5FZQA

Designed tpr protein m4n
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
106
structure length
106
Chain Sequence
NSIKTLSNLANLLAQEGKAEEAIKYMRKAVSLDPNNIKTLSNLANLLAQEGKAEEAIKYMRKAVSLDPNNIKTLSNLAVLLAQEGKAEEAIKYMRKAVSLIDKAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Origin of a folded repeat protein from an intrinsically disordered ancestor.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Unknown function
molecule keywords DESIGNED TPR PROTEIN
total genus 45
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5fzqA00
4N2SA 4BT8A 2C0LA 2BUGA 2XGMA 3QWVA 3S7FA 5FJYA 3FP3A 2KC7A 4EQFA 3FWVA 3ZGQA 4RG6A 4HOTA 3GZ2A 3VTYA 5JJ6A 4JA7A 2UWJG 3ASGA 3NF1A 4H7YA 3TG4A 4Y6WA 3ESKA 4WNDA 2PQRA 3LY7A 2YHCA 4N39A 4A1SA 2XCCA 5A6CA 2HO1A 4BTAA 4BWRA 5G04C 5G04J 3MV2B 3RU0A 2AVPA 4B94A 3AS5A 2L6JA 5M72A 2C2LA 4JHRA 1ZBPA 4Y6CA 2VYIA 2Q7FA 1ZU2A 2XCBA 3CKBA 5ARFA 2Y4TA 3EDTB 2WQHA 3CVNA 3RO2A 4GA2A 3QKYA 2PQNA 3WXXA 2KCKA 3CK8A 2XEVA 4J8DA 5HQ8A 4NRHB 4HORA 4J8EA 4H7XA 3LCAA 5KJMA 3RJVA 5FZRA 2LSVA 4XI9A 4I2WA 1WAO1 2VQ2A 2XPIA 4GYYA 5AYWD 4AIFA 3PE3A 4YVOA 5KJNA 3U3WA 4UI9K 4I2ZA 3ASHA 2QFCA 1ELWA 1KLXA 3GYZA 3KAEA 3MKRA 4G1TA 3PDNA 1XNFA 4F3VA 4GZ6A 3U4TA 3LYAA 2VSYA 4ME2A 2GW1A 4WUYA 2VSNA 4AY5A 5CCLA 3CVPA 2IFUA 3RO3A 1OUVA 2PZIA 3Q15A 4N3AA 4N5CA 2NC9A 4U0ZA 5KJLA 4AY6A 5A7DB 4NQ0A 3HYMB 1E96B 2KCLA 2I6HA 3CK9A 3PE4A 4GCNA 2UY1A 1KT1A 2VGYA 3E4BA 4XIFA 1YA0A 4I9EA 4I17A 5FT9A 3R9AB 4N2QA 3ASFA 4I1AA 3OXGA 2VGXA 2JLBA 4GCOA 5BNWA 1ELRA 4CGWA 2OOEA 4JA9A 4YNDA 1IYGA 4G2VA 1HZ4A 4JL0A 4J8FA 4GYOA 5G05C 4HOSA 2VGXB 3ZPJA 4O6FA 3LPZA 3AS8A 2YQ8A 5DBKA 5CCMA 3AS4A 2UY1B 3UUXA 3CK7A 3Q4AB 3Q5MA 1Y8MA 4G26A 3TG5A 2P58C 5HI7A 3RKVA 3S7BA 5JJ7A 5LCWC 5EX3A 2Y4UA 3TAXA 2V5FA 3MV3B 3Q47B 4HOQA 2DBAA 4U07A 3IEGA 4XI0A 2C0MA 3OXLA 4GA0A 4GZ3A 3FFLA 4UI9C 5FZSA 2XGSA 3SF4A 3SZ7A 3ULQA 3GW4A 4WNEA 3ZN3A 5JJTA 4YVQC 2IF4A 4WNFA 5LCWJ 4G25A 4UQXA 5FTPA 4CGVA 3BEEA 2FBNA 3K9IA 3O48A 5EX0A 5C1DA 3UPVA 2LNIA 3OXFA 4GZ5A 5BW8C 5DIZA 3LY9A 4LEUA 3URZA 3VTXA 3ZHEA 2WPVA 2HR2A 4J0UA 1QZ2A 3RIBA 4APOA 1FCHA 5EKQD 2LSUA 5G05J 2FI7A 3QOUA 1HH8A 1PC2A 1NA0A 1W3BA 4GA1A 4GYWA 3ZHEB 4BTBA 3CEQA 3CVLA 4KYOB 1NZNA 2FO7A 5FZQA 3ASDA 2KCVA 3QWPA 4GPKA 4RG9A 5D0QD 1WM5A 3UQ3A 4G23A 3CV0A 4CDRA 1NA3A 3ZFWA 5BT1A 2ONDA 1P5QA 2MHKA 2PL2A 1KT0A 4KBQA 4IN3B 4ABNA 1B89A 3CVQA 4U04A 4KXKB 4HOUA 3GZ1A 3QDNA 2FF4A 1A17A 2HYZA 3MEKA 5D0OD 3TGOA 3JYSA 3CKCA 4WNGA 4N3CA 3LKUA 4BT9A 1TJCA 2FEZA 1QQEA 3LY8A 5CHEE 4I9CA 3S7DA 3N71A 4UQYA 5ARGA 3S7JA 4W9RA 5KJKA 2R5SA 3QWWA 3KS2A 2KATA 4G24A 2XGOA 2E2EA 4U0SA 4UQZA 4AM9A 1HXIA 4N3BA 4UI9J 3MA5A 3Q49B 3KD7A 4U0UA 1IHGA 2J9QA
chains in the Genus database with same CATH superfamily
2C0LA 3QWVA 3PEUB 5ENQD 3MX3A 2MYOA 3ZNGA 3D9JA 2CG3A 2CFUA 4PS8A 1ZB1A 4B94A 4BSXA 3T9KA 5A23A 3TXMA 3KEZA 3UMVA 4FP7A 4DI3A 1SA5A 2I2OA 2X38A 4N5QA 5JHAA 2NC9A 2VGYA 1FPPA 1HO8A 3UM3A 5DBKA 3MKQB 4WWPA 2VTBB 3HHMA 1FVHA 1PAQA 1SQMA 2DBAA 3C3RA 3ULYA 3UINC 4GTOA 1IXVA 3UPVA 2WB2A 2I1JA 2V4LA 3Q9NC 1NA0A 5B3SE 2ETCA 3E32A 2BKGA 5EN5D 1SW6A 2WXNA 1OWNA 3JYSA 4KT6B 5D2MC 1PY1A 4F53A 3HRAA 3QJZA 3FP3A 4EQFA 2JABA 4HOTA 4I1OB 3LY7A 2YNQA 3P2BA 2HO1A 3D3MA 4NURA 5BXUA 4FULA 1U2VG 1O5MA 2F8YA 1TR4A 4U7EB 4EBAG 5JMND 2DVWA 2WXFA 3EDTB 4P29A 3WXXA 4OAUC 5J90A 4GYYA 1OY3D 3ZYMA 3L54A 2QFCA 1BPOA 3NZUA 5AENA 2GW1A 4WUYA 1N52A 3FUDA 5C2YA 4AY6A 4NQ0A 3FTXA 3ASFA 4WAFA 2JLBA 3L82A 1QBQA 2Y69E 3TWWA 3FUMA 3DPYA 4TXPA 5CCMA 4LERA 2A5EA 3Q5MA 3SBTB 4XE0A 5BUZA 2WXRA 3Q7AA 2EQXA 1N0RA 3CHQA 4EZKA 4AOFA 4UWKA 5C1DA 5BV1A 3ABME 3MYVA 3URZA 3CHSA 1U3CA 4KYOB 5D0QD 1UJKA 4CT0A 4JHJA 1OWLA 3PEVB 2FEZA 3Q9UC 3SHFA 4EHMA 2AXUA 2X6JA 2WXIA 2XEHA 4AV7A 2XGMA 4MS6A 1N0QA 2L6JA 3WG7E 2VYIA 5D66A 2R03A 2WVIA 3MKQA 2WQHA 3V2OA 4FJYA 3CVYA 1V55E 4AVXA 2IY0C 4G11A 3D9PA 2QZAA 3JXJA 1OWOA 2BKKB 4LRZA 5KNHD 5AAOA 5LX8A 4GU5A 3EU9A 4CDMA 3HYMB 4GCNA 4I1MA 3UM0A 2QYUA 4LNUD 1H6OA 1IYGA 4B8AA 5IY5E 3JQ0A 3KEAA 2CHWA 3S7BA 3D9KA 4JPSA 1K8KG 4CCAA 1S70B 1Q2ZA 3ASOE 3MCXA 3V2XA 3APCA 3O48A 4KVMA 4DI4A 3RIBA 4A3TA 3FTUA 3PZ3A 1TNOA 2KCVA 3PZ4A 1WG0A 4DK5A 3CV0A 2AWIA 3AG2E 2PM6A 1UN9A 3S7DA 3SNXA 4FU3A 2ZU6B 4RSYA 4BSZB 2CHZA 5H7PA 4G8KA 5JHBA 4G26A 2B6CA 4JZYA 3UM2A 1DCEA 1D8EA 3TJPA 3APFA 4HS2A 4GTPA 1Z3XA 4BWRA 5G04J 1H0AA 2P9PG 1N11A 3OAWA 3B7RL 4HXIA 2VSOE 4LCTA 2WXLA 2F8XK 3ZKJA 2XS1A 5KCMA 4ANXA 1YYHA 3RRMB 4F1PA 4GZ6A 1LF8A 3W9GA 2PNNA 4L23A 1BD8A 3CLJA 5HKPA 1ELKA 2I6HA 4DX7D 1YA0A 4I9EA 4FHJA 4O1PA 4G2VA 3AU4A 2VGXB 4BESA 3SQVA 1JWFA 1S63A 1Y8MA 4HORA 2WXKA 2XZDG 3AJIA 4JXTA 5EX3A 3PZ1A 3I3NA 3B7BA 2KXPC 5KNGA 3APDA 1N95A 3UIPC 1N54A 4CGVA 3D9OA 2LNIA 3Q7FA 4GZ5A 1TNUA 1H6PA 1SZAA 1FCHA 4QFVA 4BTBA 1L5JA 4U8HA 1WM5A 4HVBA 4ABNA 4C9BB 2NSZA 3UKUG 3CGHA 3ML9A 4JVSA 2QYJA 3ZXSA 3DSUA 1WDYA 5BV0A 4C0MA 3LXUX 2KATA 1GW6A 2V4HC 5ENTD 2L0IA 4LSZE 4U8VD 1KPSB 2A4ZA 4GTTA 2GRQB 3QB2A 4APFA 1IQRA 1QYMA 2PQRA 3Q78A 4MRUA 4DX5D 4TRQA 3E34A 1HG5A 1UG3A 3CIAA 1TJFA 3AAAC 3O4ZA 1ZU2A 4HNAD 3G2SA 5KJMA 3FEYA 2DYRE 4BFRA 1OWPA 3ASHA 3KSLA 3VLFA 3DXMG 2EILE 4RQIA 5FT9A 3Q73A 1D8DA 1MX6A 4K5BA 3CVVA 3UUXA 4IULA 3ISMC 2Y4UA 3MV3B 2LO6A 4KZ0A 3ESLA 4GA0A 2P9LG 3ZN3A 3ULQA 2WXPA 4WNEA 3PREA 4YDYA 2J08A 4C48B 2WMNA 2E0IA 4ATGA 4J0UA 2FO7A 2RG8A 4CDRA 2V8SE 3ZFWA 2WXQA 4TXQA 