5FZQA

Designed tpr protein m4n
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
106
structure length
106
Chain Sequence
NSIKTLSNLANLLAQEGKAEEAIKYMRKAVSLDPNNIKTLSNLANLLAQEGKAEEAIKYMRKAVSLDPNNIKTLSNLAVLLAQEGKAEEAIKYMRKAVSLIDKAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DESIGNED TPR PROTEIN
publication title Origin of a folded repeat protein from an intrinsically disordered ancestor.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Unknown function
total genus 45
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5fzqA00
5CHEE 3CKBA 2XPIA 2UY1A 1WM5A 5EX3A 3OXFA 2WPVA 4I17A 4GA2A 4ABNA 4O6FA 5EKQD 1HXIA 1Y8MA 4JA7A 4YNDA 3QKYA 4H7YA 3LY9A 2NC9A 4U0ZA 3SZ7A 5DIZA 2HR2A 1ZU2A 3TG5A 2J9QA 5D0OD 3PE3A 2VSYA 2PQRA 3GYZA 4BTBA 3LCAA 5KJKA 1QZ2A 3QDNA 4GA1A 3NF1A 3URZA 4N3AA 4BTAA 3GW4A 2XEVA 4JL0A 3Q15A 4G1TA 2FI7A 3KD7A 3U3WA 2L6JA 4NRHB 2VGXA 2Q7FA 3MA5A 3RO2A 2VGYA 3LPZA 5G05C 1ELWA 1WAO1 1NZNA 2P58C 3LYAA 4U0UA 4N5CA 4JA9A 3S7FA 3Q5MA 2LSUA 3Q49B 4U07A 4HOTA 2XGOA 5G04J 1TJCA 1W3BA 2BUGA 1PC2A 4GCOA 1FCHA 5M72A 5BT1A 4UQYA 4J0UA 4KYOB 4KBQA 5CCLA 2AVPA 3ZPJA 5JJTA 3UQ3A 4HORA 4UQXA 2JLBA 1B89A 4GCNA 4UI9C 4BT8A 3ASDA 4F3VA 4N39A 3JYSA 3Q4AB 2XGMA 4GPKA 2LNIA 3UPVA 3FFLA 4N3BA 4CGVA 1KLXA 5LCWC 1XNFA 3OXLA 4I9CA 5ARGA 3GZ1A 2C0LA 3TAXA 5FTPA 5FT9A 2FF4A 2HO1A 2HYZA 5HQ8A 3IEGA 4I2WA 2DBAA 1QQEA 4CDRA 4WUYA 4GA0A 3ASGA 1NA0A 4W9RA 3K9IA 3R9AB 3CK7A 2ONDA 5KJLA 3UUXA 3RJVA 2QFCA 3CK8A 4A1SA 4ME2A 4I2ZA 4YVQC 3LKUA 3CVLA 3QWWA 2VYIA 3FWVA 3BEEA 3PE4A 3FP3A 5BNWA 2IF4A 3WXXA 4HOQA 4Y6CA 3RKVA 2C0MA 5BW8C 2KATA 4WNFA 3SF4A 2XGSA 2Y4UA 5AYWD 3E4BA 2XCBA 1A17A 3VTXA 3N71A 2PZIA 3ASHA 3CK9A 4AM9A 4H7XA 2V5FA 4B94A 3AS5A 4G2VA 5JJ6A 1ZBPA 4J8FA 4RG6A 4EQFA 4AY5A 2UY1B 4XI9A 4APOA 3RU0A 3CVNA 4GZ6A 2IFUA 3MV3B 5G04C 3EDTB 4U04A 4XI0A 3MEKA 4LEUA 5KJMA 5HI7A 4Y6WA 2I6HA 4N2QA 3ZGQA 4BWRA 3QOUA 3ZN3A 2E2EA 3QWVA 5C1DA 1P5QA 2PQNA 5FZSA 4UQZA 3MKRA 3GZ2A 3U4TA 2WQHA 3ASFA 4J8EA 5A6CA 1KT0A 3CVQA 4AIFA 4HOUA 4G26A 3ULQA 5EX0A 3ZFWA 4GZ5A 5FZRA 2FO7A 4UI9K 3ESKA 3S7JA 1E96B 4G25A 2GW1A 3S7DA 3LY8A 3ZHEB 4G24A 4XIFA 3TG4A 4NQ0A 4HOSA 5FZQA 2PL2A 3CEQA 2VQ2A 4GYYA 4IN3B 4YVOA 2MHKA 2UWJG 3QWPA 4U0SA 3CV0A 1IYGA 5DBKA 2R5SA 4I9EA 3HYMB 2FBNA 3OXGA 2KCLA 5G05J 3KS2A 1KT1A 4BT9A 4GYOA 1HH8A 3Q47B 2VSNA 1IHGA 1HZ4A 2LSVA 5KJNA 3LY7A 2YHCA 4WNEA 1YA0A 4GYWA 3RIBA 5JJ7A 3VTYA 4I1AA 3ZHEA 5ARFA 3CKCA 5A7DB 3S7BA 5D0QD 4CGWA 4UI9J 3TGOA 2FEZA 2C2LA 2KCKA 4JHRA 4N2SA 3AS8A 4GZ3A 3MV2B 4RG9A 4J8DA 1NA3A 2OOEA 4WNGA 3PDNA 4WNDA 5CCMA 5LCWJ 2Y4TA 3RO3A 3KAEA 2YQ8A 1ELRA 3O48A 5FJYA 2XCCA 4AY6A 2KCVA 4G23A 4N3CA 3AS4A 4KXKB 2VGXB 1OUVA 3CVPA 2KC7A
chains in the Genus database with same CATH superfamily
2KZTA 2XPIA 1WM5A 5EX3A 2WXRA 2ZISA 4I17A 1MX2A 2WXMA 3EUVA 3HXCA 1HXIA 4HXIA 1K1BA 4IYPA 3ZW3A 1PY1A 4P29A 1N94A 4I1MA 2XQ0A 1OT8A 4HLLA 5ENRD 5D0OD 2OCCE 2VSYA 2PQRA 4BTBA 3LCAA 3CVWA 4L9PA 3B7SA 1IKND 4BTAA 3GW4A 4JL0A 1HFAA 3L13A 2FI7A 3KD7A 3U3WA 1GW6A 3NAWA 4NRHB 1MHQA 4ILHB 4NACA 2XZDG 1Z3YA 4CYMD 1WAO1 4RSYA 3DSTA 2A4ZA 2DVWA 3CHQA 4N5CA 1OCCE 4WWPA 5ENQD 4C0MA 3SD5A 2YINA 4UWFA 2GRPB 3DSWA 2P9KG 2MRIA 4DLOA 1PC2A 1JCRA 1FCHA 4HI9A 3TWVA 1TN8A 5BT1A 4U96D 3D9JA 5CCLA 5JJTA 4HORA 1B89A 1TR4A 1WY6A 5LOZA 4F3VA 2LAIA 1UJJA 4GTVA 3C3OA 3PREA 3E34A 4DX2A 5T8IA 4N3BA 4CGVA 3FTYA 2P2CP 1EYHA 3FTWA 4JHKA 4BETA 3TAXA 2EIJE 2ETAA 1OWOA 3RRUA 1U3DA 3NZUA 4WWNA 4LSZE 3TWUA 1DC2A 1TN7A 1BD8A 3CIAA 3FEXA 3ONKA 4BERA 4B93B 3ZUVB 3HVEA 3FUFA 4OYSA 3G2UA 5CEAA 2ONDA 5HS0A 3RJVA 5EDSA 4I43A 4A1SA 4ME2A 4YVQC 2RFAA 2L0TB 3CVLA 5B1BE 3PE4A 4OVVA 2IF4A 2R17C 2F8XK 2C0MA 3HIZA 4TRQA 3FUNA 3RRMB 3SF4A 3EHMA 3G2WA 2J09A 2WXHA 4GB9A 3E4BA 1A17A 4JD2G 3CK9A 3SFZA 2V5FA 3G2SA 4XKBA 4KMOA 5ANRA 4YDEA 4MBGA 4AP2A 4AY5A 3UT4A 1FT2A 1INZA 4QFVA 2FO1E 4FLHA 4KVMA 4XI9A 3EU9A 2IFUA 1ELKA 5CRUA 3WG7E 4BX8A 3MEKA 4LEUA 4IULA 5BV0A 3DSXA 2I2OA 3UTMA 4Y6WA 2I6HA 1DCEA 3FEYA 1L5JA 4BFRA 4BWRA 4UWGA 2BEDA 3UKUG 2AJAA 5C1DA 1P5QA 2XPYA 3AJIA 1IHBA 4UUCA 2MOWA 1JCSA 4FJZA 4UQZA 3C72A 3MKRA 1H6OA 2ZXWE 3FTVA 3SQVA 5CEDB 3MZLB 1AWCB 4WWOA 1TJFA 1OWLA 2ETCA 3L16A 1OCOE 4URKA 3OAWA 5FZRA 5T4YA 3S7DA 3LY8A 2DYSE 3PH0C 2KBXA 4HB5A 1WG0A 1X81A 4JEUA 5FZQA 2Y3AA 1UN9A 4G8KA 2VQ2A 2WM9A 3KSQA 1SA5A 2MHKA 1N52A 2P9LG 3APFA 1FT1A 3CV0A 1IYGA 3ZEFA 3AG2E 4GTQA 2EILE 2XZTG 3G2TA 3FU3A 3AU5A 3ZNGA 5G05J 1KT1A 3TWXA 4DX6D 1MX6A 4J6IA 2E0IA 3L17A 3PZDA 1IHGA 1HZ4A 1BI8B 5KJNA 3BU8A 2X6JA 3U9WA 4FC8A 2IOSA 4WNEA 3R9MA 2BKKB 4B0ZA 4CRWA 3DWLG 3GZSA 2HM8A 5JJ7A 1N4QA 4I1AA 4GTRA 1OCRE 3JXJA 4HFGA 4XZ4A 3ULYA 3CKCA 2CG2A 5A7DB 3S7BA 4UI9J 1KZOA 1ZB1A 2FEZA 3BG0B 3ZKJA 2C2LA 2GRRB 5FINA 4I6GA 3FH8A 4BSZB 3UM2A 1Z3XA 5JHAA 5CCMA 5AIJA 5FJYA 4GMJA 1VDYA 1D8EA 2KCVA 4JHJA 1JWFA 3UT8A 1YYHA 4G8LA 5ENOD 2F37A 5CHEE 3CKBA 2UY1A 5C2YA 2WPVA 4O1PA 4HRMB 3PZ4A 4O6FA 3DPDA 1H6KA 3V2XA 3ABLE 3L9TA 4EBAA 4YNDA 3TWWA 2NSZA 3CHPA 4ANVA 4B8CB 4DI4A 3B7UX 2FULA 4A63B 1AP7A 4U0ZA 2RD0A 5D2MC 3SZ7A 5DIZA 3ZYKA 2HR2A 4LNUD 3TG5A 3Q9NC 2J9QA 1HO8A 2YNQA 3L6AA 5KJKA 4YDOA 2V5QC 3NF1A 3RRNB 3URZA 2XEVA 4CZ2D 1S0PA 3Q15A 4LERA 4D10C 3Q9UC 1IXVA 1TN6A 2L6JA 5AQ9A 3APDA 3TXMA 2Q7FA 3W9FA 4DUIA 3VLDA 3NB2A 2F0YA 4GAAA 2Y1LE 5G05C 2J4DA 3ESLA 2ILRA 4HS2A 2P58C 4F1PA 4U0UA 3ZXPA 5KWDA 3MCXA 3FUDA 3Q5MA 