5G04J

Structure of the human apc-cdc20-hsl1 complex
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
532
structure length
504
Chain Sequence
NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Molecular Mechanism of Apc/C Activation by Mitotic Phosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 180
structure length 504
sequence length 532
chains with identical sequence K
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
J PF13176 TPR_7 Tetratricopeptide repeat
J PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5g04J00
3KAEA 5EX0A 2L6JA 4CGVA 3MV2B 4GA1A 5LCWC 2KATA 4I9EA 2FBNA 1ZU2A 4GCOA 4N2SA 3MKRA 2PZIA 3UUXA 4WNFA 3GZ2A 3CKCA 5FZQA 3S7FA 3QKYA 3Q49B 3PDNA 4J8EA 5M72A 2YHCA 3Q15A 1WM5A 3QWPA 2HR2A 4UQZA 3ZPJA 1OUVA 4GA2A 3QOUA 4N3CA 3GW4A 2VGXB 4U0ZA 4AY6A 2FI7A 4HORA 4Y6WA 2FEZA 3AS5A 4I17A 1NA0A 3ZHEA 4Y6CA 3VTXA 4GYWA 5EKQD 1Y8MA 5G04J 3S7JA 5DBKA 1B89A 3RIBA 2E2EA 3OXGA 1HH8A 4WNDA 3ZHEB 4UI9C 5LCWJ 3KS2A 5KJKA 4KXKB 4UQYA 4WNEA 4BWRA 2GW1A 1TJCA 2Y4UA 4I1AA 5FT9A 4GZ6A 3SF4A 3Q47B 5G05C 3CK7A 4JA9A 3AS4A 5D0QD 1KLXA 2VSYA 2WPVA 4RG9A 3LKUA 4GZ5A 3GZ1A 3OXLA 3ASFA 3CEQA 1QZ2A 2MHKA 1YA0A 3MV3B 3Q4AB 4ME2A 3CVLA 3FWVA 1NZNA 2UY1A 3NF1A 3S7DA 1HZ4A 3ASDA 4IN3B 4UI9J 3PE4A 3TG5A 2KCKA 2IF4A 3OXFA 4A1SA 4BTBA 2VQ2A 2NC9A 4HOTA 4WNGA 3BEEA 5FZRA 3LYAA 3QWVA 3VTYA 1ELWA 1ZBPA 4HOQA 1PC2A 3HYMB 3O48A 5JJTA 3CK8A 5G05J 2XEVA 4G2VA 1W3BA 5AYWD 5HQ8A 3Q5MA 1NA3A 2HYZA 3IEGA 4J8FA 1A17A 4N39A 5FZSA 4XIFA 5FTPA 1WAO1 4N3AA 4XI0A 5ARGA 4GZ3A 3RO2A 4F3VA 2PQNA 3PE3A 4G24A 4BT8A 3ULQA 2LSUA 3GYZA 4KYOB 4GPKA 2KCLA 3LY8A 3WXXA 4G1TA 4I2WA 3EDTB 5JJ7A 3ASHA 3UPVA 3RKVA 3ZGQA 3CVPA 3ZN3A 1E96B 2ONDA 4I9CA 5BT1A 4CGWA 4I2ZA 2IFUA 1HXIA 2WQHA 4NRHB 4YNDA 4H7YA 4N3BA 3LY7A 4GYYA 4NQ0A 1FCHA 2VSNA 3S7BA 4GYOA 5HI7A 4N2QA 3RJVA 3U4TA 4JA7A 4G23A 5BW8C 3FP3A 4JL0A 1QQEA 3R9AB 2VYIA 3CVNA 2YQ8A 2I6HA 3MEKA 3RU0A 4RG6A 3CVQA 5A7DB 2XPIA 4KBQA 3U3WA 5G04C 4AM9A 2KC7A 5FJYA 4U04A 4EQFA 2UY1B 4CDRA 4G26A 4J8DA 5KJLA 2V5FA 4U0UA 5DIZA 2Y4TA 2KCVA 3CV0A 2QFCA 2LSVA 3QDNA 3MA5A 5EX3A 2AVPA 3CKBA 1P5QA 4O6FA 3JYSA 3ZFWA 1ELRA 2XGSA 4APOA 2VGXA 4B94A 2HO1A 5CCMA 1IYGA 3TG4A 3LPZA 3AS8A 4H7XA 4YVOA 2Q7FA 5CHEE 4BTAA 5KJNA 3RO3A 1XNFA 4XI9A 5C1DA 4AIFA 2FO7A 2PQRA 4UQXA 5BNWA 3N71A 4U0SA 4N5CA 2C2LA 2OOEA 2J9QA 4W9RA 4YVQC 5CCLA 2PL2A 3ASGA 3SZ7A 4J0UA 2JLBA 4AY5A 3UQ3A 3E4BA 2LNIA 2VGYA 3LY9A 2XCBA 1IHGA 2C0LA 2DBAA 3TGOA 2C0MA 4JHRA 4ABNA 5ARFA 3QWWA 2XCCA 4WUYA 4HOSA 3FFLA 4G25A 2BUGA 2R5SA 5A6CA 2P58C 3ESKA 3TAXA 2XGOA 4U07A 1KT1A 4BT9A 3LCAA 3URZA 4HOUA 3K9IA 2UWJG 2FF4A 5KJMA 4LEUA 4UI9K 5JJ6A 4GCNA 1KT0A 4GA0A 3CK9A 3KD7A 2XGMA 5D0OD
chains in the Genus database with same CATH superfamily
3SFYA 5EYLA 5EX0A 4CZ2D 3J5QB 3UT8A 4F53A 3QK0A 1ZU2A 3AG3E 4GCOA 5KBAA 3ULEG 2J07A 3ZVVA 2L0IA 4DI4A 2J49A 3FEXA 3ULYA 4E85A 2R2LA 5IY5E 4GPMA 3CKCA 4DX7D 3HG0D 3VLFA 2VTBB 3PDNA 3FH5A 1OCRE 2I2OA 2XZTG 4UQZA 2F0YA 3LS8A 1OUVA 4YDEA 3QOUA 4AY6A 3FEYA 3UM2A 1Z3XA 3C5RA 3AS5A 1NA0A 3ZHEA 4Y6CA 3U9WA 3QC1A 3SFXA 2X3MA 4GYWA 4I1OB 3CHSA 2OCCE 4L7TA 5DBKA 1QNFA 3OXGA 1HH8A 4WNDA 2WXPA 3SBTB 4UI9C 3X2QE 5KJKA 3G2TA 1O1SA 3DPYA 1TR4A 3PUJA 5E75A 5EIBE 4PS7A 3FTWA 5EN5D 3DSTA 4B89A 2RD0A 3B7RL 1MZCA 2P2CP 2Y69E 1DC2A 3JUIA 4GMRA 3Q47B 4QQIA 1KLXA 3UT4A 2ETBA 4GZ5A 3ZNGA 2J4DA 4BSZB 3JCKC 1Y6IA 4TXPA 2R05A 2GRMA 3C3RA 4A3TA 3C3OA 4TUUA 4QFVA 3PEUB 4HI8A 4DX2A 4DLQA 2A4ZA 2MHKA 4JPSA 3DPDA 4ME2A 1KZOA 2X6IA 3ZUVB 2J08A 3FU6A 1NL4A 3LVQE 4HNAD 1HX8A 3SD5A 1G3NB 2AW6A 4ANUA 3TG5A 2KCKA 1H2TC 4U8YD 2WQ7A 5T3RA 4U63A 4BTBA 3I5PA 1OWNA 5JHAA 3DEPA 5FZRA 1N11A 3JXJA 1BI7B 3JQ1A 4HOQA 5AQ9A 3CVVA 1JWFA 5EILA 1N4SA 2WM9A 1VDYA 4HI9A 5CMWA 3CK8A 3SGHA 2XEVA 2HYZA 3IEGA 1HF8A 1TNZA 1JCRA 1KPSB 4BY6A 3CHPA 4U8HA 4N3AA 2PM7A 5ARGA 3RO2A 1D8DA 3ABME 4R7LA 2CHXA 2QYJA 1MX2A 4CT0A 3UM1A 1L5JA 2EINE 3NOGD 2A5UA 3OAWA 4DI3A 5BT1A 4CGWA 3Q73A 1O1TA 1HXIA 1UJKA 2EIJE 4NRHB 1HG2A 4L1BA 1SZ9A 4N3BA 3LY7A 1FCHA 1IXVA 3CHRA 4EBAA 3I4GA 2RFAA 1E8ZA 3PUKA 3Q78A 5BW8C 3FHEA 4DX1A 1K1AA 3IXEA 3R9AB 1AP7A 1QBQA 3MEKA 3ZYKA 2H6HA 3RRUA 3V2OA 5B3SE 3UM0A 4DRXE 3UI2A 5ITZF 3QJZA 1X81A 3HHMA 3HRAA 4KT6B 2AXZA 2VJ8A 5BPPA 1INZA 3T9KA 4A3VA 1U3DA 4GTSA 4DX5D 2JABA 2ZIRA 2V4LA 2QFCA 3EHMA 2J09A 3B7TA 1P5QA 1DVPA 3ZFWA 3AU5A 4IYPA 2XGSA 1HFAA 3PREA 3FUKA 1FT2A 4A55A 2V5QC 3QB2A 4MLPA 1EPUA 3L9TA 3PH0C 4OVUA 2DCPA 5KJNA 3NBNB 3ZYQA 3E37A 3UIOC 2KZTB 4URKA 3FU3A 3PZ1A 3D9IA 1IHBA 2FO7A 2V0PA 3ZIMA 5BNWA 3FUHA 1X5BA 3IV0A 2C2LA 4UWLA 2OOEA 1TNUA 2L9BA 2H6IA 2OEWA 3MZLB 4F1SA 3KSLA 5D2MC 2OEVA 4HRNA 3CIAA 4J0UA 3KEAA 4AY5A 1WG0A 2LNIA 4GZDA 3IBEA 1N4QA 2VGYA 2ZU6B 2JEKA 2CG3A 3TGOA 2C0MA 2NSZA 4JHRA 3L08A 4ABNA 3EHRA 1TN6A 3LXUX 4EECA 1Z5SC 3QWWA 2WXMA 3FUNA 2E0IA 2XS1A 1DCQA 1MX6A 4G25A 3DRAA 4EZLA 3ESKA 3E33A 2XGOA 1KT1A 4XZ4A 2WXIA 3URZA 2UWJG 4YDOA 2QC9A 5CMYA 5JA4D 4I1MA 5JJ6A 4HRMB 1TN7A 3B7BA 3PEVB 4Q96A 2NXPA 4JD2G 2L6JA 3P2BA 2J8SD 4I9EA 2FBNA 3NOCD 3FULA 4MBGA 3CVXA 3QARA 4JEUA 1H2VC 3DSXA 5BV1A 5E76A 4X8QA 2LXMA 2XRYA 3G2UA 3Q49B 4K5CA 4PH4B 1WM5A 1MJ0A 4M7CA 2BEDA 5FQ4A 2I9CA 2FI7A 3CR3A 1OY3D 1S63A 4J7WA 4KVMA 4APFA 3IKOB 4HORA 4Y6WA 3TWRA 4FA6A 5EDSA 3FH8A 3DSWA 3VTXA 2RG8A 3S7JA 1Y8MA 3L16A 3TXMA 2XPYA 4GMLA 1TNYA 4BFRA 2Y1LE 1H6PA 4JXTA 3ZHEB 5LCWJ 2P9IG 