5G1AA

Bordetella alcaligenes hdah bound to pfsaha
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
370
structure length
369
Chain Sequence
HHAIGYVWNTLYGWVDTGTGSLAAANLTARMQPISHHLAHPDTKRRFHELVCASGQIEHLTPIAAVAATDADILRAHSAAHLENMKRVSNLPTGGDTGDGITMMGNGGLEIARLSAGGAVELTRRVATGELSAGYALVNPPGHHAPHNAAMGFCIFNNTSVAAGYARAVLGMERVAILDWDVHHGNGTQDIWWNDPSVLTISLHQHLCFPPDSGYSTERGAGNGHGYNINVPLPPGSGNAAYLHAMDQVVLPALRAYRPQLIIVGSGFDASMLDPLARMMVTADGFRQMARRTIDCAADICDGRIVFVQEGGYSPHYLPFCGLAVIEELTGVRSLPDPYHEFLAGMGGNTLLDAERAAIEIVPLLADIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE DEACETYLASE-LIKE AMIDOHYDROLASE
publication title The thermodynamic signature of ligand binding to histone deacetylase-like amidohydrolases is most sensitive to the flexibility in the L2-loop lining the active site pocket.
pubmed doi rcsb
source organism Alcaligenes
molecule tags Hydrolase
total genus 145
structure length 369
sequence length 370
chains with identical sequence B
ec nomenclature ec 3.5.1.4: Amidase.
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00850 Hist_deacetyl Histone deacetylase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.20 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Histone deacetylase domain 5g1aA00
3F06A 5G1AA 3ZNSA 4QA0A 3ZNRA 1C3PA 3MZ4A 5DC5A 5EF7A 4QA3A 5A2SA 5G0YA 2V5WA 3SFFA 4ZUMA 5ICNB 1ZZ1A 5THUA 3MZ3A 1C3SA 4QA1A 1VKGA 4BZ7A 5G0IA 4ZUOA 3EZPA 5THVA 5D1BA 5G0GA 5EFGA 5EFNA 5D1CA 4CBTA 4RN2A 2VQWG 4BZ6A 4QA4A 2VQVA 5G17A 5G10A 5IX0A 4ZUQA 3F0RA 4BZ9A 5G0JA 4QA6A 5DC8A 3Q9CA 2VQJA 4BZ5A 4RN1A 3C0ZA 2VQMA 5EENA 5G11A 5THTA 5IWGA 3Q9BA 5LI3A 1T64A 3MAXA 4RN0A 5FUEA 4LY1A 3MENA 4A69A 3EW8A 5G3WA 4CBYA 4ZURA 5G12A 3Q9FA 5EFKB 2VQQA 5EEIA 5G0XA 5EEMA 3MZ7A 5EFJD 4QA2A 3F07A 3RQDA 1ZZ3A 5D1DA 5DC7A 5EFBD 5FCWA 4ZUPA 5EFHA 5G0HA 1ZZ0A 5EF8A 5G1CA 2V5XA 4LXZA 5BWZA 2GH6A 5EEFA 4ZUNA 5EEKA 3EZTA 5THSA 2VCGA 4QA7A 5JI5A 3EWFA 3Q9EA 3MZ6A 3C0YA 4QA5A 1T69A 4BKXB 4BZ8A 3SFHA 5G13A 1T67A 4CQFA 1C3RA 1W22A 3C10A 5G1BA 5DC6A 2VQOA
chains in the Genus database with same CATH superfamily