4HFGA 5CRVA 1E8ZA 1H19A 1OXJA 2OEWA 4HLEA 3ZRHA 1HXIA 3SFXA 4N3BA 4CYMD 2FO1E 3KD7A 4URKA 4F6RD 3ZGQA 3FH7A 3VTYA 5JJ6A 2RD0A 4DPRA 4NACA 3UM1A 3D9LA 1IHBA 5CBNA 1E90A 3PVLA 3IV0A 4GA2A 4M3OA 3CK8A 4I2WA 3U3WA 4M7CA 2XRZA 4L7TA 4ANVA 3HG0D 5FQ4A 3AG3E 4GTMA 2IFUA 2MRIA 1Z3YA 3LVRE 3FTSA 2J07A 3V30A 4BEPA 1KT1A 4YDWA 5BNWA 2IOSA 3B7UX 4JA9A 5AJDA 2Y3AA 4XEIG 3E30A 2ZXWE 3EHNA 3UT8A 2P9IG 4EPZA 4U07A 5AIJA 3FFLA 3I4GA 4WWOA 3LDZA 2FBNA 5CERB 4APOA 3QOUA 4KZCA 1W3BA 4GA1A 1O1RA 1E8WA 1NZNA 3UQ3A 2EIJE 1KT0A 3C5RA 2F0YA 1EF1C 4BT9A 3DSWA 3V79K 3ULEG 2R05A 5E76A 4XKCA 1HS6A 4W9RA 5ENOD 3NOCD 4OYSA 5ENRD 1DCQA 3CVUA 3PZDA 4G8LA 2LXMA 3EU5A 5A6CA 2XCCA 4BTAA 4FHKA 4U95D 1N9AA 2HE0A 2XCBA 4O60A 3TWTA 4NRHB 3NBNB 5KWDA 4HRNA 5T8IA 1JCQA 3MKRA 3X2QE 4DX2A 1XNFA 2V0PA 3RRUA 1S64A 1LTXA 4YDEA 3LJ3A 3RU0A 3E4BA 4N2QA 3S2AA 2R02A 2VGXA 3FTVA 5AQAA 1BI8B 1EPUA 3ZIMA 4GTVA 3FY4A 3NQPA 5FZSA 2WXHA 5FIOA 4AEZC 1DNPA 3B13A 3L22A 5DIZA 2OVBA 3ABKE 3DSXA 4I43A 5FQ7A 4C0EA 2OVFA 4RG9A 3FU3A 2WXJA 3U9WA 3CVWA 5D0OD 3DXKG 4BERA 3LY8A 2OV8A 4AJWA 4Q69A 4LG6A 2VSXE 1AWCB 4CZ2D 4U0SA 4LNBA 3AG4E 3PRZA 3T5XA 3ZW3A 3TG4A 3HVEB 4WNDA 1MX2A 5G04C 2KZTB 2H6FA 3BUAA 3TL5A 4TV3A 5ENSD 3E33A 3FUIA 3QKYA 2PQNA 5HQ8A 2XEVA 1DVPA 3PE3A 3QC1A 1XGWA 3ML8A 2ZISA 2R17C 1K1BA 4JD2G 4ZHBA 2FULA 2P9KG 3BG0B 4GZDA 1E96B 3CVXA 3RRNB 1HZ4A 1Z5SC 4K5CA 4PH4B 5ANLA 4ILIA 3Q4AB 3ZYLA 2L9BA 1VDYA 1TNYA 3ZYKA 3IHVA 4O1OA 2WM9A 3DSVA 4MKTA 3VLDA 5CEAA 4OVUA 5CECB 4ILHB 5ANRA 4FLHA 3Q79A 3FU5A 3C3OA 4GYWA 1PC2A 4DX1A 1FVFA 1KZOA 2ZGDA 4G23A 1OCOE 5BT1A 1P5QA 2MHKA 4KBQA 2XEEA 4IN3B 4KXKB 1A17A 1LD7A 1X81A 2BTDA 2BF0X 3T8MA 2CHXA 2LXLA 3LJNA 1TNZA 3TWVA 4A1GA 3R9MA 3LEWA 4BETA 3IBEA 3B7TA 3S7FA 3P1UA 3CHOA 5FJYA 3IXEA 3ZU7B 2IO2C 4Y6WA 2MOWA 4B89A 2C2LA 4JHRA 4JHKA 2Q7FA 4J8DA 1HE8A 4IYPA 3LCAA 4YVOA 3DPDA 3UT4A 1N4PA 4UI9K 1K3ZD 3PUJA 4MBGA 3LYAA 4ME2A 2GRNB 5CCLA 3CHMA 2EIME 5KJLA 4D10C 4YVQC 2UY1A 4I6GA 3R9AB 4I1AA 2I1KA 4YNDA 4B93B 3I4RB 4HOSA 3EJNA 4AXHA 4F3VA 2KM4A 3PNTB 4OAVB 3SGHA 4HOQA 3R7RA 4UI9C 4AIFA 1JPLA 2XGSA 4WNFA 1TNBA 3K9IA 3DEOA 4V3IA 2XPZA 1QZ2A 5EKQD 4IRUA 1G3NB 2R59A 1BI7B 3CEQA 2J4BA 2IQCA 1H6KA 2PL2A 1TYQG 2GROB 4CDNA 1SVXA 3QWWA 1BU9A 3HDXA 2X6KA 2J9QA 3EHMA 3QK0A 5CMWA 3DSTA 4A1SA 5T4YA 3TWXA 4FADA 2KCKA 5BXOA 3ZEFA 1OCZE 2AXZA 1WAO1 2VQ2A 2XHEA 5FWQA 3ZYQA 4CRWA 4GMLA 4HB5A 3D9NA 1HFAA 5A7DB 1MYOA 3PUKA 5B1AE 4I17A 3L6AA 3OXGA 4GCOA 4EZLA 5FQ8A 1TN6A 2IO3C 3SBSA 4O6FA 2GRMA 3SD5A 2RFMA 4L1BA 1QNFA 2WXMA 3Q47B 2C0MA 3SZ7A 3HIZA 3TWSA 3PNLB 3VTXA 2LSUA 2P9UG 4JEUA 2RKKA 4GMRA 1RW2A 3QWPA 3JQ1A 4UWLA 4QQIA 4U04A 3G2TA 3UI2A 3MEKA 2J8SD 4JB8P 3LKUA 5ARGA 4EZJA 5KJKA 2VTBA 3EUVA 2LAIA 4L9PA 3NZSA 4R7LA 4U0UA 5CBOA 1RZ4A 2KZTA 3NF1A 4X8QA 4U96D 1Z6TA 4ZFHA 4FA6A 2AVPA 5M72A 2LAHA 1BLXB 2Y4TA 1MZCA 3CVNA 4PS3A 3UX4A 4ANUA 4J8EA 4H7XA 2LUHA 4TUMA 1N4QA 4NIKA 4CEMA 3E37A 2IEJA 4HI8A 3ZUVB 3BU8A 2VSNA 2VGEA 3RO3A 4DUIA 1S0PA 2KCLA 3C98A 5EIBE 4GMJA 2X6FA 2B0OE 1ELRA 5ITZF 4KMOA 3CQGB 3GZSA 4GTSA 3KSQA 5AJLA 2EIKE 2BEDA 4HRMB 3FUJA 3SF4A 3FU6A 4HBDA 3L08A 3IHYA 5J08A 2DYSE 4CT4A 2FI7A 4DJAA 3JUEA 3CVLA 3ASDA 3JCKC 1NA3A 1LD8A 2A5UA 4E6HA 4WNGA 4UUCA 4TUUA 5BPPA 4DLQA 1TJCA 4YDOA 4FJZA 2DZNA 5B1BE 3L13A 4G24A 4UQZA 2WXGA 4BT8A 1U3DA 2BUGA 3FUFA 2YHCA 3R7QA 2OCCE 5FQ6A 1H2VC 3CSTA 4L2LA 5ARFA 3RO2A 3FH5A 3RJVA 4XI9A 2IJGX 2P2CP 4I6EA 3L16A 2WMOA 2VSYA 4DX6D 2H6GA 4Q96A 3TWUA 4JEHA 4GB9A 4BX8A 3CK9A 3U4TA 1H2UA 2XQ0A 1O1TA 4CGWA 3Q75A 2NXPA 3ZPJA 4LUNU 2YQ8A 1D9SA 1Y6IA 3JUIA 4ANWA 5CMYA 5LCWC 2V5FA 3UIOC 3IEGA 4BY6A 2DZOA 2RFAA 3DRAA 5AQ7A 4I6JA 1TN7A 3LY9A 5AQBA 5G05J 1TN8A 3ZHEB 1EYHA 3RK6A 4GPKA 4ACKA 2DCPA 3SY2A 1N4SA 3FUKA 4AP2A 3G2VA 5CRUA 2WQ6A 4UWGA 4J7WA 1JUQA 2Y0BG 4J8SA 2KC7A 5LOZA 3I5PA 4UWFA 4JA7A 2UWJG 3ASGA 4A55A 4N39A 4RVBA 3U66A 2PM7A 3MV2B 5KBAA 1MJ0A 3CKBA 3OTNA 1OWMA 3HXDA 3J5QB 1HF8A 2M63A 5KJNA 4FC8A 2P9NG 1KLXA 2ZGGA 3GYZA 3FULA 3T8KA 1EDUA 3SFZA 3FTYA 2DWZA 2PZIA 4N3AA 3MZLB 2VJ8A 2R2LA 3FU0A 3PE4A 2KBXA 3EIQC 1HG2A 4A63B 2OOEA 3U64A 3QNKA 2ILRA 4JL0A 3DBSA 2GRRB 1NI1A 1JWGA 2UY1B 5AARA 3TG5A 4ATZD 1UN8A 3CR3A 1MQSA 1K1AA 4XI0A 3OXLA 4GZ3A 4KVOA 3TXNA 3GW4A 4G25A 4UQXA 2J49A 5EX0A 1HU3A 1OCRE 5LP0A 3T5VA 1UJJA 5HS0A 1INZA 1E7UA 3RAUA 3LS8A 2AW6A 3J5PA 3QDNA 2HM8A 2HYZA 2GRPB 1OCCE 3LVQE 3S7JA 3PH0C 2ETAA 4ILGA 1TEZA 5JA4D 2OEVA 3Q49B 1IHGA 4K5AB 4GPMA 5HRYA 2IU1A 3AS5A 4F7AA 1ZBPA 4Y6CA 4RLYA 1IQUA 3CHPA 4B8CB 5FZRA 2LSVA 5E75A 1NL4A 4U63A 4XZ4A 1E8YA 3PDNA 2Y1LE 5EDSA 4JW1A 2GRLA 2J09A 5G55A 4U0ZA 1YMPA 2I9CA 3ZVVA 2V5QC 2H6IA 5CEDB 4BX9A 4PUCA 3L17A 3TWRA 3FUNA 3C72A 3CK7A 2AJAA 1SA4A 3RKVA 1DC2A 3BG1B 3TAXA 3G2WA 3UKRG 2AXVA 3SFYA 5JJTA 2IF4A 1E8XA 3C3QA 3EHRA 3DSSA 3BEEA 3D9IA 3ZHEA 2WPVA 3BQOA 2IOLA 2F37A 2L0TB 1HH8A 1X5BA 3D9HA 5FZQA 5T3RA 2GGFA 4DLOA 2ONDA 4UWHA 2P9SG 3CVQA 4XKBA 3GZ1A 3ENEA 3CKCA 4L2YA 4N3CA 3NAWA 4GTQA 1QQEA 3CHRA 4I9CA 2R5SA 4FLBA 3KS2A 3SO8A 2E2EA 4E85A 5AN8A 4UI9J 5G2NA 3UT7A 2L6BA 4RG6A 3NB2A 3GZ2A 4H7YA 2XS8A 1FT1A 2H6HA 3UTMA 2IONA 5ENNA 4U8YD 1HX8A 4PDXA 1V54E 3ABLE 4WWNA 2XPIA 5AQ9A 4HI9A 1FT2A 3KAEA 4GZCA 3FTWA 4XX5A 2XPYA 2XENA 4DRXE 3Q15A 4B0ZA 4GTRA 3DEPA 1N4RA 1A5EA 4XIFA 3PZ2A 2X3MA 3NOGD 2ZIRA 4J8FA 3AS8A 1JCRA 2P58C 4F1SA 2QC9A 3CSFA 3SI5A 1NP7A 2WXOA 5EILA 3HVEA 5FTPA 1O1SA 2QY7A 4LNGA 