3MX3A 1UJJA 5CEAA 5AQBA 4UQYA 2I1KA 4Q94A 4WNEA 3DSUA 2F8YA 1LF8A 2BTDA 4J6IA 5FT9A 3LVRE 4GZ6A 3GZSA 3PZDA 1HS6A 3SF4A 1BI8B 4JA9A 2MRIA 3TWUA 4DPRA 4RG9A 3ZYMA 2H6GA 2DWZA 1JCSA 2X6KA 3HVEA 1UW4B 1LD8A 2RKKA 2PNNA 2IOLA 2F37A 4ZFHA 1HU3A 3D9HA 4BSXA 2IO2C 4RSYA 3NAWA 5ENRD 3Q4AB 4WWPA 3U66A 3RRNB 3NF1A 2X6JA 3S7DA 3ASDA 4IN3B 2CHZA 5FQ8A 2MYOA 2V4HC 3TXNA 4ILGA 4ZHBA 3L13A 4GTQA 4U96D 2VQ2A 1O5MA 1N52A 4PS3A 1OWMA 3LYAA 4FC8A 4TV3A 4O1PA 2QZAA 4J8SA 4UWHA 5G05J 2IEJA 3W9FA 3G2WA 4F7AA 2M63A 1W3BA 3NB2A 5T8IA 3Q5MA 4GTMA 4J8FA 4UWGA 4AVXA 1A17A 3FUMA 4N39A 4XIFA 5FZSA 4BESA 5CEDB 2XHEA 3EU5A 3PE3A 4BT8A 3UTMA 3GYZA 1UN9A 4UUCA 1K8KG 4KYOB 2IJGX 3EDTB 3LJ3A 2XRZA 5KCMA 3IHVA 3APFA 1OXJA 3ZGQA 3CVPA 3Q9NC 4TRQA 3FDHA 2X6FA 2YHEA 3B95A 3PS6A 4H7YA 3TWVA 2QY7A 4U8VD 2VSNA 3S7BA 4G8LA 3G2SA 3U4TA 5ENQD 4JA7A 4G23A 3MKQA 3PZ2A 5D66A 3FP3A 5A23A 1QQEA 5C2YA 1OWPA 2XENA 2ZXWE 4MS6A 4BX9A 2I6HA 5ENTD 4LNBA 4GTRA 3CVQA 3KSQA 4UWKA 1EYHA 2XPIA 4AOFA 1K1BA 4KBQA 3C98A 2WXJA 3VLDA 3SNXA 2AXVA 4GU5A 2UY1B 4G26A 3ML9A 5KJLA 1OCOE 2A5EA 2KCVA 3UMVA 2XEHA 2XPZA 5AQAA 4I6GA 3MA5A 5EX3A 3JYSA 3FUFA 2VGEA 4MKTA 2HO1A 1E8WA 1MQSA 5CCMA 2XZDG 3LPZA 3ABKE 3PVLA 2Q7FA 5JMND 4BTAA 3JQ0A 3RO3A 3PNLB 2GRNB 5AIJA 5C1DA 1SW6A 1XGWA 3T5XA 1SZAA 3D3MA 4HFGA 4UQXA 3N71A 4N5CA 4GZCA 4DK5A 4HQDA 4HLEA 3ASOE 2WXLA 2R02A 4W9RA 4NACA 4YVQC 5CCLA 1TYQG 1A5EA 1BLXB 1PY1A 4KVOA 5AN8A 3D9LA 3Q9UC 3E4BA 4BEPA 4B0ZA 5CERB 3DBSA 2XCBA 3FTYA 2XEEA 4FU3A 2C0LA 4GTOA 2DBAA 3FTXA 3BG0B 4FJZA 3FTSA 3FFLA 2OVFA 4E6HA 5KWDA 2BUGA 4AV7A 2P58C 5G2NA 2WXNA 4HRLA 3DWLG 3S2AA 4U07A 4FLHA 2HM8A 5JHBA 4HOUA 1SA4A 3K9IA 2WXHA 2EIKE 5BV0A 4UI9K 1TNBA 2FULA 3KD7A 5B1BE 3DXMG 5LP0A 5D0OD 5H7PA 3KAEA 4CGVA 5LCWC 3BU8A 2CG2A 4J8YA 3O4ZA 3UUXA 5CRVA 3MGBA 2B0OE 1JCQA 1PAQA 4FP7A 3MCXA 3Q79A 2OVBA 1HE8A 4FULA 4J8EA 4GMJA 2YHCA 3Q15A 3QWPA 1LTXA 2GRPB 4WAFA 4GA2A 1IQRA 4FADA 4N3CA 3BG1B 3PRZA 3GW4A 1ELKA 2VGXB 4U0ZA 3IHYA 2PM6A 1YMPA 4FHKA 4YDYA 2AJAA 1KZPA 5T4YA 3R7RA 2LO6A 4XX5A 5AENA 5EKQD 4L9PA 3D9NA 2QYUA 3DSSA 1B89A 3RIBA 4Z68A 5CRUA 3TWXA 4GAAA 3TWTA 4B8CB 2CFZA 3ZKJA 3SBSA 2DVWA 5EIDA 3CSFA 2GROB 2WVIA 3C3QA 1BU9A 4HBDA 2LXLA 4ILIA 5AARA 5BUZA 1E8XA 1ZB1A 2BKGA 5FWQA 3SI5A 4C9BB 5B1AE 4JW1A 4FHJA 3SQVA 4DUIA 3CHQA 1UOHA 1TJCA 3NQPA 3D9KA 2Y4UA 2FO1E 5G05C 3CK7A 5D0QD 4G8KA 4I6EA 3LKUA 3L17A 3GZ1A 1N0RA 2ETAA 5FQ7A 4N5QA 3OXLA 4K0RA 3ASFA 2ZGDA 4TUMA 5AJDA 3FUIA 3CVUA 4JHKA 3TWQA 1YA0A 3ZEFA 3HVEB 3CVLA 3FWVA 1NZNA 1AWCB 1OWLA 3UXGA 4U95D 3PE4A 2ILRA 3OXFA 4A1SA 4NIKA 4BX8A 2GRLA 3D9JA 2NC9A 2WQ6A 3FUJA 4WNGA 4PUCA 3RAUA 3VTYA 2MOWA 4JVSA 4V3IA 4CYMD 3HXFA 3FTUA 3FUEA 4WWOA 1NI1A 3JUEA 1D8EA 3O48A 5JJTA 4HVBA 4ANXA 3SO8A 3TWSA 5AYWD 3FY4A 1NA3A 1OWOA 4ILHB 4FLBA 4L2YA 3D9PA 4HXIA 3UKRG 2IQCA 3EJNA 5FTPA 5J08A 4XI0A 1IKND 4AEZC 1TJFA 4LNGA 1O1RA 3B13A 2P9SG 1Q2ZA 5FQ6A 1N95A 4RQIA 3RSEG 4GPKA 3LY8A 3WXXA 4G1TA 2J4BA 3LJNA 5LFAA 3L6AA 5JJ7A 4LSZE 3SFZA 3UPVA 3APCA 3ZN3A 1E96B 2ONDA 2DZNA 5HRYA 2CFUA 4CRWA 4I2ZA 1MHQA 4LUNU 2WQHA 4PS8A 4NURA 3L54A 4GYYA 4C0MA 3HXBA 4GYOA 5BXUA 4RVBA 3ESLA 5ENPD 3RJVA 4OVVA 1MX4A 4JL0A 4OAVB 3UT7A 2AXUA 4FJYA 4JB8P 2VYIA 2IONA 1FVHA 3CVNA 2YQ8A 3RU0A 3LEWA 3KEZA 4K5BA 2EQXA 1FPPA 5LOZA 5A7DB 3AJIA 2P9NG 3W9GA 3LDZA 4KZCA 3MYVA 3U3WA 5G04C 1BPOA 3HIZA 2WMNA 1E7VA 3TJPA 1OCCE 4EQFA 4IRUA 2V5FA 1TN8A 1QYMA 2Y4TA 3CV0A 2LSVA 3QDNA 2KXPC 1EF1C 1NP7A 3CKBA 1RW2A 4O6FA 3Q75A 1ELRA 3I3NA 2WXOA 4APOA 2WXRA 4B94A 5J90A 4EZKA 2WXQA 4DX6D 3TG4A 3AS8A 4H7XA 4I43A 5CHEE 3ISMC 4LRZA 3PNTB 3R9MA 3CHMA 4XI9A 3DEOA 2PQRA 3BQOA 2EILE 2ZGGA 1IQUA 4JHJA 4LERA 3SHFA 3ZU7B 4B93B 4B8AA 2R17C 3FUDA 3DXKG 1N4PA 3ASGA 2XQ0A 3SZ7A 3CQCB 3ZXSA 4CEMA 2WXGA 4LG6A 4CCAA 3UQ3A 3CVWA 4LNUD 4PDXA 3Q7AA 1JUQA 2WXFA 3LY9A 1HG5A 1IHGA 1E90A 5ARFA 3C72A 2XCCA 4HOSA 2WMOA 4GTTA 2R5SA 3EU9A 3TAXA 4ATGA 3UINC 2WB2A 4BT9A 3UIPC 2FF4A 5KJMA 3VLEA 4GCNA 2P9PG 2EIME 1S0PA 4GA0A 5LX8A 3CK9A 4AJWA 3TWWA 4L23A 4HLLA 3MV2B 2F8XK 4GA1A 4YDWA 2KATA 2VTBA 4TXRA 4OAUC 1BD8A 4N2SA 3MKRA 1EDUA 2PZIA 4LCTA 4WNFA 1H19A 5ANLA 3GZ2A 4HS2A 3PZ4A 4U7EB 5FZQA 3FU0A 1SQMA 3S7FA 3QKYA 3ASNE 2IO3C 5M72A 2XS8A 3G2VA 3TL5A 3QAQA 2HR2A 1RZ4A 2LUHA 4RLYA 3ZPJA 4ANVA 5ENOD 4GTPA 4MRUA 3EHNA 1D9SA 1JPLA 4XEIG 2DYSE 3BUAA 2KBXA 2FEZA 4I17A 4DJAA 4KZ0A 1Z3YA 3T8KA 4AP2A 2ZISA 5G04J 2GRQB 4BERA 5CBOA 2E2EA 4JEHA 2HE0A 2GRRB 2AWIA 3UM3A 3D9OA 3UKUG 1OCZE 3KS2A 4KXKB 3HXEA 4BWRA 1OT8A 3CHOA 5HS0A 5FINA 1DNPA 4A1GA 2B6CA 2GW1A 2YNQA 3ML8A 4GTVA 1N9AA 4JC8A 4I1AA 1N54A 3JXIA 3CLJA 3AS4A 4F6RD 2VSYA 2WPVA 3DSVA 1TEZA 1U3CA 4O1OA 3B7SA 5CBNA 2X6HA 3ZYLA 3ONKA 4IULA 5HKPA 3CEQA 1QZ2A 1LD7A 3ONLA 4Q69A 3MV3B 2BKKB 4TXQA 2UY1A 1HZ4A 3T5VA 3V30A 3MJWA 4UI9J 3Q7FA 1FVFA 4CDMA 1H2UA 3P1UA 2IF4A 3EHQA 3EIJA 2R03A 2I1JA 4HOTA 3NZUA 3BEEA 4D10C 3QWVA 1ELWA 1ZBPA 1Z6TA 1PC2A 3CGHA 3HYMB 4CT4A 3APDA 3HDXA 3NZSA 5AQ7A 1SA5A 3F6QA 4ATZD 4G2VA 4EBAG 1E8YA 5HQ8A 1K3ZD 1H6KA 2YINA 4L2LA 3QNKA 1UN8A 2WXKA 1WAO1 4HB5A 4GZ3A 4F3VA 2PQNA 2P9UG 4G24A 3RK6A 2Y0BG 3ULQA 2LSUA 2VSOE 2OV8A 2IOSA 3R7QA 1JWGA 2KCLA 4I2WA 4P29A 1U2VG 4KMOA 3ASHA 3RKVA 3B7UX 1H6OA 4I9CA 2IFUA 3FTVA 1S64A 4ACKA 3AU4A 4YNDA 3PZ3A 5EYPF 2DYRE 3ZW3A 3HXDA 4XKCA 2VSXE 3ABLE 4NQ0A 2V8SE 5HI7A 4N2QA 3I4RB 5KNHD 1FT1A 3L22A 1SVXA 3ZRHA 5ENNA 5KNGA 3EIQC 4C0EA 4ACLA 3V79K 