 4DXSA 1RUC1 4MGTA 2HWB2 2AH2A 4C0BA 2W95A 2XQXA 4GJYA 5A3WA 2WO7A 4QQOA 4XFFA 5FQ0B 5LA1A 3ZSLA 2DYCA 4CDWC 1HJFA 1NUKA 4RS5A 4EN8B 1V70A 3JBG3 4R52A 5FY5A 4EYUA 1HRI1 5FP8A 4LJHA 1A8DA 3H1WA 2QDNA 3Q9OA 4AXOA 1O8SA 3MPBA 4OVEA 3ST7A 2YFZA 4JTOA 1OOPB 3QH7A 4F83A 3WG3A 3N9LA 2F4PA 2G9FA 4FAGA 5GALA 5J37A 2HWC3 1VB2A 1YIFA 2GNBA 5JOYA 3WW2A 5LY1A 3B9CA 4HL0A 3WDXA 2HKXA 1RJ7A 3CJIC 3JBG2 3WG1A 2BJSA 1RUI1 1TME3 4IQPA 4XXAA 2YY1A 1BLZA 5FZ4A 2FDFA 1RUJ3 4Q4V3 1QEXA 4AGVA 4CDUC 3O1VA 1G9FA 4PLNA 2R072 1REFA 3CO2A 5FWEA 2X09A 1N3PA 3LSDA 2VCMA 2GN7A 4ZS3A 4MXVA 3OYWA 3P6BA 4NPLA 4OUSA 4Q4Y2 3VKFC 1TEIA 4BLIA 2DTYA 4DUXA 2WSUA 5EJ1B 1V9U1 4N7IA 4QPGB 3AP4A 4QWNA 3RZKA 2JENA 2VOVA 2VUDA 3K2OA 1I1EA 2ZJCA 1ENRA 4YGBA 4FQZA 1VBA1 4DINB 4QX7A 3I49A 3OPZA 4Q0PA 3KGZA 3OYWB 5IAXA 4LLFA 4WM8A 2WZR1 5DUUA 1LECA 1R091 2HYKA 1X50A 4JHTA 2RDRA 3D3AA 4AFBA 3KSCA 5J36A 3B93A 3AFGA 2BDRA 4QDQA 3LCPA 2OXBA 1QJZA 3HD8B 2MEV2 3LEGA 3I2HA 2OZJA 3DCQA 3VDBA 4DQAA 1C5IA 3RDIA 4FPJA 3VKLA 4XABA 5GLWA 1NCRC 4JGYC 2ZGLA 3NO8A 3FUOA 3O1TA 1GP4A 1ZRIA 2W9XA 2XKOA 4P5YA 1VRH3 4K21A 4XILA 5FZBA 4CDXC 2ORXA 2B42B 2VNGA 4ZY9A 5FYSA 3RJRA 1RUE2 4ZU5A 4DO0A 2VPVA 4LQRA 2PHLA 1WBLA 1APNA 1DGWX 1KS5A 1OH4A 3C7GA 3EO6A 4I0AA 4QB2A 3M7AA 4F8AA 3NAPA 1UO9A 2J1TA 2JE7A 1OQEA 3LIGA 4XYXA 5A7SA 4K7JA 3VD3A 4NHKA 4XTPA 2P37A 3WQ1A 1UMIA 2GNTA 5AC91 2NM1A 3FHQA 4DXRA 2WWJA 2WS92 4JV4A 5C3SA 2ZS6B 4JRAA 3SQOA 1FOD3 3LOBA 1OQDA 4ASKA 2J1RA 1OI6A 4MX3A 4HVQA 4GQ7A 5FZCA 3ORJA 3M3QA 5C4WB 1UNBA 2IFWA 3MUY1 2VZ1A 1R092 1W9YA 3HVDA 4LBJA 2Y0IA 1B35A 2HWE3 1PZ7A 2YU1A 1QQP1 2JDMA 3HPNA 1DZQA 1FPN2 2DURA 4KU8A 4D69A 5T5OA 2ERFA 3ZOIA 2EALA 2YUEA 1H1MA 2WKKA 5HCAA 4H7LA 5CZKA 5FZ0A 4QMAA 1URXA 3ZXLA 2ARAA 4UFIA 5GKAC 5LRSA 3ALQA 2P3IA 3LPFA 4W65A 1NY71 2X29A 5C71A 1MVQA 1N1VA 2VR4A 3C7HA 3IMNA 4HETA 4QX2A 2FDKA 2BOJA 2WABA 3ZMOA 1NKGA 4QHBA 4P9LA 4XCBA 3CZUA 5GZGA 3HBKA 1W2AX 3IMMA 5FZHA 1SHWB 1AR82 2WC2A 4V2WA 5FK8A 1RHI2 2GMMA 2GNDA 3CMGA 4YW6A 1SCSA 5JAXA 2PHFA 4XVHA 1EUUA 4KGGA 4W6XA 1W6NB 2G19A 4KH9A 4MSVA 4IERA 4NRMA 3W5NA 4WBBA 2WNEA 2P34A 5KXEA 1I3HA 2C6SA 1VMFA 3PNAA 1GNZA 2PN5A 1VAMA 3IAQA 3WF1A 4IGPA 3EBRA 1FYUA 4XMIA 4QX3A 3ON7A 5KXBA 4IEUA 2W87A 3NSTA 4A3XA 1WLDA 4CDXB 1U5IA 2Y6HA 3E5UA 3LA2A 2DCYA 1FPN1 2N7GA 3JXSA 4BIFA 1X9PA 2TBVA 3ZXJA 1W9TA 1I5PA 1V9U2 2W1QA 4SBVA 4XUNA 1UW8A 2AEYA 3VBOB 1DBNA 1JS9A 3NNJA 1BBT1 1NA1A 4WVMB 2QE3A 1W8WA 4YVWA 3C2UA 1NOVA 1F31A 1WCUA 3TRSB 3BB6A 1JTZX 4MG2A 5EFUA 2ARXA 5LEJA 1H4HA 2H0BA 1XOYA 2VCCA 5FJKA 3SEEA 1JHJA 3O0WA 4XUQA 4DZGA 3OD0A 4OQ9A 5L9VA 3TEWA 4N43B 4YRDA 2XQRA 1ULGA 2E32A 3BN6A 4RSUA 2JG9A 2ZTNA 1G9DA 4FFIA 2VZTA 4GIQA 1DFQA 4L2NA 1CQ9A 1AR71 3USSA 4COYA 1ZZBA 4XCAA 5E8AA 4Q4W3 1CJPA 1OBNA 4U36A 1JYIA 4GZ9A 4YG6A 3F2ZA 3OGGA 3DKQA 3PLQA 4QDRA 5TSWA 1R083 1W8TA 2GH2A 3AMPA 2SLIA 4GJZA 4H55A 4AVTA 4CU7A 3IT8A 3LEIA 1JHNA 3KV5A 4JAAA 5FQ0A 4N43A 5GZDA 1GLHA 4QKDA 1W8OA 4WM7C 1LOGA 3ECQA 1WKYA 4XUPA 3VZLA 4KBZA 2NZ9A 4W50A 1Q8SA 3RI8A 4OQ8A 4CRQA 3VL8A 2DFCA 4E4SA 1PGL2 2YGMA 3N9NA 3PUQA 3KCCA 4OI0A 5A32A 3A0KA 5E89A 4N9HA 1R64A 3I3DA 1UOFA 4TWTA 1V9U3 4COWA 4PLMA 2FZ2A 3OBZA 5F5QA 2Z42A 4Z2AA 2JDNA 5F7UA 1ZBE1 4IEOA 4WZCA 4A7KA 4X8NA 2Y6JA 4LKEA 1IZ3A 3CDZB 5DG1A 1F5FA 1W39A 4PF5A 2PYTA 3BALA 1EV11 4UFKA 1QJX2 1UOJA 2CU5A 3VDAA 3ZN5A 3ZYJB 5KR7A 4AVSA 4L11A 1AR61 4Q4V1 5T52A 5LRRA 4D94A 2FQPA 1QXPA 3FZ3A 3ZM8A 3UNPA 2ZEYA 3MI8A 5LA0A 3ZYBA 3O0XA 3ACGA 3N7KA 4BE3A 4I0WB 3M2MA 2Q0AA 5HCBA 1HN1A 2A70A 3JD71 5IFPA 2Y6FA 3AL5A 1RMU2 2C9AA 1RUG3 3POBA 5JSPA 1QJU2 4AI2A 1KGYA 3EHKA 4ATFA 3NNFA 3JD72 5FP7A 3S30A 1B09A 5FPLA 4A3ZA 1X36A 1YYNA 2VZ3A 4RL7A 1V6OA 3SCHA 4RN5A 2P6HA 1V0AA 3OCPA 5C9AC 5LZ6A 3IN9A 3AKPA 4XFBA 5C3PA 4C1XA 2HJIA 4LE3A 5JXIA 1FAYA 3TEZA 3JB4C 5FTTC 3ILNA 3VBHB 4C0HA 1FPN3 3WZ1A 2JG8A 2BGOA 2RS32 1DZTA 4XIKA 3VB9A 4IV3A 1QMJA 4EN6B 5JOZA 3SLIA 1G9AA 1AX2A 1QDOA 2W92A 2YROA 1LRHA 5A1AA 1XRUA 1CR7A 4TZDA 2W1SA 2GALA 1YQ5A 3OGSA 2FMDA 4XZPA 4L92A 3T0AA 1IG0A 3KZ4C 1LOBA 2D6LX 2WS93 3A21A 4WM7B 4YNIA 5FLIA 1OF3A 2Q8CA 4EQVA 1Q8PA 1MS9A 3ZN4A 2GH8A 2XJQA 3VZMA 2W91A 4OMCA 5A6YA 2BUKA 4Y26A 2JICA 1SBEA 1XNDA 1UYZA 5EPAA 3ABZA 3WDYA 1NZIA 3S7IA 1F8VA 1TE1B 3E6BA 4NHYA 1EY2A 1TNFA 3GBWA 2ZGTA 2DVFA 5SV5A 1NCQA 1Z7S2 3LOIA 2XKPA 4GB32 2GZWA 1H2LA 3GM8A 3T2TA 1S0FA 4FXKB 2ZX0A 5FYTA 4LLOA 4Y1VA 4AI9A 4M00A 5EV7A 5C3QA 2R32A 2VMFA 5KHIA 3H7YA 1HIXA 2PMWB 4O7XA 4XF4A 1C3HA 3FE5A 3T4HB 1VBC3 2KXLA 4J6GA 3SISA 4AEDB 1US2A 2VNVA 3POEA 4HPKB 5LASA 1HXS1 1MS8A 1UN1A 1PGL1 1NQJA 1W6OB 2D5FA 2D40A 2W68A 3KQRA 4PI0A 4WV8A 5LK5A 1GZTA 4PHZA 3UKVA 3VBUA 4XJ9A 5FYYA 3ZXGA 1G9BA 4ZZ8A 4CZSA 5L36A 3GBGA 2WA3A 1I5ZA 2QQPA 1AHSA 2ZHMA 5LBEA 2C0ZA 5F3IA 1RITA 4ET7A 2ZXQA 1PK6B 5F3EA 4AF9A 1JYNA 3MV01 2NMOA 1DQ2A 1H8TB 3WW1A 3ZFFB 2DCJA 2BTVC 3GGLA 1JYVA 4AZZA 3K4ZA 4HMZA 5DZGA 3WVJA 1PNFA 5K8SA 1IG3A 1GZWB 3T09A 5FDBA 1VALA 1EYBA 2D6OX 1PGW2 1WWYA 4BQ2A 1AVBA 2A3XA 4QPIA 4FTEA 3ZYGA 1UY0A 2XJTA 4QAWA 1GANA 3ES1A 2D3PA 2VXRA 5A1LA 5JPNB 1O3TA 1KFXL 1O91A 1NXD1 2P3YA 3I2JA 3KCYA 4ITCA 2P6CA 4UWDA 5JR2A 4P14A 1JZ7A 4P9IA 5LCWL 5LEKA 2ZGQA 4YVSB 4FTSA 5ACA1 5A3OA 1UL9A 4OHZA 1O8PA 5FXWA 4Z1VA 1GU3A 2VAUA 1HXS3 1HV1A 2Q30A 3K51A 1RGSA 1OKQA 1UQXA 3B7MA 1FOD2 2I45A 4YW2A 1WCQA 2IC1A 2O14A 2WFF2 2RM22 3NAPB 3AP9A 3NRUA 1M06G 3Q8CA 2NN8A 4IXLA 1QJEA 3B69A 3P1IA 2Y64A 3RZJA 2F4LA 1KDMA 5HCHA 3H1MA 5CIRA 3HQXA 4F3JA 2B46X 3NNGA 1DHKB 2WJSA 1QOTA 2ZMNA 3EQEA 4MADA 1VBA3 4XPVA 2VD7A 3WCSA 1PM4A 4NVPA 3K4AA 2WNVB 5BNOC 4NHMA 3K4DA 2IXHA 4PBOA 1AJKA 1CZVA 2O1QA 3I2KA 2EIEA 2Z2SB 1S55A 4TXWA 2Q1ZB 5F5AA 4ZXKA 2QQJA 3KMHA 5A7WB 1XSQA 1QNWA 1J59A 3RYRA 3E6CC 3MF6A 1LU1A 1EV13 3KF5A 1K5MC 5EIYB 3UYJA 5A3LA 1KD7A 4AVCA 3B9IA 4LMFA 4J1XA 5C9AA 2PXJA 1NCQC 1J84A 2VZRA 3JD73 5IW0A 2MEV3 4CA9A 3FLRA 2A75A 4C91A 4CU6A 3O1MA 4ZPIA 1ZBA3 4HVRA 4LOSA 1YUDA 2W0XA 5IJRA 4AAPA 3MW3A 4GXLA 2VCAA 1E5RA 4V2VA 2QJVA 2YYOA 3B01A 3RGBA 1CX4A 1MQTB 1QNYA 4LA3A 1YFYA 3WQ7A 4UOJA 1PO13 4XE9A 3H7JA 5EZWA 1UYPA 1HRI3 2BVVA 4PDWA 4ARYA 3BU7A 2VUAA 1BYHA 5CA6A 5JOWA 4Q1RA 2XUEA 3PUIA 4XETA 1IQAA 4Q0SA 1O4YA 2E33A 3RFRA 2OS2A 1POV0 4ES9A 1JH5A 2PQQA 2CGNA 4YZ1A 2PHXA 4M0HA 2R062 3A0NA 3E5XA 2PHRA 1H9PA 5F39A 4PCRA 2R49A 4CXXA 3U4SA 1SBDA 5FBJA 2JWPA 3POSA 3ZDSA 1OOPA 2X10A 1FX5A 1SACA 4MO3M 2BVBA 3T0BA 1LOAA 5FK7A 3U10A 3I2OA 3R4DB 1IKQA 4RFRB 3OB8A 1VPHA 1SDWA 2ZGNA 4QB1A 5JCTA 5JIAA 3NJYA 3KD4A 4YZ2A 4UFLA 4YG0A 2HEYF 2UWBA 2Y0OA 1DGRN 1UX6A 1OPOA 1SPPA 1WD3A 3GZAA 5F8PA 2V72A 3R6SA 5JDBA 5CFCC 1WA4A 3USUB 1PX3A 1ZX5A 4N43C 5DUVA 1CPMA 1V6IA 2Q1MA 3NW4A 2R071 3ROUA 3WW3A 2W08A 4B7EA 2QQOA 2R1BA 2RR13 3ZXDA 2VOWA 1DQ4A 1GQPA 5JXJA 4BCUA 1MS5A 4W4ZA 1XYNA 4RFT0 5C8CC 2VQTA 2ETEA 4YVWB 5FZFA 3ZXFA 4TYSA 5FYUA 4JKLA 5FP4A 2IXLA 2D98A 3D6EA 1VBD2 3MLLA 1PMIA 4YW1A 3ZVXA 4RA0A 4XFAA 2RVAA 3J9SA 3SEPA 2HLEA 3WDTA
