5G00A

Crystal structure of a potato sti-kunitz bifunctional inhibitor of serine and aspartic proteases in space group p4322 and ph 7.4
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
185
structure length
185
Chain Sequence
PLPKPVLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPSGTPVRFIPLSTNIFEDQLLNIQFNIPTVKLCVSYTIWKVGNLNAYFRTMLLETGGTIGQADNSYFKIVKSSKIGYNLLSCPFTSIICLRCPEDQFCAKVGVVIQNGKRRLALVNENPLDVLFQEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KTI-A PROTEIN
publication title Structures of a bi-functional Kunitz-type STI family inhibitor of serine and aspartic proteases: Could the aspartic protease inhibition have evolved from a canonical serine protease-binding loop?
pubmed doi rcsb
source organism Solanum tuberosum
molecule tags Hydrolase inhibitor
total genus 34
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 5g00A00
1IILA 1TFMB 2GO2A 2J3PA 3CRIA 3HALA 3V0AA 3O4BA 1P63A 2D20A 3BA5A 3I29B 5HPZA 41BIA 3V0BA 1EV2A 2MC2A 1FQ9A 5EHAA 4ENDA 1M16A 4Q9PA 1BA7A 3ZXGA 3NBDA 2ERMA 3BTAA 1JY0A 2VLCA 1CE7B 1E0OA 3FJHA 4I96A 5DSSB 3Q7YA 4D8HA 3NBCA 4P6AA 4HJJA 1YBIA 3UD8A 2NM1A 3IM6A 1DQOA 1Z2VA 2NP0A 1ILR1 1FWUA 4QD2C 2MLLB 3P6IA 1DFCA 2NZ9A 3FUQA 4OEGA 5GAQA 4G6MA 2FDBM 2Y9XE 1V6WA 3VT1A 3PUBA 3AJ6A 4DCKC 4XFTA 3FJJA 1HWMB 3I2XA 2ZQOA 1TOOA 1AVXB 1FWVA 1FV2A 1I1BA 4IQPA 1HKNA 3VSFA 4JRAA 1NUNA 4GP3A 3HOMA 1N4KA 1RZOB 2UUSA 2VUAA 4EFRA 1BLDA 1R8OA 4J23B 2VXTI 1S0GA 1IRAX 3UJ4A 2YUGA 1ISXA 1Q03A 3CA4A 8I1BA 3CU1B 4II0A 4I6IA 3UDAA 5BXPA 4ZGRB 2D1ZA 2Z49A 2DRYA 1BARA 3A21A 1ITBA 2BEAA 4ZFUB 1R8NA 3HBWA 1MC9A 4X39A 5FZZA 3FJEA 5I1BA 4ZBVB 2Q9XA 3CRHA 4G9NA 4OWKA 1W3FA 1M2TB 1BFFA 3O5WB 3ZC9A 4OUJA 3OBRA 1G9CA 1IHKA 4DEPA 3I2AA 3BADA 4LO2C 3VT0A 3N7MA 4CJMA 3FJ9A 4LO0A 3BX1C 4XKIA 4YOLA 4ZOTA 2WBCA 3P6JA 4JKXB 1PC8B 5BXSA 4USPA 4I4RA 1Z4SA 2DRZA 5E24E 3AZVA 3IM5A 1TP0A 2GZBA 3BAVA 4KEJA 1TWEA 1IRPA 3QYDA 1D0HA 1JLXA 1RG8A 3R4UA 21BIA 1S0FA 4KBBA 4QKRA 2MIBA 1AFCA 1AVWB 1YYNA 3ZC8A 1XZZA 2ZR1B 1XYFA 4OWLA 1WD4A 4I8MA 4ZFYB 2D24A 3BA4A 1G9BA 4LO0C 2ESUA 3FJKA 2KKIA 2KH2A 1ABRB 1QXMA 1BFBA 1DIWA 1QQKA 5BQUA 4I4OA 1TTUA 3QR5A 4I0YA 1K5UA 1Z0HA 2E4MA 4EB2B 2K4AB 1TIEA 2DS0A 4IONA 2Y9GA 3AZWA 4IZXA 3FJCA 5F8WA 1FMMS 4JKQA 3S8KA 3N7LA 2D22A 1A8DA 3WA1A 3AJ5A 3B9UA 3H6RB 1KNMA 1IJTA 3CA6A 3Q7XA 2RG9B 3WO4A 2KI6B 1PUUB 4L4HA 4JP0A 1NZKA 4ZKTB 5BP5A 2D23A 3WO3A 3IAGC 2P39A 4LO7B 3BRGC 1QQLA 5BXRA 1ISVA 5BQUC 2AFGA 4USOA 3VSZA 3S8JA 1SR4C 3P53A 3BRDA 1DQGA 3JRRA 5FZYA 2AAIB 3TC2A 3WINA 1PZZA 2L5XA 2WRYA 3BAOA 2DREA 1FGAA 2E4MC 3O4AA 3FGMA 3A07A 4IHZA 4G1RA 1HWPB 2VSEA 4OEEA 1DFQA 4EEEB 3O4CA 3T8SA 1JLYA 2HWMA 1UPSA 4IY8A 2F2FA 4LO2A 9ILBA 1YXWA 5D61A 1XHBA 4DENA 4J2YA 4J2XA 3FJAA 5FNWA 2FFVA 3MPPG 2HW9A 4Q9GA 1YTOA 3OGGA 3ZX7A 5BVPI 3IIRA 3CA1A 4HR6C 5BP5C 2NYYA 5JLVA 2BEBA 4HA2A 4ISQA 3SNVA 2KLLA 2BFHA 1S0LA 2D7IA 3AKHA 3HMYA 4KEKA 2QYIB 1S0EA 1S0BA 3D7WB 3FJBA 3WINC 3NJ5A 1K5VA 1V6UA 4QO3A 5D62A 4JPZA 4IYBA 3AH2A 4GAFA 4GOYA 5G00A 1S0DA 2F2FC 3WMUA 4FVVA 1I1EA 1ISZA 4KC3A 4X38A 2K8RA 3BA7A 3RMYA 4QD2B 1Q04A 4I4UA 3CAHA 1AF9A 1WBCA 4I4VA 4Z9WB 3WMVA 4ZLBB 3AKGA 3V79C 2VSAA 4G9MA 4EKXB 3RTJB 2FFUA 7I1BA 3V0AB 1CVSA 4IY9A 3N7JA 4F34A 4GAIA 1G9DA 2Z48A 1IT0A 3V0BB 4LO8B 3LTQA 1JQZA 4H04A 3VWCA 4X3AA 3O3QA 2D44A 1ONKB 3OJ2A 4LO7C 4JAWA 4D0TA 3N0KA 4I4YA 2X2TA 4I1BA 5B2HA 3PMEA 4I1EA 2Q3NB 1ISWA 1TWMA 5DVHA 4LO1A 5FZUA 2NVHA 3OGFA 4EFPA 1ISYA 5EG6C 2IWTB 6I1BA 1SR4A 1EPWA 3BAQA 1L2HA 1FN0A 3FUOA 3HN1A 1F31A 3CQAA 3POKA 3A23A 3EF2A 2Y9FA 3Q7WA 1FV3A 3WO2A 4WBCA 1Q1UA 3BB2A 3CRGA 4FGFA 2FO1A 1JT7A 4Q91A 3FJ8A 3N7KA 1BLAA 4ZA3B 1JT4A 1HIBA 4GP0A 3E8LC 4Z8SB 1AXMA 3LLPA 5F8SA 1SZ6B 4LO3A 4LO1C 1JT5A 3UD7A 4R6UB 2F8XC 4G6JA 4GOVA 4ISRA 3IM7A 5BOWA 4J2SA 2IHOA 2AQZA 1JT3A 3NBEA 3F1RA 1WD3A 3O4DA 2I1BA 3MALA 3RMXA 3BRFA 1DZDA 4P0JA 3NBNA 2R9KB 