4HOTA 3Q79A 5G04J 4GCOA 2NYJA 3QB2A 3LJNA 2BTDA 1N4PA 2H6GA 1E8XA 4GZCA 2AVPA 1G3NB 4LRZA 2DCPA 2JLBA 4UI9C 2A5EA 3ASDA 3AG3E 3SHFA 3Q4AB 2WXOA 2XGMA 1SVXA 4ILGA 2LNIA 2B0OE 3UPVA 3FY4A 1TYQG 1KLXA 4ANXA 3UX4A 4I9CA 3U66A 5ARGA 2Y0BG 5FT9A 2FF4A 2HO1A 5J90A 1N0RA 3CGHA 4FU3A 2PNNA 4I2WA 3C98A 3MJWA 4TUUA 3T8KA 5BXUA 3B95A 3ASGA 1NA0A 3PZ1A 3E30A 2V0PA 2QYJA 1EDUA 1A5EA 3R9AB 3TWTA 5KJLA 2IONA 2QFCA 3PZ2A 1IQUA 4V3IA 3FTUA 3HXEA 4UWHA 1KZPA 3FP3A 4AJWA 1OCZE 2R59A 1FPPA 2DZOA 3FU6A 5G55A 3RAUA 4I6EA 2IY0C 4WNFA 4LUNU 4FADA 3G2VA 1HU3A 4E6HA 1D8DA 4LG6A 4N5QA 3ZU7B 3R7RA 2WXJA 2QC9A 5AARA 2PZIA 3ASHA 4APFA 2A5UA 1HF8A 2CHXA 4C0EA 3NQPA 4DJAA 5CECB 4PS7A 1E8WA 4G2VA 5JJ6A 4J8FA 4RG6A 3V30A 1Q2ZA 2ZIRA 3Q78A 2M63A 2XEHA 3TWRA 1HE8A 3UI2A 3RU0A 3EIQC 4GZ6A 5G04C 4LNBA 3EDTB 3PUKA 4U04A 3FTZA 2GRLA 2MYOA 3CQGB 3D9MA 4JC8A 3UXGA 4PS8A 5FWQA 3HHMA 5HI7A 4JEHA 5FQ8A 4LCTA 1QBQA 3JQ1A 4N2QA 1RZ4A 3CHSA 3D9HA 2E2EA 3FH5A 4JZYA 2PQNA 4NIKA 5CRVA 5FZSA 5LFAA 4FHKA 2XHEA 4JPSA 4XEIG 3HG0D 5B3SE 1MX4A 4KVOA 2X38A 3GZ2A 2WXIA 3PS6A 2I9CA 1JPLA 3W9GA 1LD7A 1TNZA 3PVLA 1KT0A 4NURA 2YHEA 4AIFA 1SZ9A 5CMYA 3ULQA 3ZFWA 4JW1A 3T8MA 1N0QA 4UI9K 2KM4A 1UG3A 3S7JA 5HKPA 2X6HA 4EZJA 3EHRA 5FIOA 2VTBA 5G2NA 3SI5A 3TXNA 5EYPF 3ABKE 5FQ7A 5CBNA 4YVOA 5EILA 4U0SA 3UKRG 3EU5A 4B89A 3AAAC 5LP0A 1TNOA 2H6IA 4F1SA 3QNKA 4HBDA 4GYOA 3Q47B 3LVQE 2VSNA 4CDNA 2LSVA 4E85A 1N11A 3UINC 2WMOA 1OXJA 3SGHA 3LY7A 2YHCA 4DX7D 1Z6TA 3DPYA 4HVBA 3RIBA 3HVEB 4PS3A 1TNUA 4Z68A 3VTYA 3UIPC 5D0QD 3JUIA 3CHOA 4MS6A 4A3VA 2KCKA 3R7QA 4DX1A 3DBSA 2BF0X 3MV2B 2JEKA 5ENTD 2OOEA 3DXKG 1EPUA 4DI3A 2YQ8A 3O48A 1H19A 2X3MA 4AY6A 4N3CA 5AENA 5ENNA 2VGXB 4XE0A 4K0RA 4A1GA 1OWMA 3HXBA 1SZAA 3O4ZA 4OVUA 2R03A 2WXNA 4ANWA 4EBAG 1YMPA 4GA2A 4AEZC 2QY7A 2R2LA 3ULEG 5EKQD 1MQSA 1Y8MA 1OWPA 1LTXA 1QYMA 4JA7A 3L82A 1K1AA 5JMND 3BQOA 3KEAA 1E7VA 3PRZA 3AG4E 3QKYA 2WXKA 3LY9A 2NC9A 2I1KA 1DVPA 2DIWA 4DPRA 2F8YA 5JHBA 2OEWA 2IO2C 2PM7A 5A23A 3Q75A 1ZU2A 2RFMA 4GMRA 1RW2A 4ATGA 3GYZA 4WAFA 2V4LA 1QZ2A 3QDNA 4GA1A 4N3AA 2LXLA 2WQ7A 3PUJA 3B13A 1S63A 4JXTA 5AQAA 5FQ4A 4J8YA 3RO2A 3LPZA 3UM1A 5ANLA 1NZNA 3FU0A 4YDWA 2B6CA 3L54A 4GTPA 2BKGA 1TJCA 1W3BA 4EZKA 2BUGA 4TXPA 5M72A 1N95A 4ZFHA 1MYOA 3D3MA 3D9KA 4UQYA 4AOFA 2XENA 3KSLA 3SFXA 3UQ3A 4FLBA 4GCNA 4BT8A 4HRLA 3LJ3A 4N39A 1K8KG 1N54A 3BG1B 1SW6A 4BSXA 3FFLA 3FUMA 5KNHD 1NL4A 1QNFA 3ABME 1XNFA 2ZU6B 3ZXSA 5BUZA 3FULA 4IRUA 3GZ1A 2C0LA 5FTPA 4UWLA 2HYZA 3D9LA 3LXUX 5HQ8A 3QK0A 2VSXE 4L1BA 2DBAA 3UM0A 2KXPC 4GU5A 1QQEA 4CDRA 3QC1A 2AWIA 4U7EB 3B7BA 4GA0A 3F6QA 4W9RA 3DEOA 3ZYQA 3V2OA 3UMVA 4G11A 2WXPA 3CVUA 3CK8A 2HE0A 1DNPA 3ZYMA 4GTTA 3LKUA 3LVRE 2H6FA 3DSUA 1TEZA 2IU1A 1BLXB 3FWVA 3BEEA 4F53A 1DCQA 4C9BB 2GGFA 3WXXA 5AJDA 4HOQA 3FHEA 4Y6CA 3RKVA 5BW8C 2KATA 4DRXE 4HNAD 2J4BA 4CEMA 3ML8A 3I4RB 1X5BA 4HLEA 4EHMA 3N71A 2V4HC 4AM9A 3CR3A 2Y69E 3HDXA 1BPOA 4B94A 3DSSA 1ZBPA 3T5XA 2UY1B 3EHQA 3MKQB 4FJYA 5H7PA 2WVIA 3J5QB 3MV3B 3CSTA 3RSEG 3IV0A 4CDMA 2OV8A 1JWGA 4ANUA 2VSOE 3DXMG 1S70B 4L2LA 5AJLA 1TNBA 5IY5E 1MZCA 3D9PA 3TJPA 4FA6A 3AG1E 3ZN3A 2H6HA 2CHZA 4YDYA 2J07A 2AXVA 3UIOC 2CFUA 3I5PA 1H2TC 1O1SA 4GZDA 3ISMC 4RLYA 4K5AB 1O5MA 3JUEA 3JXIA 3X2QE 4L2YA 3FUKA 2WQHA 3FTSA 4ILIA 3J5PA 5A6CA 4Q96A 3P1UA 2VGEA 4HOUA 4G26A 3FUIA 5EX0A 1OWNA 5KBAA 2GRQB 3OTNA 4GZ5A 1E8ZA 4BY6A 5CERB 1HG2A 4J7WA 5E75A 5BPPA 3ZHEB 4G24A 2ZGGA 4QQIA 4R7LA 4XIFA 4BEPA 4NQ0A 4ATZD 4O1OA 3JQ0A 4IN3B 1OY3D 3JCKC 3B7TA 2UWJG 4CCAA 2EINE 4ZHBA 5B1AE 4KZCA 3L22A 4AV7A 5DBKA 3CVYA 5HRYA 2XEEA 3FDHA 4K03A 1SA4A 5CBOA 2IOLA 4TUMA 3HYMB 2FBNA 4RVBA 4C48B 2KCLA 2OVFA 4MKTA 3QARA 1U2VG 2V8SE 1HH8A 4MRUA 2KZTB 4XX5A 2QYUA 4AXHA 3MYVA 1H0AA 1YA0A 3IBEA 4GYWA 5FQ6A 1NI1A 5LX8A 2ETBA 1HG5A 4OAVB 4DLQA 1UOHA 1MJ0A 2WXFA 4JHRA 4GZ3A 2XPZA 4RG9A 4J8DA 4FP7A 4WNGA 3DRAA 2IO3C 3PDNA 2J49A 5LCWJ 2WQ6A 3RO3A 3KAEA 1ELRA 3E33A 2XCCA 3I3NA 3AS4A 4KXKB 4U95D 3SBTB 3ZYLA 1OUVA 2KC7A 5CMWA 1KPSB 1HS6A 4O60A 3OXFA 3Q73A 3NOCD 4ACLA 4ABNA 4U8HA 2EIKE 3PEUB 2LXMA 3D9NA 4HQDA 4H7YA 1V55E 2AXZA 4XKCA 4A3TA 3RK6A 3P2BA 2XS8A 3SBSA 4GMLA 4I6JA 3PE3A 4I1OB 3I4GA 3APCA 1FVHA 1NFIE 2GRMA 4G1TA 1HX8A 4X8QA 4U8VD 4KZ0A 2VGXA 3KEZA 3L08A 4DK5A 3MA5A 2VGYA 1ELWA 5EYLA 3LYAA 2LAHA 2OEVA 4J8SA 4JA9A 3S7FA 3FH7A 2OVBA 4GTOA 3U64A 2LSUA 3Q49B 3NOGD 4U07A 3EJNA 2XGOA 4EPZA 1H2UA 4AVXA 3UT7A 2I1JA 2XS1A 1XGWA 5KNGA 2LUHA 4J0UA 4KYOB 4KBQA 4PUCA 3ZPJA 4RQIA 3TL5A 4UQXA 4GTSA 3Q7AA 3DEPA 3V79K 3JYSA 5E76A 5KCMA 2VTBB 3Q7FA 4GPKA 3LDZA 3PZ3A 3QJZA 4TXRA 1UJKA 3MX3A 5LCWC 2EQXA 1WDYA 1YCSB 3TWQA 2X6KA 3OXLA 2R05A 5ENSD 1Z5SC 3TWSA 4L23A 4KT6B 3IEGA 3UM3A 4CT0A 2RKKA 4Q69A 3EIJA 4WUYA 2GROB 1BU9A 1TNYA 3PNTB 3K9IA 3ZIMA 4B8AA 3CK7A 5BXOA 3C5RA 3UUXA 4GTMA 4PH4B 3CVXA 4TV3A 4I2ZA 4F6RD 1E7UA 2IJGX 3QWWA 2VYIA 3CLJA 4U63A 1JUQA 3FUJA 2L6BA 3QAQA 4L7TA 1JCQA 3IHYA 2WXGA 5BNWA 3FUEA 2X6FA 3T9KA 3FU5A 4M7CA 5EIDA 4LNGA 3HXDA 4Q94A 5D66A 2P9SG 3CHMA 1UN8A 1O1TA 5JA4D 2XGSA 1PAQA 4JB8P 2Y4UA 3ASOE 5AYWD 3IKOB 2XCBA 3ASNE 4ACKA 3VTXA 3VLEA 4UWKA 5AAOA 3ONLA 3SFYA 2WXLA 3CSFA 4H7XA 1LF8A 2DWZA 2DZNA 5EIBE 4U8YD 3AS5A 3LS8A 3ENEA 4EQFA 2L0IA 3EHNA 5AQBA 4APOA 3CVNA 1NP7A 3FUHA 5EN5D 4A55A 2WB2A 3PNLB 3IXEA 4XI0A 1SQMA 5KJMA 4K5BA 1FVFA 1LD8A 3T5VA 2IQCA 4BESA 1U3CA 3ZGQA 1N9AA 1O1RA 3QOUA 4TXQA 3QWVA 3NZSA 4FHJA 3E37A 3ML9A 