3PS6A 3OXFA 4AY5A 5BW8C 3CQCB 1E7VA 4GAAA 4K0RA 4K03A 3ONLA 3QAQA 3FDHA 3ONKA 1B89A 1IKND 2NYJA 2XZTG 2YINA 1MX4A 3HXCA 5FINA 3V31A 3FUHA 1UW4B 4UQYA 3DWLG 2XGOA 4A3VA 3TWQA 3AG1E 4GYOA 4N2SA 1N94A 1SZ9A 3B7SA 4Q94A 3G2UA 1UOHA 3FWVA 4HQDA 4EBAA 4TXRA 2YHEA 3RSEG 5EIDA 3ESKA 2J4DA 2CG2A 1NFIE 3FHEA 2DIWA 3B95A 1H2TC 3F6QA 3D9MA 2ETBA 3HXEA 5LFAA 3ASNE 3HXFA 4JC8A 3W9FA 4Z68A 5AYWD 1OT8A 2X6HA 4I2ZA 1YCSB 1ELWA 3EHQA 4G1TA 1WY6A 4HRLA 4PS7A 3CVPA 1OUVA 4N5CA 3FH8A 3IKOB 4EECA 1JCSA 3HXBA 3L9TA 5G05C 2X6IA 3LPZA 3AS4A 5JJ7A 5HI7A 3UXGA 2EINE 2CFZA 3VLEA 1MHQA 5LCWJ 3FTZA 4MLPA 4J6IA 4LEUA 4OVVA 2HR2A 3JXIA 3QARA 3MGBA 4ACLA 3AU5A 5ENPD 3MJWA 2WQ7A 1AP7A 3FUEA 4HOUA 3ZXPA 2FF4A 1KZPA 3EIJA 3TGOA 2XRYA 5CHEE 5EYPF 3N71A 2JEKA 3FEXA 4AM9A 4HLLA 3MA5A 5EYLA 4J8YA
chains in the Genus database with same CATH topology
3IBEA 2C0LA 3B7TA 4J8SA 3QWVA 3P1UA 3CHOA 3S7FA 5FJYA 2KC7A 5LOZA 2A4ZA 3I5PA 3QB2A 4APFA 3PEUB 3MX3A 4UWFA 4JA7A 2UWJG 3ASGA 4Y6WA 3D9JA 4A55A 1IQRA 2PQRA 4MRUA 4N39A 2CG3A 2CFUA 4TRQA 4PS8A 2MOWA 4RVBA 3U66A 2PM7A 1HG5A 3MV2B 4B94A 4B89A 2C2LA 4JHRA 1UG3A 3CIAA 1TJFA 3O4ZA 2Q7FA 1ZU2A 4JHKA 3CKBA 3OTNA 4BSXA 5A23A 3G2SA 1OWMA 3TXMA 3KEZA 4J8DA 3UMVA 1HE8A 4IYPA 4FP7A 3LCAA 5KJMA 3FEYA 4DI3A 1HF8A 2M63A 5KJNA 4YVOA 4BFRA 4FC8A 3DPDA 3UT4A 1OWPA 4UI9K 2I2OA 3ASHA 1KLXA 3GYZA 3VLFA 3PUJA 2X38A 3LYAA 3FULA 4ME2A 1EDUA 3SFZA 3FTYA 5CCLA 3CHMA 2PZIA 4N3AA 5JHAA 3MZLB 2VJ8A 2NC9A 5KJLA 4D10C 3FU0A 4YVQC 3PE4A 2UY1A 2VGYA 4I6GA 5FT9A 1HO8A 3R9AB 4I1AA 2I1KA 3EIQC 1HG2A 2OOEA 4YNDA 3I4RB 3U64A 3QNKA 2ILRA 4JL0A 4HOSA 3EJNA 3DBSA 3CVVA 5DBKA 4AXHA 3MKQB 4WWPA 4F3VA 1JWGA 2UY1B 3UUXA 2VTBB 4IULA 3TG5A 2KM4A 3HHMA 3PNTB 2Y4UA 1UN8A 3SGHA 3CR3A 3MV3B 4HOQA 1FVHA 1PAQA 1SQMA 2DBAA 1MQSA 2LO6A 4KZ0A 3R7RA 3ESLA 4XI0A 3OXLA 4GA0A 4GZ3A 4UI9C 4AIFA 1JPLA 2XGSA 4KVOA 3TXNA 2WXPA 3GW4A 4WNEA 3PREA 3ULQA 3ZN3A 4WNFA 2J08A 4G25A 4UQXA 2J49A 5EX0A 2WMNA 1HU3A 3K9IA 3UPVA 4V3IA 2XPZA 2WB2A 2E0IA 4ATGA 5LP0A 4J0UA 1QZ2A 2I1JA 1UJJA 2V4LA 3LEWA 5EKQD 3T5VA 4IRUA 1NA0A 2R59A 3CEQA 1INZA 2FO7A 2RG8A 1E7UA 4CDRA 2V8SE 2J4BA 3ZFWA 2PL2A 2IQCA 1H6KA 2AW6A 2WXQA 3LS8A 4HFGA 3QDNA 2HM8A 4CDNA 2HYZA 1E8ZA 2WXNA 1H19A 1OWNA 3JYSA 4HLEA 4KT6B 3ZRHA 3LVQE 3S7JA 3PH0C 3QWWA 1PY1A 4F53A 4ILGA 1TEZA 1HXIA 3HDXA 4N3BA 2X6KA 3Q49B 3KD7A 1IHGA 2J9QA 3QJZA 4URKA 3EHMA 3QK0A 3FP3A 5CMWA 4EQFA 3ZGQA 3FH7A 4HOTA 3VTYA 5JJ6A 2RD0A 4I1OB 4A1SA 4DPRA 3LY7A 2YNQA 5T4YA 3P2BA 4NACA 2HO1A 3D3MA 4NURA 4FULA 2IU1A 3AS5A 4F7AA 3D9LA 4EBAG 1ZBPA 4Y6CA 1E90A 2WXFA 3PVLA 4FADA 3EDTB 1IQUA 3CHPA 3IV0A 4GA2A 4M3OA 4P29A 2KCKA 3CK8A 3WXXA 4B8CB 3ZEFA 5J90A 5FZRA 2LSVA 5E75A 4I2WA 2AXZA 1WAO1 2VQ2A 4GYYA 2XHEA 3ZYMA 5FWQA 3ZYQA 3L54A 4U63A 4CRWA 3U3WA 2XRZA 4XZ4A 4L7TA 1E8YA 2QFCA 1BPOA 4ANVA 3PDNA 5FQ4A 3NZUA 5AENA 5EDSA 2GW1A 4JW1A 4WUYA 1N52A 2GRLA 3FUDA 2J09A 4GMLA 5C2YA 2IFUA 2MRIA 1Z3YA 3D9NA 5G55A 4U0ZA 3LVRE 4AY6A 1HFAA 3FTSA 5A7DB 4NQ0A 3FTXA 2J07A 3PUKA 2I9CA 1KT1A 3ZVVA 4I17A 3ASFA 3L6AA 3OXGA 4WAFA 4GCOA 2JLBA 5BNWA 2IOSA 3B7UX 4JA9A 4EZLA 3FUMA 5AJDA 5FQ8A 4BX9A 4PUCA 2Y3AA 3L17A 3SBSA 4O6FA 2GRMA 5CCMA 3SD5A 3FUNA 4LERA 3CK7A 3Q5MA 3EHNA 4L1BA 3RKVA 3SBTB 1QNFA 4XE0A 3BG1B 3UT8A 2WXMA 3TAXA 5BUZA 2WXRA 3G2WA 3Q47B 4EPZA 4U07A 5AIJA 2C0MA 2EQXA 2AXVA 3FFLA 3HIZA 3SZ7A 3CHQA 3I4GA 4EZKA 4AOFA 5JJTA 2IF4A 4WWOA 1E8XA 4UWKA 3LDZA 3BEEA 2FBNA 5C1DA 5BV1A 3D9IA 3MYVA 3ZHEA 3PNLB 3URZA 3VTXA 2WPVA 3CHSA 2IOLA 4APOA 2LSUA 1U3CA 3QOUA 4KZCA 1HH8A 1W3BA 1X5BA 2L0TB 4GA1A 4JEUA 1E8WA 4KYOB 1NZNA 5FZQA 5T3RA 3QWPA 5D0QD 3UQ3A 1UJKA 4CT0A 3JQ1A 2GGFA 4JHJA 4UWLA 4DLOA 2ONDA 1KT0A 4UWHA 3CVQA 4XKBA 1EF1C 4U04A 3G2TA 3GZ1A 3ENEA 3MEKA 3CKCA 1OWLA 4L2YA 4N3CA 3LKUA 4BT9A 3PEVB 2FEZA 1QQEA 3CHRA 4I9CA 3SHFA 5ARGA 4EZJA 5E76A 4XKCA 1HS6A 4W9RA 2AXUA 2R5SA 4FLBA 3KS2A 5KJKA 2VTBA 2E2EA 2X6JA 4E85A 2LAIA 4OYSA 3NZSA 2WXIA 4UI9J 4R7LA 4AV7A 4U0UA 5G2NA 3UT7A 3CVUA 2XGMA 4MS6A 3PZDA 4RG6A 2KZTA 3GZ2A 3NF1A 4H7YA 5A6CA 1Z6TA 2XCCA 4BTAA 4FA6A 4FHKA 2IONA 5ENNA 2AVPA 5M72A 2L6JA 2LAHA 2VYIA 2XCBA 1HX8A 2WVIA 2Y4TA 3MKQA 2WQHA 3CVNA 4PDXA 4FJYA 4PS3A 3UX4A 3CVYA 4ANUA 4NRHB 4J8EA 4H7XA 4AVXA 4WWNA 2XPIA 4G11A 4CEMA 3D9PA 5T8IA 3MKRA 3KAEA 1XNFA 3FTWA 4GZCA 4XX5A 2V0PA 2XPYA 3RRUA 1OWOA 2VSNA 4LRZA 5LX8A 3RO3A 3Q15A 4GU5A 4B0ZA 1S0PA 4CDMA 3HYMB 2KCLA 4GCNA 3C98A 3LJ3A 3RU0A 4XIFA 3E4BA 4I1MA 2X3MA 4GMJA 4N2QA 2X6FA 3S2AA 2VGXA 3FTVA 1ELRA 4KMOA 1IYGA 1EPUA 4B8AA 4J8FA 3CQGB 3GZSA 3JQ0A 3ZIMA 3AS8A 5AJLA 2CHWA 2P58C 3FY4A 3S7BA 3D9KA 4F1SA 3CSFA 4JPSA 3SI5A 3NQPA 4CCAA 3FUJA 1NP7A 3SF4A 5FZSA 3FU6A 2WXHA 2WXOA 3HVEA 5FTPA 3MCXA 2QY7A 3L08A 4AEZC 1DNPA 3IHYA 3PS6A 3APCA 3O48A 4KVMA 4DI4A 3B13A 3L22A 3OXFA 5BW8C 4AY5A 5DIZA 5J08A 2OVBA 3RIBA 3CQCB 4I43A 4CT4A 4A3TA 2FI7A 5FQ7A 1E7VA 4DJAA 3FTUA 3CVLA 2OVFA 4C0EA 4GAAA 3ASDA 2KCVA 4DK5A 4K0RA 4RG9A 3JCKC 3FU3A 3CV0A 4K03A 3ONLA 1NA3A 3QAQA 3FDHA 2A5UA 3ONKA 1B89A 2WXJA 3U9WA 3CVWA 4E6HA 2AWIA 2YINA 5D0OD 2PM6A 4WNGA 4TUUA 5BPPA 4DLQA 1TJCA 1UN9A 3FUHA 3LY8A 3S7DA 4FJZA 3SNXA 4FU3A 1UW4B 4UQYA 2OV8A 2ZU6B 4AJWA 4Q69A 2VSXE 4RSYA 2CHZA 3L13A 2XGOA 4G24A 4U0SA 4UQZA 4A3VA 2WXGA 4G26A 5JHBA 3PRZA 4GYOA 4JZYA 4BT8A 1U3DA 3T5XA 4N2SA 2BUGA 1SZ9A 3B7SA 4Q94A 3G2UA 3TJPA 3FWVA 4EBAA 3ZW3A 3APFA 2YHEA 3FUFA 3TG4A 4HS2A 3ESKA 3HVEB 2J4DA 