2RSTA 3AKFA 1WBAA 2M49A 3ZXDA 2QN4A 1J0SA 4L4IA 3R4SA 3PG0A 3BAHA 4I2SA 5DUYA 1BFGA 3FJDA 1II4A 3K1XA 2AXMA 1FMZA 3JUTA 3ILAA 4I4SA 4ZFWB 5FNXA 4A7ZA 2K43A 1PWAA 3F62B 2ET2A 4I4PA 5DZUA 5F90A 4A7KA 1AVUA 4XFSA 3UJ0A 4LO3C 1XG6A 3O4OA 3BAUA 1EVTA 1HWOB 3H6RA 2VXRA 1G82A 3RSJA 1BFCA 3H6SE 5BXTA 1HWNB 4I37A 1YF8B 2XOAA 2RQ9A 4EFQA 3CA0A 1RY7A 4AN6A 3VUOA 1AVAC 1DZCA 4KEIA 1DLLA 4I4XA 4J2KA 3A22A 5EC5A 2KI4A 1T4QA 3O49A 4I3NA 2LIEA 1W3GA 2HZ9A 4QALA 1MD6A 1BASA 2FGFA 4P0LA 1OQLB 3CA5A 4AN7B 3O44A 2ZQNA 4D0ZA 1V6XA 4QBVA 1T9FA 3CA3A 3C9ZA 3VEQA 4OWJA 3BAGA 4X37A 5D63A 4H9WA 1VCLA 4XFUA 3AH4A 4OW4A 2D7RA 3RTIB 1DJSB 2Y9WC 3H6QA 5JMCA 4TLPA 2X2SA 4F83A 1W3AA 4I4QA 2HWAA 3FJFA 4A7YA 1GGPB 1PUMB 3AKIA 3FJIA 4P0KA 3OJMA 3PHZA 1V6VA 3KMVA 3OBTA 2P23A 2D43A 4PC4A 2VU9A 1HCDA 3AH1A 1G9AA 3W9TA 1S0CA 4IZEA 1EYLA 3OJVA 4QBCA 4JQ0A 4QKSA 2NTDA 1JTCA 2LIQA 1IOBA 1RMLA 3UD9A 5F8YA 4QC4A 4I7IA 3VT2A 3HSMA 4OEFA 1HCEA 31BIA 3FFZA
chains in the Genus database with same CATH superfamily
1IILA 1TFMB 2GO2A 2J3PA 3CRIA 3HALA 3V0AA 3O4BA 1P63A 2D20A 3BA5A 3I29B 5HPZA 41BIA 3V0BA 1EV2A 2MC2A 1FQ9A 5EHAA 4ENDA 1M16A 4Q9PA 1BA7A 3ZXGA 3NBDA 2ERMA 3BTAA 1JY0A 2VLCA 1CE7B 1E0OA 3FJHA 4I96A 5DSSB 3Q7YA 4D8HA 3NBCA 4P6AA 4HJJA 1YBIA 3UD8A 2NM1A 3IM6A 1DQOA 1Z2VA 2NP0A 1ILR1 1FWUA 4QD2C 2MLLB 3P6IA 1DFCA 2NZ9A 3FUQA 4OEGA 5GAQA 4G6MA 2FDBM 2Y9XE 1V6WA 3VT1A 3PUBA 3AJ6A 4DCKC 4XFTA 3FJJA 1HWMB 3I2XA 2ZQOA 1TOOA 1AVXB 1FWVA 1FV2A 1I1BA 4IQPA 1HKNA 3VSFA 4JRAA 1NUNA 4GP3A 3HOMA 1N4KA 1RZOB 2UUSA 2VUAA 4EFRA 1BLDA 1R8OA 4J23B 2VXTI 1S0GA 1IRAX 3UJ4A 2YUGA 1ISXA 1Q03A 3CA4A 8I1BA 3CU1B 4II0A 4I6IA 3UDAA 5BXPA 4ZGRB 2D1ZA 2Z49A 2NS2A 2DRYA 1BARA 3A21A 1ITBA 2BEAA 4ZFUB 1R8NA 3HBWA 1MC9A 4X39A 5FZZA 3FJEA 5I1BA 4ZBVB 2Q9XA 3CRHA 4G9NA 4OWKA 1W3FA 1M2TB 1BFFA 3O5WB 3ZC9A 4OUJA 3OBRA 1G9CA 1IHKA 4DEPA 3I2AA 3BADA 4LO2C 3VT0A 3N7MA 4CJMA 3FJ9A 4LO0A 3BX1C 4XKIA 4YOLA 4ZOTA 2WBCA 3P6JA 4JKXB 1PC8B 5BXSA 4USPA 4I4RA 1Z4SA 2DRZA 5E24E 3AZVA 4MZHA 3IM5A 1TP0A 2GZBA 3BAVA 4KEJA 1TWEA 1IRPA 3QYDA 1D0HA 1JLXA 1RG8A 3R4UA 21BIA 1S0FA 4KBBA 4QKRA 2MIBA 1AFCA 1AVWB 1YYNA 3ZC8A 1XZZA 2ZR1B 1XYFA 4OWLA 1WD4A 4I8MA 4ZFYB 2D24A 3BA4A 1G9BA 4LO0C 2ESUA 3FJKA 2KKIA 2KH2A 1ABRB 1QXMA 1BFBA 1DIWA 1QQKA 5BQUA 4I4OA 1TTUA 3QR5A 4I0YA 1K5UA 1Z0HA 2E4MA 4EB2B 2K4AB 1TIEA 2DS0A 4IONA 2Y9GA 3AZWA 4IZXA 3FJCA 4H75A 5F8WA 1FMMS 4JKQA 3S8KA 3N7LA 2D22A 1A8DA 3WA1A 3AJ5A 3B9UA 3H6RB 1KNMA 1IJTA 3CA6A 3Q7XA 2RG9B 3WO4A 2KI6B 1PUUB 4L4HA 4JP0A 1NZKA 4ZKTB 5BP5A 2D23A 3WO3A 3IAGC 2P39A 4LO7B 3BRGC 1QQLA 5BXRA 1ISVA 5BQUC 2AFGA 4USOA 3VSZA 3S8JA 1SR4C 3P53A 3BRDA 1DQGA 3JRRA 5FZYA 2AAIB 3TC2A 3WINA 1PZZA 2L5XA 2WRYA 3BAOA 2DREA 1FGAA 2E4MC 3O4AA 3FGMA 3A07A 4IHZA 4G1RA 1HWPB 2VSEA 4OEEA 1DFQA 4EEEB 3O4CA 3T8SA 1JLYA 2HWMA 1UPSA 4IY8A 2F2FA 4LO2A 9ILBA 1YXWA 5D61A 1XHBA 4DENA 4J2YA 4J2XA 3FJAA 5FNWA 2FFVA 3MPPG 2HW9A 4Q9GA 1YTOA 3OGGA 3ZX7A 5BVPI 3IIRA 3CA1A 4HR6C 5BP5C 2NYYA 5JLVA 2BEBA 4HA2A 4ISQA 3SNVA 2KLLA 2BFHA 1S0LA 2D7IA 3AKHA 3HMYA 4KEKA 2QYIB 1S0EA 1S0BA 3D7WB 3FJBA 3WINC 3NJ5A 1K5VA 1V6UA 4QO3A 5D62A 4JPZA 4IYBA 3AH2A 4GAFA 4GOYA 4MZFB 5G00A 1S0DA 2F2FC 3WMUA 4FVVA 1I1EA 1ISZA 4KC3A 4X38A 2K8RA 3BA7A 3RMYA 4QD2B 1Q04A 4I4UA 3CAHA 1AF9A 1WBCA 4I4VA 4Z9WB 3WMVA 4ZLBB 3AKGA 3V79C 2VSAA 4G9MA 4EKXB 3RTJB 2FFUA 7I1BA 3V0AB 1CVSA 4IY9A 3N7JA 4F34A 4GAIA 1G9DA 2Z48A 1IT0A 3V0BB 4LO8B 3LTQA 1JQZA 4H04A 3VWCA 4X3AA 3O3QA 2D44A 1ONKB 3OJ2A 4LO7C 4JAWA 4D0TA 3N0KA 4I4YA 2X2TA 4I1BA 5B2HA 3PMEA 4I1EA 2Q3NB 1ISWA 1TWMA 5DVHA 4LO1A 5FZUA 2NVHA 3OGFA 4EFPA 1ISYA 5EG6C 2IWTB 6I1BA 1SR4A 1EPWA 3BAQA 1L2HA 1FN0A 3FUOA 3HN1A 1F31A 3CQAA 3POKA 3A23A 3EF2A 2Y9FA 3Q7WA 1FV3A 3WO2A 4WBCA 1Q1UA 3BB2A 3CRGA 4FGFA 2FO1A 1JT7A 4Q91A 3FJ8A 3N7KA 1BLAA 4ZA3B 1JT4A 1HIBA 4GP0A 3E8LC 4Z8SB 1AXMA 3LLPA 5F8SA 1SZ6B 4LO3A 4LO1C 1JT5A 