chains in the Genus database with same CATH topology
5FZOB 5A3PA 3K2OA 4GD4A 4QXCA 2OT7A 2OQ7A 3ZPOA 5F3CA 5IVVA 2VD7A 4QX7A 4Y4RA 4D6RA 5FY7A 5FZEA 3PTRB 4Y33A 4UF0B 5FXVA 4CCKA 4D6QA 5FZ8A 3OPWA 3PUSA 5A3TA 3RVHA 3AVSA 5FUPA 4BXFA 5F5AA 5IVEA 5FYIA 5A7WB 5LWBA 2WWUA 5F32A 4BU2A 2W2IA 5FJKA 5FZ6A 2Q8CA 3LDBA 2OX0A 3UYJA 4TN7A 3PU8A 4EZ4A 5IVBA 3ZLIA 5FY0A 2PXJA 5FZOA 2YPDA 4LIUA 5IW0A 3N9OA 4BISA 5FZBA 5FYZA 5IVFA 4AAPA 4LITA 5FYSA 4IGOA 4DO0A 4V2VA 4HONA 4UF0A 5FY9A 5FYVA 4CSWA 3OPTA 5A3NA 5FYBA 3DXUA 3PDQA 4CCNA 5FYHA 5FYTA 4C8DA 4GJZA 5ANQA 5FY8A 5FYMA 5FY1A 4HOOA 5FZAA 5A7SA 4AI9A 3KV5A 4XDPA 4E4HA 5FPUA 4QXBA 5FP9A 5FZDA 5FXZA 2YBKA 5FPBA 5IVJA 2P5BA 2XUEA 5F3GA 4LIVA 5F37A 5F5IA 2YBSA 2OS2A 2WWJA 4LXLA 5IVCA 2YBPA 4Y3OA 4QX8A 3N9NA 3PUQA 5FJHA 5FYYA 5FXXA 4ASKA 3AL6A 5FZIA 3AVRA 5FZ1A 5E6HA 3KVAA 5F39A 5FZCA 5FZGA 5LY2A 4GJYA 3U4SA 4NUBA 5FBJA 5A3WA 5CEHA 2YU2A 2GP3A 5F3IA 5FZ7A 3U78A 5F5CA 5FZ3A 2YU1A 5F3EA 2OQ6A 4EYUA 5LW9A 3N9MA 5FY5A 1VRBA 5FP8A 5A1FA 5K4LA 3PU3A 2XDVA 5KR7A 5FV3A 4CUGA 5FZ0A 3DXTA 4XDOA 5FY4A 3NJYA 4EZHA 3N9LA 3KVBA 2XXZA 5A7QA 5FWJA 4DIQA 5FPVA 4QXHA 5IWFA 2GP5A 5F2WA 3KV6A 5FZLA 3N9QA 5FZKA 5A7OA 2Q8DA 5A1LA 5FP3A 5LY1A 4GAZA 4CCJA 3AL5A 5FZHA 4V2WA 5FZ9A 4D6SA 4QU1A 5A7NA 5FYCA 5FZ4A 5FXWA 5A7WA 3LD8A 2Q8EA 5FZMA 5FP7A 5FPLA 4CCOA 3PUAA 5FZFA 5FWEA 5F2SA 4CCLA 4CCMA 5IVYA 5FYUA 4IGQA 3N9PA 5FP4A 3K3OA 5A80A 5FPAA 5A7PA 3KV4A 4IGPA 5ISLA 3KV9A 4URAA 3PURA 2XMLA 4QWNA 3K3NA 5FUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZO B;  5A3P A;  3K2O A;  4GD4 A;  4QXC A;  2OT7 A;  2OQ7 A;  3ZPO A;  5F3C A;  5IVV A;  2VD7 A;  4QX7 A;  4Y4R A;  4D6R A;  5FY7 A;  5FZE A;  3PTR B;  4Y33 A;  4UF0 B;  5FXV A;  4CCK A;  4D6Q A;  5FZ8 A;  3OPW A;  3PUS A;  5A3T A;  3RVH A;  3AVS A;  5FUP A;  4BXF A;  5F5A A;  5IVE A;  5FYI A;  5A7W B;  5LWB A;  2WWU A;  5F32 A;  4BU2 A;  2W2I A;  5FJK A;  5FZ6 A;  2Q8C A;  3LDB A;  2OX0 A;  3UYJ A;  4TN7 A;  3PU8 A;  4EZ4 A;  5IVB A;  3ZLI A;  5FY0 A;  2PXJ A;  5FZO A;  2YPD A;  4LIU A;  5IW0 A;  3N9O A;  4BIS A;  5FZB A;  5FYZ A;  5IVF A;  4AAP A;  4LIT A;  5FYS A;  4IGO A;  4DO0 A;  4V2V A;  4HON A;  4UF0 A;  5FY9 A;  5FYV A;  4CSW A;  3OPT A;  5A3N A;  5FYB A;  3DXU A;  3PDQ A;  4CCN A;  5FYH A;  5FYT A;  4C8D A;  4GJZ A;  5ANQ A;  5FY8 A;  5FYM A;  5FY1 A;  4HOO A;  5FZA A;  5A7S A;  4AI9 A;  3KV5 A;  4XDP A;  4E4H A;  5FPU A;  4QXB A;  5FP9 A;  5FZD A;  5FXZ A;  2YBK A;  5FPB A;  5IVJ A;  2P5B A;  2XUE A;  5F3G A;  4LIV A;  5F37 A;  5F5I A;  2YBS A;  2OS2 A;  2WWJ A;  4LXL A;  5IVC A;  2YBP A;  4Y3O A;  4QX8 A;  3N9N A;  3PUQ A;  5FJH A;  5FYY A;  5FXX A;  4ASK A;  3AL6 A;  5FZI A;  3AVR A;  5FZ1 A;  5E6H A;  3KVA A;  5F39 A;  5FZC A;  5FZG A;  5LY2 A;  4GJY A;  3U4S A;  4NUB A;  5FBJ A;  5A3W A;  5CEH A;  2YU2 A;  2GP3 A;  5F3I A;  5FZ7 A;  3U78 A;  5F5C A;  5FZ3 A;  2YU1 A;  5F3E A;  2OQ6 A;  4EYU A;  5LW9 A;  3N9M A;  5FY5 A;  1VRB A;  5FP8 A;  5A1F A;  5K4L A;  3PU3 A;  2XDV A;  5KR7 A;  5FV3 A;  4CUG A;  5FZ0 A;  3DXT A;  4XDO A;  5FY4 A;  3NJY A;  4EZH A;  3N9L A;  3KVB A;  2XXZ A;  5A7Q A;  5FWJ A;  4DIQ A;  5FPV A;  4QXH A;  5IWF A;  2GP5 A;  5F2W A;  3KV6 A;  5FZL A;  3N9Q A;  5FZK A;  5A7O A;  2Q8D A;  5A1L A;  5FP3 A;  5LY1 A;  4GAZ A;  4CCJ A;  3AL5 A;  5FZH A;  4V2W A;  5FZ9 A;  4D6S A;  4QU1 A;  5A7N A;  5FYC A;  5FZ4 A;  5FXW A;  5A7W A;  3LD8 A;  2Q8E A;  5FZM A;  5FP7 A;  5FPL A;  4CCO A;  3PUA A;  5FZF A;  5FWE A;  5F2S A;  4CCL A;  4CCM A;  5IVY A;  5FYU A;  4IGQ A;  3N9P A;  5FP4 A;  3K3O A;  5A80 A;  5FPA A;  5A7P A;  3KV4 A;  4IGP A;  5ISL A;  3KV9 A;  4URA A;  3PUR A;  2XML A;  4QWN A;  3K3N A;  5FUN A; 
#chains in the Genus database with same CATH topology
 4AVA A;  1JYC A;  4GD4 A;  4QXC A;  4P9J A;  5JUV A;  2BNM A;  2OQ7 A;  2DCZ A;  1JBC A;  1W9W A;  1UYY A;  1YEW A;  4Y4R A;  3VDC A;  1G7Y A;  2VOX A;  3FBY A;  4OZO A;  1MQT C;  5G05 L;  2D6P A;  3PVN A;  3WEZ A;  4Y33 A;  4CU9 A;  5HBA A;  2D43 A;  2WLP A;  3V0A B;  4HVO A;  1FMD 1;  1X33 A;  3VBF A;  1SFY A;  4FOV A;  3GJA A;  4FPH A;  2VQ0 A;  1AYN 1;  4HK9 A;  2JG8 B;  2EA7 A;  5FYI A;  5A33 A;  1QU0 A;  1XE7 A;  4AED A;  3HIF A;  4Q8K A;  1W2T A;  2Y6G A;  1LKN A;  3UJQ A;  4EWE A;  1YI7 A;  4EN0 A;  3PIG A;  1N1Y A;  4NJ4 A;  4Y1Z A;  2DVD A;  3R0R A;  1QQP 3;  4GH4 A;  2HWE 1;  1US3 A;  2Q1F A;  2DBN A;  2X5I C;  4KU7 A;  2WDB A;  1H1I A;  2JDY A;  2ZEX A;  4RQP A;  2BEO A;  5GM0 A;  4SLI A;  4GB3 1;  2HWB 3;  1AYM 3;  4LIT A;  4R9D A;  1GZW A;  4XQ4 A;  2BZD A;  1O3S A;  4Q4Y 1;  4IET A;  4CP9 B;  5K0U C;  2IFR A;  3TAY A;  4B1M A;  1ZRD A;  1RIN A;  3GNE A;  1DF0 A;  3WG2 A;  4UFJ A;  5EHD A;  4CCN A;  4QKB A;  1D4M 1;  3K75 B;  3RWN A;  4C8D A;  2LRP A;  3J8F 1;  5FYM A;  1HQW A;  4K6B A;  2ARC A;  4ZHN A;  2FMY A;  2EXK A;  1WLW A;  3ZFF A;  3AJZ A;  2RR1 1;  4IEV A;  4ZXE A;  4ATE A;  5FPB A;  3VBU B;  3O1O A;  1POV 3;  5F3G A;  4URT A;  2DTW A;  1OD5 A;  4E9K A;  1BJQ A;  2A5Z A;  4JHZ A;  2BBV A;  1ZRF A;  2XLG A;  5BNP B;  3ZDV A;  2H6B A;  2QBX A;  4LUK A;  4Q4W 2;  1BBT 2;  2G9G A;  1SG3 A;  2W1U A;  3I8T A;  1R1A 1;  5D8A C;  2VBP A;  3CNA A;  2IXK A;  3MID A;  3BOW A;  5I8T A;  4PDW C;  5AC9 3;  3DPR C;  2YU2 A;  3NV3 A;  5F5C A;  5L9R A;  1OLQ A;  1W2U A;  1YQC A;  2E7T A;  2VZQ A;  1VRB A;  2ZHN A;  3WF0 A;  2E63 A;  3BOD A;  4GKY A;  3OBT A;  2ATF A;  1Q43 A;  2D3R A;  2YV8 A;  4DS0 A;  5JLV A;  2XDV A;  2VY0 A;  5JXH A;  1HX6 A;  2VMC A;  4HT1 T;  2VZO A;  2MNG A;  1MPX A;  3WY6 A;  5FY4 A;  1H0B A;  3EXU A;  1UXZ A;  4N7U A;  4FPC A;  3SH5 A;  5C8C A;  3SCF A;  2YFU A;  2XJR A;  5IWF A;  2BOI A;  1H6Y A;  3KV6 A;  3PMS A;  4OUE A;  3ASI A;  4B4R A;  1UIK A;  4NMI A;  1W6O A;  3N7J A;  1WMX A;  2NYY A;  5EXO A;  4CCJ A;  5IYY A;  2WQ8 A;  1HRV 1;  5JVV A;  3WUD A;  4UW6 A;  1WBF A;  3VLB B;  4EV0 A;  4ES8 A;  3N7M A;  3BTA A;  4MZU A;  4COZ A;  1L7Q A;  1J3P A;  4CEY C;  5T5P A;  3IDA A;  1Y7B A;  2Y8K A;  3RI9 A;  1VBE 2;  3D4K A;  2GAU A;  