4BETA 4O60A 4RG6A 4CDNA 3U64A 1N94A 1E7UA 1V54E 3HXCA 4K5AB 4AM9A 4ANWA 2KC7A 3AG4E 5FJYA 1S70B 4U04A 2IU1A 3CSTA 4UWFA 2RFMA 4CDRA 2NYJA 2P9KG 4J8DA 5DIZA 2R59A 4U0UA 2ETCA 2P9LG 3E34A 4C48B 4DLOA 1GW6A 2AVPA 4WWNA 3EUVA 3J5PA 5ANRA 2H6FA 1N0QA 2VGXA 4K03A 4OYSA 2KZTA 4JZYA 1IYGA 4YVOA 2DIWA 1YYHA 3AG2E 3ENEA 4A63B 1XNFA 5G55A 5AAOA 3FTZA 3FH7A 5AJLA 4AIFA 1UG3A 4G11A 4EZJA 4XE0A 1WY6A 4U0SA 3V2XA 1N4RA 2Y3AA 3FU5A 4GB9A 2J9QA 3V31A 1TNOA 3UX4A 1NFIE 2LAIA 3AAAC 2DZOA 1DCEA 2PL2A 2KM4A 2GGFA 2CHWA 1HO8A 2JLBA 2L0TB 4F1PA 4I6JA 3ZXPA 4EPZA 5BXOA 3WG7E 3RRMB 3E32A 5ENSD 3CVYA 4XKBA 2L6BA 4WUYA 3L82A 5FIOA 5A6CA 2LAHA 1V55E 3D9MA 2IY0C 5CECB 2X38A 3LCAA 3MKQB 1WDYA 3AG1E 3T8MA 4M3OA 3E30A 3CQGB 3SY2A 4LEUA 1YCSB 1KT0A 1H0AA 3OTNA 4EHMA 4AXHA 2BF0X 2XGMA 1MYOA
chains in the Genus database with same CATH topology
3KAEA 4L23A 5EX0A 2L6JA 4CGVA 3P2BA 3MV2B 4GA1A 5LCWC 2KATA 3UT8A 4F53A 2VTBA 4I9EA 3QK0A 2FBNA 1ZU2A 3FULA 2CG2A 4GCOA 2J07A 3ZVVA 2L0IA 3CVXA 4DI4A 4N2SA 2J49A 3MKRA 3FEXA 3O4ZA 4E85A 3QARA 1EDUA 2PZIA 1H2VC 4JEUA 4LCTA 4WNFA 3UUXA 5BV1A 3MGBA 5E76A 1H19A 5ANLA 3GZ2A 4HS2A 1PAQA 3CKCA 4FP7A 5FZQA 3FU0A 3MCXA 1SQMA 2OVBA 2XRYA 3G2UA 3S7FA 3VLFA 2VTBB 1HE8A 3QKYA 3Q49B 3PDNA 4FULA 4PH4B 4J8EA 3FH5A 4GMJA 5M72A 2I2OA 2YHCA 1WM5A 3G2VA 3Q15A 3QWPA 3TL5A 3QAQA 2HR2A 4WAFA 4UQZA 3LS8A 3ZPJA 4ANVA 1OUVA 4GA2A 1IQRA 4MRUA 4FADA 3QOUA 5FQ4A 4N3CA 3BG1B 3EHNA 3PRZA 3GW4A 1ELKA 2VGXB 4U0ZA 2I9CA 4AY6A 2FI7A 3IHYA 3CR3A 2PM6A 3FEYA 4KVMA 4FHKA 1JPLA 4APFA 1Z3XA 3IKOB 4HORA 4Y6WA 2FEZA 3AS5A 4I17A 4DJAA 5T4YA 4KZ0A 3R7RA 1Z3YA 1NA0A 2LO6A 4FA6A 3FH8A 5EDSA 3ZHEA 4Y6CA 3U9WA 4XX5A 3QC1A 4AP2A 2X3MA 3VTXA 2RG8A 5AENA 4GYWA 5EKQD 1Y8MA 4I1OB 3L16A 5G04J 3CHSA 3S7JA 3TXMA 3D9NA 2XPYA 4L7TA 5DBKA 1QNFA 4GMLA 4BFRA 1B89A 3RIBA 2E2EA 4JEHA 3OXGA 1HH8A 4WNDA 4JXTA 2WXPA 2AWIA 3D9OA 4GAAA 3SBTB 4UI9C 3ZHEB 4B8CB 2CFZA 5LCWJ 3MX3A 3KS2A 3SBSA 5KJKA 3G2TA 1UJJA 4KXKB 4UQYA 2I1KA 3CSFA 4Q94A 2WVIA 4WNEA 4ILIA 3PUJA 5BUZA 1E8XA 5E75A 5FWQA 4BWRA 3SI5A 3CHOA 4C9BB 4JW1A 4PS7A 4FHJA 3FTWA 3CHQA 1LF8A 1DNPA 4B89A 4A1GA 2RD0A 2GW1A 1TJCA 2YNQA 3B7RL 3ML8A 2BTDA 3NQPA 3D9KA 2Y4UA 4J6IA 4JC8A 4I1AA 5FT9A 3LVRE 4GZ6A 3GZSA 1N54A 3PZDA 1HS6A 3SF4A 3JUIA 3Q47B 5G05C 3CLJA 3CK7A 4JA9A 3AS4A 2MRIA 5D0QD 4DPRA 1KLXA 2VSYA 2WPVA 4RG9A 3UT4A 3ZYMA 1TEZA 4I6EA 3LKUA 4GZ5A 3L17A 1U3CA 2J4DA 3GZ1A 5FQ7A 3OXLA 2X6KA 3B7SA 3HVEA 4K0RA 3ASFA 3JCKC 1Y6IA 1UW4B 2X6HA 3ZYLA 3ONKA 5AJDA 3FUIA 3CVUA 2IOLA 4IULA 2GRMA 3CEQA 1HU3A 4BSXA 1QZ2A 4A3TA 4JHKA 4TUUA 4QFVA 4RSYA 3PEUB 4DLQA 2A4ZA 2MHKA 3ONLA 1YA0A 3DPDA 3MV3B 4JPSA 3Q4AB 3ZEFA 4Q69A 4WWPA 3HVEB 4ME2A 3CVLA 3FWVA 1NZNA 2UY1A 3U66A 2X6IA 3NF1A 2J08A 3RRNB 2X6JA 3S7DA 3FU6A 1HZ4A 3ASDA 4IN3B 3T5VA 3LVQE 1OWLA 3MJWA 2CHZA 1HX8A 4UI9J 3SD5A 5FQ8A 1FVFA 4CDMA 3TXNA 2AW6A 3PE4A 4ANUA 3TG5A 2KCKA 1H2TC 4ILGA 1H2UA 3P1UA 2WQ7A 2ILRA 5T3RA 2IF4A 3OXFA 4A1SA 3L13A 3EIJA 4BX8A 4U63A 2GRLA 4BTBA 3D9JA 3I5PA 2VQ2A 2I1JA 2NC9A 1OWNA 1N52A 3FUJA 4PS3A 4WNGA 3NZUA 1OWMA 5JHAA 2WQ6A 4HOTA 3BEEA 4PUCA 4D10C 5FZRA 3LYAA 3QWVA 3VTYA 4FC8A 1ELWA 1ZBPA 2MOWA 3JQ1A 4HOQA 4TV3A 1Z6TA 1PC2A 4JVSA 4V3IA 3CGHA 3HYMB 1JWFA 3APDA 4CT4A 3CVVA 3FTUA 3HDXA 3FUEA 4WWOA 2WM9A 1VDYA 3NZSA 4J8SA 4UWHA 3O48A 5CMWA 5JJTA 3CK8A 5G05J 3SGHA 2XEVA 4HVBA 4ANXA 3G2WA 4F7AA 4G2VA 2M63A 1W3BA 5AYWD 4EBAG 3FY4A 1E8YA 5T8IA 5HQ8A 3Q5MA 1NA3A 1H6KA 2YINA 1OWOA 2HYZA 4ILHB 3IEGA 1HF8A 4FLBA 4J8FA 4UWGA 4AVXA 4L2LA 4L2YA 3QNKA 1A17A 3D9PA 3FUMA 4HXIA 4N39A 4XIFA 5FZSA 4BY6A 1UN8A 2WXKA 3CHPA 2IQCA 3EJNA 4U8HA 5FTPA 1WAO1 4N3AA 4XI0A 5J08A 2PM7A 5ARGA 4AEZC 1TJFA 2XHEA 4GZ3A 3RO2A 4F3VA 2PQNA 3PE3A 4G24A 3RK6A 4R7LA 4BT8A 3B13A 3ULQA 2LSUA 3GYZA 2VSOE 2OV8A 2IOSA 3R7QA 1UN9A 5FQ6A 2CHXA 4KYOB 1JWGA 4GPKA 2KCLA 2IJGX 3LY8A 3WXXA 4G1TA 4I2WA 2J4BA 3EDTB 5LFAA 3L6AA 3LJ3A 4P29A 2XRZA 5JJ7A 4CT0A 4KMOA 5KCMA 3ASHA 3IHVA 3APFA 1L5JA 3SFZA 3UPVA 3RKVA 3APCA 3ZGQA 3CVPA 2A5UA 3B7UX 3OAWA 3ZN3A 1E96B 2ONDA 4I9CA 4TRQA 4DI3A 5BT1A 4CGWA 3FDHA 2CFUA 4CRWA 4I2ZA 1MHQA 2X6FA 2IFUA 3FTVA 4LUNU 1HXIA 2YHEA 4ACKA 2WQHA 1UJKA 3AU4A 4NRHB 4YNDA 4PS8A 4NURA 3ZW3A 1HG2A 3PS6A 4H7YA 4XKCA 3L54A 2VSXE 1SZ9A 4L1BA 4GYYA 2QY7A 3LY7A 4NQ0A 1FCHA 2VSNA 4N3BA 2V8SE 4GYOA 5HI7A 3S7BA 4C0MA 4N2QA 3G2SA 4RVBA 3CHRA 3ESLA 3RJVA 4EBAA 3I4GA 3U4TA 4JA7A 4G23A 3I4RB 1E8ZA 4OVVA 3MKQA 3PUKA 3L22A 5BW8C 3FHEA 3FP3A 5A23A 4JL0A 3ZRHA 3UT7A 1QQEA 2AXUA 4FJYA 5ENNA 5C2YA 3R9AB 1OWPA 2VYIA 3EIQC 2IONA 4MS6A 4C0EA 1FVHA 3CVNA 4BX9A 2YQ8A 2I6HA 3MEKA 3RU0A 4ACLA 3LEWA 3KEZA 3ZYKA 3RRUA 4RG6A 2EQXA 4CDNA 3CVQA 3U64A 5LOZA 4UWKA 1EYHA 2XPIA 5A7DB 4AOFA 1E7UA 3LDZA 4KZCA 3MYVA 4KBQA 3QJZA 3C98A 5G04C 1BPOA 3HIZA 3U3WA 4AM9A 4ANWA 2WMNA 2KC7A 3HHMA 4KT6B 1E7VA 5FJYA 3TJPA 2AXZA 2WXJA 4U04A 2VJ8A 3VLDA 2IU1A 4EQFA 4IRUA 5BPPA 3CSTA 1INZA 3SNXA 2AXVA 4GU5A 4UWFA 2UY1B 4CDRA 4A3VA 1U3DA 4G26A 3ML9A 4J8DA 5KJLA 2V5FA 2V4LA 2R59A 4U0UA 2Y4TA 5DIZA 2KCVA 3CV0A 3UMVA 2XPZA 2QFCA 2LSVA 3EHMA 3QDNA 1EF1C 2J09A 4DLOA 4I6GA 3MA5A 3B7TA 1GW6A 2AVPA 1NP7A 3CKBA 4WWNA 1P5QA 5EX3A 1DVPA 4O6FA 3JYSA 3ZFWA 3AU5A 1ELRA 4IYPA 2XGSA 5ANRA 3I3NA 1HFAA 2WXOA 3FUFA 3PREA 4APOA 2VGXA 3FUKA 4K03A 2WXRA 4MKTA 4OYSA 4B94A 2HO1A 2KZTA 4JZYA 1E8WA 1MQSA 4A55A 4EZKA 2WXQA 5J90A 5CCMA 1IYGA 3QB2A 3LPZA 3AS8A 4H7XA 