3UD7A 4R6UB 2F8XC 4G6JA 4GOVA 4ISRA 3IM7A 5BOWA 4J2SA 2IHOA 4MZGB 2AQZA 1JT3A 3NBEA 3F1RA 1WD3A 3O4DA 2I1BA 3MALA 3RMXA 3BRFA 1DZDA 4P0JA 3NBNA 2R9KB 2RSTA 3AKFA 1WBAA 2M49A 3ZXDA 2QN4A 1J0SA 4L4IA 3R4SA 3PG0A 3BAHA 4I2SA 5DUYA 1BFGA 3FJDA 1II4A 3K1XA 2AXMA 1FMZA 3JUTA 3ILAA 4I4SA 4ZFWB 5FNXA 4A7ZA 2K43A 1PWAA 3F62B 2ET2A 4I4PA 5DZUA 5F90A 4A7KA 1AVUA 4XFSA 3UJ0A 4LO3C 1XG6A 3O4OA 3BAUA 1EVTA 1HWOB 3H6RA 2VXRA 1G82A 3RSJA 1BFCA 3H6SE 5BXTA 1HWNB 4I37A 1YF8B 2XOAA 2RQ9A 4EFQA 3CA0A 1RY7A 4AN6A 3VUOA 1AVAC 1DZCA 4KEIA 1DLLA 4I4XA 4J2KA 3A22A 5EC5A 2KI4A 1T4QA 3O49A 4I3NA 2LIEA 1W3GA 2HZ9A 4QALA 1MD6A 1BASA 2FGFA 4P0LA 1OQLB 3CA5A 4AN7B 3O44A 2ZQNA 4D0ZA 1V6XA 4QBVA 1T9FA 3CA3A 3C9ZA 3VEQA 4OWJA 3BAGA 4X37A 5D63A 4H9WA 1VCLA 4XFUA 3AH4A 4OW4A 2D7RA 3RTIB 1DJSB 2Y9WC 3H6QA 5JMCA 4TLPA 2X2SA 4F83A 1W3AA 4I4QA 2HWAA 3FJFA 4A7YA 1GGPB 1PUMB 3AKIA 3FJIA 4P0KA 3OJMA 3PHZA 1V6VA 4UY4A 3KMVA 3OBTA 2P23A 2D43A 4PC4A 2VU9A 1HCDA 3AH1A 1G9AA 3W9TA 1S0CA 4IZEA 1EYLA 3OJVA 4QBCA 4JQ0A 4QKSA 2NTDA 1JTCA 2LIQA 1IOBA 1RMLA 3UD9A 5F8YA 4QC4A 4I7IA 3VT2A 3HSMA 4OEFA 1HCEA 31BIA 3FFZA
chains in the Genus database with same CATH topology
1IILA 1TFMB 2GO2A 2J3PA 3CRIA 3HALA 3V0AA 3O4BA 1P63A 2D20A 3BA5A 3I29B 5HPZA 41BIA 3V0BA 1EV2A 2MC2A 1FQ9A 5EHAA 4ENDA 1M16A 4Q9PA 1BA7A 3ZXGA 3NBDA 2ERMA 3BTAA 1JY0A 2VLCA 1CE7B 1E0OA 3FJHA 4I96A 5DSSB 3Q7YA 4D8HA 3NBCA 4P6AA 4HJJA 1YBIA 3UD8A 2NM1A 3IM6A 1DQOA 1Z2VA 2NP0A 1ILR1 1FWUA 4QD2C 2MLLB 3P6IA 1DFCA 2NZ9A 3FUQA 4OEGA 5GAQA 4G6MA 2FDBM 2Y9XE 1V6WA 3VT1A 3PUBA 3AJ6A 4DCKC 4XFTA 3FJJA 1HWMB 3I2XA 2ZQOA 1TOOA 1AVXB 1FWVA 1FV2A 1I1BA 4IQPA 1HKNA 3VSFA 4JRAA 1NUNA 4GP3A 3HOMA 1N4KA 1RZOB 2UUSA 2VUAA 4EFRA 1BLDA 1R8OA 4J23B 2VXTI 1S0GA 1IRAX 3UJ4A 2YUGA 1ISXA 1Q03A 3CA4A 8I1BA 3CU1B 4II0A 4I6IA 3UDAA 5BXPA 4ZGRB 2D1ZA 2Z49A 2NS2A 2DRYA 1BARA 3A21A 1ITBA 2BEAA 4ZFUB 1R8NA 3HBWA 1MC9A 4X39A 5FZZA 3FJEA 5I1BA 4ZBVB 2Q9XA 3CRHA 4G9NA 4OWKA 1W3FA 1M2TB 1BFFA 3O5WB 3ZC9A 4OUJA 3OBRA 1G9CA 1IHKA 4DEPA 3I2AA 3BADA 4LO2C 3VT0A 3N7MA 4CJMA 3FJ9A 4LO0A 3BX1C 4XKIA 4YOLA 4ZOTA 2WBCA 3P6JA 4JKXB 1PC8B 5BXSA 4USPA 4I4RA 1Z4SA 2DRZA 5E24E 3AZVA 4MZHA 3IM5A 1TP0A 2GZBA 3BAVA 4KEJA 1TWEA 1IRPA 3QYDA 1D0HA 1JLXA 1RG8A 3R4UA 21BIA 1S0FA 4KBBA 4QKRA 2MIBA 1AFCA 1AVWB 1YYNA 3ZC8A 1XZZA 2ZR1B 1XYFA 4OWLA 1WD4A 4I8MA 4ZFYB 2D24A 3BA4A 1G9BA 4LO0C 2ESUA 3FJKA 2KKIA 2KH2A 1ABRB 1QXMA 1BFBA 1DIWA 1QQKA 5BQUA 4I4OA 1TTUA 3QR5A 4I0YA 1K5UA 1Z0HA 2E4MA 4EB2B 2K4AB 1TIEA 2DS0A 4IONA 2Y9GA 3AZWA 4IZXA 3FJCA 4H75A 5F8WA 1FMMS 4JKQA 3S8KA 3N7LA 2D22A 1A8DA 3WA1A 3AJ5A 3B9UA 3H6RB 1KNMA 1IJTA 3CA6A 3Q7XA 2RG9B 3WO4A 2KI6B 1PUUB 4L4HA 4JP0A 1NZKA 4ZKTB 5BP5A 2D23A 3WO3A 3IAGC 2P39A 4LO7B 3BRGC 1QQLA 5BXRA 1ISVA 5BQUC 2AFGA 4USOA 3VSZA 3S8JA 1SR4C 3P53A 3BRDA 1DQGA 3JRRA 5FZYA 2AAIB 3TC2A 3WINA 1PZZA 2L5XA 2WRYA 3BAOA 2DREA 1FGAA 2E4MC 3O4AA 3FGMA 3A07A 4IHZA 4G1RA 1HWPB 2VSEA 4OEEA 1DFQA 4EEEB 3O4CA 3T8SA 1JLYA 2HWMA 1UPSA 4IY8A 2F2FA 4LO2A 9ILBA 1YXWA 5D61A 1XHBA 4DENA 4J2YA 4J2XA 3FJAA 5FNWA 2FFVA 3MPPG 2HW9A 4Q9GA 1YTOA 3OGGA 3ZX7A 5BVPI 3IIRA 3CA1A 4HR6C 5BP5C 2NYYA 5JLVA 2BEBA 4HA2A 4ISQA 3SNVA 2KLLA 2BFHA 1S0LA 2D7IA 3AKHA 3HMYA 4KEKA 2QYIB 1S0EA 1S0BA 3D7WB 3FJBA 3WINC 3NJ5A 1K5VA 1V6UA 4QO3A 5D62A 4JPZA 4IYBA 3AH2A 4GAFA 4GOYA 4MZFB 5G00A 1S0DA 2F2FC 3WMUA 4FVVA 1I1EA 1ISZA 4KC3A 4X38A 2K8RA 3BA7A 3RMYA 4QD2B 1Q04A 4I4UA 3CAHA 1AF9A 1WBCA 4I4VA 4Z9WB 3WMVA 4ZLBB 3AKGA 3V79C 2VSAA 4G9MA 4EKXB 3RTJB 2FFUA 7I1BA 3V0AB 1CVSA 4IY9A 3N7JA 4F34A 4GAIA 1G9DA 2Z48A 1IT0A 3V0BB 4LO8B 3LTQA 1JQZA 4H04A 3VWCA 4X3AA 3O3QA 2D44A 1ONKB 3OJ2A 4LO7C 4JAWA 4D0TA 3N0KA 4I4YA 2X2TA 4I1BA 5B2HA 3PMEA 4I1EA 2Q3NB 1ISWA 1TWMA 5DVHA 4LO1A 5FZUA 2NVHA 3OGFA 4EFPA 1ISYA 5EG6C 2IWTB 6I1BA 1SR4A 1EPWA 3BAQA 1L2HA 1FN0A 3FUOA 3HN1A 1F31A 3CQAA 3POKA 3A23A 3EF2A 2Y9FA 3Q7WA 