1K3ZD 1V54E 1N4SA 1H6PA 4HRNA 3HRAA 2WMNA 2NXPA 4OAUC 3MGBA 3LEWA 4MLPA 3U4TA 1N4RA 2CHWA 2WXQA 3ASFA 4J8EA 4M3OA 2QZAA 3CVQA 3NBNB 5ITZF 3MKQA 3CHRA 1Y6IA 2J08A 2P9PG 3PEVB 4EZLA 1S64A 5BV1A 2FO7A 5AN8A 3ESKA 1E96B 4G25A 3ZRHA 2GW1A 5J08A 3VLFA 2ZGDA 2GRNB 3TG4A 3AU4A 4HOSA 1E90A 2EIME 2PL2A 3CEQA 2J8SD 4BX9A 4GYYA 2RG8A 4CT4A 3QWPA 5ENPD 4GPMA 4HI8A 3SNXA 2R5SA 4F7AA 2JABA 4I9EA 2AXUA 2LO6A 2XRYA 1UW4B 3BUAA 4DX5D 3OXGA 3KS2A 3C3RA 4BT9A 2L9BA 5AQ7A 4PDXA 3ZVVA 2VJ8A 3S2AA 3V31A 2X6IA 3CQCB 3FTXA 3B7RL 5T3RA 4EECA 2PM6A 4K5CA 1BI7B 1D9SA 3E32A 2IEJA 3ZHEA 1H2VC 5ARFA 2XRZA 4CGWA 3TGOA 3CVVA 4FULA 3DSVA 4N2SA 3AS8A 2P9NG 2CFZA 3SO8A 1NA3A 3HXFA 1E8YA 2CG3A 4WNDA 3C3QA 4JVSA 2Y4TA 1EF1C 4G23A 2DYRE 3SY2A 3CVPA 3D9IA 2R02A 2P9IG 2AW6A 3IHVA 3D9OA 2P9UG 1IQRA
chains in the Genus database with same CATH topology
4A1GA 2KZTA 5CHEE 3CKBA 1OWMA 2UY1A 2XPIA 1WM5A 1SZAA 5EX3A 2WXRA 3O4ZA 5C2YA 4OVUA 3OXFA 2WXNA 4ANWA 2WPVA 4I17A 4ACLA 4EBAG 4GA2A 4ABNA 4U8HA 4AEZC 4O6FA 2QY7A 2WXMA 5EKQD 1MQSA 1HXIA 1Y8MA 1OWPA 4JA7A 4HXIA 3DPDA 1H6KA 4IYPA 4EBAA 4YNDA 1E7VA 3PEUB 3ZW3A 2NSZA 3PRZA 1PY1A 3CHPA 4ANVA 4B8CB 4P29A 3QKYA 3D9NA 4DI4A 4H7YA 3B7UX 2WXKA 2AXZA 3LY9A 2FULA 2NC9A 2I1KA 1DVPA 4XKCA 3RK6A 3P2BA 4U0ZA 4A3TA 2RD0A 4I1MA 2DIWA 2XQ0A 4DPRA 3SZ7A 3SBSA 5DIZA 3ZYKA 5JHBA 4GMLA 2PM7A 5A23A 2HR2A 1ZU2A 3TG5A 2J9QA 5D0OD 4I6JA 3PE3A 4I1OB 1HO8A 2PQRA 2VSYA 2YNQA 3GYZA 3I4GA 3LCAA 4WAFA 4ATGA 3L6AA 4BTBA 5KJKA 3CVWA 2V4LA 1QZ2A 3B7SA 3APCA 3QDNA 1FVHA 3NF1A 4GA1A 4N3AA 3RRNB 3URZA 4BTAA 3GW4A 2XEVA 1S0PA 4JL0A 3Q15A 2WQ7A 2GRMA 4LERA 1HFAA 3PUJA 3L13A 4G1TA 4D10C 3B13A 1HX8A 2FI7A 3KD7A 4JXTA 3U3WA 2L6JA 3APDA 1GW6A 4NRHB 4KZ0A 5FQ4A 1MHQA 2VGXA 3TXMA 2Q7FA 4ILHB 3VLDA 3KEZA 3L08A 4DK5A 3MA5A 3RO2A 4NACA 2VGYA 3LPZA 1Z3YA 4GAAA 5G05C 1ELWA 1WAO1 2J4DA 5ANLA 1NZNA 4RSYA 3ESLA 2ILRA 2A4ZA 4HS2A 2P58C 3LYAA 2LAHA 3FU0A 4U0UA 3CHQA 4N5CA 3L54A 4WWPA 4J8SA 3MCXA 4JA9A 3S7FA 3FH7A 2OVBA 3FUDA 3Q5MA 3U64A 4C0MA 2LSUA 3Q49B 3SD5A 4U07A 2YINA 3EJNA 4HOTA 2XGOA 4UWFA 5G04J 1TJCA 2MRIA 1W3BA 4EZKA 2BUGA 4DLOA 1PC2A 4EPZA 4GCOA 1FCHA 1H2UA 5M72A 4AVXA 5BT1A 3D3MA 3UT7A 3QB2A 2I1JA 3D9KA 4UQYA 1XGWA 2BTDA 3D9JA 4AOFA 4J0UA 1E8XA 4KYOB 4KBQA 5CCLA 4GZCA 2AVPA 4PUCA 3ZPJA 5JJTA 3UQ3A 3TL5A 4HORA 4UQXA 4LRZA 4FLBA 2DCPA 2JLBA 1B89A 4GCNA 4UI9C 4BT8A 1WY6A 5LOZA 3ASDA 3LJ3A 4F3VA 4N39A 3JYSA 2LAIA 5E76A 5KCMA 3SHFA 1N54A 3Q4AB 2VTBB 2WXOA 2XGMA 4GPKA 1UJJA 3LDZA 3BG1B 4ILGA 2LNIA 3PREA 3UPVA 4BSXA 3FFLA 3QJZA 5T8IA 4N3BA 4CGVA 1UJKA 3FTYA 3FUMA 3FY4A 3MX3A 1KLXA 1QNFA 5LCWC 2EQXA 4ANXA 1EYHA 3FTWA 3UX4A 1XNFA 2X6KA 2ZU6B 4JHKA 3ZXSA 3OXLA 5BUZA 4I9CA 3U66A 3FULA 5ARGA 4IRUA 3GZ1A 2C0LA 3TAXA 5FTPA 4L23A 4KT6B 1OWOA 5FT9A 2FF4A 1U3DA 2HO1A 3NZUA 4UWLA 4WWNA 3RRUA 5J90A 2HYZA 3D9LA 3CGHA 3LXUX 3IEGA 3QK0A 4FU3A 5HQ8A 2VSXE 4L1BA 4I2WA 4CT0A 2DBAA 3C98A 4Q69A 3MJWA 4TUUA 4GU5A 1QQEA 4CDRA 3QC1A 2AWIA 3EIJA 4WUYA 3CIAA 3FEXA 4GA0A 3ASGA 3ONKA 1NA0A 4W9RA 3PNTB 2V0PA 1EDUA 3ZYQA 3K9IA 3HVEA 3FUFA 3R9AB 4OYSA 3G2UA 3ZIMA 4B8AA 3CK7A 2ONDA 3UMVA 4G11A 2WXPA 3UUXA 5KJLA 4PH4B 2IONA 3RJVA 3CVUA 2QFCA 3CK8A 5EDSA 3CVXA 1IQUA 1DNPA 4I43A 4V3IA 3ZYMA 4TV3A 3FTUA 4A1SA 4ME2A 4I2ZA 4YVQC 2L0TB 3LKUA 1E7UA 3LVRE 4UWHA 2IJGX 3CVLA 2VYIA 3QWWA 2IU1A 1TEZA 3FWVA 3CLJA 4U63A 1JUQA 3FUJA 3BEEA 3PE4A 3QAQA 4L7TA 4F53A 3FP3A 4AJWA 3IHYA 2WXGA 4OVVA 4C9BB 2GGFA 5BNWA 2IF4A 2R17C 3FUEA 3WXXA 5AJDA 2X6FA 2R59A 3FHEA 4HOQA 4Y6CA 3RKVA 2C0MA 3FU6A 3FU5A 5G55A 3HIZA 2KATA 4I6EA 5BW8C 4TRQA 3FUNA 3RRMB 4Q94A 4WNFA 3SF4A 3EHMA 3G2WA 2J4BA 4LUNU 4FADA 3G2VA 4CEMA 3CHMA 1UN8A 1HU3A 4E6HA 2XGSA 1PAQA 3ML8A 2J09A 2Y4UA 2WXHA 3I4RB 4GB9A 1X5BA 4HLEA 5AYWD 3E4BA 2WXJA 2XCBA 3IKOB 3R7RA 1A17A 3N71A 3VLEA 4UWKA 3VTXA 4ACKA 2PZIA 3ASHA 4APFA 3CK9A 4AM9A 3SFZA 3ONLA 2WXLA 3CSFA 4H7XA 1LF8A 3CR3A 2A5UA 2V5FA 3G2SA 1HF8A 2CHXA 4C0EA 3NQPA 4KMOA 4XKBA 4DJAA 3HDXA 1BPOA 4PS7A 5ANRA 4B94A 1E8WA 3AS5A 4G2VA 3LS8A 5JJ6A 3ENEA 1ZBPA 4J8FA 4RG6A 4AP2A 3T5XA 2L0IA 4AY5A 4EQFA 2UY1B 3EHNA 3MKQB 4FJYA 2WVIA 2M63A 3UT4A 1INZA 4QFVA 4FLHA 1HE8A 4KVMA 4XI9A 4APOA 3RU0A 3CVNA 1NP7A 3FUHA 3EIQC 4GZ6A 2IFUA 3MV3B 5G04C 4A55A 1ELKA 3CSTA 3EDTB 3PUKA 3PNLB 2WB2A 3IV0A 4U04A 4BX8A 3FTZA 2GRLA 4XI0A 3CQGB 3D9MA 4CDMA 4JC8A 3MEKA 4LEUA 1SQMA 2OV8A 4IULA 1JWGA 4PS8A 5BV0A 5FWQA 3HHMA 5KJMA 4ANUA 2I2OA 1FVFA 2VSOE 5HI7A 4L2LA 4JEHA 5FQ8A 5AJLA 2IQCA 3T5VA 4LCTA 4Y6WA 1U3CA 2I6HA 3D9PA 3JQ1A 4N2QA 3FEYA 3TJPA 3ZGQA 4FA6A 1L5JA 4BFRA 4BWRA 3CHSA 3QOUA 3ZN3A 2E2EA 3QWVA 3NZSA 4UWGA 2CHZA 3FH5A 4FHJA 1P5QA 3ML9A 4JZYA 5C1DA 2PQNA 5FZSA 5LFAA 2XPYA 2J07A 4FHKA 2XHEA 2MOWA 2AXVA 4FJZA 4JPSA 2WMNA 4UQZA 2NXPA 3MKRA 2CFUA 3I5PA 1H2TC 4GZDA 3MGBA 4KVOA 3LEWA 2X38A 3FTVA 3GZ2A 4L2YA 2WXIA 4MLPA 3U4TA 3PS6A 2I9CA 3FUKA 2WQHA 3ASFA 2CHWA 2WXQA 3MZLB 1JPLA 3FTSA 4ILIA 4J8EA 4WWOA 5A6CA 4M3OA 3PVLA 1KT0A 1OWLA 1TJFA 2YHEA 3CVQA 4NURA 4AIFA 3MKQA 3L16A 4Q96A 3P1UA 4HOUA 3CHRA 4G26A 1SZ9A 3FUIA 5CMYA 5EX0A 3ULQA 1OWNA 3ZFWA 1Y6IA 4URKA 2J08A 3OTNA 4JW1A 3PEVB 4EZLA 3OAWA 4GZ5A 1E8ZA 5FZRA 3T8MA 5T4YA 5BV1A 4BY6A 2FO7A 4UI9K 2KM4A 1UG3A 1HG2A 3ESKA 1E96B 4G25A 5E75A 3S7JA 3ZRHA 2GW1A 3S7DA 5BPPA 3LY8A 3ZHEB 5J08A 3VLFA 4G24A 2X6HA 3PH0C 4EZJA 4R7LA 4XIFA 3TG4A 3AU4A 4NQ0A 4JEUA 4HOSA 1E90A 5FZQA 2Y3AA 2VTBA 5G2NA 3SI5A 