4MLPA 4I43A 3TG4A 1EPUA 3PVLA 2DIWA 4YVOA 2Q7FA 5CHEE 4BTAA 3PH0C 4LRZA 4OVUA 3ENEA 2DCPA 5KJNA 3JQ0A 3PNTB 3ZYQA 3RO3A 3CHMA 1XNFA 3PNLB 4XI9A 5AIJA 2KZTB 5G55A 4URKA 3FU3A 3FTZA 5C1DA 3FH7A 5AJLA 1XGWA 3D9IA 4AIFA 3T5XA 1SZAA 1UG3A 2FO7A 2V0PA 3D3MA 4G11A 2PQRA 4HFGA 3ZIMA 4EZJA 4UQXA 4XE0A 1WY6A 5BNWA 3FUHA 1X5BA 3N71A 3IV0A 4U0SA 4N5CA 2C2LA 4GZCA 2Y3AA 4DK5A 1IQUA 4UWLA 2OOEA 4JHJA 3FU5A 4HLEA 4GB9A 2J9QA 2WXLA 4LERA 3SHFA 2L9BA 2R17C 3UX4A 4W9RA 3MZLB 3FUDA 4B8AA 2LAIA 4F1SA 4NACA 4YVQC 5CCLA 2PL2A 3ASGA 2XQ0A 1PY1A 2KM4A 3SZ7A 3CIAA 4J0UA 4KVOA 2GGFA 2CHWA 3CQCB 3ZXSA 3D9LA 1HO8A 4CEMA 2WXGA 2JLBA 2L0TB 4AY5A 4CCAA 4I6JA 3UQ3A 3CVWA 3E4BA 2LNIA 4B0ZA 4EPZA 4PDXA 1JUQA 4GZDA 3IBEA 2WXFA 3DBSA 2VGYA 2ZU6B 3RRMB 3LY9A 1HG5A 2XCBA 3FTYA 1IHGA 4FU3A 2C0LA 2JEKA 2DBAA 2CG3A 3TGOA 2C0MA 1E90A 2NSZA 3FTXA 3L08A 4JHRA 5ARFA 3BG0B 4ABNA 3CVYA 4FJZA 3LXUX 4EECA 3FTSA 3QWWA 2XCCA 4XKBA 2WXMA 4WUYA 4HOSA 3FUNA 2E0IA 3FFLA 2OVFA 4E6HA 2WMOA 4G25A 2BUGA 2R5SA 4EZLA 5A6CA 4AV7A 2P58C 3ESKA 2WXNA 5G2NA 3TAXA 4ATGA 2LAHA 2XGOA 3S2AA 2WB2A 4U07A 1KT1A 3D9MA 4FLHA 4XZ4A 4BT9A 2WXIA 2X38A 2HM8A 3LCAA 3MKQB 3URZA 5JHBA 4HOUA 3T8MA 4M3OA 3K9IA 2UWJG 2FF4A 5KJMA 2WXHA 3CQGB 5CMYA 5BV0A 4LEUA 4UI9K 4I1MA 3VLEA 5JJ6A 4GCNA 1H0AA 1KT0A 3OTNA 2FULA 1S0PA 4GA0A 5LX8A 3PEVB 3CK9A 4AXHA 4Q96A 3KD7A 2NXPA 2BF0X 4AJWA 2XGMA 5LP0A 5D0OD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAE A;  5EX0 A;  2L6J A;  4CGV A;  3MV2 B;  4GA1 A;  5LCW C;  2KAT A;  4I9E A;  2FBN A;  1ZU2 A;  4GCO A;  4N2S A;  3MKR A;  2PZI A;  3UUX A;  4WNF A;  3GZ2 A;  3CKC A;  5FZQ A;  3S7F A;  3QKY A;  3Q49 B;  3PDN A;  4J8E A;  5M72 A;  2YHC A;  3Q15 A;  1WM5 A;  3QWP A;  2HR2 A;  4UQZ A;  3ZPJ A;  1OUV A;  4GA2 A;  3QOU A;  4N3C A;  3GW4 A;  2VGX B;  4U0Z A;  4AY6 A;  2FI7 A;  4HOR A;  4Y6W A;  2FEZ A;  3AS5 A;  4I17 A;  1NA0 A;  3ZHE A;  4Y6C A;  3VTX A;  4GYW A;  5EKQ D;  1Y8M A;  5G04 J;  3S7J A;  5DBK A;  1B89 A;  3RIB A;  2E2E A;  3OXG A;  1HH8 A;  4WND A;  3ZHE B;  4UI9 C;  5LCW J;  3KS2 A;  5KJK A;  4KXK B;  4UQY A;  4WNE A;  4BWR A;  2GW1 A;  1TJC A;  2Y4U A;  4I1A A;  5FT9 A;  4GZ6 A;  3SF4 A;  3Q47 B;  5G05 C;  3CK7 A;  4JA9 A;  3AS4 A;  5D0Q D;  1KLX A;  2VSY A;  2WPV A;  4RG9 A;  3LKU A;  4GZ5 A;  3GZ1 A;  3OXL A;  3ASF A;  3CEQ A;  1QZ2 A;  2MHK A;  1YA0 A;  3MV3 B;  3Q4A B;  4ME2 A;  3CVL A;  3FWV A;  1NZN A;  2UY1 A;  3NF1 A;  3S7D A;  1HZ4 A;  3ASD A;  4IN3 B;  4UI9 J;  3PE4 A;  3TG5 A;  2KCK A;  2IF4 A;  3OXF A;  4A1S A;  4BTB A;  2VQ2 A;  2NC9 A;  4HOT A;  4WNG A;  3BEE A;  5FZR A;  3LYA A;  3QWV A;  3VTY A;  1ELW A;  1ZBP A;  4HOQ A;  1PC2 A;  3HYM B;  3O48 A;  5JJT A;  3CK8 A;  5G05 J;  2XEV A;  4G2V A;  1W3B A;  5AYW D;  5HQ8 A;  3Q5M A;  1NA3 A;  2HYZ A;  3IEG A;  4J8F A;  1A17 A;  4N39 A;  5FZS A;  4XIF A;  5FTP A;  1WAO 1;  4N3A A;  4XI0 A;  5ARG A;  4GZ3 A;  3RO2 A;  4F3V A;  2PQN A;  3PE3 A;  4G24 A;  4BT8 A;  3ULQ A;  2LSU A;  3GYZ A;  4KYO B;  4GPK A;  2KCL A;  3LY8 A;  3WXX A;  4G1T A;  4I2W A;  3EDT B;  5JJ7 A;  3ASH A;  3UPV A;  3RKV A;  3ZGQ A;  3CVP A;  3ZN3 A;  1E96 B;  2OND A;  4I9C A;  5BT1 A;  4CGW A;  4I2Z A;  2IFU A;  1HXI A;  2WQH A;  4NRH B;  4YND A;  4H7Y A;  4N3B A;  3LY7 A;  4GYY A;  4NQ0 A;  1FCH A;  2VSN A;  3S7B A;  4GYO A;  5HI7 A;  4N2Q A;  3RJV A;  3U4T A;  4JA7 A;  4G23 A;  5BW8 C;  3FP3 A;  4JL0 A;  1QQE A;  3R9A B;  2VYI A;  3CVN A;  2YQ8 A;  2I6H A;  3MEK A;  3RU0 A;  4RG6 A;  3CVQ A;  5A7D B;  2XPI A;  4KBQ A;  3U3W A;  5G04 C;  4AM9 A;  2KC7 A;  5FJY A;  4U04 A;  4EQF A;  2UY1 B;  4CDR A;  4G26 A;  4J8D A;  5KJL A;  2V5F A;  4U0U A;  5DIZ A;  2Y4T A;  2KCV A;  3CV0 A;  2QFC A;  2LSV A;  3QDN A;  3MA5 A;  5EX3 A;  2AVP A;  3CKB A;  1P5Q A;  4O6F A;  3JYS A;  3ZFW A;  1ELR A;  2XGS A;  4APO A;  2VGX A;  4B94 A;  2HO1 A;  5CCM A;  1IYG A;  3TG4 A;  3LPZ A;  3AS8 A;  4H7X A;  4YVO A;  2Q7F A;  5CHE E;  4BTA A;  5KJN A;  3RO3 A;  1XNF A;  4XI9 A;  5C1D A;  4AIF A;  2FO7 A;  2PQR A;  4UQX A;  5BNW A;  3N71 A;  4U0S A;  4N5C A;  2C2L A;  2OOE A;  2J9Q A;  4W9R A;  4YVQ C;  5CCL A;  2PL2 A;  3ASG A;  3SZ7 A;  4J0U A;  2JLB A;  4AY5 A;  3UQ3 A;  3E4B A;  2LNI A;  2VGY A;  3LY9 A;  2XCB A;  1IHG A;  2C0L A;  2DBA A;  3TGO A;  2C0M A;  4JHR A;  4ABN A;  5ARF A;  3QWW A;  2XCC A;  4WUY A;  4HOS A;  3FFL A;  4G25 A;  2BUG A;  2R5S A;  5A6C A;  2P58 C;  3ESK A;  3TAX A;  2XGO A;  4U07 A;  1KT1 A;  4BT9 A;  3LCA A;  3URZ A;  4HOU A;  3K9I A;  2UWJ G;  2FF4 A;  5KJM A;  4LEU A;  4UI9 K;  5JJ6 A;  4GCN A;  1KT0 A;  4GA0 A;  3CK9 A;  3KD7 A;  2XGM A;  5D0O D; 
#chains in the Genus database with same CATH topology