3AXE A;  5CYY A;  5HV4 A;  2R7E B;  1UPI A;  1W03 A;  4LBM A;  4N53 C;  3DPR A;  4H14 A;  1WGP A;  5FPA A;  5E16 A;  3AKR A;  3KV4 A;  5E88 A;  1HRV 3;  3KV9 A;  2C26 A;  3SH4 A;  2A1X A;  1YQ2 A;  1KFU L;  1A8M A;  4R9C A;  2VOT A;  1EV1 2;  3KT4 A;  2B7Y A;  1RYY A;  1DIW A;  1XNB A;  2V09 A;  3KF3 A;  4EE2 A;  4LHK A;  2HEW F;  5D2A A;  2C9K A;  2WT2 A;  2JJ6 A;  5FPZ A;  2I2S A;  1NXM A;  4HPK A;  2HBT A;  3III A;  3M3E A;  3ZN6 B;  5K7P A;  1O4T A;  1H30 A;  1AXZ A;  1IGO A;  1OD3 A;  4BYY A;  3ZFG B;  3Q8B A;  2UUR A;  3U11 A;  1KXG A;  3RJ2 X;  1JU3 A;  5FMD A;  1UZV A;  4QGM A;  4AVV A;  4QQ2 A;  3OGR A;  3TN9 1;  2R16 A;  5JR7 B;  3ZYP A;  4GWN A;  2VL4 A;  4J1W A;  4XW3 A;  2D97 A;  3I2D A;  2JG9 C;  3JBG 1;  1L3J A;  1ASJ 2;  1SLC A;  4WM8 C;  1SEF A;  1ZBE 3;  2XGX A;  2LM3 A;  4Q4X 1;  1WMF A;  1UD1 A;  4QDS A;  3SKJ E;  1D4M 2;  2WBK A;  2QFE A;  3AMH A;  5B4X A;  1WMD A;  4KL1 A;  5B2G B;  1Z7S 1;  1A78 A;  2VW0 A;  4RR3 C;  1S2B A;  4UF0 A;  2UWC A;  3WP4 A;  3GHM A;  1IKP A;  1CIY A;  3IM0 A;  2ZPX A;  1RUF 1;  3CL1 A;  3WCR A;  5BNO A;  3THT A;  5KXC A;  1ZBA 2;  1D4M 3;  2DVG A;  2KM2 A;  4M01 A;  3VKO A;  1RXF A;  2VW1 A;  2WT0 A;  5FZA A;  4DXZ A;  4CEW B;  4YM3 A;  2OYZ A;  1CN1 A;  2WO1 A;  4OUM A;  5ACA 3;  4LTA A;  1Z78 A;  1UMZ A;  3AZW A;  4I30 A;  1EAH 3;  5JOX A;  1LHU A;  3AFK A;  1SFN A;  1DQ1 A;  5T54 A;  1ODN A;  2HWB 1;  3EYP A;  4EN7 B;  1LR5 A;  3MFC A;  2YBS A;  4P5H A;  1YIP A;  4MGZ E;  1IPS A;  2QTW B;  2XVG A;  5A3M A;  4E4D X;  4IES A;  2RE9 A;  1X9T A;  2QZ2 A;  1QH7 A;  4G9S B;  3I2G A;  3AMN A;  3VHP A;  2DUP A;  4ISQ A;  2WNU A;  1S0I A;  2VUL A;  1AXK A;  3ZSK A;  5FZI A;  3TEX A;  3WHU A;  2ES3 A;  5FZ1 A;  4B4P A;  3E1F 1;  4W6W A;  5LY2 A;  2C24 A;  5JZG C;  1LHV A;  4OFG A;  1EAH 1;  5CG8 A;  3U78 A;  2XWJ B;  1WW7 A;  2Y6K A;  4GAL A;  5HI0 A;  2QQU A;  4YAR A;  4FI9 A;  4IV3 C;  1GNY A;  3MLJ A;  1SPP B;  4CP0 A;  4EWD A;  1DCS A;  4BK4 A;  2VBB A;  5A6Q A;  2PAM A;  4YGC A;  3CU7 A;  1OFN A;  4NWV A;  3KLS A;  1LOD A;  3PTY A;  4Y4Y A;  4QXK A;  4AQS A;  1DGR A;  4LO4 B;  4BA6 A;  2ZGP A;  4IE7 A;  3OF1 A;  5L9B A;  2E6V A;  3CIH A;  1HB3 A;  1S1A A;  4JC1 A;  1JZ4 A;  4NIG A;  4XQD A;  1YJK A;  3OY8 B;  3SCG A;  4GMP 0;  4Q0U A;  3ZFG C;  1GFF 2;  1C8N A;  3O1S A;  5FYC A;  1UZ0 A;  4FPK A;  4PQQ A;  5GLU A;  4LO5 B;  3WXP A;  1HQL A;  3AYA A;  5K0U A;  2WRA A;  1UCX A;  3PUA A;  1QJY 1;  2R06 3;  5DAB A;  5F1R A;  5IAT A;  4FPY A;  1YXW A;  2JXA A;  4RD7 A;  3H8R A;  3I59 B;  2NPI A;  5DUX A;  3BTZ A;  1MVE A;  1WW5 A;  2WZR 2;  3IDB B;  3PUR A;  1GWK A;  3B94 A;  3UK9 A;  5KWR A;  3VBF B;  1JYT A;  3WNM A;  3I2I A;  4ONU A;  4RS5 B;  1HRI 2;  2JKX A;  3MZH A;  3ZPO A;  2PEL A;  5D8A B;  4CUA A;  3MFA A;  1W06 A;  4XF0 A;  1PO1 2;  4I0B A;  4AQT A;  3LKJ A;  4H3W A;  3ZX7 A;  3HR9 A;  5A33 B;  4CCK A;  1G86 A;  4AEM A;  3WNO A;  1NZC A;  2ET1 A;  1ENS A;  2BW8 A;  3OPW A;  1LOF C;  4OI2 A;  5GLZ A;  3ZKU A;  4A7Z A;  4MLO A;  1TMF 1;  3LDR A;  4NO4 A;  3BCW A;  5FUP A;  2XG3 A;  5LBB A;  1GQH A;  2ZAC A;  5DQ0 A;  5I0R A;  4FFG A;  1LHO A;  2H0V A;  2RS1 3;  3NMB A;  1FMD 3;  1RC6 A;  5F32 A;  4BQX A;  4FOW A;  4DOU A;  1C8M 2;  4LKD A;  1LUL A;  4OZX A;  3PU8 A;  1VBE 3;  3I7D A;  1DQ6 A;  5IVB A;  4IE5 A;  2ZCW A;  2NLR A;  4HFS A;  3VDD C;  3R4S A;  3GF6 A;  5FY0 A;  4AFD A;  4AHZ A;  4CDX A;  5AFB A;  5J1X A;  3VN4 A;  2FHR A;  1T6G C;  2VJX A;  1VBB 1;  4FQ4 A;  2DVA A;  2VXJ A;  4KGQ A;  1E57 A;  1GYK A;  4GA9 A;  5DXD A;  4AI8 A;  5KHG A;  2KA3 A;  4GWJ A;  3BI3 A;  3GXU A;  3F95 A;  4HON A;  5FIX A;  5FY9 A;  4UAP A;  3P3N A;  1F9K A;  3UGG A;  3QOP A;  1XE0 A;  3OSD A;  1MEC 1;  3HOB A;  1VR3 A;  4KQ7 A;  3S57 A;  2OA2 A;  3WP3 A;  4EWA A;  2Z69 A;  5FY1 A;  4DB5 A;  4QKN A;  4I2O A;  2JX9 A;  4LBN A;  2AEZ A;  2PLV 2;  3HQU A;  4B3N A;  1YJL A;  4NN0 A;  4AI3 A;  1WLT A;  2QKD A;  4N53 A;  4FPL A;  5F5I A;  4DY3 A;  3R4U A;  4UI9 L;  4UBG A;  1RTV A;  1NT0 A;  4BQ5 A;  1Q8Q A;  4K9S A;  5CKN A;  2V4V A;  2Y33 A;  1QDC A;  3M70 A;  1XNT A;  5IK4 A;  1PK6 A;  1OUR A;  2D93 A;  4GWI A;  4LO6 B;  4UYB A;  1OH3 A;  1R08 1;  2ET7 A;  1UY2 A;  2EXH A;  2ZZQ A;  2A6V A;  1NLQ A;  2ZAB A;  4UW5 A;  1CON A;  2GP3 A;  2JEC A;  3PIJ A;  1NQD A;  3N9M A;  1LB2 A;  4JZR A;  1UAI A;  4Q0Q A;  2R0H A;  2YC2 A;  1U5X A;  2HWF 1;  3B5L B;  3H3L A;  4NRO A;  1XC6 A;  5C9A B;  1B35 B;  5JXG A;  4XDO A;  1O4Z A;  3CJX A;  1L7R A;  2K46 A;  1UPS A;  3SKV A;  2BGP A;  4OCT A;  3J26 N;  5AVP A;  3DUI A;  5A7Q A;  4ARX A;  5KC6 A;  1RUD 3;  2YMZ A;  2ZAA A;  4QPY A;  4R4X A;  5FUI A;  1UOG A;  4CDQ B;  5BPX A;  3U37 A;  3SNM A;  2UY9 A;  1ASJ 1;  3KB5 A;  5AC9 2;  2JIJ A;  3GCX A;  3AYE A;  5C3R A;  3FJS A;  2ZA9 A;  4IW3 A;  2UYB A;  2VVF A;  5DAW A;  5FRA A;  5C5U A;  3BOP A;  5FOJ B;  2VNO A;  4BM8 A;  4FPE A;  1AL2 2;  4CCM A;  3MBW A;  3HEI A;  4CP9 A;  3CLP A;  3IBM A;  3GJB A;  2VZU A;  3VBR C;  1YWK A;  4CCD A;  4LBQ B;  1DDL A;  2GC1 A;  5EYX A;  3AZZ A;  1QGL A;  1FMD 2;  4XBQ A;  5A7P A;  4AFC A;  4EN9 B;  2A3Y A;  1ZRC A;  3HNY M;  3K48 A;  4ORF A;  2BQP A;  1QXJ A;  2W5F A;  1W8H A;  3ACL A;  5FUN A;  1DZR A;  4AAX A;  3VBU C;  1Q56 A;  2P4E A;  4A4A A;  3NKT A;  3ATG A;  5AVA A;  4ZU7 A;  1RUI 3;  1O3Q A;  2G1M A;  3V56 A;  5T5J A;  2XH6 A;  3MIC A;  3HNB M;  4A41 A;  3C7F A;  2WNU C;  3DL3 A;  1XNK A;  4K1Y A;  4BQ3 A;  1PIV 1;  4JCK A;  2ZGR A;  3K77 A;  4R9A A;  1MZ6 A;  5FZ8 A;  4BXF A;  1RUD 2;  1ND2 C;  1N1S A;  2GSY A;  4CDU B;  2UU8 A;  5LWB A;  3VZJ A;  4XBL A;  4YVW C;  1TQ5 A;  1JYW A;  5D21 A;  3OGJ A;  1MS0 A;  1DYO A;  4NHL A;  2W39 A;  4NRQ A;  4CDW A;  1LES A;  1RMU 1;  2ARE A;  1KDK A;  3I2F A;  4PJY A;  4Y1U A;  1LHW A;  4UW4 A;  3TBD A;  3UES A;  3CZJ A;  3VD5 A;  1ENQ A;  5C7G A;  5JWP A;  1RUF 2;  3H3U A;  3O5S A;  4QX1 A;  1LGC A;  2ZEW A;  4AEK A;  4CSW A;  2CL2 A;  1LGB A;  2RDQ A;  3IKW A;  5EYY A;  5FYB A;  3U14 A;  4P00 B;  1CAU A;  1VBB 2;  5I0U A;  2D6K A;  5FCC A;  2JD9 A;  1S2E A;  1G8W A;  2BWC A;  5C3O A;  3OUI A;  1UIJ A;  2K9Z A;  1GOG A;  2BP6 A;  1COV 3;  1UF2 C;  4YWA A;  3HMY A;  4JQR A;  1GV9 A;  1QY4 A;  3BYW A;  2Y60 A;  2E7Q A;  1H2K A;  3N36 A;  1LHN A;  4FT8 A;  5AFE A;  2YB7 A;  4BHP A;  2P3J A;  2ZKN A;  5BYN A;  3WDU A;  5GLV A;  3D82 A;  2RJK A;  2X5I B;  3T0D A;  1TG7 A;  4GMP 