4WNDA 1Z3XA 2YHCA 3R7QA 2CG2A 3FHEA 5G04C 2KZTB 2DIWA 5G04J 1H0AA 4BWRA 3TL5A 1H2TC 4TV3A 5FQ6A 3OAWA 3B7RL 1H2VC 3CSTA 4HXIA 3FUIA 4L2LA 5ARFA 3RO2A 2VSOE 3QKYA 2PQNA 3FH5A 4LCTA 2WXLA 2XEVA 3D9MA 5HQ8A 4HORA 5LFAA 1DVPA 4JC8A 3RJVA 4XI9A 5KCMA 5AYWD 3PE3A 2X6HA 2IJGX 4ANXA 3RRMB 4I2ZA 3QC1A 1XGWA 1ELWA 4I6EA 4G1TA 3ML8A 3L16A 4GZ6A 2WMOA 2VSYA 1LF8A 1WY6A 2R17C 4PS7A 3CVPA 2FULA 4L23A 4Q96A 1OUVA 3CLJA 4N5CA 1ELKA 4JEHA 3FH8A 3BG0B 4GB9A 4BX8A 3IKOB 4GZDA 1E96B 4EECA 2I6HA 3CK9A 3U4TA 1YA0A 4I9EA 1H2UA 4FHJA 2XQ0A 3CVXA 4CGWA 3RRNB 4G2VA 1HZ4A 3AU4A 5G05C 2VGXB 2X6IA 2NXPA 4PH4B 3LPZA 4LUNU 2YQ8A 3ZPJA 5ANLA 4ILIA 3AS4A 1Y6IA 3JUIA 1JWFA 1Y8MA 3Q4AB 3ZYLA 5HI7A 2L9BA 5CMYA 4ANWA 5JJ7A 2WXKA 1VDYA 5LCWC 5EX3A 4JXTA 2V5FA 3ZYKA 3IHVA 3I3NA 2CFZA 2WM9A 3APDA 3IEGA 3VLEA 1MHQA 4MKTA 4BY6A 3VLDA 5LCWJ 1N54A 4OVUA 3FTZA 4CGVA 4MLPA 4J6IA 4ILHB 3D9OA 4I6JA 2LNIA 4GZ5A 5ANRA 4FLHA 3LY9A 4LEUA 3FU5A 4OVVA 2HR2A 1SZAA 3QARA 3MGBA 1FCHA 5G05J 4GYWA 4QFVA 1PC2A 3ZHEB 4ACLA 4BTBA 1EYHA 3AU5A 1L5JA 3RK6A 1FVFA 4GPKA 3MJWA 4U8HA 4ACKA 1WM5A 2WQ7A 4G23A 2DCPA 4HVBA 5BT1A 1P5QA 2MHKA 4KBQA 4IN3B 2NSZA 4ABNA 3FUEA 4C9BB 4KXKB 4HOUA 3FUKA 2FF4A 1A17A 3EIJA 3TGOA 3CGHA 3ML9A 4JVSA 2BTDA 2XRYA 5CHEE 3ZXSA 5BV0A 3N71A 2JEKA 2BF0X 3T8MA 4C0MA 4AP2A 3FEXA 3G2VA 2CHXA 3LXUX 2KATA 4AM9A 1GW6A 2WQ6A 4UWGA 4A1GA 3MA5A 1JUQA 2L0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N2S A;  4BT8 A;  2C0L A;  2BUG A;  2XGM A;  3QWV A;  3S7F A;  5FJY A;  3FP3 A;  2KC7 A;  4EQF A;  3FWV A;  3ZGQ A;  4RG6 A;  4HOT A;  3GZ2 A;  3VTY A;  5JJ6 A;  4JA7 A;  2UWJ G;  3ASG A;  3NF1 A;  4H7Y A;  3TG4 A;  4Y6W A;  3ESK A;  4WND A;  2PQR A;  3LY7 A;  2YHC A;  4N39 A;  4A1S A;  2XCC A;  5A6C A;  2HO1 A;  4BTA A;  4BWR A;  5G04 C;  5G04 J;  3MV2 B;  3RU0 A;  2AVP A;  4B94 A;  3AS5 A;  2L6J A;  5M72 A;  2C2L A;  4JHR A;  1ZBP A;  4Y6C A;  2VYI A;  2Q7F A;  1ZU2 A;  2XCB A;  3CKB A;  5ARF A;  2Y4T A;  3EDT B;  2WQH A;  3CVN A;  3RO2 A;  4GA2 A;  3QKY A;  2PQN A;  3WXX A;  2KCK A;  3CK8 A;  2XEV A;  4J8D A;  5HQ8 A;  4NRH B;  4HOR A;  4J8E A;  4H7X A;  3LCA A;  5KJM A;  3RJV A;  5FZR A;  2LSV A;  4XI9 A;  4I2W A;  1WAO 1;  2VQ2 A;  2XPI A;  4GYY A;  5AYW D;  4AIF A;  3PE3 A;  4YVO A;  5KJN A;  3U3W A;  4UI9 K;  4I2Z A;  3ASH A;  2QFC A;  1ELW A;  1KLX A;  3GYZ A;  3KAE A;  3MKR A;  4G1T A;  3PDN A;  1XNF A;  4F3V A;  4GZ6 A;  3U4T A;  3LYA A;  2VSY A;  4ME2 A;  2GW1 A;  4WUY A;  2VSN A;  4AY5 A;  5CCL A;  3CVP A;  2IFU A;  3RO3 A;  1OUV A;  2PZI A;  3Q15 A;  4N3A A;  4N5C A;  2NC9 A;  4U0Z A;  5KJL A;  4AY6 A;  5A7D B;  4NQ0 A;  3HYM B;  1E96 B;  2KCL A;  2I6H A;  3CK9 A;  3PE4 A;  4GCN A;  2UY1 A;  1KT1 A;  2VGY A;  3E4B A;  4XIF A;  1YA0 A;  4I9E A;  4I17 A;  5FT9 A;  3R9A B;  4N2Q A;  3ASF A;  4I1A A;  3OXG A;  2VGX A;  2JLB A;  4GCO A;  5BNW A;  1ELR A;  4CGW A;  2OOE A;  4JA9 A;  4YND A;  1IYG A;  4G2V A;  1HZ4 A;  4JL0 A;  4J8F A;  4GYO A;  5G05 C;  4HOS A;  2VGX B;  3ZPJ A;  4O6F A;  3LPZ A;  3AS8 A;  2YQ8 A;  5DBK A;  5CCM A;  3AS4 A;  2UY1 B;  3UUX A;  3CK7 A;  3Q4A B;  3Q5M A;  1Y8M A;  4G26 A;  3TG5 A;  2P58 C;  5HI7 A;  3RKV A;  3S7B A;  5JJ7 A;  5LCW C;  5EX3 A;  2Y4U A;  3TAX A;  2V5F A;  3MV3 B;  3Q47 B;  4HOQ A;  2DBA A;  4U07 A;  3IEG A;  4XI0 A;  2C0M A;  3OXL A;  4GA0 A;  4GZ3 A;  3FFL A;  4UI9 C;  5FZS A;  2XGS A;  3SF4 A;  3SZ7 A;  3ULQ A;  3GW4 A;  4WNE A;  3ZN3 A;  5JJT A;  4YVQ C;  2IF4 A;  4WNF A;  5LCW J;  4G25 A;  4UQX A;  5FTP A;  4CGV A;  3BEE A;  2FBN A;  3K9I A;  3O48 A;  5EX0 A;  5C1D A;  3UPV A;  2LNI A;  3OXF A;  4GZ5 A;  5BW8 C;  5DIZ A;  3LY9 A;  4LEU A;  3URZ A;  3VTX A;  3ZHE A;  2WPV A;  2HR2 A;  4J0U A;  1QZ2 A;  3RIB A;  4APO A;  1FCH A;  5EKQ D;  2LSU A;  5G05 J;  2FI7 A;  3QOU A;  1HH8 A;  1PC2 A;  1NA0 A;  1W3B A;  4GA1 A;  4GYW A;  3ZHE B;  4BTB A;  3CEQ A;  3CVL A;  4KYO B;  1NZN A;  2FO7 A;  5FZQ A;  3ASD A;  2KCV A;  3QWP A;  4GPK A;  4RG9 A;  5D0Q D;  1WM5 A;  3UQ3 A;  4G23 A;  3CV0 A;  4CDR A;  1NA3 A;  3ZFW A;  5BT1 A;  2OND A;  1P5Q A;  2MHK A;  2PL2 A;  1KT0 A;  4KBQ A;  4IN3 B;  4ABN A;  1B89 A;  3CVQ A;  4U04 A;  4KXK B;  4HOU A;  3GZ1 A;  3QDN A;  2FF4 A;  1A17 A;  2HYZ A;  3MEK A;  5D0O D;  3TGO A;  3JYS A;  3CKC A;  4WNG A;  4N3C A;  3LKU A;  4BT9 A;  1TJC A;  2FEZ A;  1QQE A;  3LY8 A;  5CHE E;  4I9C A;  3S7D A;  3N71 A;  4UQY A;  5ARG A;  3S7J A;  4W9R A;  5KJK A;  2R5S A;  3QWW A;  3KS2 A;  2KAT A;  4G24 A;  2XGO A;  2E2E A;  4U0S A;  4UQZ A;  4AM9 A;  1HXI A;  4N3B A;  4UI9 J;  3MA5 A;  3Q49 B;  3KD7 A;  4U0U A;  1IHG A;  2J9Q A; 
#chains in the Genus database with same CATH topology