 3SFY A;  5EYL A;  5EX0 A;  4CZ2 D;  3J5Q B;  3UT8 A;  4F53 A;  3QK0 A;  1ZU2 A;  3AG3 E;  4GCO A;  5KBA A;  3ULE G;  2J07 A;  3ZVV A;  2L0I A;  4DI4 A;  2J49 A;  3FEX A;  3ULY A;  4E85 A;  2R2L A;  5IY5 E;  4GPM A;  3CKC A;  4DX7 D;  3HG0 D;  3VLF A;  2VTB B;  3PDN A;  3FH5 A;  1OCR E;  2I2O A;  2XZT G;  4UQZ A;  2F0Y A;  3LS8 A;  1OUV A;  4YDE A;  3QOU A;  4AY6 A;  3FEY A;  3UM2 A;  1Z3X A;  3C5R A;  3AS5 A;  1NA0 A;  3ZHE A;  4Y6C A;  3U9W A;  3QC1 A;  3SFX A;  2X3M A;  4GYW A;  4I1O B;  3CHS A;  2OCC E;  4L7T A;  5DBK A;  1QNF A;  3OXG A;  1HH8 A;  4WND A;  2WXP A;  3SBT B;  4UI9 C;  3X2Q E;  5KJK A;  3G2T A;  1O1S A;  3DPY A;  1TR4 A;  3PUJ A;  5E75 A;  5EIB E;  4PS7 A;  3FTW A;  5EN5 D;  3DST A;  4B89 A;  2RD0 A;  3B7R L;  1MZC A;  2P2C P;  2Y69 E;  1DC2 A;  3JUI A;  4GMR A;  3Q47 B;  4QQI A;  1KLX A;  3UT4 A;  2ETB A;  4GZ5 A;  3ZNG A;  2J4D A;  4BSZ B;  3JCK C;  1Y6I A;  4TXP A;  2R05 A;  2GRM A;  3C3R A;  4A3T A;  3C3O A;  4TUU A;  4QFV A;  3PEU B;  4HI8 A;  4DX2 A;  4DLQ A;  2A4Z A;  2MHK A;  4JPS A;  3DPD A;  4ME2 A;  1KZO A;  2X6I A;  3ZUV B;  2J08 A;  3FU6 A;  1NL4 A;  3LVQ E;  4HNA D;  1HX8 A;  3SD5 A;  1G3N B;  2AW6 A;  4ANU A;  3TG5 A;  2KCK A;  1H2T C;  4U8Y D;  2WQ7 A;  5T3R A;  4U63 A;  4BTB A;  3I5P A;  1OWN A;  5JHA A;  3DEP A;  5FZR A;  1N11 A;  3JXJ A;  1BI7 B;  3JQ1 A;  4HOQ A;  5AQ9 A;  3CVV A;  1JWF A;  5EIL A;  1N4S A;  2WM9 A;  1VDY A;  4HI9 A;  5CMW A;  3CK8 A;  3SGH A;  2XEV A;  2HYZ A;  3IEG A;  1HF8 A;  1TNZ A;  1JCR A;  1KPS B;  4BY6 A;  3CHP A;  4U8H A;  4N3A A;  2PM7 A;  5ARG A;  3RO2 A;  1D8D A;  3ABM E;  4R7L A;  2CHX A;  2QYJ A;  1MX2 A;  4CT0 A;  3UM1 A;  1L5J A;  2EIN E;  3NOG D;  2A5U A;  3OAW A;  4DI3 A;  5BT1 A;  4CGW A;  3Q73 A;  1O1T A;  1HXI A;  1UJK A;  2EIJ E;  4NRH B;  1HG2 A;  4L1B A;  1SZ9 A;  4N3B A;  3LY7 A;  1FCH A;  1IXV A;  3CHR A;  4EBA A;  3I4G A;  2RFA A;  1E8Z A;  3PUK A;  3Q78 A;  5BW8 C;  3FHE A;  4DX1 A;  1K1A A;  3IXE A;  3R9A B;  1AP7 A;  1QBQ A;  3MEK A;  3ZYK A;  2H6H A;  3RRU A;  3V2O A;  5B3S E;  3UM0 A;  4DRX E;  3UI2 A;  5ITZ F;  3QJZ A;  1X81 A;  3HHM A;  3HRA A;  4KT6 B;  2AXZ A;  2VJ8 A;  5BPP A;  1INZ A;  3T9K A;  4A3V A;  1U3D A;  4GTS A;  4DX5 D;  2JAB A;  2ZIR A;  2V4L A;  2QFC A;  3EHM A;  2J09 A;  3B7T A;  1P5Q A;  1DVP A;  3ZFW A;  3AU5 A;  4IYP A;  2XGS A;  1HFA A;  3PRE A;  3FUK A;  1FT2 A;  4A55 A;  2V5Q C;  3QB2 A;  4MLP A;  1EPU A;  3L9T A;  3PH0 C;  4OVU A;  2DCP A;  5KJN A;  3NBN B;  3ZYQ A;  3E37 A;  3UIO C;  2KZT B;  4URK A;  3FU3 A;  3PZ1 A;  3D9I A;  1IHB A;  2FO7 A;  2V0P A;  3ZIM A;  5BNW A;  3FUH A;  1X5B A;  3IV0 A;  2C2L A;  4UWL A;  2OOE A;  1TNU A;  2L9B A;  2H6I A;  2OEW A;  3MZL B;  4F1S A;  3KSL A;  5D2M C;  2OEV A;  4HRN A;  3CIA A;  4J0U A;  3KEA A;  4AY5 A;  1WG0 A;  2LNI A;  4GZD A;  3IBE A;  1N4Q A;  2VGY A;  2ZU6 B;  2JEK A;  2CG3 A;  3TGO A;  2C0M A;  2NSZ A;  4JHR A;  3L08 A;  4ABN A;  3EHR A;  1TN6 A;  3LXU X;  4EEC A;  1Z5S C;  3QWW A;  2WXM A;  3FUN A;  2E0I A;  2XS1 A;  1DCQ A;  1MX6 A;  4G25 A;  3DRA A;  4EZL A;  3ESK A;  3E33 A;  2XGO A;  1KT1 A;  4XZ4 A;  2WXI A;  3URZ A;  2UWJ G;  4YDO A;  2QC9 A;  5CMY A;  5JA4 D;  4I1M A;  5JJ6 A;  4HRM B;  1TN7 A;  3B7B A;  3PEV B;  4Q96 A;  2NXP A;  4JD2 G;  2L6J A;  3P2B A;  2J8S D;  4I9E A;  2FBN A;  3NOC D;  3FUL A;  4MBG A;  3CVX A;  3QAR A;  4JEU A;  1H2V C;  3DSX A;  5BV1 A;  5E76 A;  4X8Q A;  2LXM A;  2XRY A;  3G2U A;  3Q49 B;  4K5C A;  4PH4 B;  1WM5 A;  1MJ0 A;  4M7C A;  2BED A;  5FQ4 A;  2I9C A;  2FI7 A;  3CR3 A;  1OY3 D;  1S63 A;  4J7W A;  4KVM A;  4APF A;  3IKO B;  4HOR A;  4Y6W A;  3TWR A;  4FA6 A;  5EDS A;  3FH8 A;  3DSW A;  3VTX A;  2RG8 A;  3S7J A;  1Y8M A;  3L16 A;  3TXM A;  2XPY A;  4GML A;  1TNY A;  4BFR A;  2Y1L E;  1H6P A;  4JXT A;  3ZHE B;  5LCW J;  2P9I G;  3MX3 A;  1UJJ A;  5CEA A;  5AQB A;  4UQY A;  2I1K A;  4Q94 A;  4WNE A;  3DSU A;  2F8Y A;  1LF8 A;  2BTD A;  4J6I A;  5FT9 A;  3LVR E;  4GZ6 A;  3GZS A;  3PZD A;  1HS6 A;  3SF4 A;  1BI8 B;  4JA9 A;  2MRI A;  3TWU A;  4DPR A;  4RG9 A;  3ZYM A;  2H6G A;  2DWZ A;  1JCS A;  2X6K A;  3HVE A;  1UW4 B;  1LD8 A;  2RKK A;  2PNN A;  2IOL A;  2F37 A;  4ZFH A;  1HU3 A;  3D9H A;  4BSX A;  2IO2 C;  4RSY A;  3NAW A;  5ENR D;  3Q4A B;  4WWP A;  3U66 A;  3RRN B;  3NF1 A;  2X6J A;  3S7D A;  3ASD A;  4IN3 B;  2CHZ A;  5FQ8 A;  2MYO A;  2V4H C;  3TXN A;  4ILG A;  4ZHB A;  3L13 A;  4GTQ A;  4U96 D;  2VQ2 A;  1O5M A;  1N52 A;  4PS3 A;  1OWM A;  3LYA A;  4FC8 A;  4TV3 A;  4O1P A;  2QZA A;  4J8S A;  4UWH A;  5G05 J;  2IEJ A;  3W9F A;  3G2W A;  4F7A A;  2M63 A;  1W3B A;  3NB2 A;  5T8I A;  3Q5M A;  4GTM A;  4J8F A;  4UWG A;  4AVX A;  1A17 A;  3FUM A;  4N39 A;  4XIF A;  5FZS A;  4BES A;  5CED B;  2XHE A;  3EU5 A;  3PE3 A;  4BT8 A;  3UTM A;  3GYZ A;  1UN9 A;  4UUC A;  1K8K G;  4KYO B;  2IJG X;  3EDT B;  3LJ3 A;  2XRZ A;  5KCM A;  3IHV A;  3APF A;  1OXJ A;  3ZGQ A;  3CVP A;  3Q9N C;  4TRQ A;  3FDH A;  2X6F A;  2YHE A;  3B95 A;  3PS6 A;  4H7Y A;  3TWV A;  2QY7 A;  4U8V D;  2VSN A;  3S7B A;  4G8L A;  3G2S A;  3U4T A;  5ENQ D;  4JA7 A;  4G23 A;  3MKQ A;  3PZ2 A;  5D66 A;  3FP3 A;  5A23 A;  1QQE A;  5C2Y A;  1OWP A;  2XEN A;  2ZXW E;  4MS6 A;  4BX9 A;  2I6H A;  5ENT D;  4LNB A;  4GTR A;  3CVQ A;  3KSQ A;  4UWK A;  1EYH A;  2XPI A;  4AOF A;  1K1B A;  4KBQ A;  3C98 A;  2WXJ A;  3VLD A;  3SNX A;  2AXV A;  4GU5 A;  2UY1 B;  4G26 A;  3ML9 A;  5KJL A;  1OCO E;  2A5E A;  2KCV A;  3UMV A;  2XEH A;  2XPZ A;  5AQA A;  4I6G A;  3MA5 A;  5EX3 A;  3JYS A;  3FUF A;  2VGE A;  4MKT A;  2HO1 A;  1E8W A;  1MQS A;  5CCM A;  2XZD G;  3LPZ A;  3ABK E;  3PVL A;  2Q7F A;  5JMN D;  4BTA A;  3JQ0 A;  3RO3 A;  3PNL B;  2GRN B;  5AIJ A;  5C1D A;  1SW6 A;  1XGW A;  3T5X A;  1SZA A;  3D3M A;  4HFG A;  4UQX A;  3N71 A;  4N5C A;  4GZC A;  4DK5 A;  4HQD A;  4HLE A;  3ASO E;  2WXL A;  2R02 A;  4W9R A;  4NAC A;  4YVQ C;  5CCL A;  1TYQ G;  1A5E A;  1BLX B;  