1UN9A 2PL2A 3TXNA 3CEQA 2VQ2A 4BX9A 2WM9A 4GYYA 3JQ0A 2RG8A 4IN3B 3JCKC 5FQ7A 3B7TA 4YVOA 2MHKA 2UWJG 1N52A 4CCAA 4CT4A 3APFA 3QWPA 4U0SA 4KZCA 3CV0A 3L22A 1IYGA 4AV7A 5DBKA 3ZEFA 3SNXA 3CVYA 2R5SA 4F7AA 4B89A 3FDHA 4I9EA 4K03A 2AXUA 2IOLA 2LO6A 1UW4B 2XRYA 3G2TA 3HYMB 2FBNA 3FU3A 4RVBA 5LP0A 3OXGA 3AU5A 2KCLA 5G05J 3KS2A 1KT1A 2OVFA 4F1SA 4MKTA 3QARA 3QNKA 4BT9A 2V8SE 4GYOA 2L9BA 1HH8A 4J6IA 4MRUA 2E0IA 2KZTB 4XX5A 3L17A 3Q47B 3LVQE 4PDXA 2VSNA 1IHGA 3PZDA 1HZ4A 4CDNA 2LSVA 4AXHA 3ZVVA 4E85A 5KJNA 2VJ8A 3S2AA 2WMOA 2X6IA 3CQCB 3FTXA 3SGHA 3B7RL 2X6JA 3LY7A 3MYVA 2YHCA 4FC8A 2IOSA 5T3RA 3U9WA 4EECA 1H0AA 4WNEA 1YA0A 2PM6A 1Z6TA 3IBEA 4GYWA 4B0ZA 4CRWA 4HVBA 3RIBA 5FQ6A 3GZSA 3HVEB 4PS3A 2HM8A 5JJ7A 3VTYA 4I1AA 5LX8A 4HFGA 3ZHEA 1H2VC 4XZ4A 5ARFA 2XRZA 3CKCA 2CG2A 5A7DB 3S7BA 5D0QD 4CGWA 4UI9J 3TGOA 2FEZA 3CVVA 1HG5A 3BG0B 2C2LA 4DLQA 3JUIA 3CHOA 4MS6A 4I6GA 4FULA 3FH8A 4A3VA 2KCKA 2WXFA 4JHRA 3R7QA 4N2SA 3AS8A 2XPZA 2BF0X 3DBSA 4GZ3A 3MV2B 2JEKA 4RG9A 2CFZA 4J8DA 1NA3A 4FP7A 1Z3XA 2OOEA 4WNGA 1E8YA 3PDNA 2CG3A 4WNDA 5JHAA 1EPUA 2J49A 4JVSA 5CCMA 4DI3A 5AIJA 5LCWJ 2Y4TA 3RO3A 3KAEA 2YQ8A 2WQ6A 1ELRA 3O48A 5FJYA 4GMJA 1VDYA 2XCCA 1H19A 1EF1C 2X3MA 4AY6A 2KCVA 4G23A 4JHJA 4N3CA 3I3NA 3AS4A 4KXKB 5ENNA 5AENA 3SBTB 2VGXB 3ZYLA 1JWFA 1OUVA 3CVPA 3D9IA 4XE0A 2KC7A 3UT8A 2AW6A 5CMWA 3IHVA 3D9OA 1HS6A 4K0RA 1IQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CHE E;  3CKB A;  2XPI A;  2UY1 A;  1WM5 A;  5EX3 A;  3OXF A;  2WPV A;  4I17 A;  4GA2 A;  4ABN A;  4O6F A;  5EKQ D;  1HXI A;  1Y8M A;  4JA7 A;  4YND A;  3QKY A;  4H7Y A;  3LY9 A;  2NC9 A;  4U0Z A;  3SZ7 A;  5DIZ A;  2HR2 A;  1ZU2 A;  3TG5 A;  2J9Q A;  5D0O D;  3PE3 A;  2VSY A;  2PQR A;  3GYZ A;  4BTB A;  3LCA A;  5KJK A;  1QZ2 A;  3QDN A;  4GA1 A;  3NF1 A;  3URZ A;  4N3A A;  4BTA A;  3GW4 A;  2XEV A;  4JL0 A;  3Q15 A;  4G1T A;  2FI7 A;  3KD7 A;  3U3W A;  2L6J A;  4NRH B;  2VGX A;  2Q7F A;  3MA5 A;  3RO2 A;  2VGY A;  3LPZ A;  5G05 C;  1ELW A;  1WAO 1;  1NZN A;  2P58 C;  3LYA A;  4U0U A;  4N5C A;  4JA9 A;  3S7F A;  3Q5M A;  2LSU A;  3Q49 B;  4U07 A;  4HOT A;  2XGO A;  5G04 J;  1TJC A;  1W3B A;  2BUG A;  1PC2 A;  4GCO A;  1FCH A;  5M72 A;  5BT1 A;  4UQY A;  4J0U A;  4KYO B;  4KBQ A;  5CCL A;  2AVP A;  3ZPJ A;  5JJT A;  3UQ3 A;  4HOR A;  4UQX A;  2JLB A;  1B89 A;  4GCN A;  4UI9 C;  4BT8 A;  3ASD A;  4F3V A;  4N39 A;  3JYS A;  3Q4A B;  2XGM A;  4GPK A;  2LNI A;  3UPV A;  3FFL A;  4N3B A;  4CGV A;  1KLX A;  5LCW C;  1XNF A;  3OXL A;  4I9C A;  5ARG A;  3GZ1 A;  2C0L A;  3TAX A;  5FTP A;  5FT9 A;  2FF4 A;  2HO1 A;  2HYZ A;  5HQ8 A;  3IEG A;  4I2W A;  2DBA A;  1QQE A;  4CDR A;  4WUY A;  4GA0 A;  3ASG A;  1NA0 A;  4W9R A;  3K9I A;  3R9A B;  3CK7 A;  2OND A;  5KJL A;  3UUX A;  3RJV A;  2QFC A;  3CK8 A;  4A1S A;  4ME2 A;  4I2Z A;  4YVQ C;  3LKU A;  3CVL A;  3QWW A;  2VYI A;  3FWV A;  3BEE A;  3PE4 A;  3FP3 A;  5BNW A;  2IF4 A;  3WXX A;  4HOQ A;  4Y6C A;  3RKV A;  2C0M A;  5BW8 C;  2KAT A;  4WNF A;  3SF4 A;  2XGS A;  2Y4U A;  5AYW D;  3E4B A;  2XCB A;  1A17 A;  3VTX A;  3N71 A;  2PZI A;  3ASH A;  3CK9 A;  4AM9 A;  4H7X A;  2V5F A;  4B94 A;  3AS5 A;  4G2V A;  5JJ6 A;  1ZBP A;  4J8F A;  4RG6 A;  4EQF A;  4AY5 A;  2UY1 B;  4XI9 A;  4APO A;  3RU0 A;  3CVN A;  4GZ6 A;  2IFU A;  3MV3 B;  5G04 C;  3EDT B;  4U04 A;  4XI0 A;  3MEK A;  4LEU A;  5KJM A;  5HI7 A;  4Y6W A;  2I6H A;  4N2Q A;  3ZGQ A;  4BWR A;  3QOU A;  3ZN3 A;  2E2E A;  3QWV A;  5C1D A;  1P5Q A;  2PQN A;  5FZS A;  4UQZ A;  3MKR A;  3GZ2 A;  3U4T A;  2WQH A;  3ASF A;  4J8E A;  5A6C A;  1KT0 A;  3CVQ A;  4AIF A;  4HOU A;  4G26 A;  3ULQ A;  5EX0 A;  3ZFW A;  4GZ5 A;  5FZR A;  2FO7 A;  4UI9 K;  3ESK A;  3S7J A;  1E96 B;  4G25 A;  2GW1 A;  3S7D A;  3LY8 A;  3ZHE B;  4G24 A;  4XIF A;  3TG4 A;  4NQ0 A;  4HOS A;  5FZQ A;  2PL2 A;  3CEQ A;  2VQ2 A;  4GYY A;  4IN3 B;  4YVO A;  2MHK A;  2UWJ G;  3QWP A;  4U0S A;  3CV0 A;  1IYG A;  5DBK A;  2R5S A;  4I9E A;  3HYM B;  2FBN A;  3OXG A;  2KCL A;  5G05 J;  3KS2 A;  1KT1 A;  4BT9 A;  4GYO A;  1HH8 A;  3Q47 B;  2VSN A;  1IHG A;  1HZ4 A;  2LSV A;  5KJN A;  3LY7 A;  2YHC A;  4WNE A;  1YA0 A;  4GYW A;  3RIB A;  5JJ7 A;  3VTY A;  4I1A A;  3ZHE A;  5ARF A;  3CKC A;  5A7D B;  3S7B A;  5D0Q D;  4CGW A;  4UI9 J;  3TGO A;  2FEZ A;  2C2L A;  2KCK A;  4JHR A;  4N2S A;  3AS8 A;  4GZ3 A;  3MV2 B;  4RG9 A;  4J8D A;  1NA3 A;  2OOE A;  4WNG A;  3PDN A;  4WND A;  5CCM A;  5LCW J;  2Y4T A;  3RO3 A;  3KAE A;  2YQ8 A;  1ELR A;  3O48 A;  5FJY A;  2XCC A;  4AY6 A;  2KCV A;  4G23 A;  4N3C A;  3AS4 A;  4KXK B;  2VGX B;  1OUV A;  3CVP A;  2KC7 A; 
#chains in the Genus database with same CATH topology