3;  2XWB B;  5DAQ A;  4FCA A;  3AVR A;  3V64 A;  1CPN A;  4XDQ A;  4Q1P A;  2BBA A;  3N3H A;  1C1F A;  3FFQ A;  4Q4V 2;  3KHB A;  1AYM 2;  3H42 B;  5CEH A;  1GBG A;  1RUG 2;  1HLC A;  3KT7 A;  3LE0 A;  3OY8 A;  1S0B A;  4IV1 A;  4LO7 A;  1F2N A;  1OA3 A;  4QX5 A;  5FZ3 A;  5IT6 A;  1AX1 A;  1J83 A;  2H6C A;  1GSL A;  2OPW A;  4UBH A;  4UT5 A;  3S5Q A;  3VKN A;  3NAP C;  1NE6 A;  4NII A;  3PU3 A;  3IB3 A;  1NX9 A;  1OT5 A;  4QKF A;  3URF A;  1L7L A;  4AEJ A;  3N4M A;  1BQP A;  4LE4 A;  3VDD B;  2GNM A;  3WF4 A;  1MQT A;  4TSV A;  2FDG A;  3QH6 A;  4L9B A;  4XJW A;  2RM2 3;  5T55 A;  1OC1 A;  4DIQ A;  1OLM A;  1WUV A;  2WYF A;  2P3K A;  2WNV C;  1J3R A;  4RHV 3;  3RPQ A;  3IDC B;  1MS1 A;  3LA3 A;  2WS9 1;  4IL7 A;  2W94 A;  2K0G A;  1LNS A;  5DN2 A;  1CZT A;  1JMU B;  1UU4 A;  1W2O A;  1Y9M A;  4J25 A;  1A3K A;  1GZ9 A;  1RVF 3;  1V6L A;  1YFX A;  2FBE A;  3MIF A;  4WVV A;  4AFM A;  4D6S A;  3TWI A;  3ELN A;  1Z0H A;  3NNM A;  4XTM A;  1O5U A;  4XAE A;  3O1U A;  5I91 A;  3I4I A;  5A32 B;  4H2A A;  3HT2 A;  2CDO A;  4P9Y A;  4S2F A;  4W8J A;  1H9W A;  1K3I A;  3I3E A;  3APB A;  5G04 L;  3ILR A;  4IND A;  4FBF A;  1YNA A;  5B4N A;  3U75 A;  4OI1 A;  2CYF A;  1JZ6 A;  3ZXA C;  3NV1 A;  1RUE 1;  1U5Y A;  2B39 A;  2XML A;  3K3N A;  4BOW A;  1PO1 1;  3IPV B;  1N1T A;  3WV6 A;  5H9R A;  4JGZ C;  1GQG A;  4OHW A;  1ZZC A;  5BNQ A;  1CAX B;  5HXM A;  2WSV A;  3UKT A;  1PM7 A;  1AJO A;  3AP7 A;  1QJU 3;  4LBK A;  3I59 A;  5FXV A;  2ZGO A;  4YYO A;  3HN1 A;  1H8T C;  1JOB A;  4QQL A;  4Q27 A;  5LBF A;  4A6S A;  5J3U A;  1BXH A;  1QHD A;  2WWS A;  4N9I A;  3WT3 A;  2BER A;  3DN7 A;  5FKC A;  4FSJ A;  2CWM A;  1D0H A;  2WWU A;  4L8Q A;  2XB6 C;  3TN9 3;  4DXT A;  1JUI A;  1D2S A;  1YC6 1;  3GZT B;  3H3Z A;  2A6W A;  1QJU 1;  2BU9 A;  3POJ A;  2CWS A;  2DFB A;  2IXI A;  2E26 A;  4KMQ A;  5DZE A;  3TYJ A;  2P1B A;  3MUZ 1;  2WII B;  3JQX A;  5C8W A;  2QQI A;  4JDO A;  3KQ4 B;  4AFA A;  3IPV A;  1MEC 2;  3QD6 A;  4LR4 A;  4MOA A;  4PIY A;  2DDU A;  1XXN A;  1WME A;  2HEV F;  2VEC A;  1RUJ 2;  3W9A A;  4Y24 A;  4E2S A;  1W6Q A;  4DUV A;  2EAK A;  1PGS A;  4QQP A;  3K46 A;  5JSO A;  4WM7 A;  2I74 A;  1XNC A;  4BQ1 A;  3UGF A;  2EIG A;  4HOO A;  3KHC A;  3WLU A;  4BWO A;  1DU3 D;  4M3C E;  4MGY E;  3UV9 A;  5FP9 A;  4JDN A;  4CUC A;  4Q8L A;  1AR8 1;  1LCL A;  3Q8F A;  3V0B B;  3JUU A;  5CFC B;  4Z2W A;  1D4V B;  1PVC 2;  4OMD A;  4NE9 A;  2MEV 1;  4Y3O A;  2JG9 B;  3ZPY A;  1TMF 2;  5CFD A;  1CAV B;  3ZFE A;  1AYN 2;  3WIN E;  4CP2 A;  4QM9 A;  2MHF A;  5FJH A;  3OEB A;  4NWW A;  1H2M A;  2XBO 3;  4U2A A;  2V4A A;  4XBN A;  1LED A;  1ZA7 A;  2QNK A;  3GZE A;  3D0S A;  3BIE A;  1CJD A;  2HWF 2;  3KGL A;  5IUQ A;  1O3R A;  3KS7 A;  2VBD A;  1EPW A;  5E1R A;  2V73 A;  4P08 A;  4QHZ A;  3ZMN A;  5I0D A;  2PAK A;  1OQ1 A;  3H9A A;  5IK7 A;  2YC0 A;  1OA4 A;  2WR9 A;  1K42 A;  4RGK A;  3GZU C;  1W8Z A;  1Y9G A;  4HK8 A;  4M4P A;  4XUO A;  1JOJ A;  5IK8 A;  2VUC A;  4AK3 A;  2JB4 A;  1NA1 C;  1V6M A;  2Y38 A;  2IXC A;  1S4C A;  2RM2 1;  1NCQ B;  1ZRR A;  1ZZ6 A;  1ULC A;  1W8F A;  2EID A;  3ES4 A;  3MHZ A;  2VVE A;  1NG0 A;  3N9Q A;  2BRT A;  4Y22 B;  5JSR A;  5KHK A;  4IV1 C;  5I0S A;  1C1L A;  2XJS A;  4QPI B;  1SQ4 A;  1T6B X;  4YW3 A;  1PO2 3;  2IVJ A;  4XJ8 A;  1G9C A;  3LB9 A;  4QU1 A;  3TNP B;  1SFP A;  4AVB A;  1OPM A;  5JI9 A;  2XHK A;  3POF A;  4AYU A;  4CCO A;  3RZG A;  3OG2 A;  3LPG A;  5ERL A;  2RMU 1;  4W6Y A;  1ULF A;  3N7L A;  2GDF A;  4LHL A;  1ZRE A;  1AYN 3;  2WFF 3;  5DDJ 1;  4I3G A;  5FMB A;  4LOR A;  4AI0 A;  1HDK A;  1NAE A;  2AAC A;  2Q5T A;  2QQW A;  2RJ2 A;  3M1H A;  2A7A A;  4QQH A;  4F7Z A;  3O14 A;  5A3P A;  1W28 A;  1EPZ A;  4OHV A;  3T3Y A;  4LT5 A;  2AYH A;  4XUR A;  3ZYI B;  3Q8A A;  4N90 A;  5GZC A;  1AYM 1;  1RXG A;  1IQD C;  2GN3 A;  4YM0 A;  3THD A;  1HJG A;  1AR8 3;  1W04 A;  1DLL A;  1VBC 1;  4NHX A;  1VAV A;  2JDZ A;  5KHH A;  3MDP A;  3VHN A;  4D6Q A;  5I93 A;  4UW3 A;  2J7M A;  2JE8 A;  4B29 A;  1V6J A;  3THP A;  1WW4 A;  2GC0 A;  1V6K A;  1V00 A;  4ASL A;  4TLG A;  1W2N A;  3LFM A;  3WQ0 A;  1MZ5 A;  2RDS A;  4LUM A;  4CXY A;  4NIA A;  2J1A A;  3NL1 A;  4FP3 A;  2VMI A;  5JZG A;  4Z92 B;  2IZW A;  3WP5 A;  4NIH A;  3BPS A;  2ID4 A;  3POW A;  1GUI A;  4CCE A;  3VKM A;  4XFH A;  4AHX A;  2WFP A;  5C33 A;  3DPR B;  3DYM A;  4E27 A;  4X8P A;  3LWC A;  1H2N A;  2E9Q A;  4KWU A;  4OHX A;  1AR6 2;  1RUH 1;  1N47 A;  1BZW A;  4LUL A;  2YC4 A;  5CVR A;  3VBR A;  5L19 A;  1OA2 A;  3AB0 A;  3DKW A;  3IIA A;  4DRR A;  5ABJ C;  1GIC A;  3WF3 A;  4XDP A;  3OJB A;  1NA1 B;  4WVM A;  3WUC A;  5C5T A;  5FMO S;  1I9R A;  4MV2 A;  3AJY A;  2P5B A;  2WZR 3;  4D8M A;  2TEP A;  1VRH 1;  2TUN A;  4MGQ A;  2ZGM A;  4YGE A;  4IEW A;  4M3C A;  3PVE A;  4BJ0 A;  3MIH A;  4YGD A;  4Z07 A;  4QHO A;  1Z7S 3;  3R05 A;  1K45 A;  1X8M A;  1ULO A;  1RJ8 A;  4N8M A;  1HB1 A;  2R07 3;  1LAJ A;  2ZOE B;  2R0F A;  4LHN A;  4CEY B;  2D44 A;  2XUM A;  1PMJ X;  2WNU B;  4JKK A;  3J7L A;  2DVB A;  1GNH A;  4Q0V A;  4WZF A;  3TNQ A;  1ULD A;  1VIW B;  4M3C B;  1BVV A;  2XBO 2;  1LU2 A;  4XAA A;  2W46 A;  4JVA A;  5BNN A;  1SLT A;  2OUH A;  1RUJ 1;  2V5Y A;  3ACF A;  1ZZ9 A;  3NQH A;  1S0D A;  4Z8B A;  1BEV 2;  2XXZ A;  3UKN A;  5BNN C;  1O59 A;  5IHR A;  2LTN A;  3CQO A;  4CUB A;  1FOD 1;  3N35 A;  1Q5O A;  1U0A A;  2RMU 2;  4V1P A;  4XUT A;  3J7H A;  1HXS 2;  5FMO L;  2RS1 1;  2F17 A;  2VW2 A;  1VMJ A;  2D3S A;  5K0U B;  2O0O A;  1KRI A;  5CAD A;  1PMH X;  3MV1 1;  1DGW A;  4XFC A;  2RS3 3;  3LD8 A;  2VNR A;  2X53 S;  4D7S A;  1U5Z A;  2WO2 A;  5FZM A;  2L9L A;  3AP6 A;  4BQW A;  4CPB A;  3WF2 A;  2QUO A;  1QIQ A;  3POI A;  1NE4 A;  3VBH A;  3KT1 A;  4CCL A;  4I02 A;  5FBZ A;  3K3O A;  3PJY A;  3OD4 A;  1LOE A;  4IEX A;  4KNC A;  4LPL A;  2CTV A;  2XVL A;  4I09 A;  4QD2 A;  3VBS C;  3WP6 A;  1RVF 1;  5CNA A;  1W6Q B;  5DAX A;  5CU1 A;  1PX4 A;  2VME A;  4HSL A;  1X7N A;  4IE6 A;  1C8M 3;  1GP5 A;  4XC9 A;  4Q2F A;  4QU2 A;  2R1D A;  3RWK X;  4BK5 A;  3H50 A;  2HWE 2;  1HQN A;  3HNM A;  2R04 1;  1BHG A;  4D6R A;  5LK7 B;  5LAT A;  1ND3 C;  3U1X A;  1AR6 3;  1OHF A;  2YZ4 A;  2QQV A;  1COV 1;  5H9S A;  1REE A;  2E53 A;  5KHJ A;  2WFF 1;  5JPM B;  1JZ2 A;  4AWD A;  1IS5 A;  1YO8 A;  1TMF 3;  5D1I A;  5IVE A;  5SV8 A;  1PVC 3;  2VTF A;  4AHY A;  4CTE A;  1DQ5 A;  4XF1 A;  5EWS A;  5FZ6 A;  4E8D A;  1VBC 2;  