1FV3A 3WO2A 4WBCA 1Q1UA 3BB2A 3CRGA 4FGFA 2FO1A 1JT7A 4Q91A 3FJ8A 3N7KA 1BLAA 4ZA3B 1JT4A 1HIBA 4GP0A 3E8LC 4Z8SB 1AXMA 3LLPA 5F8SA 1SZ6B 4LO3A 4LO1C 1JT5A 3UD7A 4R6UB 2F8XC 4G6JA 4GOVA 4ISRA 3IM7A 5BOWA 4J2SA 2IHOA 4MZGB 2AQZA 1JT3A 3NBEA 3F1RA 1WD3A 3O4DA 2I1BA 3MALA 3RMXA 3BRFA 1DZDA 4P0JA 3NBNA 2R9KB 2RSTA 3AKFA 1WBAA 2M49A 3ZXDA 2QN4A 1J0SA 4L4IA 3R4SA 3PG0A 3BAHA 4I2SA 5DUYA 1BFGA 3FJDA 1II4A 3K1XA 2AXMA 1FMZA 3JUTA 3ILAA 4I4SA 4ZFWB 5FNXA 4A7ZA 2K43A 1PWAA 3F62B 2ET2A 4I4PA 5DZUA 5F90A 4A7KA 1AVUA 4XFSA 3UJ0A 4LO3C 1XG6A 3O4OA 3BAUA 1EVTA 1HWOB 3H6RA 2VXRA 1G82A 3RSJA 1BFCA 3H6SE 5BXTA 1HWNB 4I37A 1YF8B 2XOAA 2RQ9A 4EFQA 3CA0A 1RY7A 4AN6A 3VUOA 1AVAC 1DZCA 4KEIA 1DLLA 4I4XA 4J2KA 3A22A 5EC5A 2KI4A 1T4QA 3O49A 4I3NA 2LIEA 1W3GA 2HZ9A 4QALA 1MD6A 1BASA 2FGFA 4P0LA 1OQLB 3CA5A 4AN7B 3O44A 2ZQNA 4D0ZA 1V6XA 4QBVA 1T9FA 3CA3A 3C9ZA 3VEQA 4OWJA 3BAGA 4X37A 5D63A 4H9WA 1VCLA 4XFUA 3AH4A 4OW4A 2D7RA 3RTIB 1DJSB 2Y9WC 3H6QA 5JMCA 4TLPA 2X2SA 4F83A 1W3AA 4I4QA 2HWAA 3FJFA 4A7YA 1GGPB 1PUMB 3AKIA 3FJIA 4P0KA 3OJMA 3PHZA 1V6VA 4UY4A 3KMVA 3OBTA 2P23A 2D43A 4PC4A 2VU9A 1HCDA 3AH1A 1G9AA 3W9TA 1S0CA 4IZEA 1EYLA 3OJVA 4QBCA 4JQ0A 4QKSA 2NTDA 1JTCA 2LIQA 1IOBA 1RMLA 3UD9A 5F8YA 4QC4A 4I7IA 3VT2A 3HSMA 4OEFA 1HCEA 31BIA 3FFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IIL A;  1TFM B;  2GO2 A;  2J3P A;  3CRI A;  3HAL A;  3V0A A;  3O4B A;  1P63 A;  2D20 A;  3BA5 A;  3I29 B;  5HPZ A;  41BI A;  3V0B A;  1EV2 A;  2MC2 A;  1FQ9 A;  5EHA A;  4END A;  1M16 A;  4Q9P A;  1BA7 A;  3ZXG A;  3NBD A;  2ERM A;  3BTA A;  1JY0 A;  2VLC A;  1CE7 B;  1E0O A;  3FJH A;  4I96 A;  5DSS B;  3Q7Y A;  4D8H A;  3NBC A;  4P6A A;  4HJJ A;  1YBI A;  3UD8 A;  2NM1 A;  3IM6 A;  1DQO A;  1Z2V A;  2NP0 A;  1ILR 1;  1FWU A;  4QD2 C;  2MLL B;  3P6I A;  1DFC A;  2NZ9 A;  3FUQ A;  4OEG A;  5GAQ A;  4G6M A;  2FDB M;  2Y9X E;  1V6W A;  3VT1 A;  3PUB A;  3AJ6 A;  4DCK C;  4XFT A;  3FJJ A;  1HWM B;  3I2X A;  2ZQO A;  1TOO A;  1AVX B;  1FWV A;  1FV2 A;  1I1B A;  4IQP A;  1HKN A;  3VSF A;  4JRA A;  1NUN A;  4GP3 A;  3HOM A;  1N4K A;  1RZO B;  2UUS A;  2VUA A;  4EFR A;  1BLD A;  1R8O A;  4J23 B;  2VXT I;  1S0G A;  1IRA X;  3UJ4 A;  2YUG A;  1ISX A;  1Q03 A;  3CA4 A;  8I1B A;  3CU1 B;  4II0 A;  4I6I A;  3UDA A;  5BXP A;  4ZGR B;  2D1Z A;  2Z49 A;  2DRY A;  1BAR A;  3A21 A;  1ITB A;  2BEA A;  4ZFU B;  1R8N A;  3HBW A;  1MC9 A;  4X39 A;  5FZZ A;  3FJE A;  5I1B A;  4ZBV B;  2Q9X A;  3CRH A;  4G9N A;  4OWK A;  1W3F A;  1M2T B;  1BFF A;  3O5W B;  3ZC9 A;  4OUJ A;  3OBR A;  1G9C A;  1IHK A;  4DEP A;  3I2A A;  3BAD A;  4LO2 C;  3VT0 A;  3N7M A;  4CJM A;  3FJ9 A;  4LO0 A;  3BX1 C;  4XKI A;  4YOL A;  4ZOT A;  2WBC A;  3P6J A;  4JKX B;  1PC8 B;  5BXS A;  4USP A;  4I4R A;  1Z4S A;  2DRZ A;  5E24 E;  3AZV A;  3IM5 A;  1TP0 A;  2GZB A;  3BAV A;  4KEJ A;  1TWE A;  1IRP A;  3QYD A;  1D0H A;  1JLX A;  1RG8 A;  3R4U A;  21BI A;  1S0F A;  4KBB A;  4QKR A;  2MIB A;  1AFC A;  1AVW B;  1YYN A;  3ZC8 A;  1XZZ A;  2ZR1 B;  1XYF A;  4OWL A;  1WD4 A;  4I8M A;  4ZFY B;  2D24 A;  3BA4 A;  1G9B A;  4LO0 C;  2ESU A;  3FJK A;  2KKI A;  2KH2 A;  1ABR B;  1QXM A;  1BFB A;  1DIW A;  1QQK A;  5BQU A;  4I4O A;  1TTU A;  3QR5 A;  4I0Y A;  1K5U A;  1Z0H A;  2E4M A;  4EB2 B;  2K4A B;  1TIE A;  2DS0 A;  4ION A;  2Y9G A;  3AZW A;  4IZX A;  3FJC A;  5F8W A;  1FMM S;  4JKQ A;  3S8K A;  3N7L A;  2D22 A;  1A8D A;  3WA1 A;  3AJ5 A;  3B9U A;  3H6R B;  1KNM A;  1IJT A;  3CA6 A;  3Q7X A;  2RG9 B;  3WO4 A;  2KI6 B;  1PUU B;  4L4H A;  4JP0 A;  1NZK A;  4ZKT B;  5BP5 A;  2D23 A;  3WO3 A;  3IAG C;  2P39 A;  4LO7 B;  3BRG C;  1QQL A;  5BXR A;  1ISV A;  5BQU C;  2AFG A;  4USO A;  3VSZ A;  3S8J A;  1SR4 C;  3P53 A;  3BRD A;  1DQG A;  3JRR A;  5FZY A;  2AAI B;  3TC2 A;  3WIN A;  1PZZ A;  2L5X A;  2WRY A;  3BAO A;  2DRE A;  1FGA A;  2E4M