3F06A 4RHLA 5G1AA 3ZNSA 4QA0A 3ZNRA 1C3PA 3MZ4A 1TBLA 3LP7A 5DC5A 5EF7A 4G3HA 4QA3A 4HZEA 1HQXA 5A2SA 5G0YA 1GQ7A 2V5WA 3SFFA 4ZUMA 3MFVA 5ICNB 1ZZ1A 5THUA 3MZ3A 4Q3RC 1P8QA 4IE1A 4IXVA 1PQ3A 1T4RA 1GQ6A 1C3SA 4RLAA 4IE2A 4QA1A 3E6KA 1VKGA 4HWWA 4BZ7A 4I06A 4Q40A 2CEVA 3M1RA 3MMRA 5G0IA 4ZUOA 3EZPA 5THVA 3TH7A 4GSVA 5D1BA 5G0GA 5EFGA 5EFNA 3E8ZA 5D1CA 4CBTA 4RN2A 2VQWG 4BZ6A 4QA4A 4CEVA 2VQVA 3E9BA 1P8SA 1WOHA 3GMZA 4HXQA 5G17A 4Q42A 1ZPEA 3MJLA 5G10A 5IX0A 4ZUQA 3F0RA 4BZ9A 5G0JA 1P8NA 4GSMA 2A0MA 1XFKA 1T4SA 1R1OA 2EIVA 4FCKA 4QA6A 4RHIA 5DC8A 2ZAVA 3Q9CA 4DZ4A 3F80A 2VQJA 4BZ5A 2PHOA 4IE3A 3C0ZA 4RN1A 1ZPGA 2VQMA 1P8MA 5EENA 5G11A 3GN0A 1HQ5A 5THTA 3CEVA 5IWGA 5HJ9A 3Q9BA 5LI3A 3THEA 1T64A 3MAXA 4RN0A 5FUEA 3NIPA 4LY1A 3MENA 4A69A 4MYLA 4Q3UA 5RLAA 4Q3PA 3LHLA 1TBHA 3EW8A 2PHAA 2AEBA 2EF5A 4Q3RA 1TA1A 3DJ8A 1WOIA 1HQGA 1P8OA 3KV2A 4Q3TA 5G3WA 4CBYA 4ZURA 4Q3VA 1P8RA 5G12A 5CEVA 4RHKA 1WVBA 4Q41A 3Q9FA 5EFKB 1T4TA 2VQQA 2RLAA 5EEIA 5G0XA 1HQFA 4ITYA 5EEMA 4FCIA 3MZ7A 5EFJD 1T5FA 4QA2A 3F07A 3RQDA 1ZZ3A 1HQHA 4IU0A 3SL0A 4IXUA 4Q3QA 5D1DA 5DC7A 5EFBD 5FCWA 3SJTA 1WVAA 4ZUPA 1D3VA 2EF4A 5EFHA 2PLLA 1RLAA 4GWCA 4IU4A 5G0HA 4RHJA 1ZZ0A 1WOGA 5EF8A 4RHQA 4Q3SA 2V5XA 4LXZA 5G1CA 5BWZA 1T5GA 4IU5A 2GH6A 5EEFA 4ZUNA 5EEKA 3EZTA 5THSA 2VCGA 4MYFA 1TBJA 4QA7A 4RHMA 5JI5A 3EWFA 3Q9EA 3RLAA 3MZ6A 3PZLA 3SL1A 1P8PA 4IU1A 3SKKA 3C0YA 3E8QA 4GSZA 4GWDA 4MXRA 4MYKA 4QA5A 3NIOA 1T69A 1T4PA 3MFWA 3TF3A 5G1BA 3THHA 4MYNA 1CEVA 3E6VA 3NIQA 4BKXB 4BZ8A 3SFHA 5G13A 3THJA 1T67A 4CQFA 1C3RA 1W22A 3C10A 3LP4A 5HJAA 5DC6A 2VQOA
chains in the Genus database with same CATH topology
3F06A 5G1AA 3ZNSA 4QA0A 3ZNRA 1C3PA 3MZ4A 5DC5A 5EF7A 4QA3A 5A2SA 5G0YA 2V5WA 3SFFA 4ZUMA 5ICNB 1ZZ1A 5THUA 3MZ3A 1C3SA 4QA1A 1VKGA 4BZ7A 5G0IA 4ZUOA 3EZPA 5THVA 5D1BA 5G0GA 5EFGA 5EFNA 5D1CA 4CBTA 4RN2A 2VQWG 4BZ6A 4QA4A 2VQVA 5G17A 5G10A 5IX0A 4ZUQA 3F0RA 4BZ9A 5G0JA 4QA6A 5DC8A 3Q9CA 2VQJA 4BZ5A 4RN1A 3C0ZA 2VQMA 5EENA 5G11A 5THTA 5IWGA 3Q9BA 5LI3A 1T64A 3MAXA 4RN0A 5FUEA 4LY1A 3MENA 4A69A 3EW8A 5G3WA 4CBYA 4ZURA 5G12A 3Q9FA 5EFKB 2VQQA 5EEIA 5G0XA 5EEMA 3MZ7A 5EFJD 4QA2A 3F07A 3RQDA 1ZZ3A 5D1DA 5DC7A 5EFBD 5FCWA 4ZUPA 5EFHA 5G0HA 1ZZ0A 5EF8A 5G1CA 2V5XA 4LXZA 5BWZA 2GH6A 5EEFA 4ZUNA 5EEKA 3EZTA 5THSA 2VCGA 4QA7A 5JI5A 3EWFA 3Q9EA 3MZ6A 3C0YA 4QA5A 1T69A 4BKXB 4BZ8A 3SFHA 5G13A 1T67A 4CQFA 1C3RA 1W22A 3C10A 5G1BA 5DC6A 2VQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F06 A;  5G1A A;  3ZNS A;  4QA0 A;  3ZNR A;  1C3P A;  3MZ4 A;  5DC5 A;  5EF7 A;  4QA3 A;  5A2S A;  5G0Y A;  2V5W A;  3SFF A;  4ZUM A;  5ICN