 2KZT A;  2XPI A;  1WM5 A;  5EX3 A;  2WXR A;  2ZIS A;  4I17 A;  1MX2 A;  2WXM A;  3EUV A;  3HXC A;  1HXI A;  4HXI A;  1K1B A;  4IYP A;  3ZW3 A;  1PY1 A;  4P29 A;  1N94 A;  4I1M A;  2XQ0 A;  1OT8 A;  4HLL A;  5ENR D;  5D0O D;  2OCC E;  2VSY A;  2PQR A;  4BTB A;  3LCA A;  3CVW A;  4L9P A;  3B7S A;  1IKN D;  4BTA A;  3GW4 A;  4JL0 A;  1HFA A;  3L13 A;  2FI7 A;  3KD7 A;  3U3W A;  1GW6 A;  3NAW A;  4NRH B;  1MHQ A;  4ILH B;  4NAC A;  2XZD G;  1Z3Y A;  4CYM D;  1WAO 1;  4RSY A;  3DST A;  2A4Z A;  2DVW A;  3CHQ A;  4N5C A;  1OCC E;  4WWP A;  5ENQ D;  4C0M A;  3SD5 A;  2YIN A;  4UWF A;  2GRP B;  3DSW A;  2P9K G;  2MRI A;  4DLO A;  1PC2 A;  1JCR A;  1FCH A;  4HI9 A;  3TWV A;  1TN8 A;  5BT1 A;  4U96 D;  3D9J A;  5CCL A;  5JJT A;  4HOR A;  1B89 A;  1TR4 A;  1WY6 A;  5LOZ A;  4F3V A;  2LAI A;  1UJJ A;  4GTV A;  3C3O A;  3PRE A;  3E34 A;  4DX2 A;  5T8I A;  4N3B A;  4CGV A;  3FTY A;  2P2C P;  1EYH A;  3FTW A;  4JHK A;  4BET A;  3TAX A;  2EIJ E;  2ETA A;  1OWO A;  3RRU A;  1U3D A;  3NZU A;  4WWN A;  4LSZ E;  3TWU A;  1DC2 A;  1TN7 A;  1BD8 A;  3CIA A;  3FEX A;  3ONK A;  4BER A;  4B93 B;  3ZUV B;  3HVE A;  3FUF A;  4OYS A;  3G2U A;  5CEA A;  2OND A;  5HS0 A;  3RJV A;  5EDS A;  4I43 A;  4A1S A;  4ME2 A;  4YVQ C;  2RFA A;  2L0T B;  3CVL A;  5B1B E;  3PE4 A;  4OVV A;  2IF4 A;  2R17 C;  2F8X K;  2C0M A;  3HIZ A;  4TRQ A;  3FUN A;  3RRM B;  3SF4 A;  3EHM A;  3G2W A;  2J09 A;  2WXH A;  4GB9 A;  3E4B A;  1A17 A;  4JD2 G;  3CK9 A;  3SFZ A;  2V5F A;  3G2S A;  4XKB A;  4KMO A;  5ANR A;  4YDE A;  4MBG A;  4AP2 A;  4AY5 A;  3UT4 A;  1FT2 A;  1INZ A;  4QFV A;  2FO1 E;  4FLH A;  4KVM A;  4XI9 A;  3EU9 A;  2IFU A;  1ELK A;  5CRU A;  3WG7 E;  4BX8 A;  3MEK A;  4LEU A;  4IUL A;  5BV0 A;  3DSX A;  2I2O A;  3UTM A;  4Y6W A;  2I6H A;  1DCE A;  3FEY A;  1L5J A;  4BFR A;  4BWR A;  4UWG A;  2BED A;  3UKU G;  2AJA A;  5C1D A;  1P5Q A;  2XPY A;  3AJI A;  1IHB A;  4UUC A;  2MOW A;  1JCS A;  4FJZ A;  4UQZ A;  3C72 A;  3MKR A;  1H6O A;  2ZXW E;  3FTV A;  3SQV A;  5CED B;  3MZL B;  1AWC B;  4WWO A;  1TJF A;  1OWL A;  2ETC A;  3L16 A;  1OCO E;  4URK A;  3OAW A;  5FZR A;  5T4Y A;  3S7D A;  3LY8 A;  2DYS E;  3PH0 C;  2KBX A;  4HB5 A;  1WG0 A;  1X81 A;  4JEU A;  5FZQ A;  2Y3A A;  1UN9 A;  4G8K A;  2VQ2 A;  2WM9 A;  3KSQ A;  1SA5 A;  2MHK A;  1N52 A;  2P9L G;  3APF A;  1FT1 A;  3CV0 A;  1IYG A;  3ZEF A;  3AG2 E;  4GTQ A;  2EIL E;  2XZT G;  3G2T A;  3FU3 A;  3AU5 A;  3ZNG A;  5G05 J;  1KT1 A;  3TWX A;  4DX6 D;  1MX6 A;  4J6I A;  2E0I A;  3L17 A;  3PZD A;  1IHG A;  1HZ4 A;  1BI8 B;  5KJN A;  3BU8 A;  2X6J A;  3U9W A;  4FC8 A;  2IOS A;  4WNE A;  3R9M A;  2BKK B;  4B0Z A;  4CRW A;  3DWL G;  3GZS A;  2HM8 A;  5JJ7 A;  1N4Q A;  4I1A A;  4GTR A;  1OCR E;  3JXJ A;  4HFG A;  4XZ4 A;  3ULY A;  3CKC A;  2CG2 A;  5A7D B;  3S7B A;  4UI9 J;  1KZO A;  1ZB1 A;  2FEZ A;  3BG0 B;  3ZKJ A;  2C2L A;  2GRR B;  5FIN A;  4I6G A;  3FH8 A;  4BSZ B;  3UM2 A;  1Z3X A;  5JHA A;  5CCM A;  5AIJ A;  5FJY A;  4GMJ A;  1VDY A;  1D8E A;  2KCV A;  4JHJ A;  1JWF A;  3UT8 A;  1YYH A;  4G8L A;  5ENO D;  2F37 A;  5CHE E;  3CKB A;  2UY1 A;  5C2Y A;  2WPV A;  4O1P A;  4HRM B;  3PZ4 A;  4O6F A;  3DPD A;  1H6K A;  3V2X A;  3ABL E;  3L9T A;  4EBA A;  4YND A;  3TWW A;  2NSZ A;  3CHP A;  4ANV A;  4B8C B;  4DI4 A;  3B7U X;  2FUL A;  4A63 B;  1AP7 A;  4U0Z A;  2RD0 A;  5D2M C;  3SZ7 A;  5DIZ A;  3ZYK A;  2HR2 A;  4LNU D;  3TG5 A;  3Q9N C;  2J9Q A;  1HO8 A;  2YNQ A;  3L6A A;  5KJK A;  4YDO A;  2V5Q C;  3NF1 A;  3RRN B;  3URZ A;  2XEV A;  4CZ2 D;  1S0P A;  3Q15 A;  4LER A;  4D10 C;  3Q9U C;  1IXV A;  1TN6 A;  2L6J A;  5AQ9 A;  3APD A;  3TXM A;  2Q7F A;  3W9F A;  4DUI A;  3VLD A;  3NB2 A;  2F0Y A;  4GAA A;  2Y1L E;  5G05 C;  2J4D A;  3ESL A;  2ILR A;  4HS2 A;  2P58 C;  4F1P A;  4U0U A;  3ZXP A;  5KWD A;  3MCX A;  3FUD A;  3Q5M A;  4HOT A;  3Q79 A;  5G04 J;  4GCO A;  2NYJ A;  3QB2 A;  3LJN A;  2BTD A;  1N4P A;  2H6G A;  1E8X A;  4GZC A;  2AVP A;  1G3N B;  4LRZ A;  2DCP A;  2JLB A;  4UI9 C;  2A5E A;  3ASD A;  3AG3 E;  3SHF A;  3Q4A B;  2WXO A;  2XGM A;  1SVX A;  4ILG A;  2LNI A;  2B0O E;  3UPV A;  3FY4 A;  1TYQ G;  1KLX A;  4ANX A;  3UX4 A;  4I9C A;  3U66 A;  5ARG A;  2Y0B G;  5FT9 A;  2FF4 A;  2HO1 A;  5J90 A;  1N0R A;  3CGH A;  4FU3 A;  2PNN A;  4I2W A;  3C98 A;  3MJW A;  4TUU A;  3T8K A;  5BXU A;  3B95 A;  3ASG A;  1NA0 A;  3PZ1 A;  3E30 A;  2V0P A;  2QYJ A;  1EDU A;  1A5E A;  3R9A B;  3TWT A;  5KJL A;  2ION A;  2QFC A;  3PZ2 A;  1IQU A;  4V3I A;  3FTU A;  3HXE A;  4UWH A;  1KZP A;  3FP3 A;  4AJW A;  1OCZ E;  2R59 A;  1FPP A;  2DZO A;  3FU6 A;  5G55 A;  3RAU A;  4I6E A;  2IY0 C;  4WNF A;  4LUN U;  4FAD A;  3G2V A;  1HU3 A;  4E6H A;  1D8D A;  4LG6 A;  4N5Q A;  3ZU7 B;  3R7R A;  2WXJ A;  2QC9 A;  5AAR A;  2PZI A;  3ASH A;  4APF A;  2A5U A;  1HF8 A;  2CHX A;  4C0E A;  3NQP A;  4DJA A;  5CEC B;  4PS7 A;  1E8W A;  4G2V A;  5JJ6 A;  4J8F A;  4RG6 A;  3V30 A;  1Q2Z A;  2ZIR A;  3Q78 A;  2M63 A;  2XEH A;  3TWR A;  1HE8 A;  3UI2 A;  3RU0 A;  3EIQ C;  4GZ6 A;  5G04 C;  4LNB A;  3EDT B;  3PUK A;  4U04 A;  3FTZ A;  2GRL A;  2MYO A;  3CQG B;  3D9M A;  4JC8 A;  3UXG A;  4PS8 A;  5FWQ A;  3HHM A;  5HI7 A;  4JEH A;  5FQ8 A;  4LCT A;  1QBQ A;  3JQ1 A;  4N2Q A;  1RZ4 A;  3CHS A;  3D9H A;  2E2E A;  3FH5 A;  4JZY A;  2PQN A;  4NIK A;  5CRV A;  5FZS A;  5LFA A;  4FHK A;  2XHE A;  4JPS A;  4XEI G;  3HG0 D;  5B3S E;  1MX4 A;  4KVO A;  2X38 A;  3GZ2 A;  2WXI A;  3PS6 A;  2I9C A;  1JPL A;  3W9G A;  1LD7 A;  1TNZ A;  3PVL A;  1KT0 A;  4NUR A;  2YHE A;  4AIF A;  1SZ9 A;  5CMY A;  3ULQ A;  3ZFW A;  4JW1 A;  3T8M A;  1N0Q A;  4UI9 K;  2KM4 A;  1UG3 A;  3S7J A;  5HKP A;  2X6H A;  4EZJ A;  3EHR A;  5FIO A;  2VTB A;  5G2N A;  3SI5 A;  3TXN A;  5EYP F;  3ABK E;  5FQ7 A;  5CBN A;  4YVO A;  5EIL A;  4U0S A;  3UKR G;  3EU5 A;  4B89 A;  3AAA C;  5LP0 A;  1TNO A;  2H6I A;  4F1S A;  3QNK A;  4HBD A;  4GYO A;  3Q47 B;  3LVQ E;  2VSN A;  4CDN A;  2LSV