C;  3O4A A;  3FGM A;  3A07 A;  4IHZ A;  4G1R A;  1HWP B;  2VSE A;  4OEE A;  1DFQ A;  4EEE B;  3O4C A;  3T8S A;  1JLY A;  2HWM A;  1UPS A;  4IY8 A;  2F2F A;  4LO2 A;  9ILB A;  1YXW A;  5D61 A;  1XHB A;  4DEN A;  4J2Y A;  4J2X A;  3FJA A;  5FNW A;  2FFV A;  3MPP G;  2HW9 A;  4Q9G A;  1YTO A;  3OGG A;  3ZX7 A;  5BVP I;  3IIR A;  3CA1 A;  4HR6 C;  5BP5 C;  2NYY A;  5JLV A;  2BEB A;  4HA2 A;  4ISQ A;  3SNV A;  2KLL A;  2BFH A;  1S0L A;  2D7I A;  3AKH A;  3HMY A;  4KEK A;  2QYI B;  1S0E A;  1S0B A;  3D7W B;  3FJB A;  3WIN C;  3NJ5 A;  1K5V A;  1V6U A;  4QO3 A;  5D62 A;  4JPZ A;  4IYB A;  3AH2 A;  4GAF A;  4GOY A;  5G00 A;  1S0D A;  2F2F C;  3WMU A;  4FVV A;  1I1E A;  1ISZ A;  4KC3 A;  4X38 A;  2K8R A;  3BA7 A;  3RMY A;  4QD2 B;  1Q04 A;  4I4U A;  3CAH A;  1AF9 A;  1WBC A;  4I4V A;  4Z9W B;  3WMV A;  4ZLB B;  3AKG A;  3V79 C;  2VSA A;  4G9M A;  4EKX B;  3RTJ B;  2FFU A;  7I1B A;  3V0A B;  1CVS A;  4IY9 A;  3N7J A;  4F34 A;  4GAI A;  1G9D A;  2Z48 A;  1IT0 A;  3V0B B;  4LO8 B;  3LTQ A;  1JQZ A;  4H04 A;  3VWC A;  4X3A A;  3O3Q A;  2D44 A;  1ONK B;  3OJ2 A;  4LO7 C;  4JAW A;  4D0T A;  3N0K A;  4I4Y A;  2X2T A;  4I1B A;  5B2H A;  3PME A;  4I1E A;  2Q3N B;  1ISW A;  1TWM A;  5DVH A;  4LO1 A;  5FZU A;  2NVH A;  3OGF A;  4EFP A;  1ISY A;  5EG6 C;  2IWT B;  6I1B A;  1SR4 A;  1EPW A;  3BAQ A;  1L2H A;  1FN0 A;  3FUO A;  3HN1 A;  1F31 A;  3CQA A;  3POK A;  3A23 A;  3EF2 A;  2Y9F A;  3Q7W A;  1FV3 A;  3WO2 A;  4WBC A;  1Q1U A;  3BB2 A;  3CRG A;  4FGF A;  2FO1 A;  1JT7 A;  4Q91 A;  3FJ8 A;  3N7K A;  1BLA A;  4ZA3 B;  1JT4 A;  1HIB A;  4GP0 A;  3E8L C;  4Z8S B;  1AXM A;  3LLP A;  5F8S A;  1SZ6 B;  4LO3 A;  4LO1 C;  1JT5 A;  3UD7 A;  4R6U B;  2F8X C;  4G6J A;  4GOV A;  4ISR A;  3IM7 A;  5BOW A;  4J2S A;  2IHO A;  2AQZ A;  1JT3 A;  3NBE A;  3F1R A;  1WD3 A;  3O4D A;  2I1B A;  3MAL A;  3RMX A;  3BRF A;  1DZD A;  4P0J A;  3NBN A;  2R9K B;  2RST A;  3AKF A;  1WBA A;  2M49 A;  3ZXD A;  2QN4 A;  1J0S A;  4L4I A;  3R4S A;  3PG0 A;  3BAH A;  4I2S A;  5DUY A;  1BFG A;  3FJD A;  1II4 A;  3K1X A;  2AXM A;  1FMZ A;  3JUT A;  3ILA A;  4I4S A;  4ZFW B;  5FNX A;  4A7Z A;  2K43 A;  1PWA A;  3F62 B;  2ET2 A;  4I4P A;  5DZU A;  5F90 A;  4A7K A;  1AVU A;  4XFS A;  3UJ0 A;  4LO3 C;  1XG6 A;  3O4O A;  3BAU A;  1EVT A;  1HWO B;  3H6R A;  2VXR A;  1G82 A;  3RSJ A;  1BFC A;  3H6S E;  5BXT A;  1HWN B;  4I37 A;  1YF8 B;  2XOA A;  2RQ9 A;  4EFQ A;  3CA0 A;  1RY7 A;  4AN6 A;  3VUO A;  1AVA C;  1DZC A;  4KEI A;  1DLL A;  4I4X A;  4J2K A;  3A22 A;  5EC5 A;  2KI4 A;  1T4Q A;  3O49 A;  4I3N A;  2LIE A;  1W3G A;  2HZ9 A;  4QAL A;  1MD6 A;  1BAS A;  2FGF A;  4P0L A;  1OQL B;  3CA5 A;  4AN7 B;  3O44 A;  2ZQN A;  4D0Z A;  1V6X A;  4QBV A;  1T9F A;  3CA3 A;  3C9Z A;  3VEQ A;  4OWJ A;  3BAG A;  4X37 A;  5D63 A;  4H9W A;  1VCL A;  4XFU A;  3AH4 A;  4OW4 A;  2D7R A;  3RTI B;  1DJS B;  2Y9W C;  3H6Q A;  5JMC A;  4TLP A;  2X2S A;  4F83 A;  1W3A A;  4I4Q A;  2HWA A;  3FJF A;  4A7Y A;  1GGP B;  1PUM B;  3AKI A;  3FJI A;  4P0K A;  3OJM A;  3PHZ A;  1V6V A;  3KMV A;  3OBT A;  2P23 A;  2D43 A;  4PC4 A;  2VU9 A;  1HCD A;  3AH1 A;  1G9A A;  3W9T A;  1S0C A;  4IZE A;  1EYL A;  3OJV A;  4QBC A;  4JQ0 A;  4QKS A;  2NTD A;  1JTC A;  2LIQ A;  1IOB A;  1RML A;  3UD9 A;  5F8Y A;  4QC4 A;  4I7I A;  3VT2 A;  3HSM A;  4OEF A;  1HCE A;  31BI A;  3FFZ A; 
#chains in the Genus database with same CATH topology