1PY1 A;  4KVO A;  5AN8 A;  3D9L A;  3Q9U C;  3E4B A;  4BEP A;  4B0Z A;  5CER B;  3DBS A;  2XCB A;  3FTY A;  2XEE A;  4FU3 A;  2C0L A;  4GTO A;  2DBA A;  3FTX A;  3BG0 B;  4FJZ A;  3FTS A;  3FFL A;  2OVF A;  4E6H A;  5KWD A;  2BUG A;  4AV7 A;  2P58 C;  5G2N A;  2WXN A;  4HRL A;  3DWL G;  3S2A A;  4U07 A;  4FLH A;  2HM8 A;  5JHB A;  4HOU A;  1SA4 A;  3K9I A;  2WXH A;  2EIK E;  5BV0 A;  4UI9 K;  1TNB A;  2FUL A;  3KD7 A;  5B1B E;  3DXM G;  5LP0 A;  5D0O D;  5H7P A;  3KAE A;  4CGV A;  5LCW C;  3BU8 A;  2CG2 A;  4J8Y A;  3O4Z A;  3UUX A;  5CRV A;  3MGB A;  2B0O E;  1JCQ A;  1PAQ A;  4FP7 A;  3MCX A;  3Q79 A;  2OVB A;  1HE8 A;  4FUL A;  4J8E A;  4GMJ A;  2YHC A;  3Q15 A;  3QWP A;  1LTX A;  2GRP B;  4WAF A;  4GA2 A;  1IQR A;  4FAD A;  4N3C A;  3BG1 B;  3PRZ A;  3GW4 A;  1ELK A;  2VGX B;  4U0Z A;  3IHY A;  2PM6 A;  1YMP A;  4FHK A;  4YDY A;  2AJA A;  1KZP A;  5T4Y A;  3R7R A;  2LO6 A;  4XX5 A;  5AEN A;  5EKQ D;  4L9P A;  3D9N A;  2QYU A;  3DSS A;  1B89 A;  3RIB A;  4Z68 A;  5CRU A;  3TWX A;  4GAA A;  3TWT A;  4B8C B;  2CFZ A;  3ZKJ A;  3SBS A;  2DVW A;  5EID A;  3CSF A;  2GRO B;  2WVI A;  3C3Q A;  1BU9 A;  4HBD A;  2LXL A;  4ILI A;  5AAR A;  5BUZ A;  1E8X A;  1ZB1 A;  2BKG A;  5FWQ A;  3SI5 A;  4C9B B;  5B1A E;  4JW1 A;  4FHJ A;  3SQV A;  4DUI A;  3CHQ A;  1UOH A;  1TJC A;  3NQP A;  3D9K A;  2Y4U A;  2FO1 E;  5G05 C;  3CK7 A;  5D0Q D;  4G8K A;  4I6E A;  3LKU A;  3L17 A;  3GZ1 A;  1N0R A;  2ETA A;  5FQ7 A;  4N5Q A;  3OXL A;  4K0R A;  3ASF A;  2ZGD A;  4TUM A;  5AJD A;  3FUI A;  3CVU A;  4JHK A;  3TWQ A;  1YA0 A;  3ZEF A;  3HVE B;  3CVL A;  3FWV A;  1NZN A;  1AWC B;  1OWL A;  3UXG A;  4U95 D;  3PE4 A;  2ILR A;  3OXF A;  4A1S A;  4NIK A;  4BX8 A;  2GRL A;  3D9J A;  2NC9 A;  2WQ6 A;  3FUJ A;  4WNG A;  4PUC A;  3RAU A;  3VTY A;  2MOW A;  4JVS A;  4V3I A;  4CYM D;  3HXF A;  3FTU A;  3FUE A;  4WWO A;  1NI1 A;  3JUE A;  1D8E A;  3O48 A;  5JJT A;  4HVB A;  4ANX A;  3SO8 A;  3TWS A;  5AYW D;  3FY4 A;  1NA3 A;  1OWO A;  4ILH B;  4FLB A;  4L2Y A;  3D9P A;  4HXI A;  3UKR G;  2IQC A;  3EJN A;  5FTP A;  5J08 A;  4XI0 A;  1IKN D;  4AEZ C;  1TJF A;  4LNG A;  1O1R A;  3B13 A;  2P9S G;  1Q2Z A;  5FQ6 A;  1N95 A;  4RQI A;  3RSE G;  4GPK A;  3LY8 A;  3WXX A;  4G1T A;  2J4B A;  3LJN A;  5LFA A;  3L6A A;  5JJ7 A;  4LSZ E;  3SFZ A;  3UPV A;  3APC A;  3ZN3 A;  1E96 B;  2OND A;  2DZN A;  5HRY A;  2CFU A;  4CRW A;  4I2Z A;  1MHQ A;  4LUN U;  2WQH A;  4PS8 A;  4NUR A;  3L54 A;  4GYY A;  4C0M A;  3HXB A;  4GYO A;  5BXU A;  4RVB A;  3ESL A;  5ENP D;  3RJV A;  4OVV A;  1MX4 A;  4JL0 A;  4OAV B;  3UT7 A;  2AXU A;  4FJY A;  4JB8 P;  2VYI A;  2ION A;  1FVH A;  3CVN A;  2YQ8 A;  3RU0 A;  3LEW A;  3KEZ A;  4K5B A;  2EQX A;  1FPP A;  5LOZ A;  5A7D B;  3AJI A;  2P9N G;  3W9G A;  3LDZ A;  4KZC A;  3MYV A;  3U3W A;  5G04 C;  1BPO A;  3HIZ A;  2WMN A;  1E7V A;  3TJP A;  1OCC E;  4EQF A;  4IRU A;  2V5F A;  1TN8 A;  1QYM A;  2Y4T A;  3CV0 A;  2LSV A;  3QDN A;  2KXP C;  1EF1 C;  1NP7 A;  3CKB A;  1RW2 A;  4O6F A;  3Q75 A;  1ELR A;  3I3N A;  2WXO A;  4APO A;  2WXR A;  4B94 A;  5J90 A;  4EZK A;  2WXQ A;  4DX6 D;  3TG4 A;  3AS8 A;  4H7X A;  4I43 A;  5CHE E;  3ISM C;  4LRZ A;  3PNT B;  3R9M A;  3CHM A;  4XI9 A;  3DEO A;  2PQR A;  3BQO A;  2EIL E;  2ZGG A;  1IQU A;  4JHJ A;  4LER A;  3SHF A;  3ZU7 B;  4B93 B;  4B8A A;  2R17 C;  3FUD A;  3DXK G;  1N4P A;  3ASG A;  2XQ0 A;  3SZ7 A;  3CQC B;  3ZXS A;  4CEM A;  2WXG A;  4LG6 A;  4CCA A;  3UQ3 A;  3CVW A;  4LNU D;  4PDX A;  3Q7A A;  1JUQ A;  2WXF A;  3LY9 A;  1HG5 A;  1IHG A;  1E90 A;  5ARF A;  3C72 A;  2XCC A;  4HOS A;  2WMO A;  4GTT A;  2R5S A;  3EU9 A;  3TAX A;  4ATG A;  3UIN C;  2WB2 A;  4BT9 A;  3UIP C;  2FF4 A;  5KJM A;  3VLE A;  4GCN A;  2P9P G;  2EIM E;  1S0P A;  4GA0 A;  5LX8 A;  3CK9 A;  4AJW A;  3TWW A;  4L23 A;  4HLL A;  3MV2 B;  2F8X K;  4GA1 A;  4YDW A;  2KAT A;  2VTB A;  4TXR A;  4OAU C;  1BD8 A;  4N2S A;  3MKR A;  1EDU A;  2PZI A;  4LCT A;  4WNF A;  1H19 A;  5ANL A;  3GZ2 A;  4HS2 A;  3PZ4 A;  4U7E B;  5FZQ A;  3FU0 A;  1SQM A;  3S7F A;  3QKY A;  3ASN E;  2IO3 C;  5M72 A;  2XS8 A;  3G2V A;  3TL5 A;  3QAQ A;  2HR2 A;  1RZ4 A;  2LUH A;  4RLY A;  3ZPJ A;  4ANV A;  5ENO D;  4GTP A;  4MRU A;  3EHN A;  1D9S A;  1JPL A;  4XEI G;  2DYS E;  3BUA A;  2KBX A;  2FEZ A;  4I17 A;  4DJA A;  4KZ0 A;  1Z3Y A;  3T8K A;  4AP2 A;  2ZIS A;  5G04 J;  2GRQ B;  4BER A;  5CBO A;  2E2E A;  4JEH A;  2HE0 A;  2GRR B;  2AWI A;  3UM3 A;  3D9O A;  3UKU G;  1OCZ E;  3KS2 A;  4KXK B;  3HXE A;  4BWR A;  1OT8 A;  3CHO A;  5HS0 A;  5FIN A;  1DNP A;  4A1G A;  2B6C A;  2GW1 A;  2YNQ A;  3ML8 A;  4GTV A;  1N9A A;  4JC8 A;  4I1A A;  1N54 A;  3JXI A;  3CLJ A;  3AS4 A;  4F6R D;  2VSY A;  2WPV A;  3DSV A;  1TEZ A;  1U3C A;  4O1O A;  3B7S A;  5CBN A;  2X6H A;  3ZYL A;  3ONK A;  4IUL A;  5HKP A;  3CEQ A;  1QZ2 A;  1LD7 A;  3ONL A;  4Q69 A;  3MV3 B;  2BKK B;  4TXQ A;  2UY1 A;  1HZ4 A;  3T5V A;  3V30 A;  3MJW A;  4UI9 J;  3Q7F A;  1FVF A;  4CDM A;  1H2U A;  3P1U A;  2IF4 A;  3EHQ A;  3EIJ A;  2R03 A;  2I1J A;  4HOT A;  3NZU A;  3BEE A;  4D10 C;  3QWV A;  1ELW A;  1ZBP A;  1Z6T A;  1PC2 A;  3CGH A;  3HYM B;  4CT4 A;  3APD A;  3HDX A;  3NZS A;  5AQ7 A;  1SA5 A;  3F6Q A;  4ATZ D;  4G2V A;  4EBA G;  1E8Y A;  5HQ8 A;  1K3Z D;  1H6K A;  2YIN A;  4L2L A;  