 2C0L A;  3QWV A;  3PEU B;  5ENQ D;  3MX3 A;  2MYO A;  3ZNG A;  3D9J A;  2CG3 A;  2CFU A;  4PS8 A;  1ZB1 A;  4B94 A;  4BSX A;  3T9K A;  5A23 A;  3TXM A;  3KEZ A;  3UMV A;  4FP7 A;  4DI3 A;  1SA5 A;  2I2O A;  2X38 A;  4N5Q A;  5JHA A;  2NC9 A;  2VGY A;  1FPP A;  1HO8 A;  3UM3 A;  5DBK A;  3MKQ B;  4WWP A;  2VTB B;  3HHM A;  1FVH A;  1PAQ A;  1SQM A;  2DBA A;  3C3R A;  3ULY A;  3UIN C;  4GTO A;  1IXV A;  3UPV A;  2WB2 A;  2I1J A;  2V4L A;  3Q9N C;  1NA0 A;  5B3S E;  2ETC A;  3E32 A;  2BKG A;  5EN5 D;  1SW6 A;  2WXN A;  1OWN A;  3JYS A;  4KT6 B;  5D2M C;  1PY1 A;  4F53 A;  3HRA A;  3QJZ A;  3FP3 A;  4EQF A;  2JAB A;  4HOT A;  4I1O B;  3LY7 A;  2YNQ A;  3P2B A;  2HO1 A;  3D3M A;  4NUR A;  5BXU A;  4FUL A;  1U2V G;  1O5M A;  2F8Y A;  1TR4 A;  4U7E B;  4EBA G;  5JMN D;  2DVW A;  2WXF A;  3EDT B;  4P29 A;  3WXX A;  4OAU C;  5J90 A;  4GYY A;  1OY3 D;  3ZYM A;  3L54 A;  2QFC A;  1BPO A;  3NZU A;  5AEN A;  2GW1 A;  4WUY A;  1N52 A;  3FUD A;  5C2Y A;  4AY6 A;  4NQ0 A;  3FTX A;  3ASF A;  4WAF A;  2JLB A;  3L82 A;  1QBQ A;  2Y69 E;  3TWW A;  3FUM A;  3DPY A;  4TXP A;  5CCM A;  4LER A;  2A5E A;  3Q5M A;  3SBT B;  4XE0 A;  5BUZ A;  2WXR A;  3Q7A A;  2EQX A;  1N0R A;  3CHQ A;  4EZK A;  4AOF A;  4UWK A;  5C1D A;  5BV1 A;  3ABM E;  3MYV A;  3URZ A;  3CHS A;  1U3C A;  4KYO B;  5D0Q D;  1UJK A;  4CT0 A;  4JHJ A;  1OWL A;  3PEV B;  2FEZ A;  3Q9U C;  3SHF A;  4EHM A;  2AXU A;  2X6J A;  2WXI A;  2XEH A;  4AV7 A;  2XGM A;  4MS6 A;  1N0Q A;  2L6J A;  3WG7 E;  2VYI A;  5D66 A;  2R03 A;  2WVI A;  3MKQ A;  2WQH A;  3V2O A;  4FJY A;  3CVY A;  1V55 E;  4AVX A;  2IY0 C;  4G11 A;  3D9P A;  2QZA A;  3JXJ A;  1OWO A;  2BKK B;  4LRZ A;  5KNH D;  5AAO A;  5LX8 A;  4GU5 A;  3EU9 A;  4CDM A;  3HYM B;  4GCN A;  4I1M A;  3UM0 A;  2QYU A;  4LNU D;  1H6O A;  1IYG A;  4B8A A;  5IY5 E;  3JQ0 A;  3KEA A;  2CHW A;  3S7B A;  3D9K A;  4JPS A;  1K8K G;  4CCA A;  1S70 B;  1Q2Z A;  3ASO E;  3MCX A;  3V2X A;  3APC A;  3O48 A;  4KVM A;  4DI4 A;  3RIB A;  4A3T A;  3FTU A;  3PZ3 A;  1TNO A;  2KCV A;  3PZ4 A;  1WG0 A;  4DK5 A;  3CV0 A;  2AWI A;  3AG2 E;  2PM6 A;  1UN9 A;  3S7D A;  3SNX A;  4FU3 A;  2ZU6 B;  4RSY A;  4BSZ B;  2CHZ A;  5H7P A;  4G8K A;  5JHB A;  4G26 A;  2B6C A;  4JZY A;  3UM2 A;  1DCE A;  1D8E A;  3TJP A;  3APF A;  4HS2 A;  4GTP A;  1Z3X A;  4BWR A;  5G04 J;  1H0A A;  2P9P G;  1N11 A;  3OAW A;  3B7R L;  4HXI A;  2VSO E;  4LCT A;  2WXL A;  2F8X K;  3ZKJ A;  2XS1 A;  5KCM A;  4ANX A;  1YYH A;  3RRM B;  4F1P A;  4GZ6 A;  1LF8 A;  3W9G A;  2PNN A;  4L23 A;  1BD8 A;  3CLJ A;  5HKP A;  1ELK A;  2I6H A;  4DX7 D;  1YA0 A;  4I9E A;  4FHJ A;  4O1P A;  4G2V A;  3AU4 A;  2VGX B;  4BES A;  3SQV A;  1JWF A;  1S63 A;  1Y8M A;  4HOR A;  2WXK A;  2XZD G;  3AJI A;  4JXT A;  5EX3 A;  3PZ1 A;  3I3N A;  3B7B A;  2KXP C;  5KNG A;  3APD A;  1N95 A;  3UIP C;  1N54 A;  4CGV A;  3D9O A;  2LNI A;  3Q7F A;  4GZ5 A;  1TNU A;  1H6P A;  1SZA A;  1FCH A;  4QFV A;  4BTB A;  1L5J A;  4U8H A;  1WM5 A;  4HVB A;  4ABN A;  4C9B B;  2NSZ A;  3UKU G;  3CGH A;  3ML9 A;  4JVS A;  2QYJ A;  3ZXS A;  3DSU A;  1WDY A;  5BV0 A;  4C0M A;  3LXU X;  2KAT A;  1GW6 A;  2V4H C;  5ENT D;  2L0I A;  4LSZ E;  4U8V D;  1KPS B;  2A4Z A;  4GTT A;  2GRQ B;  3QB2 A;  4APF A;  1IQR A;  1QYM A;  2PQR A;  3Q78 A;  4MRU A;  4DX5 D;  4TRQ A;  3E34 A;  1HG5 A;  1UG3 A;  3CIA A;  1TJF A;  3AAA C;  3O4Z A;  1ZU2 A;  4HNA D;  3G2S A;  5KJM A;  3FEY A;  2DYR E;  4BFR A;  1OWP A;  3ASH A;  3KSL A;  3VLF A;  3DXM G;  2EIL E;  4RQI A;  5FT9 A;  3Q73 A;  1D8D A;  1MX6 A;  4K5B A;  3CVV A;  3UUX A;  4IUL A;  3ISM C;  2Y4U A;  3MV3 B;  2LO6 A;  4KZ0 A;  3ESL A;  4GA0 A;  2P9L G;  3ZN3 A;  3ULQ A;  2WXP A;  4WNE A;  3PRE A;  4YDY A;  2J08 A;  4C48 B;  2WMN A;  2E0I A;  4ATG A;  4J0U A;  2FO7 A;  2RG8 A;  4CDR A;  2V8S E;  3ZFW A;  2WXQ A;  4TXQ A;  4HFG A;  5CRV A;  1E8Z A;  1H19 A;  1OXJ A;  2OEW A;  4HLE A;  3ZRH A;  1HXI A;  3SFX A;  4N3B A;  4CYM D;  2FO1 E;  3KD7 A;  4URK A;  4F6R D;  3ZGQ A;  3FH7 A;  3VTY A;  5JJ6 A;  2RD0 A;  4DPR A;  4NAC A;  3UM1 A;  3D9L A;  1IHB A;  5CBN A;  1E90 A;  3PVL A;  3IV0 A;  4GA2 A;  4M3O A;  3CK8 A;  4I2W A;  3U3W A;  4M7C A;  2XRZ A;  4L7T A;  4ANV A;  3HG0 D;  5FQ4 A;  3AG3 E;  4GTM A;  2IFU A;  2MRI A;  1Z3Y A;  3LVR E;  3FTS A;  2J07 A;  3V30 A;  4BEP A;  1KT1 A;  4YDW A;  5BNW A;  2IOS A;  3B7U X;  4JA9 A;  5AJD A;  2Y3A A;  4XEI G;  3E30 A;  2ZXW E;  3EHN A;  3UT8 A;  2P9I G;  4EPZ A;  4U07 A;  5AIJ A;  3FFL A;  3I4G A;  4WWO A;  3LDZ A;  2FBN A;  5CER B;  4APO A;  3QOU A;  4KZC A;  1W3B A;  4GA1 A;  1O1R A;  1E8W A;  1NZN A;  3UQ3 A;  2EIJ E;  1KT0 A;  3C5R A;  2F0Y A;  1EF1 C;  4BT9 A;  3DSW A;  3V79 K;  3ULE G;  2R05 A;  5E76 A;  4XKC A;  1HS6 A;  4W9R A;  5ENO D;  3NOC D;  4OYS A;  5ENR D;  1DCQ A;  3CVU A;  3PZD A;  4G8L A;  2LXM A;  3EU5 A;  5A6C A;  2XCC A;  4BTA A;  4FHK A;  4U95 D;  1N9A A;  2HE0 A;  2XCB A;  4O60 A;  3TWT A;  4NRH B;  3NBN B;  5KWD A;  4HRN A;  5T8I A;  1JCQ A;  3MKR A;  3X2Q E;  4DX2 A;  1XNF A;  2V0P A;  3RRU A;  1S64 A;  1LTX A;  4YDE A;  3LJ3 A;  3RU0 A;  3E4B A;  4N2Q A;  3S2A A;  2R02 A;  2VGX A;  3FTV A;  5AQA A;  1BI8 B;  1EPU A;  3ZIM A;  4GTV A;  3FY4 A;  3NQP A;  5FZS A;  2WXH A;  5FIO A;  4AEZ C;  1DNP A;  3B13 A;  3L22 A;  5DIZ A;  2OVB A;  3ABK E;  3DSX A;  4I43 A;  5FQ7 A;  4C0E A;  2OVF A;  4RG9 A;  3FU3 A;  2WXJ A;  3U9W A;  3CVW A;  5D0O D;  3DXK G;  4BER A;  3LY8 A;  2OV8 A;  4AJW A;  4Q69 A;  4LG6 A;  2VSX E;  1AWC B;  4CZ2 D;  4U0S A;  4LNB A;  3AG4 E;  3PRZ A;  3T5X A;  3ZW3 A;  3TG4 A;  3HVE B;  4WND A;  1MX2 A;  5G04 C;  2KZT B;  2H6F A;  3BUA A;  3TL5 A;  4TV3 A;  5ENS D;  3E33 A;  3FUI A;  3QKY A;  2PQN A;  5HQ8 A;  2XEV A;  1DVP A;  3PE3 A;  3QC1 A;  1XGW A;  3ML8 A;  2ZIS A;  2R17 C;  1K1B A;  4JD2 G;  4ZHB A;  2FUL A;  2P9K G;  3BG0 B;  4GZD A;  1E96 B;  3CVX A;  3RRN B;  1HZ4 A;  1Z5S C;  4K5C A;  4PH4 B;  5ANL A;  4ILI A;  3Q4A