 1IIL A;  1TFM B;  2GO2 A;  2J3P A;  3CRI A;  3HAL A;  3V0A A;  3O4B A;  1P63 A;  2D20 A;  3BA5 A;  3I29 B;  5HPZ A;  41BI A;  3V0B A;  1EV2 A;  2MC2 A;  1FQ9 A;  5EHA A;  4END A;  1M16 A;  4Q9P A;  1BA7 A;  3ZXG A;  3NBD A;  2ERM A;  3BTA A;  1JY0 A;  2VLC A;  1CE7 B;  1E0O A;  3FJH A;  4I96 A;  5DSS B;  3Q7Y A;  4D8H A;  3NBC A;  4P6A A;  4HJJ A;  1YBI A;  3UD8 A;  2NM1 A;  3IM6 A;  1DQO A;  1Z2V A;  2NP0 A;  1ILR 1;  1FWU A;  4QD2 C;  2MLL B;  3P6I A;  1DFC A;  2NZ9 A;  3FUQ A;  4OEG A;  5GAQ A;  4G6M A;  2FDB M;  2Y9X E;  1V6W A;  3VT1 A;  3PUB A;  3AJ6 A;  4DCK C;  4XFT A;  3FJJ A;  1HWM B;  3I2X A;  2ZQO A;  1TOO A;  1AVX B;  1FWV A;  1FV2 A;  1I1B A;  4IQP A;  1HKN A;  3VSF A;  4JRA A;  1NUN A;  4GP3 A;  3HOM A;  1N4K A;  1RZO B;  2UUS A;  2VUA A;  4EFR A;  1BLD A;  1R8O A;  4J23 B;  2VXT I;  1S0G A;  1IRA X;  3UJ4 A;  2YUG A;  1ISX A;  1Q03 A;  3CA4 A;  8I1B A;  3CU1 B;  4II0 A;  4I6I A;  3UDA A;  5BXP A;  4ZGR B;  2D1Z A;  2Z49 A;  2NS2 A;  2DRY A;  1BAR A;  3A21 A;  1ITB A;  2BEA A;  4ZFU B;  1R8N A;  3HBW A;  1MC9 A;  4X39 A;  5FZZ A;  3FJE A;  5I1B A;  4ZBV B;  2Q9X A;  3CRH A;  4G9N A;  4OWK A;  1W3F A;  1M2T B;  1BFF A;  3O5W B;  3ZC9 A;  4OUJ A;  3OBR A;  1G9C A;  1IHK A;  4DEP A;  3I2A A;  3BAD A;  4LO2 C;  3VT0 A;  3N7M A;  4CJM A;  3FJ9 A;  4LO0 A;  3BX1 C;  4XKI A;  4YOL A;  4ZOT A;  2WBC A;  3P6J A;  4JKX B;  1PC8 B;  5BXS A;  4USP A;  4I4R A;  1Z4S A;  2DRZ A;  5E24 E;  3AZV A;  4MZH A;  3IM5 A;  1TP0 A;  2GZB A;  3BAV A;  4KEJ A;  1TWE A;  1IRP A;  3QYD A;  1D0H A;  1JLX A;  1RG8 A;  3R4U A;  21BI A;  1S0F A;  4KBB A;  4QKR A;  2MIB A;  1AFC A;  1AVW B;  1YYN A;  3ZC8 A;  1XZZ A;  2ZR1 B;  1XYF A;  4OWL A;  1WD4 A;  4I8M A;  4ZFY B;  2D24 A;  3BA4 A;  1G9B A;  4LO0 C;  2ESU A;  3FJK A;  2KKI A;  2KH2 A;  1ABR B;  1QXM A;  1BFB A;  1DIW A;  1QQK A;  5BQU A;  4I4O A;  1TTU A;  3QR5 A;  4I0Y A;  1K5U A;  1Z0H A;  2E4M A;  4EB2 B;  2K4A B;  1TIE A;  2DS0 A;  4ION A;  2Y9G A;  3AZW A;  4IZX A;  3FJC A;  4H75 A;  5F8W A;  1FMM S;  4JKQ A;  3S8K A;  3N7L A;  2D22 A;  1A8D A;  3WA1 A;  3AJ5 A;  3B9U A;  3H6R B;  1KNM A;  1IJT A;  3CA6 A;  3Q7X A;  2RG9 B;  3WO4 A;  2KI6 B;  1PUU B;  4L4H A;  4JP0 A;  1NZK A;  4ZKT B;  5BP5 A;  2D23 A;  3WO3 A;  3IAG C;  2P39 A;  4LO7 B;  3BRG C;  1QQL A;  5BXR A;  1ISV A;  5BQU C;  2AFG A;  4USO A;  3VSZ A;  3S8J A;  1SR4 C;  3P53 A;  3BRD A;  1DQG A;  3JRR A;  5FZY A;  2AAI B;  3TC2 A;  3WIN A;  1PZZ A;  2L5X A;  2WRY A;  3BAO A;  2DRE A;  1FGA A;  2E4M C;  3O4A A;  3FGM A;  3A07 A;  4IHZ A;  4G1R A;  1HWP B;  2VSE A;  4OEE A;  1DFQ A;  4EEE B;  3O4C A;  3T8S A;  1JLY A;  2HWM A;  1UPS A;  4IY8 A;  2F2F A;  4LO2 A;  9ILB A;  1YXW A;  5D61 A;  1XHB A;  4DEN A;  4J2Y A;  4J2X A;  3FJA A;  5FNW A;  2FFV A;  3MPP G;  2HW9 A;  4Q9G A;  1YTO A;  3OGG A;  3ZX7 A;  5BVP I;  3IIR A;  3CA1 A;  4HR6 C;  5BP5 C;  2NYY A;  5JLV A;  2BEB A;  4HA2 A;  4ISQ A;  3SNV A;  2KLL A;  2BFH A;  1S0L A;  2D7I A;  3AKH A;  3HMY A;  4KEK A;  2QYI B;  1S0E A;  1S0B A;  3D7W B;  3FJB A;  3WIN C;  3NJ5 A;  1K5V A;  1V6U A;  4QO3 A;  5D62 A;  4JPZ A;  4IYB A;  3AH2 A;  4GAF A;  4GOY A;  4MZF B;  5G00 A;  1S0D A;  2F2F C;  3WMU A;  4FVV A;  1I1E A;  1ISZ A;  4KC3 A;  4X38 A;  2K8R A;  3BA7 A;  3RMY A;  4QD2 B;  1Q04 A;  4I4U A;  3CAH A;  1AF9 A;  1WBC A;  4I4V A;  4Z9W B;  3WMV A;  4ZLB B;  3AKG A;  3V79 C;  2VSA A;  4G9M A;  4EKX B;  3RTJ B;  2FFU A;  7I1B A;  3V0A B;  1CVS A;  4IY9 A;  3N7J A;  4F34 A;  4GAI A;  1G9D A;  2Z48 A;  1IT0 A;  3V0B B;  4LO8 B;  3LTQ A;  1JQZ A;  4H04 A;  3VWC A;  4X3A A;  3O3Q A;  2D44 A;  1ONK B;  3OJ2 A;  4LO7 C;  4JAW A;  4D0T A;  3N0K A;  4I4Y A;  2X2T A;  4I1B A;  5B2H A;  3PME A;  4I1E A;  2Q3N B;  1ISW A;  1TWM A;  5DVH A;  4LO1 A;  5FZU A;  2NVH A;  3OGF A;  4EFP A;  1ISY A;  5EG6 C;  2IWT B;  6I1B A;  1SR4 A;  1EPW A;  3BAQ A;  1L2H A;  1FN0 A;  3FUO A;  3HN1 A;  1F31 A;  3CQA A;  3POK A;  3A23 A;  3EF2 A;  2Y9F A;  3Q7W A;  1FV3 A;  3WO2 A;  4WBC A;  1Q1U A;  3BB2 A;  3CRG A;  4FGF A;  2FO1 A;  1JT7 A;  4Q91 A;  3FJ8 A;  3N7K A;  1BLA A;  4ZA3 B;  1JT4 A;  1HIB A;  4GP0 A;  3E8L C;  4Z8S B;  1AXM A;  3LLP A;  5F8S A;  1SZ6 B;  4LO3 A;  4LO1 C;  1JT5 A;  3UD7 A;  4R6U B;  2F8X C;  