3QNK A;  1UN8 A;  2WXK A;  1WAO 1;  4HB5 A;  4GZ3 A;  4F3V A;  2PQN A;  2P9U G;  4G24 A;  3RK6 A;  2Y0B G;  3ULQ A;  2LSU A;  2VSO E;  2OV8 A;  2IOS A;  3R7Q A;  1JWG A;  2KCL A;  4I2W A;  4P29 A;  1U2V G;  4KMO A;  3ASH A;  3RKV A;  3B7U X;  1H6O A;  4I9C A;  2IFU A;  3FTV A;  1S64 A;  4ACK A;  3AU4 A;  4YND A;  3PZ3 A;  5EYP F;  2DYR E;  3ZW3 A;  3HXD A;  4XKC A;  2VSX E;  3ABL E;  4NQ0 A;  2V8S E;  5HI7 A;  4N2Q A;  3I4R B;  5KNH D;  1FT1 A;  3L22 A;  1SVX A;  3ZRH A;  5ENN A;  5KNG A;  3EIQ C;  4C0E A;  4ACL A;  3V79 K;  4BET A;  4O60 A;  4RG6 A;  4CDN A;  3U64 A;  1N94 A;  1E7U A;  1V54 E;  3HXC A;  4K5A B;  4AM9 A;  4ANW A;  2KC7 A;  3AG4 E;  5FJY A;  1S70 B;  4U04 A;  2IU1 A;  3CST A;  4UWF A;  2RFM A;  4CDR A;  2NYJ A;  2P9K G;  4J8D A;  5DIZ A;  2R59 A;  4U0U A;  2ETC A;  2P9L G;  3E34 A;  4C48 B;  4DLO A;  1GW6 A;  2AVP A;  4WWN A;  3EUV A;  3J5P A;  5ANR A;  2H6F A;  1N0Q A;  2VGX A;  4K03 A;  4OYS A;  2KZT A;  4JZY A;  1IYG A;  4YVO A;  2DIW A;  1YYH A;  3AG2 E;  3ENE A;  4A63 B;  1XNF A;  5G55 A;  5AAO A;  3FTZ A;  3FH7 A;  5AJL A;  4AIF A;  1UG3 A;  4G11 A;  4EZJ A;  4XE0 A;  1WY6 A;  4U0S A;  3V2X A;  1N4R A;  2Y3A A;  3FU5 A;  4GB9 A;  2J9Q A;  3V31 A;  1TNO A;  3UX4 A;  1NFI E;  2LAI A;  3AAA C;  2DZO A;  1DCE A;  2PL2 A;  2KM4 A;  2GGF A;  2CHW A;  1HO8 A;  2JLB A;  2L0T B;  4F1P A;  4I6J A;  3ZXP A;  4EPZ A;  5BXO A;  3WG7 E;  3RRM B;  3E32 A;  5ENS D;  3CVY A;  4XKB A;  2L6B A;  4WUY A;  3L82 A;  5FIO A;  5A6C A;  2LAH A;  1V55 E;  3D9M A;  2IY0 C;  5CEC B;  2X38 A;  3LCA A;  3MKQ B;  1WDY A;  3AG1 E;  3T8M A;  4M3O A;  3E30 A;  3CQG B;  3SY2 A;  4LEU A;  1YCS B;  1KT0 A;  1H0A A;  3OTN A;  4EHM A;  4AXH A;  2BF0 X;  2XGM A;  1MYO A; 
#chains in the Genus database with same CATH homology
 3KAE A;  4L23 A;  5EX0 A;  2L6J A;  4CGV A;  3P2B A;  3MV2 B;  4GA1 A;  5LCW C;  2KAT A;  3UT8 A;  4F53 A;  2VTB A;  4I9E A;  3QK0 A;  2FBN A;  1ZU2 A;  3FUL A;  2CG2 A;  4GCO A;  2J07 A;  3ZVV A;  2L0I A;  3CVX A;  4DI4 A;  4N2S A;  2J49 A;  3MKR A;  3FEX A;  3O4Z A;  4E85 A;  3QAR A;  1EDU A;  2PZI A;  1H2V C;  4JEU A;  4LCT A;  4WNF A;  3UUX A;  5BV1 A;  3MGB A;  5E76 A;  1H19 A;  5ANL A;  3GZ2 A;  4HS2 A;  1PAQ A;  3CKC A;  4FP7 A;  5FZQ A;  3FU0 A;  3MCX A;  1SQM A;  2OVB A;  2XRY A;  3G2U A;  3S7F A;  3VLF A;  2VTB B;  1HE8 A;  3QKY A;  3Q49 B;  3PDN A;  4FUL A;  4PH4 B;  4J8E A;  3FH5 A;  4GMJ A;  5M72 A;  2I2O A;  2YHC A;  1WM5 A;  3G2V A;  3Q15 A;  3QWP A;  3TL5 A;  3QAQ A;  2HR2 A;  4WAF A;  4UQZ A;  3LS8 A;  3ZPJ A;  4ANV A;  1OUV A;  4GA2 A;  1IQR A;  4MRU A;  4FAD A;  3QOU A;  5FQ4 A;  4N3C A;  3BG1 B;  3EHN A;  3PRZ A;  3GW4 A;  1ELK A;  2VGX B;  4U0Z A;  2I9C A;  4AY6 A;  2FI7 A;  3IHY A;  3CR3 A;  2PM6 A;  3FEY A;  4KVM A;  4FHK A;  1JPL A;  4APF A;  1Z3X A;  3IKO B;  4HOR A;  4Y6W A;  2FEZ A;  3AS5 A;  4I17 A;  4DJA A;  5T4Y A;  4KZ0 A;  3R7R A;  1Z3Y A;  1NA0 A;  2LO6 A;  4FA6 A;  3FH8 A;  5EDS A;  3ZHE A;  4Y6C A;  3U9W A;  4XX5 A;  3QC1 A;  4AP2 A;  2X3M A;  3VTX A;  2RG8 A;  5AEN A;  4GYW A;  5EKQ D;  1Y8M A;  4I1O B;  3L16 A;  5G04 J;  3CHS A;  3S7J A;  3TXM A;  3D9N A;  2XPY A;  4L7T A;  5DBK A;  1QNF A;  4GML A;  4BFR A;  1B89 A;  3RIB A;  2E2E A;  4JEH A;  3OXG A;  1HH8 A;  4WND A;  4JXT A;  2WXP A;  2AWI A;  3D9O A;  4GAA A;  3SBT B;  4UI9 C;  3ZHE B;  4B8C B;  2CFZ A;  5LCW J;  3MX3 A;  3KS2 A;  3SBS A;  5KJK A;  3G2T A;  1UJJ A;  4KXK B;  4UQY A;  2I1K A;  3CSF A;  4Q94 A;  2WVI A;  4WNE A;  4ILI A;  3PUJ A;  5BUZ A;  1E8X A;  5E75 A;  5FWQ A;  4BWR A;  3SI5 A;  3CHO A;  4C9B B;  4JW1 A;  4PS7 A;  4FHJ A;  3FTW A;  3CHQ A;  1LF8 A;  1DNP A;  4B89 A;  4A1G A;  2RD0 A;  2GW1 A;  1TJC A;  2YNQ A;  3B7R L;  3ML8 A;  2BTD A;  3NQP A;  3D9K A;  2Y4U A;  4J6I A;  4JC8 A;  4I1A A;  5FT9 A;  3LVR E;  4GZ6 A;  3GZS A;  1N54 A;  3PZD A;  1HS6 A;  3SF4 A;  3JUI A;  3Q47 B;  5G05 C;  3CLJ A;  3CK7 A;  4JA9 A;  3AS4 A;  2MRI A;  5D0Q D;  4DPR A;  1KLX A;  2VSY A;  2WPV A;  4RG9 A;  3UT4 A;  3ZYM A;  1TEZ A;  4I6E A;  3LKU A;  4GZ5 A;  3L17 A;  1U3C A;  2J4D A;  3GZ1 A;  5FQ7 A;  3OXL A;  2X6K A;  3B7S A;  3HVE A;  4K0R A;  3ASF A;  3JCK C;  1Y6I A;  1UW4 B;  2X6H A;  3ZYL A;  3ONK A;  5AJD A;  3FUI A;  3CVU A;  2IOL A;  4IUL A;  2GRM A;  3CEQ A;  1HU3 A;  4BSX A;  1QZ2 A;  4A3T A;  4JHK A;  4TUU A;  4QFV A;  4RSY A;  3PEU B;  4DLQ A;  2A4Z A;  2MHK A;  3ONL A;  1YA0 A;  3DPD A;  3MV3 B;  4JPS A;  3Q4A B;  3ZEF A;  4Q69 A;  4WWP A;  3HVE B;  4ME2 A;  3CVL A;  3FWV A;  1NZN A;  2UY1 A;  3U66 A;  2X6I A;  3NF1 A;  2J08 A;  3RRN B;  2X6J A;  3S7D A;  3FU6 A;  1HZ4 A;  3ASD A;  4IN3 B;  3T5V A;  3LVQ E;  1OWL A;  3MJW A;  2CHZ A;  1HX8 A;  4UI9 J;  3SD5 A;  5FQ8 A;  1FVF A;  4CDM A;  3TXN A;  2AW6 A;  3PE4 A;  4ANU A;  3TG5 A;  2KCK A;  1H2T C;  4ILG A;  1H2U A;  3P1U A;  2WQ7 A;  2ILR A;  5T3R A;  2IF4 A;  3OXF A;  4A1S A;  3L13 A;  3EIJ A;  4BX8 A;  4U63 A;  2GRL A;  4BTB A;  3D9J A;  3I5P A;  2VQ2 A;  2I1J A;  2NC9 A;  1OWN A;  1N52 A;  3FUJ A;  4PS3 A;  4WNG A;  3NZU A;  1OWM A;  5JHA A;  2WQ6 A;  4HOT A;  3BEE A;  4PUC A;  4D10 C;  5FZR A;  3LYA A;  3QWV A;  3VTY A;  4FC8 A;  1ELW A;  1ZBP A;  2MOW A;  3JQ1 A;  4HOQ A;  4TV3 A;  1Z6T A;  1PC2 A;  4JVS A;  4V3I A;  3CGH A;  3HYM B;  1JWF A;  