4IEQ A;  3E97 A;  1JU4 A;  1WD4 A;  3J4U H;  5C4W A;  1I6X A;  3ETQ A;  5ABJ B;  3WNK A;  4R8H A;  4Z82 A;  3HT1 A;  3I54 A;  2PLV 1;  2PA7 A;  2A73 B;  3LDK A;  2Y34 A;  1XYO A;  1ULP A;  4P9X A;  1KIT A;  1BVP 1;  4QPI C;  4Y1Y A;  4BIS A;  5KBF A;  4BMB A;  1UY3 A;  3A4U A;  4XZU G;  5IVF A;  4E4Z A;  2NP0 A;  2EVX A;  5JI7 A;  2G9Z A;  4NOT A;  3ZN6 A;  1VBD 1;  1DYP A;  1GWM A;  3J7M A;  1AR9 1;  3RMY A;  1QXR A;  2FZ1 A;  2YDE A;  5LB6 A;  3NWK A;  1UZW A;  3DXU A;  4Y22 A;  1S2K A;  5LA2 A;  1WLC A;  2WZP P;  1XJA A;  5C6C A;  5DAV A;  1VP6 A;  3QBQ A;  1F15 A;  2B45 X;  4E4H A;  1W6P B;  5A6Z A;  3RYP A;  2LS6 A;  1IHM A;  2YBK A;  3RZL A;  1AL0 G;  1SLB A;  4BIO A;  1R08 2;  4JTN A;  3TN9 2;  3L9J T;  4E2G A;  1LJ7 A;  4RGG A;  2ENR A;  5ANN A;  3RZZ A;  5FFO C;  4S2G A;  2WYS A;  1FNY A;  2YHJ A;  5CG9 A;  3S7E A;  3MIG A;  1PIV 2;  3BKZ A;  1DQ0 A;  5FZG A;  3VD7 A;  1V6N A;  2VQU A;  1UMH A;  4GH4 C;  1H1A A;  4NUB A;  3W5M A;  1RUF 3;  2YXS A;  2J1U A;  1PO2 2;  2EAA A;  3AYD A;  1CAW B;  4BLJ A;  2PHD A;  3FUQ A;  3KCX A;  1PZ8 A;  1K12 A;  3PL0 A;  1CAV A;  3ZFE B;  1IPK A;  5DZF A;  3O1P A;  2WIN B;  2C1F A;  4XF3 A;  3UT0 A;  3EJK A;  3PJQ A;  5FV3 A;  3WHT A;  3VGI A;  3U0Z A;  1CGP A;  2WO3 A;  1JXN A;  2X05 A;  5FOB B;  4M3C F;  2DBI A;  1YI9 A;  4O9E A;  2ZAH A;  2JDP A;  2X8K A;  5FWJ A;  3VBH C;  1W6P A;  5FO7 B;  3AZV A;  2CGP A;  1NCR B;  4JGY B;  1GP6 A;  1KJL A;  2E7A A;  3CEW A;  3MO4 A;  3GDB A;  2GP5 A;  3ILF A;  5F2W A;  5FPV A;  1IS3 A;  5FZL A;  5LA9 A;  1Q8V A;  3VBS A;  2WUH A;  1OVP A;  4P9G A;  4Q29 A;  1SBF A;  1WZX A;  2BFU L;  2SBA A;  3PUH A;  3ZXE A;  3IDE A;  5BUV A;  1TME 2;  2LUW A;  2ZZJ A;  4L0P A;  4YFZ A;  4K1Z A;  4HXC A;  2WLQ A;  5CKM A;  2GMP A;  3NKG A;  2CSG A;  5CB7 A;  3T2O A;  2RMU 3;  4HN0 A;  2HH9 A;  4CEW C;  2A3W A;  5GZE A;  4OI4 A;  2VMH A;  2LRO A;  4GWM A;  3N9P A;  2OPK A;  3OBA A;  5A80 A;  3RZM A;  1OLR A;  4ZKT B;  2B5H A;  2A6Y A;  2XJU A;  2AUY A;  5CFD C;  3H0O A;  4AW7 A;  3X29 B;  3ZIX A;  1AL2 3;  2ADD A;  2XBO 1;  3LEK A;  1YHF A;  3NV4 A;  3VD4 A;  2OW4 A;  3BIW E;  1RUG 1;  3JB8 A;  5JZG B;  5FZE A;  2OUJ A;  5I8Y A;  2VGD A;  4UF0 B;  1ONA A;  1J1L A;  2FCV A;  1JI6 A;  4JDM A;  4AI1 A;  4LKF A;  1Y3T A;  2UYA A;  4AE2 A;  4HSJ A;  3S0M A;  5C4W C;  4YM1 A;  3GBF A;  1UYX A;  2QQN A;  4PDW B;  5A3T A;  3AVS A;  2BFU S;  1BK1 A;  5DPN A;  2RHP A;  4DPN A;  3QAC A;  4DMI A;  3WQB A;  3MEP A;  5H9P A;  1N3O A;  5FLH A;  2ZGU A;  2Q4S A;  3M3O A;  1JYX A;  1COV 2;  2WL1 A;  2WQZ C;  4YW4 A;  3SIT A;  4LO8 A;  4ZZ5 A;  3OBR A;  3HJR A;  4AQ6 A;  1TME 1;  4EZ4 A;  3FFZ A;  1ND3 A;  4LNV A;  1O7F A;  2JKB A;  2RS1 2;  5FZO A;  1UU6 A;  2GME A;  1VBB 3;  2B4K A;  1CX1 A;  1CZS A;  3AXD A;  1S0C A;  5FMC A;  1R09 3;  1YCI A;  2HWF 3;  3W58 A;  2VC9 A;  2CY6 A;  3BPZ A;  4ERO A;  1EUT A;  1RVF 2;  4IGO A;  4NPM A;  4D7T A;  1W0N A;  5BV6 A;  1PK6 C;  3I3B A;  5HXV A;  2WNV A;  2R30 A;  3A23 A;  4RHV 2;  3RS6 A;  1O6U A;  1WCS A;  1RUN A;  1WA6 X;  2K2S A;  5IAV A;  1Y9Q A;  1H8T A;  1TZO A;  3I97 A;  2C5D A;  1BEV 3;  1SDD B;  5ANQ A;  5FY8 A;  1SLI A;  3IWZ A;  1ENX A;  1MR5 A;  1NLS A;  2NQY A;  4HBN A;  3ZSM A;  5K9Y A;  4YZ3 A;  4TLF A;  1GZC A;  2ADE A;  4OHY A;  2UY8 A;  5IVJ A;  2X5I A;  2WAA A;  1ST8 A;  3FLT A;  2PHW A;  2VG9 A;  4L99 A;  5IVC A;  2J22 A;  4P02 B;  4BZ4 A;  1HB4 A;  1KJR A;  5T3N A;  1MS4 A;  4DFS A;  4G3Y C;  1RUD 1;  1QH6 A;  1ND3 B;  1IOA A;  1VAK A;  3AL6 A;  1M4W A;  1XNA A;  2OKX A;  3D0J A;  1J58 A;  4LA2 A;  2P2K A;  1CVN A;  1RUE 3;  3AX4 A;  1MEC 3;  3VBO C;  2LW8 A;  2JDH A;  2CGO A;  1K5M A;  2R04 2;  2B8M A;  4FPF A;  3VBR B;  2VMG A;  4LBL A;  4FAH A;  1W90 A;  3LEM A;  5IFT A;  3S5A A;  3MGU A;  3OOX A;  4JGZ A;  4TTG A;  1EP0 A;  1YRZ A;  3JQW A;  4BQ4 A;  4ISR A;  1AXY A;  1GMM A;  1R1A 3;  1UOB A;  3BUC A;  3NJZ A;  4Q4W 1;  1UU5 A;  5A3U A;  3ZKY A;  2VU9 A;  3A7Q A;  4DRV A;  4DEV A;  3M3C A;  5FZK A;  2Q8D A;  1N3Q A;  2HWC 1;  5C70 A;  3VUO A;  2EIB A;  1OXC A;  1KEX A;  3AYC A;  1RHI 3;  3RG0 A;  1UWW A;  2ZX2 A;  4MGK E;  4Y20 B;  3RZH A;  3HQR A;  5FRE A;  4K20 A;  4RR3 B;  1Q3E A;  4H7M A;  2LAL A;  4ZS2 A;  4AR2 A;  4CPB D;  4O65 A;  4XMA A;  2CAV A;  1XPW A;  4XHB A;  2KD7 A;  4A44 A;  5EQU A;  4EJR A;  1PZ9 A;  3INA A;  4PF1 A;  1K5M B;  2PTM A;  1FV2 A;  4MHU A;  4YW7 A;  1XSR A;  4URA A;  2ZML A;  4CXW A;  2HWD 2;  4K8F A;  1XBF A;  1QJX 1;  4UFM A;  4FVV A;  1RUH 3;  1PVX A;  3ME2 A;  4B7K A;  3T4V A;  4KWK A;  3BU0 A;  1JZ8 A;  3OEA A;  4FO9 A;  4GH4 B;  1QJY 3;  2HWD 1;  4L97 A;  2VO5 A;  4CP1 A;  3ZSJ A;  3TOJ A;  1LOF A;  2FCU A;  5DDJ 3;  3L2Y A;  3ZFE C;  3THC A;  3OTF A;  4YPJ A;  3C3V A;  4FTB A;  4CU8 A;  2IXJ A;  4KBB A;  1A6C A;  2JIG A;  4IV3 B;  4RGA A;  2PFW A;  5ABJ A;  4NAM A;  3V0A A;  1ALY A;  4N53 B;  1HKD A;  2CDP A;  2DCT A;  2PLV 3;  3ACI A;  3FMG A;  4M0N A;  4TN7 A;  5I8S A;  3VZK A;  3WD5 A;  3WNN A;  2CNA A;  4HN1 A;  5EJZ B;  3ZLI A;  1ULE A;  1X82 A;  5BNN B;  1E5I A;  2R6Q A;  1GOH A;  1S0G A;  5H9Q A;  4IUG A;  3AZY A;  3J8F 2;  3L2H A;  4BDV B;  1XYP A;  2XLA A;  1STM A;  1ZYB A;  1W8N A;  5GLT A;  4YVS C;  1LTE A;  4DNY A;  1ND2 A;  2J42 A;  1KQR A;  1SZB A;  2BWA A;  4OLL A;  1CAW A;  1OFS A;  2GU9 A;  4XJA A;  5J7M A;  2XOM A;  3OUH A;  1RB8 G;  2D6N A;  4KG8 A;  4LBQ A;  3FHA A;  3WSO A;  1C28 A;  5JMO A;  2XJP A;  4Q5O A;  1DP0 A;  3ETP A;  3ZSE A;  2XVK A;  1OOP C;  4OUL A;  4FFH A;  1POQ A;  4KI5 M;  1XU1 A;  4MUV A;  3LGR A;  1W05 A;  5JMC A;  1CIW A;  1OUX A;  1JUH A;  1EAH 2;  1XE8 A;  2WZE A;  3DYP A;  3V65 A;  1C8M 1;  1F5J A;  1HRV 2;  1XU2 A;  4OYU A;  3VBS B;  4MGI E;  5F37 A;  1ODM A;  4FP2 A;  4NRP A;  1RIR A;  4PIX A;  1H4G A;  4GUL A;  2D5H A;  4QB6 A;  3FLP A;  2RS5 1;  1ZZ7 A;  1UX7 A;  5CKQ A;  1O5L A;  5FXX A;  5CFC A;  1D0G A;  3BTY A;  3JU9 A;  5FKB A;  5T50 A;  5E6H A;  1W8U A;  3A22 A;  3ZYR A;  5KXD A;  2JEM A;  4JQT A;  2YPJ A;  5C8C B;  2P17 A;  1ND2 B;  2ZX3 A;  3LSE A;  5FZ7 A;  1CAU B;  1RED A;  4QM8 A;  1DLC A;  1XB9 A;  2C4X A;  3G6J B;  1ZBA 1;  4FXG B;  1UZY A;  1GOF A;  5FPX A;  1TNR A;  3MF9 A;  1VB4 A;  1SLL A;  5EJ3 A;  3U07 A;  3KVB A;  1RUC 2;  4Q26 A;  3ZIW A;  4O61 A;  5L7O B;  4HZF A;  2JB8 A;  5BY5 A;  4QGN A;  2F6B A;  1E5H A;  4YM2 A;  3T1L A;  5A7O A;  3U4X A;  2DCK A;  3JCI A;  