B;  3ZYL A;  2L9B A;  1VDY A;  1TNY A;  3ZYK A;  3IHV A;  4O1O A;  2WM9 A;  3DSV A;  4MKT A;  3VLD A;  5CEA A;  4OVU A;  5CEC B;  4ILH B;  5ANR A;  4FLH A;  3Q79 A;  3FU5 A;  3C3O A;  4GYW A;  1PC2 A;  4DX1 A;  1FVF A;  1KZO A;  2ZGD A;  4G23 A;  1OCO E;  5BT1 A;  1P5Q A;  2MHK A;  4KBQ A;  2XEE A;  4IN3 B;  4KXK B;  1A17 A;  1LD7 A;  1X81 A;  2BTD A;  2BF0 X;  3T8M A;  2CHX A;  2LXL A;  3LJN A;  1TNZ A;  3TWV A;  4A1G A;  3R9M A;  3LEW A;  4BET A;  3IBE A;  3B7T A;  3S7F A;  3P1U A;  3CHO A;  5FJY A;  3IXE A;  3ZU7 B;  2IO2 C;  4Y6W A;  2MOW A;  4B89 A;  2C2L A;  4JHR A;  4JHK A;  2Q7F A;  4J8D A;  1HE8 A;  4IYP A;  3LCA A;  4YVO A;  3DPD A;  3UT4 A;  1N4P A;  4UI9 K;  1K3Z D;  3PUJ A;  4MBG A;  3LYA A;  4ME2 A;  2GRN B;  5CCL A;  3CHM A;  2EIM E;  5KJL A;  4D10 C;  4YVQ C;  2UY1 A;  4I6G A;  3R9A B;  4I1A A;  2I1K A;  4YND A;  4B93 B;  3I4R B;  4HOS A;  3EJN A;  4AXH A;  4F3V A;  2KM4 A;  3PNT B;  4OAV B;  3SGH A;  4HOQ A;  3R7R A;  4UI9 C;  4AIF A;  1JPL A;  2XGS A;  4WNF A;  1TNB A;  3K9I A;  3DEO A;  4V3I A;  2XPZ A;  1QZ2 A;  5EKQ D;  4IRU A;  1G3N B;  2R59 A;  1BI7 B;  3CEQ A;  2J4B A;  2IQC A;  1H6K A;  2PL2 A;  1TYQ G;  2GRO B;  4CDN A;  1SVX A;  3QWW A;  1BU9 A;  3HDX A;  2X6K A;  2J9Q A;  3EHM A;  3QK0 A;  5CMW A;  3DST A;  4A1S A;  5T4Y A;  3TWX A;  4FAD A;  2KCK A;  5BXO A;  3ZEF A;  1OCZ E;  2AXZ A;  1WAO 1;  2VQ2 A;  2XHE A;  5FWQ A;  3ZYQ A;  4CRW A;  4GML A;  4HB5 A;  3D9N A;  1HFA A;  5A7D B;  1MYO A;  3PUK A;  5B1A E;  4I17 A;  3L6A A;  3OXG A;  4GCO A;  4EZL A;  5FQ8 A;  1TN6 A;  2IO3 C;  3SBS A;  4O6F A;  2GRM A;  3SD5 A;  2RFM A;  4L1B A;  1QNF A;  2WXM A;  3Q47 B;  2C0M A;  3SZ7 A;  3HIZ A;  3TWS A;  3PNL B;  3VTX A;  2LSU A;  2P9U G;  4JEU A;  2RKK A;  4GMR A;  1RW2 A;  3QWP A;  3JQ1 A;  4UWL A;  4QQI A;  4U04 A;  3G2T A;  3UI2 A;  3MEK A;  2J8S D;  4JB8 P;  3LKU A;  5ARG A;  4EZJ A;  5KJK A;  2VTB A;  3EUV A;  2LAI A;  4L9P A;  3NZS A;  4R7L A;  4U0U A;  5CBO A;  1RZ4 A;  2KZT A;  3NF1 A;  4X8Q A;  4U96 D;  1Z6T A;  4ZFH A;  4FA6 A;  2AVP A;  5M72 A;  2LAH A;  1BLX B;  2Y4T A;  1MZC A;  3CVN A;  4PS3 A;  3UX4 A;  4ANU A;  4J8E A;  4H7X A;  2LUH A;  4TUM A;  1N4Q A;  4NIK A;  4CEM A;  3E37 A;  2IEJ A;  4HI8 A;  3ZUV B;  3BU8 A;  2VSN A;  2VGE A;  3RO3 A;  4DUI A;  1S0P A;  2KCL A;  3C98 A;  5EIB E;  4GMJ A;  2X6F A;  2B0O E;  1ELR A;  5ITZ F;  4KMO A;  3CQG B;  3GZS A;  4GTS A;  3KSQ A;  5AJL A;  2EIK E;  2BED A;  4HRM B;  3FUJ A;  3SF4 A;  3FU6 A;  4HBD A;  3L08 A;  3IHY A;  5J08 A;  2DYS E;  4CT4 A;  2FI7 A;  4DJA A;  3JUE A;  3CVL A;  3ASD A;  3JCK C;  1NA3 A;  1LD8 A;  2A5U A;  4E6H A;  4WNG A;  4UUC A;  4TUU A;  5BPP A;  4DLQ A;  1TJC A;  4YDO A;  4FJZ A;  2DZN A;  5B1B E;  3L13 A;  4G24 A;  4UQZ A;  2WXG A;  4BT8 A;  1U3D A;  2BUG A;  3FUF A;  2YHC A;  3R7Q A;  2OCC E;  5FQ6 A;  1H2V C;  3CST A;  4L2L A;  5ARF A;  3RO2 A;  3FH5 A;  3RJV A;  4XI9 A;  2IJG X;  2P2C P;  4I6E A;  3L16 A;  2WMO A;  2VSY A;  4DX6 D;  2H6G A;  4Q96 A;  3TWU A;  4JEH A;  4GB9 A;  4BX8 A;  3CK9 A;  3U4T A;  1H2U A;  2XQ0 A;  1O1T A;  4CGW A;  3Q75 A;  2NXP A;  3ZPJ A;  4LUN U;  2YQ8 A;  1D9S A;  1Y6I A;  3JUI A;  4ANW A;  5CMY A;  5LCW C;  2V5F A;  3UIO C;  3IEG A;  4BY6 A;  2DZO A;  2RFA A;  3DRA A;  5AQ7 A;  4I6J A;  1TN7 A;  3LY9 A;  5AQB A;  5G05 J;  1TN8 A;  3ZHE B;  1EYH A;  3RK6 A;  4GPK A;  4ACK A;  2DCP A;  3SY2 A;  1N4S A;  3FUK A;  4AP2 A;  3G2V A;  5CRU A;  2WQ6 A;  4UWG A;  4J7W A;  1JUQ A;  2Y0B G;  4J8S A;  2KC7 A;  5LOZ A;  3I5P A;  4UWF A;  4JA7 A;  2UWJ G;  3ASG A;  4A55 A;  4N39 A;  4RVB A;  3U66 A;  2PM7 A;  3MV2 B;  5KBA A;  1MJ0 A;  3CKB A;  3OTN A;  1OWM A;  3HXD A;  3J5Q B;  1HF8 A;  2M63 A;  5KJN A;  4FC8 A;  2P9N G;  1KLX A;  2ZGG A;  3GYZ A;  3FUL A;  3T8K A;  1EDU A;  3SFZ A;  3FTY A;  2DWZ A;  2PZI A;  4N3A A;  3MZL B;  2VJ8 A;  2R2L A;  3FU0 A;  3PE4 A;  2KBX A;  3EIQ C;  1HG2 A;  4A63 B;  2OOE A;  3U64 A;  3QNK A;  2ILR A;  4JL0 A;  3DBS A;  2GRR B;  1NI1 A;  1JWG A;  2UY1 B;  5AAR A;  3TG5 A;  4ATZ D;  1UN8 A;  3CR3 A;  1MQS A;  1K1A A;  4XI0 A;  3OXL A;  4GZ3 A;  4KVO A;  3TXN A;  3GW4 A;  4G25 A;  4UQX A;  2J49 A;  5EX0 A;  1HU3 A;  1OCR E;  5LP0 A;  3T5V A;  1UJJ A;  5HS0 A;  1INZ A;  1E7U A;  3RAU A;  3LS8 A;  2AW6 A;  3J5P A;  3QDN A;  2HM8 A;  2HYZ A;  2GRP B;  1OCC E;  3LVQ E;  3S7J A;  3PH0 C;  2ETA A;  4ILG A;  1TEZ A;  5JA4 D;  2OEV A;  3Q49 B;  1IHG A;  4K5A B;  4GPM A;  5HRY A;  2IU1 A;  3AS5 A;  4F7A A;  1ZBP A;  4Y6C A;  4RLY A;  1IQU A;  3CHP A;  4B8C B;  5FZR A;  2LSV A;  5E75 A;  1NL4 A;  4U63 A;  4XZ4 A;  1E8Y A;  3PDN A;  2Y1L E;  5EDS A;  4JW1 A;  2GRL A;  2J09 A;  5G55 A;  4U0Z A;  1YMP A;  2I9C A;  3ZVV A;  2V5Q C;  2H6I A;  5CED B;  4BX9 A;  4PUC A;  3L17 A;  3TWR A;  3FUN A;  3C72 A;  3CK7 A;  2AJA A;  1SA4 A;  3RKV A;  1DC2 A;  3BG1 B;  3TAX A;  3G2W A;  3UKR G;  2AXV A;  3SFY A;  5JJT A;  2IF4 A;  1E8X A;  3C3Q A;  3EHR A;  3DSS A;  3BEE A;  3D9I A;  3ZHE A;  2WPV A;  3BQO A;  2IOL A;  2F37 A;  2L0T B;  1HH8 A;  1X5B A;  3D9H A;  5FZQ A;  5T3R A;  2GGF A;  4DLO A;  2OND A;  4UWH A;  2P9S G;  3CVQ A;  4XKB A;  3GZ1 A;  3ENE A;  3CKC A;  4L2Y A;  4N3C A;  3NAW A;  4GTQ A;  1QQE A;  3CHR A;  4I9C A;  2R5S A;  4FLB A;  3KS2 A;  3SO8 A;  2E2E A;  4E85 