3APD A;  4CT4 A;  3CVV A;  3FTU A;  3HDX A;  3FUE A;  4WWO A;  2WM9 A;  1VDY A;  3NZS A;  4J8S A;  4UWH A;  3O48 A;  5CMW A;  5JJT A;  3CK8 A;  5G05 J;  3SGH A;  2XEV A;  4HVB A;  4ANX A;  3G2W A;  4F7A A;  4G2V A;  2M63 A;  1W3B A;  5AYW D;  4EBA G;  3FY4 A;  1E8Y A;  5T8I A;  5HQ8 A;  3Q5M A;  1NA3 A;  1H6K A;  2YIN A;  1OWO A;  2HYZ A;  4ILH B;  3IEG A;  1HF8 A;  4FLB A;  4J8F A;  4UWG A;  4AVX A;  4L2L A;  4L2Y A;  3QNK A;  1A17 A;  3D9P A;  3FUM A;  4HXI A;  4N39 A;  4XIF A;  5FZS A;  4BY6 A;  1UN8 A;  2WXK A;  3CHP A;  2IQC A;  3EJN A;  4U8H A;  5FTP A;  1WAO 1;  4N3A A;  4XI0 A;  5J08 A;  2PM7 A;  5ARG A;  4AEZ C;  1TJF A;  2XHE A;  4GZ3 A;  3RO2 A;  4F3V A;  2PQN A;  3PE3 A;  4G24 A;  3RK6 A;  4R7L A;  4BT8 A;  3B13 A;  3ULQ A;  2LSU A;  3GYZ A;  2VSO E;  2OV8 A;  2IOS A;  3R7Q A;  1UN9 A;  5FQ6 A;  2CHX A;  4KYO B;  1JWG A;  4GPK A;  2KCL A;  2IJG X;  3LY8 A;  3WXX A;  4G1T A;  4I2W A;  2J4B A;  3EDT B;  5LFA A;  3L6A A;  3LJ3 A;  4P29 A;  2XRZ A;  5JJ7 A;  4CT0 A;  4KMO A;  5KCM A;  3ASH A;  3IHV A;  3APF A;  1L5J A;  3SFZ A;  3UPV A;  3RKV A;  3APC A;  3ZGQ A;  3CVP A;  2A5U A;  3B7U X;  3OAW A;  3ZN3 A;  1E96 B;  2OND A;  4I9C A;  4TRQ A;  4DI3 A;  5BT1 A;  4CGW A;  3FDH A;  2CFU A;  4CRW A;  4I2Z A;  1MHQ A;  2X6F A;  2IFU A;  3FTV A;  4LUN U;  1HXI A;  2YHE A;  4ACK A;  2WQH A;  1UJK A;  3AU4 A;  4NRH B;  4YND A;  4PS8 A;  4NUR A;  3ZW3 A;  1HG2 A;  3PS6 A;  4H7Y A;  4XKC A;  3L54 A;  2VSX E;  1SZ9 A;  4L1B A;  4GYY A;  2QY7 A;  3LY7 A;  4NQ0 A;  1FCH A;  2VSN A;  4N3B A;  2V8S E;  4GYO A;  5HI7 A;  3S7B A;  4C0M A;  4N2Q A;  3G2S A;  4RVB A;  3CHR A;  3ESL A;  3RJV A;  4EBA A;  3I4G A;  3U4T A;  4JA7 A;  4G23 A;  3I4R B;  1E8Z A;  4OVV A;  3MKQ A;  3PUK A;  3L22 A;  5BW8 C;  3FHE A;  3FP3 A;  5A23 A;  4JL0 A;  3ZRH A;  3UT7 A;  1QQE A;  2AXU A;  4FJY A;  5ENN A;  5C2Y A;  3R9A B;  1OWP A;  2VYI A;  3EIQ C;  2ION A;  4MS6 A;  4C0E A;  1FVH A;  3CVN A;  4BX9 A;  2YQ8 A;  2I6H A;  3MEK A;  3RU0 A;  4ACL A;  3LEW A;  3KEZ A;  3ZYK A;  3RRU A;  4RG6 A;  2EQX A;  4CDN A;  3CVQ A;  3U64 A;  5LOZ A;  4UWK A;  1EYH A;  2XPI A;  5A7D B;  4AOF A;  1E7U A;  3LDZ A;  4KZC A;  3MYV A;  4KBQ A;  3QJZ A;  3C98 A;  5G04 C;  1BPO A;  3HIZ A;  3U3W A;  4AM9 A;  4ANW A;  2WMN A;  2KC7 A;  3HHM A;  4KT6 B;  1E7V A;  5FJY A;  3TJP A;  2AXZ A;  2WXJ A;  4U04 A;  2VJ8 A;  3VLD A;  2IU1 A;  4EQF A;  4IRU A;  5BPP A;  3CST A;  1INZ A;  3SNX A;  2AXV A;  4GU5 A;  4UWF A;  2UY1 B;  4CDR A;  4A3V A;  1U3D A;  4G26 A;  3ML9 A;  4J8D A;  5KJL A;  2V5F A;  2V4L A;  2R59 A;  4U0U A;  2Y4T A;  5DIZ A;  2KCV A;  3CV0 A;  3UMV A;  2XPZ A;  2QFC A;  2LSV A;  3EHM A;  3QDN A;  1EF1 C;  2J09 A;  4DLO A;  4I6G A;  3MA5 A;  3B7T A;  1GW6 A;  2AVP A;  1NP7 A;  3CKB A;  4WWN A;  1P5Q A;  5EX3 A;  1DVP A;  4O6F A;  3JYS A;  3ZFW A;  3AU5 A;  1ELR A;  4IYP A;  2XGS A;  5ANR A;  3I3N A;  1HFA A;  2WXO A;  3FUF A;  3PRE A;  4APO A;  2VGX A;  3FUK A;  4K03 A;  2WXR A;  4MKT A;  4OYS A;  4B94 A;  2HO1 A;  2KZT A;  4JZY A;  1E8W A;  1MQS A;  4A55 A;  4EZK A;  2WXQ A;  5J90 A;  5CCM A;  1IYG A;  3QB2 A;  3LPZ A;  3AS8 A;  4H7X A;  4MLP A;  4I43 A;  3TG4 A;  1EPU A;  3PVL A;  2DIW A;  4YVO A;  2Q7F A;  5CHE E;  4BTA A;  3PH0 C;  4LRZ A;  4OVU A;  3ENE A;  2DCP A;  5KJN A;  3JQ0 A;  3PNT B;  3ZYQ A;  3RO3 A;  3CHM A;  1XNF A;  3PNL B;  4XI9 A;  5AIJ A;  2KZT B;  5G55 A;  4URK A;  3FU3 A;  3FTZ A;  5C1D A;  3FH7 A;  5AJL A;  1XGW A;  3D9I A;  4AIF A;  3T5X A;  1SZA A;  1UG3 A;  2FO7 A;  2V0P A;  3D3M A;  4G11 A;  2PQR A;  4HFG A;  3ZIM A;  4EZJ A;  4UQX A;  4XE0 A;  1WY6 A;  5BNW A;  3FUH A;  1X5B A;  3N71 A;  3IV0 A;  4U0S A;  4N5C A;  2C2L A;  4GZC A;  2Y3A A;  4DK5 A;  1IQU A;  4UWL A;  2OOE A;  4JHJ A;  3FU5 A;  4HLE A;  4GB9 A;  2J9Q A;  2WXL A;  4LER A;  3SHF A;  2L9B A;  2R17 C;  3UX4 A;  4W9R A;  3MZL B;  3FUD A;  4B8A A;  2LAI A;  4F1S A;  4NAC A;  4YVQ C;  5CCL A;  2PL2 A;  3ASG A;  2XQ0 A;  1PY1 A;  2KM4 A;  3SZ7 A;  3CIA A;  4J0U A;  4KVO A;  2GGF A;  2CHW A;  3CQC B;  3ZXS A;  3D9L A;  1HO8 A;  4CEM A;  2WXG A;  2JLB A;  2L0T B;  4AY5 A;  4CCA A;  4I6J A;  3UQ3 A;  3CVW A;  3E4B A;  2LNI A;  4B0Z A;  4EPZ A;  4PDX A;  1JUQ A;  4GZD A;  3IBE A;  2WXF A;  3DBS A;  2VGY A;  2ZU6 B;  3RRM B;  3LY9 A;  1HG5 A;  2XCB A;  3FTY A;  1IHG A;  4FU3 A;  2C0L A;  2JEK A;  2DBA A;  2CG3 A;  3TGO A;  2C0M A;  1E90 A;  2NSZ A;  3FTX A;  3L08 A;  4JHR A;  5ARF A;  3BG0 B;  4ABN A;  3CVY A;  4FJZ A;  3LXU X;  4EEC A;  3FTS A;  3QWW A;  2XCC A;  4XKB A;  2WXM A;  4WUY A;  4HOS A;  3FUN A;  2E0I A;  3FFL A;  2OVF A;  4E6H A;  2WMO A;  4G25 A;  2BUG A;  2R5S A;  4EZL A;  5A6C A;  4AV7 A;  2P58 C;  3ESK A;  2WXN A;  5G2N A;  3TAX A;  4ATG A;  2LAH A;  2XGO A;  3S2A A;  2WB2 A;  4U07 A;  1KT1 A;  3D9M A;  4FLH A;  4XZ4 A;  4BT9 A;  2WXI A;  2X38 A;  2HM8 A;  3LCA A;  3MKQ B;  3URZ A;  5JHB A;  4HOU A;  3T8M A;  4M3O A;  3K9I A;  2UWJ G;  2FF4 A;  5KJM A;  2WXH A;  3CQG B;  5CMY A;  5BV0 A;  4LEU A;  4UI9 K;  4I1M A;  3VLE A;  5JJ6 A;  4GCN A;  1H0A A;  1KT0 A;  3OTN A;  2FUL A;  1S0P A;  4GA0 A;  5LX8 A;  3PEV B;  3CK9 A;  4AXH A;  4Q96 A;  3KD7 A;  2NXP A;  2BF0 X;  4AJW A;  2XGM A;  5LP0 A;  5D0O D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...