4G6J A;  4GOV A;  4ISR A;  3IM7 A;  5BOW A;  4J2S A;  2IHO A;  4MZG B;  2AQZ A;  1JT3 A;  3NBE A;  3F1R A;  1WD3 A;  3O4D A;  2I1B A;  3MAL A;  3RMX A;  3BRF A;  1DZD A;  4P0J A;  3NBN A;  2R9K B;  2RST A;  3AKF A;  1WBA A;  2M49 A;  3ZXD A;  2QN4 A;  1J0S A;  4L4I A;  3R4S A;  3PG0 A;  3BAH A;  4I2S A;  5DUY A;  1BFG A;  3FJD A;  1II4 A;  3K1X A;  2AXM A;  1FMZ A;  3JUT A;  3ILA A;  4I4S A;  4ZFW B;  5FNX A;  4A7Z A;  2K43 A;  1PWA A;  3F62 B;  2ET2 A;  4I4P A;  5DZU A;  5F90 A;  4A7K A;  1AVU A;  4XFS A;  3UJ0 A;  4LO3 C;  1XG6 A;  3O4O A;  3BAU A;  1EVT A;  1HWO B;  3H6R A;  2VXR A;  1G82 A;  3RSJ A;  1BFC A;  3H6S E;  5BXT A;  1HWN B;  4I37 A;  1YF8 B;  2XOA A;  2RQ9 A;  4EFQ A;  3CA0 A;  1RY7 A;  4AN6 A;  3VUO A;  1AVA C;  1DZC A;  4KEI A;  1DLL A;  4I4X A;  4J2K A;  3A22 A;  5EC5 A;  2KI4 A;  1T4Q A;  3O49 A;  4I3N A;  2LIE A;  1W3G A;  2HZ9 A;  4QAL A;  1MD6 A;  1BAS A;  2FGF A;  4P0L A;  1OQL B;  3CA5 A;  4AN7 B;  3O44 A;  2ZQN A;  4D0Z A;  1V6X A;  4QBV A;  1T9F A;  3CA3 A;  3C9Z A;  3VEQ A;  4OWJ A;  3BAG A;  4X37 A;  5D63 A;  4H9W A;  1VCL A;  4XFU A;  3AH4 A;  4OW4 A;  2D7R A;  3RTI B;  1DJS B;  2Y9W C;  3H6Q A;  5JMC A;  4TLP A;  2X2S A;  4F83 A;  1W3A A;  4I4Q A;  2HWA A;  3FJF A;  4A7Y A;  1GGP B;  1PUM B;  3AKI A;  3FJI A;  4P0K A;  3OJM A;  3PHZ A;  1V6V A;  4UY4 A;  3KMV A;  3OBT A;  2P23 A;  2D43 A;  4PC4 A;  2VU9 A;  1HCD A;  3AH1 A;  1G9A A;  3W9T A;  1S0C A;  4IZE A;  1EYL A;  3OJV A;  4QBC A;  4JQ0 A;  4QKS A;  2NTD A;  1JTC A;  2LIQ A;  1IOB A;  1RML A;  3UD9 A;  5F8Y A;  4QC4 A;  4I7I A;  3VT2 A;  3HSM A;  4OEF A;  1HCE A;  31BI A;  3FFZ A; 
#chains in the Genus database with same CATH homology
 1IIL A;  1TFM B;  2GO2 A;  2J3P A;  3CRI A;  3HAL A;  3V0A A;  3O4B A;  1P63 A;  2D20 A;  3BA5 A;  3I29 B;  5HPZ A;  41BI A;  3V0B A;  1EV2 A;  2MC2 A;  1FQ9 A;  5EHA A;  4END A;  1M16 A;  4Q9P A;  1BA7 A;  3ZXG A;  3NBD A;  2ERM A;  3BTA A;  1JY0 A;  2VLC A;  1CE7 B;  1E0O A;  3FJH A;  4I96 A;  5DSS B;  3Q7Y A;  4D8H A;  3NBC A;  4P6A A;  4HJJ A;  1YBI A;  3UD8 A;  2NM1 A;  3IM6 A;  1DQO A;  1Z2V A;  2NP0 A;  1ILR 1;  1FWU A;  4QD2 C;  2MLL B;  3P6I A;  1DFC A;  2NZ9 A;  3FUQ A;  4OEG A;  5GAQ A;  4G6M A;  2FDB M;  2Y9X E;  1V6W A;  3VT1 A;  3PUB A;  3AJ6 A;  4DCK C;  4XFT A;  3FJJ A;  1HWM B;  3I2X A;  2ZQO A;  1TOO A;  1AVX B;  1FWV A;  1FV2 A;  1I1B A;  4IQP A;  1HKN A;  3VSF A;  4JRA A;  1NUN A;  4GP3 A;  3HOM A;  1N4K A;  1RZO B;  2UUS A;  2VUA A;  4EFR A;  1BLD A;  1R8O A;  4J23 B;  2VXT I;  1S0G A;  1IRA X;  3UJ4 A;  2YUG A;  1ISX A;  1Q03 A;  3CA4 A;  8I1B A;  3CU1 B;  4II0 A;  4I6I A;  3UDA A;  5BXP A;  4ZGR B;  2D1Z A;  2Z49 A;  2NS2 A;  2DRY A;  1BAR A;  3A21 A;  1ITB A;  2BEA A;  4ZFU B;  1R8N A;  3HBW A;  1MC9 A;  4X39 A;  5FZZ A;  3FJE A;  5I1B A;  4ZBV B;  2Q9X A;  3CRH A;  4G9N A;  4OWK A;  1W3F A;  1M2T B;  1BFF A;  3O5W B;  3ZC9 A;  4OUJ A;  3OBR A;  1G9C A;  1IHK A;  4DEP A;  3I2A A;  3BAD A;  4LO2 C;  3VT0 A;  3N7M A;  4CJM A;  3FJ9 A;  4LO0 A;  3BX1 C;  4XKI A;  4YOL A;  4ZOT A;  2WBC A;  3P6J A;  4JKX B;  1PC8 B;  5BXS A;  4USP A;  4I4R A;  1Z4S A;  2DRZ A;  5E24 E;  3AZV A;  4MZH A;  3IM5 A;  1TP0 A;  2GZB A;  3BAV A;  4KEJ A;  1TWE A;  1IRP A;  3QYD A;  1D0H A;  1JLX A;  1RG8 A;  3R4U A;  21BI A;  1S0F A;  4KBB A;  4QKR A;  2MIB A;  1AFC A;  1AVW B;  1YYN A;  3ZC8 A;  1XZZ A;  2ZR1 B;  1XYF A;  4OWL A;  1WD4 A;  4I8M A;  4ZFY B;  2D24 A;  3BA4 A;  1G9B A;  4LO0 C;  2ESU A;  3FJK A;  2KKI A;  2KH2 A;  1ABR B;  1QXM A;  1BFB A;  1DIW A;  1QQK A;  5BQU A;  4I4O A;  1TTU A;  3QR5 A;  4I0Y A;  1K5U A;  1Z0H A;  2E4M A;  4EB2 B;  2K4A B;  1TIE A;  2DS0 A;  4ION A;  2Y9G A;  3AZW A;  4IZX A;  3FJC A;  4H75 A;  5F8W A;  1FMM S;  4JKQ A;  3S8K A;  3N7L A;  2D22 A;  1A8D A;  3WA1 A;  3AJ5 A;  3B9U A;  