B;  1ZZ1 A;  5THU A;  3MZ3 A;  1C3S A;  4QA1 A;  1VKG A;  4BZ7 A;  5G0I A;  4ZUO A;  3EZP A;  5THV A;  5D1B A;  5G0G A;  5EFG A;  5EFN A;  5D1C A;  4CBT A;  4RN2 A;  2VQW G;  4BZ6 A;  4QA4 A;  2VQV A;  5G17 A;  5G10 A;  5IX0 A;  4ZUQ A;  3F0R A;  4BZ9 A;  5G0J A;  4QA6 A;  5DC8 A;  3Q9C A;  2VQJ A;  4BZ5 A;  4RN1 A;  3C0Z A;  2VQM A;  5EEN A;  5G11 A;  5THT A;  5IWG A;  3Q9B A;  5LI3 A;  1T64 A;  3MAX A;  4RN0 A;  5FUE A;  4LY1 A;  3MEN A;  4A69 A;  3EW8 A;  5G3W A;  4CBY A;  4ZUR A;  5G12 A;  3Q9F A;  5EFK B;  2VQQ A;  5EEI A;  5G0X A;  5EEM A;  3MZ7 A;  5EFJ D;  4QA2 A;  3F07 A;  3RQD A;  1ZZ3 A;  5D1D A;  5DC7 A;  5EFB D;  5FCW A;  4ZUP A;  5EFH A;  5G0H A;  1ZZ0 A;  5EF8 A;  5G1C A;  2V5X A;  4LXZ A;  5BWZ A;  2GH6 A;  5EEF A;  4ZUN A;  5EEK A;  3EZT A;  5THS A;  2VCG A;  4QA7 A;  5JI5 A;  3EWF A;  3Q9E A;  3MZ6 A;  3C0Y A;  4QA5 A;  1T69 A;  4BKX B;  4BZ8 A;  3SFH A;  5G13 A;  1T67 A;  4CQF A;  1C3R A;  1W22 A;  3C10 A;  5G1B A;  5DC6 A;  2VQO A; 
#chains in the Genus database with same CATH topology
 3F06 A;  4RHL A;  5G1A A;  3ZNS A;  4QA0 A;  3ZNR A;  1C3P A;  3MZ4 A;  1TBL A;  3LP7 A;  5DC5 A;  5EF7 A;  4G3H A;  4QA3 A;  4HZE A;  1HQX A;  5A2S A;  5G0Y A;  1GQ7 A;  2V5W A;  3SFF A;  4ZUM A;  3MFV A;  5ICN B;  1ZZ1 A;  5THU A;  3MZ3 A;  4Q3R C;  1P8Q A;  4IE1 A;  4IXV A;  1PQ3 A;  1T4R A;  1GQ6 A;  1C3S A;  4RLA A;  4IE2 A;  4QA1 A;  3E6K A;  1VKG A;  4HWW A;  4BZ7 A;  4I06 A;  4Q40 A;  2CEV A;  3M1R A;  3MMR A;  5G0I A;  4ZUO A;  3EZP A;  5THV A;  3TH7 A;  4GSV A;  5D1B A;  5G0G A;  5EFG A;  5EFN A;  3E8Z A;  5D1C A;  4CBT A;  4RN2 A;  2VQW G;  4BZ6 A;  4QA4 A;  4CEV A;  2VQV A;  3E9B A;  1P8S A;  1WOH A;  3GMZ A;  4HXQ A;  5G17 A;  4Q42 A;  1ZPE A;  3MJL A;  5G10 A;  5IX0 A;  4ZUQ A;  3F0R A;  4BZ9 A;  5G0J A;  1P8N A;  4GSM A;  2A0M A;  1XFK A;  1T4S A;  1R1O A;  2EIV A;  4FCK A;  4QA6 A;  4RHI A;  5DC8 A;  2ZAV A;  3Q9C A;  4DZ4 A;  3F80 A;  2VQJ A;  4BZ5 A;  2PHO A;  4IE3 A;  3C0Z A;  4RN1 A;  1ZPG A;  2VQM A;  1P8M A;  5EEN A;  5G11 A;  3GN0 A;  1HQ5 A;  5THT A;  3CEV A;  5IWG A;  5HJ9 A;  3Q9B A;  5LI3 A;  3THE A;  1T64 A;  3MAX A;  4RN0 A;  5FUE A;  3NIP A;  4LY1 A;  3MEN A;  4A69 A;  4MYL A;  4Q3U A;  5RLA A;  4Q3P A;  3LHL A;  1TBH A;  3EW8 A;  2PHA A;  2AEB A;  2EF5 A;  4Q3R A;  1TA1 A;  3DJ8 A;  1WOI A;  