A;  4E85 A;  1N11 A;  3UIN C;  2WMO A;  1OXJ A;  3SGH A;  3LY7 A;  2YHC A;  4DX7 D;  1Z6T A;  3DPY A;  4HVB A;  3RIB A;  3HVE B;  4PS3 A;  1TNU A;  4Z68 A;  3VTY A;  3UIP C;  5D0Q D;  3JUI A;  3CHO A;  4MS6 A;  4A3V A;  2KCK A;  3R7Q A;  4DX1 A;  3DBS A;  2BF0 X;  3MV2 B;  2JEK A;  5ENT D;  2OOE A;  3DXK G;  1EPU A;  4DI3 A;  2YQ8 A;  3O48 A;  1H19 A;  2X3M A;  4AY6 A;  4N3C A;  5AEN A;  5ENN A;  2VGX B;  4XE0 A;  4K0R A;  4A1G A;  1OWM A;  3HXB A;  1SZA A;  3O4Z A;  4OVU A;  2R03 A;  2WXN A;  4ANW A;  4EBA G;  1YMP A;  4GA2 A;  4AEZ C;  2QY7 A;  2R2L A;  3ULE G;  5EKQ D;  1MQS A;  1Y8M A;  1OWP A;  1LTX A;  1QYM A;  4JA7 A;  3L82 A;  1K1A A;  5JMN D;  3BQO A;  3KEA A;  1E7V A;  3PRZ A;  3AG4 E;  3QKY A;  2WXK A;  3LY9 A;  2NC9 A;  2I1K A;  1DVP A;  2DIW A;  4DPR A;  2F8Y A;  5JHB A;  2OEW A;  2IO2 C;  2PM7 A;  5A23 A;  3Q75 A;  1ZU2 A;  2RFM A;  4GMR A;  1RW2 A;  4ATG A;  3GYZ A;  4WAF A;  2V4L A;  1QZ2 A;  3QDN A;  4GA1 A;  4N3A A;  2LXL A;  2WQ7 A;  3PUJ A;  3B13 A;  1S63 A;  4JXT A;  5AQA A;  5FQ4 A;  4J8Y A;  3RO2 A;  3LPZ A;  3UM1 A;  5ANL A;  1NZN A;  3FU0 A;  4YDW A;  2B6C A;  3L54 A;  4GTP A;  2BKG A;  1TJC A;  1W3B A;  4EZK A;  2BUG A;  4TXP A;  5M72 A;  1N95 A;  4ZFH A;  1MYO A;  3D3M A;  3D9K A;  4UQY A;  4AOF A;  2XEN A;  3KSL A;  3SFX A;  3UQ3 A;  4FLB A;  4GCN A;  4BT8 A;  4HRL A;  3LJ3 A;  4N39 A;  1K8K G;  1N54 A;  3BG1 B;  1SW6 A;  4BSX A;  3FFL A;  3FUM A;  5KNH D;  1NL4 A;  1QNF A;  3ABM E;  1XNF A;  2ZU6 B;  3ZXS A;  5BUZ A;  3FUL A;  4IRU A;  3GZ1 A;  2C0L A;  5FTP A;  4UWL A;  2HYZ A;  3D9L A;  3LXU X;  5HQ8 A;  3QK0 A;  2VSX E;  4L1B A;  2DBA A;  3UM0 A;  2KXP C;  4GU5 A;  1QQE A;  4CDR A;  3QC1 A;  2AWI A;  4U7E B;  3B7B A;  4GA0 A;  3F6Q A;  4W9R A;  3DEO A;  3ZYQ A;  3V2O A;  3UMV A;  4G11 A;  2WXP A;  3CVU A;  3CK8 A;  2HE0 A;  1DNP A;  3ZYM A;  4GTT A;  3LKU A;  3LVR E;  2H6F A;  3DSU A;  1TEZ A;  2IU1 A;  1BLX B;  3FWV A;  3BEE A;  4F53 A;  1DCQ A;  4C9B B;  2GGF A;  3WXX A;  5AJD A;  4HOQ A;  3FHE A;  4Y6C A;  3RKV A;  5BW8 C;  2KAT A;  4DRX E;  4HNA D;  2J4B A;  4CEM A;  3ML8 A;  3I4R B;  1X5B A;  4HLE A;  4EHM A;  3N71 A;  2V4H C;  4AM9 A;  3CR3 A;  2Y69 E;  3HDX A;  1BPO A;  4B94 A;  3DSS A;  1ZBP A;  3T5X A;  2UY1 B;  3EHQ A;  3MKQ B;  4FJY A;  5H7P A;  2WVI A;  3J5Q B;  3MV3 B;  3CST A;  3RSE G;  3IV0 A;  4CDM A;  2OV8 A;  1JWG A;  4ANU A;  2VSO E;  3DXM G;  1S70 B;  4L2L A;  5AJL A;  1TNB A;  5IY5 E;  1MZC A;  3D9P A;  3TJP A;  4FA6 A;  3AG1 E;  3ZN3 A;  2H6H A;  2CHZ A;  4YDY A;  2J07 A;  2AXV A;  3UIO C;  2CFU A;  3I5P A;  1H2T C;  1O1S A;  4GZD A;  3ISM C;  4RLY A;  4K5A B;  1O5M A;  3JUE A;  3JXI A;  3X2Q E;  4L2Y A;  3FUK A;  2WQH A;  3FTS A;  4ILI A;  3J5P A;  5A6C A;  4Q96 A;  3P1U A;  2VGE A;  4HOU A;  4G26 A;  3FUI A;  5EX0 A;  1OWN A;  5KBA A;  2GRQ B;  3OTN A;  4GZ5 A;  1E8Z A;  4BY6 A;  5CER B;  1HG2 A;  4J7W A;  5E75 A;  5BPP A;  3ZHE B;  4G24 A;  2ZGG A;  4QQI A;  4R7L A;  4XIF A;  4BEP A;  4NQ0 A;  4ATZ D;  4O1O A;  3JQ0 A;  4IN3 B;  1OY3 D;  3JCK C;  3B7T A;  2UWJ G;  4CCA A;  2EIN E;  4ZHB A;  5B1A E;  4KZC A;  3L22 A;  4AV7 A;  5DBK A;  3CVY A;  5HRY A;  2XEE A;  3FDH A;  4K03 A;  1SA4 A;  5CBO A;  2IOL A;  4TUM A;  3HYM B;  2FBN A;  4RVB A;  4C48 B;  2KCL A;  2OVF A;  4MKT A;  3QAR A;  1U2V G;  2V8S E;  1HH8 A;  4MRU A;  2KZT B;  4XX5 A;  2QYU A;  4AXH A;  3MYV A;  1H0A A;  1YA0 A;  3IBE A;  4GYW A;  5FQ6 A;  1NI1 A;  5LX8 A;  2ETB A;  1HG5 A;  4OAV B;  4DLQ A;  1UOH A;  1MJ0 A;  2WXF A;  4JHR A;  4GZ3 A;  2XPZ A;  4RG9 A;  4J8D A;  4FP7 A;  4WNG A;  3DRA A;  2IO3 C;  3PDN A;  2J49 A;  5LCW J;  2WQ6 A;  3RO3 A;  3KAE A;  1ELR A;  3E33 A;  2XCC A;  3I3N A;  3AS4 A;  4KXK B;  4U95 D;  3SBT B;  3ZYL A;  1OUV A;  2KC7 A;  5CMW A;  1KPS B;  1HS6 A;  4O60 A;  3OXF A;  3Q73 A;  3NOC D;  4ACL A;  4ABN A;  4U8H A;  2EIK E;  3PEU B;  2LXM A;  3D9N A;  4HQD A;  4H7Y A;  1V55 E;  2AXZ A;  4XKC A;  4A3T A;  3RK6 A;  3P2B A;  2XS8 A;  3SBS A;  4GML A;  4I6J A;  3PE3 A;  4I1O B;  3I4G A;  3APC A;  1FVH A;  1NFI E;  2GRM A;  4G1T A;  1HX8 A;  4X8Q A;  4U8V D;  4KZ0 A;  2VGX A;  3KEZ A;  3L08 A;  4DK5 A;  3MA5 A;  2VGY A;  1ELW A;  5EYL A;  3LYA A;  2LAH A;  2OEV A;  4J8S A;  4JA9 A;  3S7F A;  3FH7 A;  2OVB A;  4GTO A;  3U64 A;  2LSU A;  3Q49 B;  3NOG D;  4U07 A;  3EJN A;  2XGO A;  4EPZ A;  1H2U A;  4AVX A;  3UT7 A;  2I1J A;  2XS1 A;  1XGW A;  5KNG A;  2LUH A;  4J0U A;  4KYO B;  4KBQ A;  4PUC A;  3ZPJ A;  4RQI A;  3TL5 A;  4UQX A;  4GTS A;  3Q7A A;  3DEP A;  3V79 K;  3JYS A;  5E76 A;  5KCM A;  2VTB B;  3Q7F A;  4GPK A;  3LDZ A;  3PZ3 A;  3QJZ A;  4TXR A;  1UJK A;  3MX3 A;  5LCW C;  2EQX A;  1WDY A;  1YCS B;  3TWQ A;  2X6K A;  3OXL A;  2R05 A;  5ENS D;  1Z5S C;  3TWS A;  4L23 A;  4KT6 B;  3IEG A;  3UM3 A;  4CT0 A;  2RKK A;  4Q69 A;  3EIJ A;  4WUY A;  2GRO B;  1BU9 A;  1TNY A;  3PNT B;  3K9I A;  3ZIM A;  4B8A A;  3CK7 A;  5BXO A;  3C5R A;  3UUX A;  4GTM A;  4PH4 B;  3CVX A;  4TV3 A;  4I2Z A;  4F6R D;  1E7U A;  2IJG X;  3QWW A;  2VYI A;  3CLJ A;  4U63 A;  1JUQ A;  3FUJ A;  2L6B A;  3QAQ A;  4L7T A;  1JCQ A;  3IHY A;  2WXG A;  5BNW A;  3FUE A;  2X6F A;  3T9K A;  3FU5 A;  4M7C A;  5EID A;  4LNG A;  3HXD A;  4Q94 A;  5D66 A;  2P9S G;  3CHM A;  1UN8 A;  1O1T A;  5JA4 D;  2XGS