4O9G A;  1QWR A;  3AKT A;  4COU A;  3VZN A;  5APA A;  1T2X A;  3BTX A;  1ZA4 A;  3O0V A;  4XFG A;  3WNL A;  1HW5 A;  1SCR A;  5A7N A;  1OLM E;  5A7W A;  3V0B A;  4XJU A;  1F4A A;  2JG8 C;  2ZX4 A;  3MPP G;  1OUS A;  2DWR A;  2IVI B;  4MXW B;  2HWC 2;  1F35 A;  3H8O A;  4DY5 A;  1JOD A;  3C7O A;  1C4R A;  1DGL A;  2BNN A;  5J96 B;  5FO8 B;  4YG3 A;  5IVY A;  1NY7 2;  2Y6L A;  3LF7 A;  1PGW 1;  1W3X A;  1BCX A;  2XR4 A;  4JRL A;  1ASJ 3;  1P8J A;  2B9U A;  1H8V A;  2AEN A;  2VH9 A;  3POY A;  5DUW A;  5BXX A;  4XOG A;  2OT7 A;  2RS5 3;  4K3U A;  4XXP A;  3O7O A;  4Q4X 3;  3SMH A;  4CCC A;  1W9S A;  2QVS B;  5EP9 A;  3W20 A;  5LBC A;  3WW4 A;  4XFI A;  2ORZ A;  5FY7 A;  4BB3 A;  5CBL A;  3PTR B;  1W99 A;  3AK0 A;  4XQW A;  1POV 1;  2Z79 A;  1GKB A;  2QCS B;  4CDW B;  2VMD A;  2VTX A;  3IAP A;  2VTX J;  4YFW A;  4PLO A;  3VV1 A;  1KS4 A;  3AZX A;  2ZKL A;  3ZXK A;  4BXS V;  2NMN A;  3O12 A;  2WQ4 A;  1VBE 1;  3J8F 3;  1SLA A;  2PHT A;  1HV0 A;  2XLF A;  4BU2 A;  2ZX1 A;  2Z5W A;  4R4Z A;  3LDB A;  1OSG A;  2JE9 A;  3Q8E A;  3SC7 X;  1GR3 A;  3QLQ A;  4CEW A;  5L73 A;  1BKZ A;  2ZEZ A;  3HWJ A;  4KWJ A;  3IZO A;  5F9T A;  4MET A;  4UXA A;  4FFF A;  1U12 A;  2VCB A;  3HAG A;  3AM2 A;  3N9O A;  5D8A A;  2J1V A;  1BMV 1;  4RS5 C;  1FT9 A;  4B4Q A;  3TEY A;  4A42 A;  1AR9 2;  4XIO A;  4YW5 A;  1OKO A;  4GMP 1;  4XJZ A;  2AZ5 A;  2J1S A;  4CEY A;  1BBT 3;  4HKO A;  4IEY A;  1AF9 A;  3OPT A;  1BMV 2;  3H8U A;  5FLJ A;  3G7D A;  3T08 A;  1UY1 A;  3FN9 A;  4NR1 A;  3T30 A;  3DF0 A;  2AR6 A;  4FPG A;  2A6Z A;  3WNX A;  4LOT A;  1W6N A;  3KM5 A;  3VDD A;  4QPW A;  3RSJ A;  5A6X A;  3GCW A;  1ZZ8 A;  1LEM A;  1RUC 3;  4JGZ B;  2IUW A;  5IK5 A;  3T2P A;  2ZGK A;  2YBP A;  3ZYF A;  1OF4 A;  1RUO A;  2B9V A;  3E6D A;  2FDJ A;  1PNG A;  2QQL A;  3AMQ A;  1QKQ A;  3WG4 A;  5BNO B;  1A34 A;  2DUQ A;  3KVA A;  4Y5Z 0;  1YFU A;  2KR2 A;  3AKS A;  4YVS A;  4A7Y A;  4A6O A;  1W6M B;  2D6M A;  2RR1 2;  3D5O A;  5CAZ A;  5DMY A;  5KC5 A;  1X8E A;  2ZHL A;  5F3C A;  2OQ6 A;  2JDK A;  1RMU 3;  2DF7 A;  4AGG A;  4FOY A;  1VBA 2;  5A70 A;  4A45 A;  1QQP 2;  5K4L A;  3VHR A;  3AKQ A;  4LK7 A;  3D8C A;  5DAP A;  3UJO A;  2E51 A;  3WR0 A;  4B1L A;  3BVC A;  4HLT A;  1DYK A;  3ZYH A;  4Y5T A;  4AQ2 A;  2HYX A;  3MW2 A;  4NPR A;  1NLR A;  4CYD A;  3I3M A;  2VVD A;  1R1A 2;  3ACH A;  2MPF A;  2JD4 A;  4AGR A;  1D2Q A;  4ZU4 A;  3M3I A;  4PT6 A;  4XEZ A;  4AED C;  2JDA A;  2VUJ A;  2VQA A;  4HKW A;  4BME A;  4PI2 A;  1R1Z A;  5FP3 A;  1QJX 3;  1FXZ A;  4RR3 A;  1W6M A;  1PVC 1;  3CF6 E;  5FR3 A;  1Q8O A;  2WZ8 A;  4YZ4 A;  5FZ9 A;  2W3J A;  4S2H A;  1MZE A;  2OII A;  4C1W A;  4XF9 A;  1RL3 A;  1VJ2 A;  4YSF A;  1YQ8 A;  1SMV A;  4I3P A;  5GJ6 A;  5J98 B;  2FDI A;  4LK6 A;  4X6Q B;  1W3V A;  3HN3 A;  4NID A;  3RNS A;  3AMM A;  3KWV A;  4Q4Y 3;  1LEN A;  2FCT A;  2Z4F A;  1VBD 3;  3FL7 A;  4Y20 A;  2FDH A;  1LGN A;  4WM8 B;  2WA4 A;  3JZV A;  1AR7 2;  3H8X A;  1JN2 P;  1AZD A;  1VLN A;  4PBP A;  2W52 A;  2WAO A;  3NVC A;  4NAO A;  5FAX A;  3P3P A;  3NJX A;  1JZ3 A;  1W0O A;  2XJV A;  4MYE A;  3UGH A;  4CDQ C;  2D7F A;  1PO2 1;  1AUY A;  3LZZ A;  4QPG A;  3RQ0 A;  2ZHK A;  5J48 A;  3PME A;  4JKM A;  2BYV E;  4PIZ A;  3OGV A;  3FWE A;  4XHX A;  3MLK A;  1AR9 3;  2RS5 2;  4LHS A;  1YQ6 A;  3PUS A;  5CIS A;  1F4H A;  3RVH A;  1G6N A;  3T1M A;  1QJY 2;  1DG6 A;  1H6X A;  2JDU A;  1YFW A;  5BNP A;  4ASM B;  4MVT A;  2BGC A;  4ZON A;  2WN2 A;  5L7O C;  2VOK A;  2OX0 A;  4I01 A;  3M4F A;  2HWD 3;  2BV4 A;  3DEC A;  1CES A;  3LAG A;  2O8O A;  3M8L A;  4LBO A;  5CFD B;  1BK0 A;  1YLL A;  4K40 A;  1D7P M;  3O1R A;  2YG0 A;  2ILM A;  5FYZ A;  5F6K A;  2WN3 A;  2XL7 A;  2A71 A;  3VBO A;  2W47 A;  3AP5 A;  5T5L A;  4AHW A;  1FI2 A;  4LBQ D;  2BPA 2;  5FYV A;  4PQ9 A;  5A3N A;  3PDQ A;  4COV A;  3B3Q E;  4E8C A;  4RQP B;  4Q4X 2;  4Y5S A;  3AC0 A;  5J09 A;  4BQY A;  2G4I A;  1ACC A;  3EMR A;  3POG A;  5FPU A;  2XON A;  2RG4 A;  3FX3 A;  5ACA 2;  1RHI 1;  2PAE A;  3DGT A;  4MGS A;  3GYD A;  3H1Y A;  2Q8O A;  3B00 A;  3W59 A;  1S0J A;  4QX8 A;  2XL9 A;  2A6X A;  5L7O A;  2EF6 A;  3T2Q A;  3C8X A;  1J3Q A;  2BNO A;  2ZBJ A;  2OZ6 A;  4IE4 A;  1BEV 1;  1K5J A;  1HB2 A;  2EIC A;  3HBZ A;  4HAN A;  4MH0 E;  1JW6 A;  4G4F A;  4A2U A;  3OUJ A;  2DU1 A;  3MYX A;  2RS3 1;  2XHN A;  1AX0 A;  5LW9 A;  3C7E A;  4D7Y A;  4CVU A;  3EB7 A;  1FV3 A;  2GC2 A;  5A1F A;  4JX0 A;  1ZBE 2;  3LA7 A;  1QF3 A;  2ARB A;  1NCR A;  4HG6 B;  1RUH 2;  4JGY A;  4MXW A;  3WDW A;  4BH9 A;  2W1W A;  4RHV 1;  4UFH A;  3DXT A;  4CUG A;  4EZH A;  3NJV A;  3VBF C;  5FO9 B;  3TB0 A;  1E5S A;  1IS4 A;  4AOC A;  3ZR6 A;  4M4R A;  1VMH A;  4AL9 A;  4QXH A;  4QX0 A;  2DV9 A;  3BGA A;  3CKH A;  1AL2 1;  1MZF A;  2FD8 A;  2PHU A;  4FOQ A;  3W21 A;  3SHR A;  1JOP A;  4GAZ A;  2CV6 A;  2QQM A;  4C90 A;  3WNP A;  1UKG A;  2O8Q A;  3DEM A;  1CWP A;  1RUI 2;  2QQK A;  5JIU A;  1W0P A;  3ZO0 B;  1J1T A;  1WW6 A;  2Q8E A;  4CDQ A;  1JZ5 A;  4QT6 A;  1HN0 A;  1UZZ A;  2UWA A;  5F2S A;  4LKS A;  3ZFG A;  1CD3 G;  4LEJ A;  1ZNP A;  4FPO B;  4IGQ A;  1WCK A;  4QGL A;  5I0T A;  3RYK A;  1IS6 A;  5ISL A;  4RYD A;  1Y43 B;  4KWL A;  3ITQ A;  3CBN A;  3FC0 A;  3CJI A;  3VD9 A;  4GKX A;  1VE0 A;  3GHN A;  2QZ3 A;  3J7N A;  5F6L B;  5FZO B;  1FAT A;  2AGS A;  4K8R B;  1ZVF A;  4CDU A;  5IVV A;  3LQC A;  1C5H A;  4BPZ A;  4IDZ A;  4GB3 3;  4YLZ A;  5BNP C;  1UY4 A;  2ZMK A;  1WCD J;  1ZM1 A;  2RJL A;  4MHR A;  2DU0 A;  3CJI B;  4B8E A;  2E31 A;  3WDV A;  1OMI A;  4RQP C;  2J1E A;  1W9F A;  3E5Q A;  3WX5 A;  3ZR5 A;  4D3W A;  2R06 1;  1LOC A;  1QOS A;  2YGL A;  2GC3 A;  2VE1 A;  1AR7 3;  5GZF A;  3MW4 A;  5DG2 A;  2WNO A;  1VRH 2;  3PVO A;  2W2I A;  3NV2 A;  3DYO A;  3UET A;  2Y26 A;  4IE0 A;  4DEQ A;  2PQS A;  3WOG A;  3SH3 A;  4WVW A;  4R9B A;  4D0Q A;  1Y4W A;  3CHX A;  3LFI A;  5HCF A;  2XPJ A;  4KG0 A;  2EXI A;  1IPJ A;  2DUO A;  1OVS A;  2VZP A;  2YPD A;  1QOO A;  4LIU A;  3FHI B;  1CAX A;  2VZS A;  4QPG C;  3RRD A;  3UL2 A;  1UKR A;  4WVZ A;  2CHH A;  3PVB B;  3VZO A;  1MAC A;  4IV1 B;  1GWL A;  5DDJ 2;  4DUW A;  2ZGS A;  2IWG B;  1PIV 3;  2V5D A;  3ZFF C;  3QCW A;  3P5B A;  1QJF A;  3PHM A;  2OVU A;  2I07 B;  4Y1X A;  3FBM A;  3SXW A;  5FYH A;  3USU A;  4HKL A;  1MS3 A;  1B35 C;  2RV9 A;  2VZV A;  1PHM A;  2EXJ A;  3NNL A;  4XAC A;  3RMX A;  1C57 A;  4QXB A;  1XQN A;  4P9W A;  3GAL A;  2CAU