3H6R B;  1KNM A;  1IJT A;  3CA6 A;  3Q7X A;  2RG9 B;  3WO4 A;  2KI6 B;  1PUU B;  4L4H A;  4JP0 A;  1NZK A;  4ZKT B;  5BP5 A;  2D23 A;  3WO3 A;  3IAG C;  2P39 A;  4LO7 B;  3BRG C;  1QQL A;  5BXR A;  1ISV A;  5BQU C;  2AFG A;  4USO A;  3VSZ A;  3S8J A;  1SR4 C;  3P53 A;  3BRD A;  1DQG A;  3JRR A;  5FZY A;  2AAI B;  3TC2 A;  3WIN A;  1PZZ A;  2L5X A;  2WRY A;  3BAO A;  2DRE A;  1FGA A;  2E4M C;  3O4A A;  3FGM A;  3A07 A;  4IHZ A;  4G1R A;  1HWP B;  2VSE A;  4OEE A;  1DFQ A;  4EEE B;  3O4C A;  3T8S A;  1JLY A;  2HWM A;  1UPS A;  4IY8 A;  2F2F A;  4LO2 A;  9ILB A;  1YXW A;  5D61 A;  1XHB A;  4DEN A;  4J2Y A;  4J2X A;  3FJA A;  5FNW A;  2FFV A;  3MPP G;  2HW9 A;  4Q9G A;  1YTO A;  3OGG A;  3ZX7 A;  5BVP I;  3IIR A;  3CA1 A;  4HR6 C;  5BP5 C;  2NYY A;  5JLV A;  2BEB A;  4HA2 A;  4ISQ A;  3SNV A;  2KLL A;  2BFH A;  1S0L A;  2D7I A;  3AKH A;  3HMY A;  4KEK A;  2QYI B;  1S0E A;  1S0B A;  3D7W B;  3FJB A;  3WIN C;  3NJ5 A;  1K5V A;  1V6U A;  4QO3 A;  5D62 A;  4JPZ A;  4IYB A;  3AH2 A;  4GAF A;  4GOY A;  4MZF B;  5G00 A;  1S0D A;  2F2F C;  3WMU A;  4FVV A;  1I1E A;  1ISZ A;  4KC3 A;  4X38 A;  2K8R A;  3BA7 A;  3RMY A;  4QD2 B;  1Q04 A;  4I4U A;  3CAH A;  1AF9 A;  1WBC A;  4I4V A;  4Z9W B;  3WMV A;  4ZLB B;  3AKG A;  3V79 C;  2VSA A;  4G9M A;  4EKX B;  3RTJ B;  2FFU A;  7I1B A;  3V0A B;  1CVS A;  4IY9 A;  3N7J A;  4F34 A;  4GAI A;  1G9D A;  2Z48 A;  1IT0 A;  3V0B B;  4LO8 B;  3LTQ A;  1JQZ A;  4H04 A;  3VWC A;  4X3A A;  3O3Q A;  2D44 A;  1ONK B;  3OJ2 A;  4LO7 C;  4JAW A;  4D0T A;  3N0K A;  4I4Y A;  2X2T A;  4I1B A;  5B2H A;  3PME A;  4I1E A;  2Q3N B;  1ISW A;  1TWM A;  5DVH A;  4LO1 A;  5FZU A;  2NVH A;  3OGF A;  4EFP A;  1ISY A;  5EG6 C;  2IWT B;  6I1B A;  1SR4 A;  1EPW A;  3BAQ A;  1L2H A;  1FN0 A;  3FUO A;  3HN1 A;  1F31 A;  3CQA A;  3POK A;  3A23 A;  3EF2 A;  2Y9F A;  3Q7W A;  1FV3 A;  3WO2 A;  4WBC A;  1Q1U A;  3BB2 A;  3CRG A;  4FGF A;  2FO1 A;  1JT7 A;  4Q91 A;  3FJ8 A;  3N7K A;  1BLA A;  4ZA3 B;  1JT4 A;  1HIB A;  4GP0 A;  3E8L C;  4Z8S B;  1AXM A;  3LLP A;  5F8S A;  1SZ6 B;  4LO3 A;  4LO1 C;  1JT5 A;  3UD7 A;  4R6U B;  2F8X C;  4G6J A;  4GOV A;  4ISR A;  3IM7 A;  5BOW A;  4J2S A;  2IHO A;  4MZG B;  2AQZ A;  1JT3 A;  3NBE A;  3F1R A;  1WD3 A;  3O4D A;  2I1B A;  3MAL A;  3RMX A;  3BRF A;  1DZD A;  4P0J A;  3NBN A;  2R9K B;  2RST A;  3AKF A;  1WBA A;  2M49 A;  3ZXD A;  2QN4 A;  1J0S A;  4L4I A;  3R4S A;  3PG0 A;  3BAH A;  4I2S A;  5DUY A;  1BFG A;  3FJD A;  1II4 A;  3K1X A;  2AXM A;  1FMZ A;  3JUT A;  3ILA A;  4I4S A;  4ZFW B;  5FNX A;  4A7Z A;  2K43 A;  1PWA A;  3F62 B;  2ET2 A;  4I4P A;  5DZU A;  5F90 A;  4A7K A;  1AVU A;  4XFS A;  3UJ0 A;  4LO3 C;  1XG6 A;  3O4O A;  3BAU A;  1EVT A;  1HWO B;  3H6R A;  2VXR A;  1G82 A;  3RSJ A;  1BFC A;  3H6S E;  5BXT A;  1HWN B;  4I37 A;  1YF8 B;  2XOA A;  2RQ9 A;  4EFQ A;  3CA0 A;  1RY7 A;  4AN6 A;  3VUO A;  1AVA C;  1DZC A;  4KEI A;  1DLL A;  4I4X A;  4J2K A;  3A22 A;  5EC5 A;  2KI4 A;  1T4Q A;  3O49 A;  4I3N A;  2LIE A;  1W3G A;  2HZ9 A;  4QAL A;  1MD6 A;  1BAS A;  2FGF A;  4P0L A;  1OQL B;  3CA5 A;  4AN7 B;  3O44 A;  2ZQN A;  4D0Z A;  1V6X A;  4QBV A;  1T9F A;  3CA3 A;  3C9Z A;  3VEQ A;  4OWJ A;  3BAG A;  4X37 A;  5D63 A;  4H9W A;  1VCL A;  4XFU A;  3AH4 A;  4OW4 A;  2D7R A;  3RTI B;  1DJS B;  2Y9W C;  3H6Q A;  5JMC A;  4TLP A;  2X2S A;  4F83 A;  1W3A A;  4I4Q A;  2HWA A;  3FJF A;  4A7Y A;  1GGP B;  1PUM B;  3AKI A;  3FJI A;  4P0K A;  3OJM A;  3PHZ A;  1V6V A;  4UY4 A;  3KMV A;  3OBT A;  2P23 A;  2D43 A;  4PC4 A;  2VU9 A;  1HCD A;  3AH1 A;  1G9A A;  3W9T A;  1S0C A;  4IZE A;  1EYL A;  3OJV A;  4QBC A;  4JQ0 A;  4QKS A;  2NTD A;  1JTC A;  2LIQ A;  1IOB A;  1RML A;  3UD9 A;  5F8Y A;  4QC4 A;  4I7I A;  3VT2 A;  3HSM A;  4OEF A;  1HCE A;  31BI A;  3FFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...