1HQG A;  1P8O A;  3KV2 A;  4Q3T A;  5G3W A;  4CBY A;  4ZUR A;  4Q3V A;  1P8R A;  5G12 A;  5CEV A;  4RHK A;  1WVB A;  4Q41 A;  3Q9F A;  5EFK B;  1T4T A;  2VQQ A;  2RLA A;  5EEI A;  5G0X A;  1HQF A;  4ITY A;  5EEM A;  4FCI A;  3MZ7 A;  5EFJ D;  1T5F A;  4QA2 A;  3F07 A;  3RQD A;  1ZZ3 A;  1HQH A;  4IU0 A;  3SL0 A;  4IXU A;  4Q3Q A;  5D1D A;  5DC7 A;  5EFB D;  5FCW A;  3SJT A;  1WVA A;  4ZUP A;  1D3V A;  2EF4 A;  5EFH A;  2PLL A;  1RLA A;  4GWC A;  4IU4 A;  5G0H A;  4RHJ A;  1ZZ0 A;  1WOG A;  5EF8 A;  4RHQ A;  4Q3S A;  2V5X A;  4LXZ A;  5G1C A;  5BWZ A;  1T5G A;  4IU5 A;  2GH6 A;  5EEF A;  4ZUN A;  5EEK A;  3EZT A;  5THS A;  2VCG A;  4MYF A;  1TBJ A;  4QA7 A;  4RHM A;  5JI5 A;  3EWF A;  3Q9E A;  3RLA A;  3MZ6 A;  3PZL A;  3SL1 A;  1P8P A;  4IU1 A;  3SKK A;  3C0Y A;  3E8Q A;  4GSZ A;  4GWD A;  4MXR A;  4MYK A;  4QA5 A;  3NIO A;  1T69 A;  1T4P A;  3MFW A;  3TF3 A;  5G1B A;  3THH A;  4MYN A;  1CEV A;  3E6V A;  3NIQ A;  4BKX B;  4BZ8 A;  3SFH A;  5G13 A;  3THJ A;  1T67 A;  4CQF A;  1C3R A;  1W22 A;  3C10 A;  3LP4 A;  5HJA A;  5DC6 A;  2VQO A; 
#chains in the Genus database with same CATH homology
 3F06 A;  5G1A A;  3ZNS A;  4QA0 A;  3ZNR A;  1C3P A;  3MZ4 A;  5DC5 A;  5EF7 A;  4QA3 A;  5A2S A;  5G0Y A;  2V5W A;  3SFF A;  4ZUM A;  5ICN B;  1ZZ1 A;  5THU A;  3MZ3 A;  1C3S A;  4QA1 A;  1VKG A;  4BZ7 A;  5G0I A;  4ZUO A;  3EZP A;  5THV A;  5D1B A;  5G0G A;  5EFG A;  5EFN A;  5D1C A;  4CBT A;  4RN2 A;  2VQW G;  4BZ6 A;  4QA4 A;  2VQV A;  5G17 A;  5G10 A;  5IX0 A;  4ZUQ A;  3F0R A;  4BZ9 A;  5G0J A;  4QA6 A;  5DC8 A;  3Q9C A;  2VQJ A;  4BZ5 A;  4RN1 A;  3C0Z A;  2VQM A;  5EEN A;  5G11 A;  5THT A;  5IWG A;  3Q9B A;  5LI3 A;  1T64 A;  3MAX A;  4RN0 A;  5FUE A;  4LY1 A;  3MEN A;  4A69 A;  3EW8 A;  5G3W A;  4CBY A;  4ZUR A;  5G12 A;  3Q9F A;  5EFK B;  2VQQ A;  5EEI A;  5G0X A;  5EEM A;  3MZ7 A;  5EFJ D;  4QA2 A;  3F07 A;  3RQD A;  1ZZ3 A;  5D1D A;  5DC7 A;  5EFB D;  5FCW A;  4ZUP A;  5EFH A;  5G0H A;  1ZZ0 A;  5EF8 A;  5G1C A;  2V5X A;  4LXZ A;  5BWZ A;  2GH6 A;  5EEF A;  4ZUN A;  5EEK A;  3EZT A;  5THS A;  2VCG A;  4QA7 A;  5JI5 A;  3EWF A;  3Q9E A;  3MZ6 A;  3C0Y A;  4QA5 A;  1T69 A;  4BKX B;  4BZ8 A;  3SFH A;  5G13 A;  1T67 A;  4CQF A;  1C3R A;  1W22 A;  3C10 A;  5G1B A;  5DC6 A;  2VQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...