A;  5FZD A;  5FXZ A;  3VHO A;  1FNZ A;  5HV0 A;  4LIV A;  3MIE A;  3MIB A;  3S6P A;  5M0T A;  2AC1 A;  4E2Q A;  2TNF A;  4LXL A;  1UXX X;  2R04 3;  3ENR A;  3I3Q A;  2RDN A;  3LIH A;  2QDR A;  2WT1 A;  3VL9 A;  4AG4 A;  1NYW A;  4CE8 A;  1TVG A;  3B02 A;  2HBU A;  4YZ5 A;  1S0E A;  3DV8 A;  4X6R B;  5HPO A;  4S2D A;  2VM9 A;  4IEZ A;  4IEP A;  4DXS A;  1RUC 1;  4MGT A;  2HWB 2;  2AH2 A;  4C0B A;  2W95 A;  2XQX A;  4GJY A;  5A3W A;  2WO7 A;  4QQO A;  4XFF A;  5FQ0 B;  5LA1 A;  3ZSL A;  2DYC A;  4CDW C;  1HJF A;  1NUK A;  4RS5 A;  4EN8 B;  1V70 A;  3JBG 3;  4R52 A;  5FY5 A;  4EYU A;  1HRI 1;  5FP8 A;  4LJH A;  1A8D A;  3H1W A;  2QDN A;  3Q9O A;  4AXO A;  1O8S A;  3MPB A;  4OVE A;  3ST7 A;  2YFZ A;  4JTO A;  1OOP B;  3QH7 A;  4F83 A;  3WG3 A;  3N9L A;  2F4P A;  2G9F A;  4FAG A;  5GAL A;  5J37 A;  2HWC 3;  1VB2 A;  1YIF A;  2GNB A;  5JOY A;  3WW2 A;  5LY1 A;  3B9C A;  4HL0 A;  3WDX A;  2HKX A;  1RJ7 A;  3CJI C;  3JBG 2;  3WG1 A;  2BJS A;  1RUI 1;  1TME 3;  4IQP A;  4XXA A;  2YY1 A;  1BLZ A;  5FZ4 A;  2FDF A;  1RUJ 3;  4Q4V 3;  1QEX A;  4AGV A;  4CDU C;  3O1V A;  1G9F A;  4PLN A;  2R07 2;  1REF A;  3CO2 A;  5FWE A;  2X09 A;  1N3P A;  3LSD A;  2VCM A;  2GN7 A;  4ZS3 A;  4MXV A;  3OYW A;  3P6B A;  4NPL A;  4OUS A;  4Q4Y 2;  3VKF C;  1TEI A;  4BLI A;  2DTY A;  4DUX A;  2WSU A;  5EJ1 B;  1V9U 1;  4N7I A;  4QPG B;  3AP4 A;  4QWN A;  3RZK A;  2JEN A;  2VOV A;  2VUD A;  3K2O A;  1I1E A;  2ZJC A;  1ENR A;  4YGB A;  4FQZ A;  1VBA 1;  4DIN B;  4QX7 A;  3I49 A;  3OPZ A;  4Q0P A;  3KGZ A;  3OYW B;  5IAX A;  4LLF A;  4WM8 A;  2WZR 1;  5DUU A;  1LEC A;  1R09 1;  2HYK A;  1X50 A;  4JHT A;  2RDR A;  3D3A A;  4AFB A;  3KSC A;  5J36 A;  3B93 A;  3AFG A;  2BDR A;  4QDQ A;  3LCP A;  2OXB A;  1QJZ A;  3HD8 B;  2MEV 2;  3LEG A;  3I2H A;  2OZJ A;  3DCQ A;  3VDB A;  4DQA A;  1C5I A;  3RDI A;  4FPJ A;  3VKL A;  4XAB A;  5GLW A;  1NCR C;  4JGY C;  2ZGL A;  3NO8 A;  3FUO A;  3O1T A;  1GP4 A;  1ZRI A;  2W9X A;  2XKO A;  4P5Y A;  1VRH 3;  4K21 A;  4XIL A;  5FZB A;  4CDX C;  2ORX A;  2B42 B;  2VNG A;  4ZY9 A;  5FYS A;  3RJR A;  1RUE 2;  4ZU5 A;  4DO0 A;  2VPV A;  4LQR A;  2PHL A;  1WBL A;  1APN A;  1DGW X;  1KS5 A;  1OH4 A;  3C7G A;  3EO6 A;  4I0A A;  4QB2 A;  3M7A A;  4F8A A;  3NAP A;  1UO9 A;  2J1T A;  2JE7 A;  1OQE A;  3LIG A;  4XYX A;  5A7S A;  4K7J A;  3VD3 A;  4NHK A;  4XTP A;  2P37 A;  3WQ1 A;  1UMI A;  2GNT A;  5AC9 1;  2NM1 A;  3FHQ A;  4DXR A;  2WWJ A;  2WS9 2;  4JV4 A;  5C3S A;  2ZS6 B;  4JRA A;  3SQO A;  1FOD 3;  3LOB A;  1OQD A;  4ASK A;  2J1R A;  1OI6 A;  4MX3 A;  4HVQ A;  4GQ7 A;  5FZC A;  3ORJ A;  3M3Q A;  5C4W B;  1UNB A;  2IFW A;  3MUY 1;  2VZ1 A;  1R09 2;  1W9Y A;  3HVD A;  4LBJ A;  2Y0I A;  1B35 A;  2HWE 3;  1PZ7 A;  2YU1 A;  1QQP 1;  2JDM A;  3HPN A;  1DZQ A;  1FPN 2;  2DUR A;  4KU8 A;  4D69 A;  5T5O A;  2ERF A;  3ZOI A;  2EAL A;  2YUE A;  1H1M A;  2WKK A;  5HCA A;  4H7L A;  5CZK A;  5FZ0 A;  4QMA A;  1URX A;  3ZXL A;  2ARA A;  4UFI A;  5GKA C;  5LRS A;  3ALQ A;  2P3I A;  3LPF A;  4W65 A;  1NY7 1;  2X29 A;  5C71 A;  1MVQ A;  1N1V A;  2VR4 A;  3C7H A;  3IMN A;  4HET A;  4QX2 A;  2FDK A;  2BOJ A;  2WAB A;  3ZMO A;  1NKG A;  4QHB A;  4P9L A;  4XCB A;  3CZU A;  5GZG A;  3HBK A;  1W2A X;  3IMM A;  5FZH A;  1SHW B;  1AR8 2;  2WC2 A;  4V2W A;  5FK8 A;  1RHI 2;  2GMM A;  2GND A;  3CMG A;  4YW6 A;  1SCS A;  5JAX A;  2PHF A;  4XVH A;  1EUU A;  4KGG A;  4W6X A;  1W6N B;  2G19 A;  4KH9 A;  4MSV A;  4IER A;  4NRM A;  3W5N A;  4WBB A;  2WNE A;  2P34 A;  5KXE A;  1I3H A;  2C6S A;  1VMF A;  3PNA A;  1GNZ A;  2PN5 A;  1VAM A;  3IAQ A;  3WF1 A;  4IGP A;  3EBR A;  1FYU A;  4XMI A;  4QX3 A;  3ON7 A;  5KXB A;  4IEU A;  2W87 A;  3NST A;  4A3X A;  1WLD A;  4CDX B;  1U5I A;  2Y6H A;  3E5U A;  3LA2 A;  2DCY A;  1FPN 1;  2N7G A;  3JXS A;  4BIF A;  1X9P A;  2TBV A;  3ZXJ A;  1W9T A;  1I5P A;  1V9U 2;  2W1Q A;  4SBV A;  4XUN A;  1UW8 A;  2AEY A;  3VBO B;  1DBN A;  1JS9 A;  3NNJ A;  1BBT 1;  1NA1 A;  4WVM B;  2QE3 A;  1W8W A;  4YVW A;  3C2U A;  1NOV A;  1F31 A;  1WCU A;  3TRS B;  3BB6 A;  1JTZ X;  4MG2 A;  5EFU A;  2ARX A;  5LEJ A;  1H4H A;  2H0B A;  1XOY A;  2VCC A;  5FJK A;  3SEE A;  1JHJ A;  3O0W A;  4XUQ A;  4DZG A;  3OD0 A;  4OQ9 A;  5L9V A;  3TEW A;  4N43 B;  4YRD A;  2XQR A;  1ULG A;  2E32 A;  3BN6 A;  4RSU A;  2JG9 A;  2ZTN A;  1G9D A;  4FFI A;  2VZT A;  4GIQ A;  1DFQ A;  4L2N A;  1CQ9 A;  1AR7 1;  3USS A;  4COY A;  1ZZB A;  4XCA A;  5E8A A;  4Q4W 3;  1CJP A;  1OBN A;  4U36 A;  1JYI A;  4GZ9 A;  4YG6 A;  3F2Z A;  3OGG A;  3DKQ A;  3PLQ A;  4QDR A;  5TSW A;  1R08 3;  1W8T A;  2GH2 A;  3AMP A;  2SLI A;  4GJZ A;  4H55 A;  4AVT A;  4CU7 A;  3IT8 A;  3LEI A;  1JHN A;  3KV5 A;  4JAA A;  5FQ0 A;  4N43 A;  5GZD A;  1GLH A;  4QKD A;  1W8O A;  4WM7 C;  1LOG A;  3ECQ A;  1WKY A;  4XUP A;  3VZL A;  4KBZ A;  2NZ9 A;  4W50 A;  1Q8S A;  3RI8 A;  4OQ8 A;  4CRQ A;  3VL8 A;  2DFC A;  4E4S A;  1PGL 2;  2YGM A;  3N9N A;  3PUQ A;  3KCC A;  4OI0 A;  5A32 A;  3A0K A;  5E89 A;  4N9H A;  1R64 A;  3I3D A;  1UOF A;  4TWT A;  1V9U 3;  4COW A;  4PLM A;  2FZ2 A;  3OBZ A;  5F5Q A;  2Z42 A;  4Z2A A;  2JDN A;  5F7U A;  1ZBE 1;  4IEO A;  4WZC A;  4A7K A;  4X8N A;  2Y6J A;  4LKE A;  1IZ3 A;  3CDZ B;  5DG1 A;  1F5F A;  1W39 A;  4PF5 A;  2PYT A;  3BAL A;  1EV1 1;  4UFK A;  1QJX 2;  1UOJ A;  2CU5 A;  3VDA A;  3ZN5 A;  3ZYJ B;  5KR7 A;  4AVS A;  4L11 A;  1AR6 1;  4Q4V 1;  5T52 A;  5LRR A;  4D94 A;  2FQP A;  1QXP A;  3FZ3 A;  3ZM8 A;  3UNP A;  2ZEY A;  3MI8 A;  5LA0 A;  3ZYB A;  3O0X A;  3ACG A;  3N7K A;  4BE3 A;  4I0W B;  3M2M A;  2Q0A A;  5HCB A;  1HN1 A;  2A70 A;  3JD7 1;  5IFP A;  2Y6F A;  3AL5 A;  1RMU 2;  2C9A A;  1RUG 3;  3POB A;  5JSP A;  1QJU 2;  4AI2 A;  1KGY A;  3EHK A;  4ATF A;  3NNF A;  3JD7 2;  5FP7 A;  3S30 A;  1B09 A;  5FPL A;  4A3Z A;  1X36 A;  1YYN A;  2VZ3 A;  4RL7 A;  1V6O A;  3SCH A;  4RN5 A;  2P6H A;  1V0A A;  3OCP A;  5C9A C;  5LZ6 A;  3IN9 A;  3AKP A;  4XFB A;  5C3P A;  4C1X A;  2HJI A;  4LE3 A;  5JXI A;  1FAY A;  3TEZ A;  3JB4 C;  5FTT C;  3ILN A;  3VBH B;  4C0H A;  1FPN 3;  3WZ1 A;  2JG8 A;  2BGO A;  2RS3 2;  1DZT A;  4XIK A;  3VB9 A;  4IV3 A;  1QMJ A;  4EN6 B;  5JOZ A;  3SLI A;  1G9A A;  1AX2 A;  1QDO A;  2W92 A;  2YRO A;  1LRH A;  5A1A A;  1XRU A;  1CR7 A;  4TZD A;  2W1S A;  2GAL A;  1YQ5 A;  3OGS A;  2FMD A;  4XZP A;  4L92 A;  3T0A A;  1IG0 A;  3KZ4 C;  1LOB A;  2D6L X;  2WS9 3;  3A21 A;  4WM7 B;  4YNI A;  5FLI A;  1OF3 A;  