A;  1PAQ A;  4JB8 P;  2Y4U A;  3ASO E;  5AYW D;  3IKO B;  2XCB A;  3ASN E;  4ACK A;  3VTX A;  3VLE A;  4UWK A;  5AAO A;  3ONL A;  3SFY A;  2WXL A;  3CSF A;  4H7X A;  1LF8 A;  2DWZ A;  2DZN A;  5EIB E;  4U8Y D;  3AS5 A;  3LS8 A;  3ENE A;  4EQF A;  2L0I A;  3EHN A;  5AQB A;  4APO A;  3CVN A;  1NP7 A;  3FUH A;  5EN5 D;  4A55 A;  2WB2 A;  3PNL B;  3IXE A;  4XI0 A;  1SQM A;  5KJM A;  4K5B A;  1FVF A;  1LD8 A;  3T5V A;  2IQC A;  4BES A;  1U3C A;  3ZGQ A;  1N9A A;  1O1R A;  3QOU A;  4TXQ A;  3QWV A;  3NZS A;  4FHJ A;  3E37 A;  3ML9 A;  1K3Z D;  1V54 E;  1N4S A;  1H6P A;  4HRN A;  3HRA A;  2WMN A;  2NXP A;  4OAU C;  3MGB A;  3LEW A;  4MLP A;  3U4T A;  1N4R A;  2CHW A;  2WXQ A;  3ASF A;  4J8E A;  4M3O A;  2QZA A;  3CVQ A;  3NBN B;  5ITZ F;  3MKQ A;  3CHR A;  1Y6I A;  2J08 A;  2P9P G;  3PEV B;  4EZL A;  1S64 A;  5BV1 A;  2FO7 A;  5AN8 A;  3ESK A;  1E96 B;  4G25 A;  3ZRH A;  2GW1 A;  5J08 A;  3VLF A;  2ZGD A;  2GRN B;  3TG4 A;  3AU4 A;  4HOS A;  1E90 A;  2EIM E;  2PL2 A;  3CEQ A;  2J8S D;  4BX9 A;  4GYY A;  2RG8 A;  4CT4 A;  3QWP A;  5ENP D;  4GPM A;  4HI8 A;  3SNX A;  2R5S A;  4F7A A;  2JAB A;  4I9E A;  2AXU A;  2LO6 A;  2XRY A;  1UW4 B;  3BUA A;  4DX5 D;  3OXG A;  3KS2 A;  3C3R A;  4BT9 A;  2L9B A;  5AQ7 A;  4PDX A;  3ZVV A;  2VJ8 A;  3S2A A;  3V31 A;  2X6I A;  3CQC B;  3FTX A;  3B7R L;  5T3R A;  4EEC A;  2PM6 A;  4K5C A;  1BI7 B;  1D9S A;  3E32 A;  2IEJ A;  3ZHE A;  1H2V C;  5ARF A;  2XRZ A;  4CGW A;  3TGO A;  3CVV A;  4FUL A;  3DSV A;  4N2S A;  3AS8 A;  2P9N G;  2CFZ A;  3SO8 A;  1NA3 A;  3HXF A;  1E8Y A;  2CG3 A;  4WND A;  3C3Q A;  4JVS A;  2Y4T A;  1EF1 C;  4G23 A;  2DYR E;  3SY2 A;  3CVP A;  3D9I A;  2R02 A;  2P9I G;  2AW6 A;  3IHV A;  3D9O A;  2P9U G;  1IQR A; 
#chains in the Genus database with same CATH homology
 4A1G A;  2KZT A;  5CHE E;  3CKB A;  1OWM A;  2UY1 A;  2XPI A;  1WM5 A;  1SZA A;  5EX3 A;  2WXR A;  3O4Z A;  5C2Y A;  4OVU A;  3OXF A;  2WXN A;  4ANW A;  2WPV A;  4I17 A;  4ACL A;  4EBA G;  4GA2 A;  4ABN A;  4U8H A;  4AEZ C;  4O6F A;  2QY7 A;  2WXM A;  5EKQ D;  1MQS A;  1HXI A;  1Y8M A;  1OWP A;  4JA7 A;  4HXI A;  3DPD A;  1H6K A;  4IYP A;  4EBA A;  4YND A;  1E7V A;  3PEU B;  3ZW3 A;  2NSZ A;  3PRZ A;  1PY1 A;  3CHP A;  4ANV A;  4B8C B;  4P29 A;  3QKY A;  3D9N A;  4DI4 A;  4H7Y A;  3B7U X;  2WXK A;  2AXZ A;  3LY9 A;  2FUL A;  2NC9 A;  2I1K A;  1DVP A;  4XKC A;  3RK6 A;  3P2B A;  4U0Z A;  4A3T A;  2RD0 A;  4I1M A;  2DIW A;  2XQ0 A;  4DPR A;  3SZ7 A;  3SBS A;  5DIZ A;  3ZYK A;  5JHB A;  4GML A;  2PM7 A;  5A23 A;  2HR2 A;  1ZU2 A;  3TG5 A;  2J9Q A;  5D0O D;  4I6J A;  3PE3 A;  4I1O B;  1HO8 A;  2PQR A;  2VSY A;  2YNQ A;  3GYZ A;  3I4G A;  3LCA A;  4WAF A;  4ATG A;  3L6A A;  4BTB A;  5KJK A;  3CVW A;  2V4L A;  1QZ2 A;  3B7S A;  3APC A;  3QDN A;  1FVH A;  3NF1 A;  4GA1 A;  4N3A A;  3RRN B;  3URZ A;  4BTA A;  3GW4 A;  2XEV A;  1S0P A;  4JL0 A;  3Q15 A;  2WQ7 A;  2GRM A;  4LER A;  1HFA A;  3PUJ A;  3L13 A;  4G1T A;  4D10 C;  3B13 A;  1HX8 A;  2FI7 A;  3KD7 A;  4JXT A;  3U3W A;  2L6J A;  3APD A;  1GW6 A;  4NRH B;  4KZ0 A;  5FQ4 A;  1MHQ A;  2VGX A;  3TXM A;  2Q7F A;  4ILH B;  3VLD A;  3KEZ A;  3L08 A;  4DK5 A;  3MA5 A;  3RO2 A;  4NAC A;  2VGY A;  3LPZ A;  1Z3Y A;  4GAA A;  5G05 C;  1ELW A;  1WAO 1;  2J4D A;  5ANL A;  1NZN A;  4RSY A;  3ESL A;  2ILR A;  2A4Z A;  4HS2 A;  2P58 C;  3LYA A;  2LAH A;  3FU0 A;  4U0U A;  3CHQ A;  4N5C A;  3L54 A;  4WWP A;  4J8S A;  3MCX A;  4JA9 A;  3S7F A;  3FH7 A;  2OVB A;  3FUD A;  3Q5M A;  3U64 A;  4C0M A;  2LSU A;  3Q49 B;  3SD5 A;  4U07 A;  2YIN A;  3EJN A;  4HOT A;  2XGO A;  4UWF A;  5G04 J;  1TJC A;  2MRI A;  1W3B A;  4EZK A;  2BUG A;  4DLO A;  1PC2 A;  4EPZ A;  4GCO A;  1FCH A;  1H2U A;  5M72 A;  4AVX A;  5BT1 A;  3D3M A;  3UT7 A;  3QB2 A;  2I1J A;  3D9K A;  4UQY A;  1XGW A;  2BTD A;  3D9J A;  4AOF A;  4J0U A;  1E8X A;  4KYO B;  4KBQ A;  5CCL A;  4GZC A;  2AVP A;  4PUC A;  3ZPJ A;  5JJT A;  3UQ3 A;  3TL5 A;  4HOR A;  4UQX A;  4LRZ A;  4FLB A;  2DCP A;  2JLB A;  1B89 A;  4GCN A;  4UI9 C;  4BT8 A;  1WY6 A;  5LOZ A;  3ASD A;  3LJ3 A;  4F3V A;  4N39 A;  3JYS A;  2LAI A;  5E76 A;  5KCM A;  3SHF A;  1N54 A;  3Q4A B;  2VTB B;  2WXO A;  2XGM A;  4GPK A;  1UJJ A;  3LDZ A;  3BG1 B;  4ILG A;  2LNI A;  3PRE A;  3UPV A;  4BSX A;  3FFL A;  3QJZ A;  5T8I A;  4N3B A;  4CGV A;  1UJK A;  3FTY A;  3FUM A;  3FY4 A;  3MX3 A;  1KLX A;  1QNF A;  5LCW C;  2EQX A;  4ANX A;  1EYH A;  3FTW A;  3UX4 A;  1XNF A;  2X6K A;  2ZU6 B;  4JHK A;  3ZXS A;  3OXL A;  5BUZ A;  4I9C A;  3U66 A;  3FUL A;  5ARG A;  4IRU A;  3GZ1 A;  2C0L A;  3TAX A;  5FTP A;  4L23 A;  4KT6 B;  1OWO A;  5FT9 A;  2FF4 A;  1U3D A;  2HO1 A;  3NZU A;  4UWL A;  4WWN A;  3RRU A;  5J90 A;  2HYZ A;  3D9L A;  3CGH A;  3LXU X;  3IEG A;  3QK0 A;  4FU3 A;  5HQ8 A;  2VSX E;  4L1B A;  4I2W A;  4CT0 A;  2DBA A;  3C98 A;  4Q69 A;  3MJW A;  4TUU A;  4GU5 A;  1QQE A;  4CDR A;  3QC1 A;  2AWI A;  3EIJ A;  4WUY A;  3CIA A;  3FEX A;  4GA0 A;  3ASG A;  3ONK A;  1NA0 A;  4W9R A;  3PNT B;  2V0P A;  1EDU A;  3ZYQ A;  3K9I A;  3HVE A;  3FUF A;  3R9A B;  4OYS A;  3G2U A;  3ZIM A;  4B8A A;  3CK7 A;  2OND A;  3UMV A;  4G11 A;  2WXP A;  3UUX A;  5KJL A;  4PH4 B;  2ION A;  3RJV A;  3CVU A;  2QFC A;  3CK8 A;  5EDS A;  3CVX A;  1IQU A;  1DNP A;  4I43 A;  4V3I A;  3ZYM