A;  5AN8 A;  4UI9 J;  5G2N A;  3UT7 A;  2L6B A;  4RG6 A;  3NB2 A;  3GZ2 A;  4H7Y A;  2XS8 A;  1FT1 A;  2H6H A;  3UTM A;  2ION A;  5ENN A;  4U8Y D;  1HX8 A;  4PDX A;  1V54 E;  3ABL E;  4WWN A;  2XPI A;  5AQ9 A;  4HI9 A;  1FT2 A;  3KAE A;  4GZC A;  3FTW A;  4XX5 A;  2XPY A;  2XEN A;  4DRX E;  3Q15 A;  4B0Z A;  4GTR A;  3DEP A;  1N4R A;  1A5E A;  4XIF A;  3PZ2 A;  2X3M A;  3NOG D;  2ZIR A;  4J8F A;  3AS8 A;  1JCR A;  2P58 C;  4F1S A;  2QC9 A;  3CSF A;  3SI5 A;  1NP7 A;  2WXO A;  5EIL A;  3HVE A;  5FTP A;  1O1S A;  2QY7 A;  4LNG A;  3PS6 A;  3OXF A;  4AY5 A;  5BW8 C;  3CQC B;  1E7V A;  4GAA A;  4K0R A;  4K03 A;  3ONL A;  3QAQ A;  3FDH A;  3ONK A;  1B89 A;  1IKN D;  2NYJ A;  2XZT G;  2YIN A;  1MX4 A;  3HXC A;  5FIN A;  3V31 A;  3FUH A;  1UW4 B;  4UQY A;  3DWL G;  2XGO A;  4A3V A;  3TWQ A;  3AG1 E;  4GYO A;  4N2S A;  1N94 A;  1SZ9 A;  3B7S A;  4Q94 A;  3G2U A;  1UOH A;  3FWV A;  4HQD A;  4EBA A;  4TXR A;  2YHE A;  3RSE G;  5EID A;  3ESK A;  2J4D A;  2CG2 A;  1NFI E;  3FHE A;  2DIW A;  3B95 A;  1H2T C;  3F6Q A;  3D9M A;  2ETB A;  3HXE A;  5LFA A;  3ASN E;  3HXF A;  4JC8 A;  3W9F A;  4Z68 A;  5AYW D;  1OT8 A;  2X6H A;  4I2Z A;  1YCS B;  1ELW A;  3EHQ A;  4G1T A;  1WY6 A;  4HRL A;  4PS7 A;  3CVP A;  1OUV A;  4N5C A;  3FH8 A;  3IKO B;  4EEC A;  1JCS A;  3HXB A;  3L9T A;  5G05 C;  2X6I A;  3LPZ A;  3AS4 A;  5JJ7 A;  5HI7 A;  3UXG A;  2EIN E;  2CFZ A;  3VLE A;  1MHQ A;  5LCW J;  3FTZ A;  4MLP A;  4J6I A;  4LEU A;  4OVV A;  2HR2 A;  3JXI A;  3QAR A;  3MGB A;  4ACL A;  3AU5 A;  5ENP D;  3MJW A;  2WQ7 A;  1AP7 A;  3FUE A;  4HOU A;  3ZXP A;  2FF4 A;  1KZP A;  3EIJ A;  3TGO A;  2XRY A;  5CHE E;  5EYP F;  3N71 A;  2JEK A;  3FEX A;  4AM9 A;  4HLL A;  3MA5 A;  5EYL A;  4J8Y A; 
#chains in the Genus database with same CATH homology
 3IBE A;  2C0L A;  3B7T A;  4J8S A;  3QWV A;  3P1U A;  3CHO A;  3S7F A;  5FJY A;  2KC7 A;  5LOZ A;  2A4Z A;  3I5P A;  3QB2 A;  4APF A;  3PEU B;  3MX3 A;  4UWF A;  4JA7 A;  2UWJ G;  3ASG A;  4Y6W A;  3D9J A;  4A55 A;  1IQR A;  2PQR A;  4MRU A;  4N39 A;  2CG3 A;  2CFU A;  4TRQ A;  4PS8 A;  2MOW A;  4RVB A;  3U66 A;  2PM7 A;  1HG5 A;  3MV2 B;  4B94 A;  4B89 A;  2C2L A;  4JHR A;  1UG3 A;  3CIA A;  1TJF A;  3O4Z A;  2Q7F A;  1ZU2 A;  4JHK A;  3CKB A;  3OTN A;  4BSX A;  5A23 A;  3G2S A;  1OWM A;  3TXM A;  3KEZ A;  4J8D A;  3UMV A;  1HE8 A;  4IYP A;  4FP7 A;  3LCA A;  5KJM A;  3FEY A;  4DI3 A;  1HF8 A;  2M63 A;  5KJN A;  4YVO A;  4BFR A;  4FC8 A;  3DPD A;  3UT4 A;  1OWP A;  4UI9 K;  2I2O A;  3ASH A;  1KLX A;  3GYZ A;  3VLF A;  3PUJ A;  2X38 A;  3LYA A;  3FUL A;  4ME2 A;  1EDU A;  3SFZ A;  3FTY A;  5CCL A;  3CHM A;  2PZI A;  4N3A A;  5JHA A;  3MZL B;  2VJ8 A;  2NC9 A;  5KJL A;  4D10 C;  3FU0 A;  4YVQ C;  3PE4 A;  2UY1 A;  2VGY A;  4I6G A;  5FT9 A;  1HO8 A;  3R9A B;  4I1A A;  2I1K A;  3EIQ C;  1HG2 A;  2OOE A;  4YND A;  3I4R B;  3U64 A;  3QNK A;  2ILR A;  4JL0 A;  4HOS A;  3EJN A;  3DBS A;  3CVV A;  5DBK A;  4AXH A;  3MKQ B;  4WWP A;  4F3V A;  1JWG A;  2UY1 B;  3UUX A;  2VTB B;  4IUL A;  3TG5 A;  2KM4 A;  3HHM A;  3PNT B;  2Y4U A;  1UN8 A;  3SGH A;  3CR3 A;  3MV3 B;  4HOQ A;  1FVH A;  1PAQ A;  1SQM A;  2DBA A;  1MQS A;  2LO6 A;  4KZ0 A;  3R7R A;  3ESL A;  4XI0 A;  3OXL A;  4GA0 A;  4GZ3 A;  4UI9 C;  4AIF A;  1JPL A;  2XGS A;  4KVO A;  3TXN A;  2WXP A;  3GW4 A;  4WNE A;  3PRE A;  3ULQ A;  3ZN3 A;  4WNF A;  2J08 A;  4G25 A;  4UQX A;  2J49 A;  5EX0 A;  2WMN A;  1HU3 A;  3K9I A;  3UPV A;  4V3I A;  2XPZ A;  2WB2 A;  2E0I A;  4ATG A;  5LP0 A;  4J0U A;  1QZ2 A;  2I1J A;  1UJJ A;  2V4L A;  3LEW A;  5EKQ D;  3T5V A;  4IRU A;  1NA0 A;  2R59 A;  3CEQ A;  1INZ A;  2FO7 A;  2RG8 A;  1E7U A;  4CDR A;  2V8S E;  2J4B A;  3ZFW A;  2PL2 A;  2IQC A;  1H6K A;  2AW6 A;  2WXQ A;  3LS8 A;  4HFG A;  3QDN A;  2HM8 A;  4CDN A;  2HYZ A;  1E8Z A;  2WXN A;  1H19 A;  1OWN A;  3JYS A;  4HLE A;  4KT6 B;  3ZRH A;  3LVQ E;  3S7J A;  3PH0 C;  3QWW A;  1PY1 A;  4F53 A;  4ILG A;  1TEZ A;  1HXI A;  3HDX A;  4N3B A;  2X6K A;  3Q49 B;  3KD7 A;  1IHG A;  2J9Q A;  3QJZ A;  4URK A;  3EHM A;  3QK0 A;  3FP3 A;  5CMW A;  4EQF A;  3ZGQ A;  3FH7 A;  4HOT A;  3VTY A;  5JJ6 A;  2RD0 A;  4I1O B;  4A1S A;  4DPR A;  3LY7 A;  2YNQ A;  5T4Y A;  3P2B A;  4NAC A;  2HO1 A;  3D3M A;  4NUR A;  4FUL A;  2IU1 A;  3AS5 A;  4F7A A;  3D9L A;  4EBA G;  1ZBP A;  4Y6C A;  1E90 A;  2WXF A;  3PVL A;  4FAD A;  3EDT B;  1IQU A;  3CHP A;  3IV0 A;  4GA2 A;  4M3O A;  4P29 A;  2KCK A;  3CK8 A;  3WXX A;  4B8C B;  3ZEF A;  5J90 A;  5FZR A;  2LSV A;  5E75 A;  4I2W A;  2AXZ A;  1WAO 1;  2VQ2 A;  4GYY A;  2XHE A;  3ZYM A;  5FWQ A;  3ZYQ A;  3L54 A;  4U63 A;  4CRW A;  3U3W A;  2XRZ A;  4XZ4 A;  4L7T A;  1E8Y A;  2QFC A;  1BPO A;  4ANV A;  3PDN A;  5FQ4 A;  3NZU A;  5AEN A;  5EDS A;  2GW1 A;  4JW1 A;  4WUY A;  1N52 A;  2GRL A;  3FUD A;  2J09 A;  4GML A;  5C2Y A;  2IFU A;  2MRI A;  1Z3Y A;  3D9N A;  5G55 A;  4U0Z A;  3LVR E;  4AY6 A;  1HFA A;  3FTS A;  5A7D B;  4NQ0 A;  3FTX A;  2J07 A;  3PUK A;  2I9C A;  1KT1 A;  3ZVV A;  4I17 A;  3ASF A;  3L6A A;  3OXG A;  4WAF A;  4GCO A;  2JLB A;  5BNW A;  2IOS A;  3B7U X;  4JA9 A;  4EZL A;  3FUM A;  5AJD A;  5FQ8 A;  4BX9 A;  4PUC A;  2Y3A A;  3L17 A;  3SBS A;  4O6F A;  2GRM A;  5CCM A;  3SD5 A;  3FUN A;  4LER A;  3CK7 A;  3Q5M A;  3EHN A;  4L1B A;  3RKV