2Q8C A;  4EQV A;  1Q8P A;  1MS9 A;  3ZN4 A;  2GH8 A;  2XJQ A;  3VZM A;  2W91 A;  4OMC A;  5A6Y A;  2BUK A;  4Y26 A;  2JIC A;  1SBE A;  1XND A;  1UYZ A;  5EPA A;  3ABZ A;  3WDY A;  1NZI A;  3S7I A;  1F8V A;  1TE1 B;  3E6B A;  4NHY A;  1EY2 A;  1TNF A;  3GBW A;  2ZGT A;  2DVF A;  5SV5 A;  1NCQ A;  1Z7S 2;  3LOI A;  2XKP A;  4GB3 2;  2GZW A;  1H2L A;  3GM8 A;  3T2T A;  1S0F A;  4FXK B;  2ZX0 A;  5FYT A;  4LLO A;  4Y1V A;  4AI9 A;  4M00 A;  5EV7 A;  5C3Q A;  2R32 A;  2VMF A;  5KHI A;  3H7Y A;  1HIX A;  2PMW B;  4O7X A;  4XF4 A;  1C3H A;  3FE5 A;  3T4H B;  1VBC 3;  2KXL A;  4J6G A;  3SIS A;  4AED B;  1US2 A;  2VNV A;  3POE A;  4HPK B;  5LAS A;  1HXS 1;  1MS8 A;  1UN1 A;  1PGL 1;  1NQJ A;  1W6O B;  2D5F A;  2D40 A;  2W68 A;  3KQR A;  4PI0 A;  4WV8 A;  5LK5 A;  1GZT A;  4PHZ A;  3UKV A;  3VBU A;  4XJ9 A;  5FYY A;  3ZXG A;  1G9B A;  4ZZ8 A;  4CZS A;  5L36 A;  3GBG A;  2WA3 A;  1I5Z A;  2QQP A;  1AHS A;  2ZHM A;  5LBE A;  2C0Z A;  5F3I A;  1RIT A;  4ET7 A;  2ZXQ A;  1PK6 B;  5F3E A;  4AF9 A;  1JYN A;  3MV0 1;  2NMO A;  1DQ2 A;  1H8T B;  3WW1 A;  3ZFF B;  2DCJ A;  2BTV C;  3GGL A;  1JYV A;  4AZZ A;  3K4Z A;  4HMZ A;  5DZG A;  3WVJ A;  1PNF A;  5K8S A;  1IG3 A;  1GZW B;  3T09 A;  5FDB A;  1VAL A;  1EYB A;  2D6O X;  1PGW 2;  1WWY A;  4BQ2 A;  1AVB A;  2A3X A;  4QPI A;  4FTE A;  3ZYG A;  1UY0 A;  2XJT A;  4QAW A;  1GAN A;  3ES1 A;  2D3P A;  2VXR A;  5A1L A;  5JPN B;  1O3T A;  1KFX L;  1O91 A;  1NXD 1;  2P3Y A;  3I2J A;  3KCY A;  4ITC A;  2P6C A;  4UWD A;  5JR2 A;  4P14 A;  1JZ7 A;  4P9I A;  5LCW L;  5LEK A;  2ZGQ A;  4YVS B;  4FTS A;  5ACA 1;  5A3O A;  1UL9 A;  4OHZ A;  1O8P A;  5FXW A;  4Z1V A;  1GU3 A;  2VAU A;  1HXS 3;  1HV1 A;  2Q30 A;  3K51 A;  1RGS A;  1OKQ A;  1UQX A;  3B7M A;  1FOD 2;  2I45 A;  4YW2 A;  1WCQ A;  2IC1 A;  2O14 A;  2WFF 2;  2RM2 2;  3NAP B;  3AP9 A;  3NRU A;  1M06 G;  3Q8C A;  2NN8 A;  4IXL A;  1QJE A;  3B69 A;  3P1I A;  2Y64 A;  3RZJ A;  2F4L A;  1KDM A;  5HCH A;  3H1M A;  5CIR A;  3HQX A;  4F3J A;  2B46 X;  3NNG A;  1DHK B;  2WJS A;  1QOT A;  2ZMN A;  3EQE A;  4MAD A;  1VBA 3;  4XPV A;  2VD7 A;  3WCS A;  1PM4 A;  4NVP A;  3K4A A;  2WNV B;  5BNO C;  4NHM A;  3K4D A;  2IXH A;  4PBO A;  1AJK A;  1CZV A;  2O1Q A;  3I2K A;  2EIE A;  2Z2S B;  1S55 A;  4TXW A;  2Q1Z B;  5F5A A;  4ZXK A;  2QQJ A;  3KMH A;  5A7W B;  1XSQ A;  1QNW A;  1J59 A;  3RYR A;  3E6C C;  3MF6 A;  1LU1 A;  1EV1 3;  3KF5 A;  1K5M C;  5EIY B;  3UYJ A;  5A3L A;  1KD7 A;  4AVC A;  3B9I A;  4LMF A;  4J1X A;  5C9A A;  2PXJ A;  1NCQ C;  1J84 A;  2VZR A;  3JD7 3;  5IW0 A;  2MEV 3;  4CA9 A;  3FLR A;  2A75 A;  4C91 A;  4CU6 A;  3O1M A;  4ZPI A;  1ZBA 3;  4HVR A;  4LOS A;  1YUD A;  2W0X A;  5IJR A;  4AAP A;  3MW3 A;  4GXL A;  2VCA A;  1E5R A;  4V2V A;  2QJV A;  2YYO A;  3B01 A;  3RGB A;  1CX4 A;  1MQT B;  1QNY A;  4LA3 A;  1YFY A;  3WQ7 A;  4UOJ A;  1PO1 3;  4XE9 A;  3H7J A;  5EZW A;  1UYP A;  1HRI 3;  2BVV A;  4PDW A;  4ARY A;  3BU7 A;  2VUA A;  1BYH A;  5CA6 A;  5JOW A;  4Q1R A;  2XUE A;  3PUI A;  4XET A;  1IQA A;  4Q0S A;  1O4Y A;  2E33 A;  3RFR A;  2OS2 A;  1POV 0;  4ES9 A;  1JH5 A;  2PQQ A;  2CGN A;  4YZ1 A;  2PHX A;  4M0H A;  2R06 2;  3A0N A;  3E5X A;  2PHR A;  1H9P A;  5F39 A;  4PCR A;  2R49 A;  4CXX A;  3U4S A;  1SBD A;  5FBJ A;  2JWP A;  3POS A;  3ZDS A;  1OOP A;  2X10 A;  1FX5 A;  1SAC A;  4MO3 M;  2BVB A;  3T0B A;  1LOA A;  5FK7 A;  3U10 A;  3I2O A;  3R4D B;  1IKQ A;  4RFR B;  3OB8 A;  1VPH A;  1SDW A;  2ZGN A;  4QB1 A;  5JCT A;  5JIA A;  3NJY A;  3KD4 A;  4YZ2 A;  4UFL A;  4YG0 A;  2HEY F;  2UWB A;  2Y0O A;  1DGR N;  1UX6 A;  1OPO A;  1SPP A;  1WD3 A;  3GZA A;  5F8P A;  2V72 A;  3R6S A;  5JDB A;  5CFC C;  1WA4 A;  3USU B;  1PX3 A;  1ZX5 A;  4N43 C;  5DUV A;  1CPM A;  1V6I A;  2Q1M A;  3NW4 A;  2R07 1;  3ROU A;  3WW3 A;  2W08 A;  4B7E A;  2QQO A;  2R1B A;  2RR1 3;  3ZXD A;  2VOW A;  1DQ4 A;  1GQP A;  5JXJ A;  4BCU A;  1MS5 A;  4W4Z A;  1XYN A;  4RFT 0;  5C8C C;  2VQT A;  2ETE A;  4YVW B;  5FZF A;  3ZXF A;  4TYS A;  5FYU A;  4JKL A;  5FP4 A;  2IXL A;  2D98 A;  3D6E A;  1VBD 2;  3MLL A;  1PMI A;  4YW1 A;  3ZVX A;  4RA0 A;  4XFA A;  2RVA A;  3J9S A;  3SEP A;  2HLE A;  3WDT A; 
#chains in the Genus database with same CATH homology
 5FZO B;  5A3P A;  3K2O A;  4GD4 A;  4QXC A;  2OT7 A;  2OQ7 A;  3ZPO A;  5F3C A;  5IVV A;  2VD7 A;  4QX7 A;  4Y4R A;  4D6R A;  5FY7 A;  5FZE A;  3PTR B;  4Y33 A;  4UF0 B;  5FXV A;  4CCK A;  4D6Q A;  5FZ8 A;  3OPW A;  3PUS A;  5A3T A;  3RVH A;  3AVS A;  5FUP A;  4BXF A;  5F5A A;  5IVE A;  5FYI A;  5A7W B;  5LWB A;  2WWU A;  5F32 A;  4BU2 A;  2W2I A;  5FJK A;  5FZ6 A;  2Q8C A;  3LDB A;  2OX0 A;  3UYJ A;  4TN7 A;  3PU8 A;  4EZ4 A;  5IVB A;  3ZLI A;  5FY0 A;  2PXJ A;  5FZO A;  2YPD A;  4LIU A;  5IW0 A;  3N9O A;  4BIS A;  5FZB A;  5FYZ A;  5IVF A;  4AAP A;  4LIT A;  5FYS A;  4IGO A;  4DO0 A;  4V2V A;  4HON A;  4UF0 A;  5FY9 A;  5FYV A;  4CSW A;  3OPT A;  5A3N A;  5FYB A;  3DXU A;  3PDQ A;  4CCN A;  5FYH A;  5FYT A;  4C8D A;  4GJZ A;  5ANQ A;  5FY8 A;  5FYM A;  5FY1 A;  4HOO A;  5FZA A;  5A7S A;  4AI9 A;  3KV5 A;  4XDP A;  4E4H A;  5FPU A;  4QXB A;  5FP9 A;  5FZD A;  5FXZ A;  2YBK A;  5FPB A;  5IVJ A;  2P5B A;  2XUE A;  5F3G A;  4LIV A;  5F37 A;  5F5I A;  2YBS A;  2OS2 A;  2WWJ A;  4LXL A;  5IVC A;  2YBP A;  4Y3O A;  4QX8 A;  3N9N A;  3PUQ A;  5FJH A;  5FYY A;  5FXX A;  4ASK A;  3AL6 A;  5FZI A;  3AVR A;  5FZ1 A;  5E6H A;  3KVA A;  5F39 A;  5FZC A;  5FZG A;  5LY2 A;  4GJY A;  3U4S A;  4NUB A;  5FBJ A;  5A3W A;  5CEH A;  2YU2 A;  2GP3 A;  5F3I A;  5FZ7 A;  3U78 A;  5F5C A;  5FZ3 A;  2YU1 A;  5F3E A;  2OQ6 A;  4EYU A;  5LW9 A;  3N9M A;  5FY5 A;  1VRB A;  5FP8 A;  5A1F A;  5K4L A;  3PU3 A;  2XDV A;  5KR7 A;  5FV3 A;  4CUG A;  5FZ0 A;  3DXT A;  4XDO A;  5FY4 A;  3NJY A;  4EZH A;  3N9L A;  3KVB A;  2XXZ A;  5A7Q A;  5FWJ A;  4DIQ A;  5FPV A;  4QXH A;  5IWF A;  2GP5 A;  5F2W A;  3KV6 A;  5FZL A;  3N9Q A;  5FZK A;  5A7O A;  2Q8D A;  5A1L A;  5FP3 A;  5LY1 A;  4GAZ A;  4CCJ A;  3AL5 A;  5FZH A;  4V2W A;  5FZ9 A;  4D6S A;  4QU1 A;  5A7N A;  5FYC A;  5FZ4 A;  5FXW A;  5A7W A;  3LD8 A;  2Q8E A;  5FZM A;  5FP7 A;  5FPL A;  4CCO A;  3PUA A;  5FZF A;  5FWE A;  5F2S A;  4CCL A;  4CCM A;  5IVY A;  5FYU A;  4IGQ A;  3N9P A;  5FP4 A;  3K3O A;  5A80 A;  5FPA A;  5A7P A;  3KV4 A;  4IGP A;  5ISL A;  3KV9 A;  4URA A;  3PUR A;  2XML A;  4QWN A;  3K3N A;  5FUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...