A;  4TV3 A;  3FTU A;  4A1S A;  4ME2 A;  4I2Z A;  4YVQ C;  2L0T B;  3LKU A;  1E7U A;  3LVR E;  4UWH A;  2IJG X;  3CVL A;  2VYI A;  3QWW A;  2IU1 A;  1TEZ A;  3FWV A;  3CLJ A;  4U63 A;  1JUQ A;  3FUJ A;  3BEE A;  3PE4 A;  3QAQ A;  4L7T A;  4F53 A;  3FP3 A;  4AJW A;  3IHY A;  2WXG A;  4OVV A;  4C9B B;  2GGF A;  5BNW A;  2IF4 A;  2R17 C;  3FUE A;  3WXX A;  5AJD A;  2X6F A;  2R59 A;  3FHE A;  4HOQ A;  4Y6C A;  3RKV A;  2C0M A;  3FU6 A;  3FU5 A;  5G55 A;  3HIZ A;  2KAT A;  4I6E A;  5BW8 C;  4TRQ A;  3FUN A;  3RRM B;  4Q94 A;  4WNF A;  3SF4 A;  3EHM A;  3G2W A;  2J4B A;  4LUN U;  4FAD A;  3G2V A;  4CEM A;  3CHM A;  1UN8 A;  1HU3 A;  4E6H A;  2XGS A;  1PAQ A;  3ML8 A;  2J09 A;  2Y4U A;  2WXH A;  3I4R B;  4GB9 A;  1X5B A;  4HLE A;  5AYW D;  3E4B A;  2WXJ A;  2XCB A;  3IKO B;  3R7R A;  1A17 A;  3N71 A;  3VLE A;  4UWK A;  3VTX A;  4ACK A;  2PZI A;  3ASH A;  4APF A;  3CK9 A;  4AM9 A;  3SFZ A;  3ONL A;  2WXL A;  3CSF A;  4H7X A;  1LF8 A;  3CR3 A;  2A5U A;  2V5F A;  3G2S A;  1HF8 A;  2CHX A;  4C0E A;  3NQP A;  4KMO A;  4XKB A;  4DJA A;  3HDX A;  1BPO A;  4PS7 A;  5ANR A;  4B94 A;  1E8W A;  3AS5 A;  4G2V A;  3LS8 A;  5JJ6 A;  3ENE A;  1ZBP A;  4J8F A;  4RG6 A;  4AP2 A;  3T5X A;  2L0I A;  4AY5 A;  4EQF A;  2UY1 B;  3EHN A;  3MKQ B;  4FJY A;  2WVI A;  2M63 A;  3UT4 A;  1INZ A;  4QFV A;  4FLH A;  1HE8 A;  4KVM A;  4XI9 A;  4APO A;  3RU0 A;  3CVN A;  1NP7 A;  3FUH A;  3EIQ C;  4GZ6 A;  2IFU A;  3MV3 B;  5G04 C;  4A55 A;  1ELK A;  3CST A;  3EDT B;  3PUK A;  3PNL B;  2WB2 A;  3IV0 A;  4U04 A;  4BX8 A;  3FTZ A;  2GRL A;  4XI0 A;  3CQG B;  3D9M A;  4CDM A;  4JC8 A;  3MEK A;  4LEU A;  1SQM A;  2OV8 A;  4IUL A;  1JWG A;  4PS8 A;  5BV0 A;  5FWQ A;  3HHM A;  5KJM A;  4ANU A;  2I2O A;  1FVF A;  2VSO E;  5HI7 A;  4L2L A;  4JEH A;  5FQ8 A;  5AJL A;  2IQC A;  3T5V A;  4LCT A;  4Y6W A;  1U3C A;  2I6H A;  3D9P A;  3JQ1 A;  4N2Q A;  3FEY A;  3TJP A;  3ZGQ A;  4FA6 A;  1L5J A;  4BFR A;  4BWR A;  3CHS A;  3QOU A;  3ZN3 A;  2E2E A;  3QWV A;  3NZS A;  4UWG A;  2CHZ A;  3FH5 A;  4FHJ A;  1P5Q A;  3ML9 A;  4JZY A;  5C1D A;  2PQN A;  5FZS A;  5LFA A;  2XPY A;  2J07 A;  4FHK A;  2XHE A;  2MOW A;  2AXV A;  4FJZ A;  4JPS A;  2WMN A;  4UQZ A;  2NXP A;  3MKR A;  2CFU A;  3I5P A;  1H2T C;  4GZD A;  3MGB A;  4KVO A;  3LEW A;  2X38 A;  3FTV A;  3GZ2 A;  4L2Y A;  2WXI A;  4MLP A;  3U4T A;  3PS6 A;  2I9C A;  3FUK A;  2WQH A;  3ASF A;  2CHW A;  2WXQ A;  3MZL B;  1JPL A;  3FTS A;  4ILI A;  4J8E A;  4WWO A;  5A6C A;  4M3O A;  3PVL A;  1KT0 A;  1OWL A;  1TJF A;  2YHE A;  3CVQ A;  4NUR A;  4AIF A;  3MKQ A;  3L16 A;  4Q96 A;  3P1U A;  4HOU A;  3CHR A;  4G26 A;  1SZ9 A;  3FUI A;  5CMY A;  5EX0 A;  3ULQ A;  1OWN A;  3ZFW A;  1Y6I A;  4URK A;  2J08 A;  3OTN A;  4JW1 A;  3PEV B;  4EZL A;  3OAW A;  4GZ5 A;  1E8Z A;  5FZR A;  3T8M A;  5T4Y A;  5BV1 A;  4BY6 A;  2FO7 A;  4UI9 K;  2KM4 A;  1UG3 A;  1HG2 A;  3ESK A;  1E96 B;  4G25 A;  5E75 A;  3S7J A;  3ZRH A;  2GW1 A;  3S7D A;  5BPP A;  3LY8 A;  3ZHE B;  5J08 A;  3VLF A;  4G24 A;  2X6H A;  3PH0 C;  4EZJ A;  4R7L A;  4XIF A;  3TG4 A;  3AU4 A;  4NQ0 A;  4JEU A;  4HOS A;  1E90 A;  5FZQ A;  2Y3A A;  2VTB A;  5G2N A;  3SI5 A;  1UN9 A;  2PL2 A;  3TXN A;  3CEQ A;  2VQ2 A;  4BX9 A;  2WM9 A;  4GYY A;  3JQ0 A;  2RG8 A;  4IN3 B;  3JCK C;  5FQ7 A;  3B7T A;  4YVO A;  2MHK A;  2UWJ G;  1N52 A;  4CCA A;  4CT4 A;  3APF A;  3QWP A;  4U0S A;  4KZC A;  3CV0 A;  3L22 A;  1IYG A;  4AV7 A;  5DBK A;  3ZEF A;  3SNX A;  3CVY A;  2R5S A;  4F7A A;  4B89 A;  3FDH A;  4I9E A;  4K03 A;  2AXU A;  2IOL A;  2LO6 A;  1UW4 B;  2XRY A;  3G2T A;  3HYM B;  2FBN A;  3FU3 A;  4RVB A;  5LP0 A;  3OXG A;  3AU5 A;  2KCL A;  5G05 J;  3KS2 A;  1KT1 A;  2OVF A;  4F1S A;  4MKT A;  3QAR A;  3QNK A;  4BT9 A;  2V8S E;  4GYO A;  2L9B A;  1HH8 A;  4J6I A;  4MRU A;  2E0I A;  2KZT B;  4XX5 A;  3L17 A;  3Q47 B;  3LVQ E;  4PDX A;  2VSN A;  1IHG A;  3PZD A;  1HZ4 A;  4CDN A;  2LSV A;  4AXH A;  3ZVV A;  4E85 A;  5KJN A;  2VJ8 A;  3S2A A;  2WMO A;  2X6I A;  3CQC B;  3FTX A;  3SGH A;  3B7R L;  2X6J A;  3LY7 A;  3MYV A;  2YHC A;  4FC8 A;  2IOS A;  5T3R A;  3U9W A;  4EEC A;  1H0A A;  4WNE A;  1YA0 A;  2PM6 A;  1Z6T A;  3IBE A;  4GYW A;  4B0Z A;  4CRW A;  4HVB A;  3RIB A;  5FQ6 A;  3GZS A;  3HVE B;  4PS3 A;  2HM8 A;  5JJ7 A;  3VTY A;  4I1A A;  5LX8 A;  4HFG A;  3ZHE A;  1H2V C;  4XZ4 A;  5ARF A;  2XRZ A;  3CKC A;  2CG2 A;  5A7D B;  3S7B A;  5D0Q D;  4CGW A;  4UI9 J;  3TGO A;  2FEZ A;  3CVV A;  1HG5 A;  3BG0 B;  2C2L A;  4DLQ A;  3JUI A;  3CHO A;  4MS6 A;  4I6G A;  4FUL A;  3FH8 A;  4A3V A;  2KCK A;  2WXF A;  4JHR A;  3R7Q A;  4N2S A;  3AS8 A;  2XPZ A;  2BF0 X;  3DBS A;  4GZ3 A;  3MV2 B;  2JEK A;  4RG9 A;  2CFZ A;  4J8D A;  1NA3 A;  4FP7 A;  1Z3X A;  2OOE A;  4WNG A;  1E8Y A;  3PDN A;  2CG3 A;  4WND A;  5JHA A;  1EPU A;  2J49 A;  4JVS A;  5CCM A;  4DI3 A;  5AIJ A;  5LCW J;  2Y4T A;  3RO3 A;  3KAE A;  2YQ8 A;  2WQ6 A;  1ELR A;  3O48 A;  5FJY A;  4GMJ A;  1VDY A;  2XCC A;  1H19 A;  1EF1 C;  2X3M A;  4AY6 A;  2KCV A;  4G23 A;  4JHJ A;  4N3C A;  3I3N A;  3AS4 A;  4KXK B;  5ENN A;  5AEN A;  3SBT B;  2VGX B;  3ZYL A;  1JWF A;  1OUV A;  3CVP A;  3D9I A;  4XE0 A;  2KC7 A;  3UT8 A;  2AW6 A;  5CMW A;  3IHV A;  3D9O A;  1HS6 A;  4K0R A;  1IQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...