A;  3SBT B;  1QNF A;  4XE0 A;  3BG1 B;  3UT8 A;  2WXM A;  3TAX A;  5BUZ A;  2WXR A;  3G2W A;  3Q47 B;  4EPZ A;  4U07 A;  5AIJ A;  2C0M A;  2EQX A;  2AXV A;  3FFL A;  3HIZ A;  3SZ7 A;  3CHQ A;  3I4G A;  4EZK A;  4AOF A;  5JJT A;  2IF4 A;  4WWO A;  1E8X A;  4UWK A;  3LDZ A;  3BEE A;  2FBN A;  5C1D A;  5BV1 A;  3D9I A;  3MYV A;  3ZHE A;  3PNL B;  3URZ A;  3VTX A;  2WPV A;  3CHS A;  2IOL A;  4APO A;  2LSU A;  1U3C A;  3QOU A;  4KZC A;  1HH8 A;  1W3B A;  1X5B A;  2L0T B;  4GA1 A;  4JEU A;  1E8W A;  4KYO B;  1NZN A;  5FZQ A;  5T3R A;  3QWP A;  5D0Q D;  3UQ3 A;  1UJK A;  4CT0 A;  3JQ1 A;  2GGF A;  4JHJ A;  4UWL A;  4DLO A;  2OND A;  1KT0 A;  4UWH A;  3CVQ A;  4XKB A;  1EF1 C;  4U04 A;  3G2T A;  3GZ1 A;  3ENE A;  3MEK A;  3CKC A;  1OWL A;  4L2Y A;  4N3C A;  3LKU A;  4BT9 A;  3PEV B;  2FEZ A;  1QQE A;  3CHR A;  4I9C A;  3SHF A;  5ARG A;  4EZJ A;  5E76 A;  4XKC A;  1HS6 A;  4W9R A;  2AXU A;  2R5S A;  4FLB A;  3KS2 A;  5KJK A;  2VTB A;  2E2E A;  2X6J A;  4E85 A;  2LAI A;  4OYS A;  3NZS A;  2WXI A;  4UI9 J;  4R7L A;  4AV7 A;  4U0U A;  5G2N A;  3UT7 A;  3CVU A;  2XGM A;  4MS6 A;  3PZD A;  4RG6 A;  2KZT A;  3GZ2 A;  3NF1 A;  4H7Y A;  5A6C A;  1Z6T A;  2XCC A;  4BTA A;  4FA6 A;  4FHK A;  2ION A;  5ENN A;  2AVP A;  5M72 A;  2L6J A;  2LAH A;  2VYI A;  2XCB A;  1HX8 A;  2WVI A;  2Y4T A;  3MKQ A;  2WQH A;  3CVN A;  4PDX A;  4FJY A;  4PS3 A;  3UX4 A;  3CVY A;  4ANU A;  4NRH B;  4J8E A;  4H7X A;  4AVX A;  4WWN A;  2XPI A;  4G11 A;  4CEM A;  3D9P A;  5T8I A;  3MKR A;  3KAE A;  1XNF A;  3FTW A;  4GZC A;  4XX5 A;  2V0P A;  2XPY A;  3RRU A;  1OWO A;  2VSN A;  4LRZ A;  5LX8 A;  3RO3 A;  3Q15 A;  4GU5 A;  4B0Z A;  1S0P A;  4CDM A;  3HYM B;  2KCL A;  4GCN A;  3C98 A;  3LJ3 A;  3RU0 A;  4XIF A;  3E4B A;  4I1M A;  2X3M A;  4GMJ A;  4N2Q A;  2X6F A;  3S2A A;  2VGX A;  3FTV A;  1ELR A;  4KMO A;  1IYG A;  1EPU A;  4B8A A;  4J8F A;  3CQG B;  3GZS A;  3JQ0 A;  3ZIM A;  3AS8 A;  5AJL A;  2CHW A;  2P58 C;  3FY4 A;  3S7B A;  3D9K A;  4F1S A;  3CSF A;  4JPS A;  3SI5 A;  3NQP A;  4CCA A;  3FUJ A;  1NP7 A;  3SF4 A;  5FZS A;  3FU6 A;  2WXH A;  2WXO A;  3HVE A;  5FTP A;  3MCX A;  2QY7 A;  3L08 A;  4AEZ C;  1DNP A;  3IHY A;  3PS6 A;  3APC A;  3O48 A;  4KVM A;  4DI4 A;  3B13 A;  3L22 A;  3OXF A;  5BW8 C;  4AY5 A;  5DIZ A;  5J08 A;  2OVB A;  3RIB A;  3CQC B;  4I43 A;  4CT4 A;  4A3T A;  2FI7 A;  5FQ7 A;  1E7V A;  4DJA A;  3FTU A;  3CVL A;  2OVF A;  4C0E A;  4GAA A;  3ASD A;  2KCV A;  4DK5 A;  4K0R A;  4RG9 A;  3JCK C;  3FU3 A;  3CV0 A;  4K03 A;  3ONL A;  1NA3 A;  3QAQ A;  3FDH A;  2A5U A;  3ONK A;  1B89 A;  2WXJ A;  3U9W A;  3CVW A;  4E6H A;  2AWI A;  2YIN A;  5D0O D;  2PM6 A;  4WNG A;  4TUU A;  5BPP A;  4DLQ A;  1TJC A;  1UN9 A;  3FUH A;  3LY8 A;  3S7D A;  4FJZ A;  3SNX A;  4FU3 A;  1UW4 B;  4UQY A;  2OV8 A;  2ZU6 B;  4AJW A;  4Q69 A;  2VSX E;  4RSY A;  2CHZ A;  3L13 A;  2XGO A;  4G24 A;  4U0S A;  4UQZ A;  4A3V A;  2WXG A;  4G26 A;  5JHB A;  3PRZ A;  4GYO A;  4JZY A;  4BT8 A;  1U3D A;  3T5X A;  4N2S A;  2BUG A;  1SZ9 A;  3B7S A;  4Q94 A;  3G2U A;  3TJP A;  3FWV A;  4EBA A;  3ZW3 A;  3APF A;  2YHE A;  3FUF A;  3TG4 A;  4HS2 A;  3ESK A;  3HVE B;  2J4D A;  4WND A;  1Z3X A;  2YHC A;  3R7Q A;  2CG2 A;  3FHE A;  5G04 C;  2KZT B;  2DIW A;  5G04 J;  1H0A A;  4BWR A;  3TL5 A;  1H2T C;  4TV3 A;  5FQ6 A;  3OAW A;  3B7R L;  1H2V C;  3CST A;  4HXI A;  3FUI A;  4L2L A;  5ARF A;  3RO2 A;  2VSO E;  3QKY A;  2PQN A;  3FH5 A;  4LCT A;  2WXL A;  2XEV A;  3D9M A;  5HQ8 A;  4HOR A;  5LFA A;  1DVP A;  4JC8 A;  3RJV A;  4XI9 A;  5KCM A;  5AYW D;  3PE3 A;  2X6H A;  2IJG X;  4ANX A;  3RRM B;  4I2Z A;  3QC1 A;  1XGW A;  1ELW A;  4I6E A;  4G1T A;  3ML8 A;  3L16 A;  4GZ6 A;  2WMO A;  2VSY A;  1LF8 A;  1WY6 A;  2R17 C;  4PS7 A;  3CVP A;  2FUL A;  4L23 A;  4Q96 A;  1OUV A;  3CLJ A;  4N5C A;  1ELK A;  4JEH A;  3FH8 A;  3BG0 B;  4GB9 A;  4BX8 A;  3IKO B;  4GZD A;  1E96 B;  4EEC A;  2I6H A;  3CK9 A;  3U4T A;  1YA0 A;  4I9E A;  1H2U A;  4FHJ A;  2XQ0 A;  3CVX A;  4CGW A;  3RRN B;  4G2V A;  1HZ4 A;  3AU4 A;  5G05 C;  2VGX B;  2X6I A;  2NXP A;  4PH4 B;  3LPZ A;  4LUN U;  2YQ8 A;  3ZPJ A;  5ANL A;  4ILI A;  3AS4 A;  1Y6I A;  3JUI A;  1JWF A;  1Y8M A;  3Q4A B;  3ZYL A;  5HI7 A;  2L9B A;  5CMY A;  4ANW A;  5JJ7 A;  2WXK A;  1VDY A;  5LCW C;  5EX3 A;  4JXT A;  2V5F A;  3ZYK A;  3IHV A;  3I3N A;  2CFZ A;  2WM9 A;  3APD A;  3IEG A;  3VLE A;  1MHQ A;  4MKT A;  4BY6 A;  3VLD A;  5LCW J;  1N54 A;  4OVU A;  3FTZ A;  4CGV A;  4MLP A;  4J6I A;  4ILH B;  3D9O A;  4I6J A;  2LNI A;  4GZ5 A;  5ANR A;  4FLH A;  3LY9 A;  4LEU A;  3FU5 A;  4OVV A;  2HR2 A;  1SZA A;  3QAR A;  3MGB A;  1FCH A;  5G05 J;  4GYW A;  4QFV A;  1PC2 A;  3ZHE B;  4ACL A;  4BTB A;  1EYH A;  3AU5 A;  1L5J A;  3RK6 A;  1FVF A;  4GPK A;  3MJW A;  4U8H A;  4ACK A;  1WM5 A;  2WQ7 A;  4G23 A;  2DCP A;  4HVB A;  5BT1 A;  1P5Q A;  2MHK A;  4KBQ A;  4IN3 B;  2NSZ A;  4ABN A;  3FUE A;  4C9B B;  4KXK B;  4HOU A;  3FUK A;  2FF4 A;  1A17 A;  3EIJ A;  3TGO A;  3CGH A;  3ML9 A;  4JVS A;  2BTD A;  2XRY A;  5CHE E;  3ZXS A;  5BV0 A;  3N71 A;  2JEK A;  2BF0 X;  3T8M A;  4C0M A;  4AP2 A;  3FEX A;  3G2V A;  2CHX A;  3LXU X;  2KAT A;  4AM9 A;  1GW6 A;  2WQ6 A;  4UWG A;  4A1G A;  3MA5 A;  1JUQ A;  2L0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...