5G1AA

Bordetella alcaligenes hdah bound to pfsaha
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
370
structure length
369
Chain Sequence
b'HHAIGYVWNTLYGWVDTGTGSLAAANLTARMQPISHHLAHPDTKRRFHELVCASGQIEHLTPIAAVAATDADILRAHSAAHLENMKRVSNLPTGGDTGDGITMMGNGGLEIARLSAGGAVELTRRVATGELSAGYALVNPPGHHAPHNAAMGFCIFNNTSVAAGYARAVLGMERVAILDWDVHHGNGTQDIWWNDPSVLTISLHQHLCFPPDSGYSTERGAGNGHGYNINVPLPPGSGNAAYLHAMDQVVLPALRAYRPQLIIVGSGFDASMLDPLARMMVTADGFRQMARRTIDCAADICDGRIVFVQEGGYSPHYLPFCGLAVIEELTGVRSLPDPYHEFLAGMGGNTLLDAERAAIEIVPLLADIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE DEACETYLASE-LIKE AMIDOHYDROLASE
publication title The thermodynamic signature of ligand binding to histone deacetylase-like amidohydrolases is most sensitive to the flexibility in the L2-loop lining the active site pocket.
pubmed doi rcsb
source organism Alcaligenes
molecule tags Hydrolase
total genus 145
structure length 369
sequence length 370
chains with identical sequence B
ec nomenclature ec 3.5.1.4: Amidase.
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00850 Hist_deacetyl Histone deacetylase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.20 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Histone deacetylase domain 5g1aA00
5FCWA 5G0XA 5G17A 4RN2A 2VQJA 4BZ6A 4RN1A 5G1AA 5BWZA 1ZZ1A 1VKGA 3MAXA 4BZ7A 5DC6A 5G0JA 5G0HA 5THVA 3SFFA 5THUA 4CBTA 3MENA 3SFHA 1C3SA 5D1DA 5EEFA 1T64A 5EENA 4ZURA 5G12A 3ZNRA 5G13A 2VQVA 4ZUPA 4ZUOA 1ZZ0A 4QA6A 3F0RA 5G11A 5LI3A 1T69A 4ZUMA 4BKXB 1W22A 5EFJD 4ZUQA 2VQQA 3Q9EA 4BZ5A 3MZ6A 4ZUNA 4LY1A 5G0IA 5EEIA 5G10A 3EW8A 5G0GA 5THTA 3Q9FA 2GH6A 3C0YA 1T67A 5D1BA 2VQWG 5EFGA 4RN0A 5EFNA 5EFKB 5IWGA 5D1CA 3EZTA 5G0YA 3MZ4A 4LXZA 5ICNB 4QA2A 4QA4A 4CQFA 2VQMA 5EEMA 3C0ZA 3F06A 5G1BA 4CBYA 3F07A 5G1CA 5THSA 3MZ7A 2VQOA 5EF7A 5DC7A 3Q9BA 3EZPA 5FUEA 4A69A 3RQDA 4QA0A 1C3RA 3Q9CA 3ZNSA 2VCGA 4BZ9A 5JI5A 4QA5A 1C3PA 4QA1A 3C10A 3EWFA 1ZZ3A 2V5WA 4BZ8A 2V5XA 5EFHA 3MZ3A 5EF8A 5EEKA 5A2SA 5DC8A 4QA7A 5EFBD 5IX0A 5DC5A 4QA3A 5G3WA
chains in the Genus database with same CATH superfamily
5FCWA 5G0XA 4IU4A 5G17A 4Q3UA 4RN2A 2VQJA 1P8RA 2CEVA 3THJA 4BZ6A 4G3HA 4RN1A 5G1AA 5BWZA 1D3VA 3RLAA 1ZZ1A 1VKGA 3MAXA 4IE3A 4IXUA 4BZ7A 3LHLA 5DC6A 1P8QA 4MXRA 4ITYA 5G0HA 5G0JA 5THVA 4I06A 2PHOA 1WVBA 4HWWA 3SFFA 2PHAA 4RHJA 5THUA 3SL0A 4CBTA 3MENA 3MMRA 4Q3RC 3SFHA 1C3SA 5D1DA 3SKKA 5EEFA 1T64A 3E6VA 4Q3VA 5EENA 5CEVA 1WOGA 4ZURA 3DJ8A 5G12A 1GQ7A 5G13A 2VQVA 4ZUPA 3ZNRA 1T5FA 4ZUOA 3NIPA 1ZZ0A 1TBHA 4QA6A 3F0RA 1HQXA 4MYKA 1CEVA 1HQ5A 1TBJA 2PLLA 5HJ9A 4RHMA 5G11A 1T69A 5LI3A 4CEVA 4Q3QA 4ZUMA 3THHA 4BKXB 1W22A 3NIOA 3TF3A 4IU1A 1PQ3A 5EFJD 4ZUQA 1T4TA 1P8PA 1RLAA 2VQQA 3Q9EA 4RHKA 3MZ6A 4HXQA 4ZUNA 1HQFA 4GSZA 4LY1A 4BZ5A 5G0IA 1XFKA 5EEIA 5G10A 3GN0A 1P8OA 3EW8A 5G0GA 4RHIA 5THTA 3CEVA 3KV2A 3LP4A 4Q3PA 5RLAA 3Q9FA 2RLAA 3THEA 2GH6A 3E9BA 3C0YA 1T67A 5D1BA 1T4PA 4DZ4A 1TBLA 4Q41A 2VQWG 5EFGA 1ZPGA 4RN0A 1P8NA 4IXVA 5EFNA 2EIVA 2EF5A 5EFKB 4RHQA 5IWGA 5D1CA 4GSVA 1P8SA 4RLAA 3EZTA 3M1RA 5G0YA 3MZ4A 4MYFA 4LXZA 3SL1A 5ICNB 4QA2A 3E8ZA 4QA4A 1TA1A 1HQHA 3GMZA 3NIQA 1GQ6A 4IE2A 5HJAA 4CQFA 4GSMA 2VQMA 5EEMA 1ZPEA 3MFWA 1T5GA 1WOHA 3C0ZA 1WVAA 3F06A 5G1BA 4CBYA 3F07A 4MYNA 1P8MA 3TH7A 3LP7A 5G1CA 1HQGA 1WOIA 2EF4A 3SJTA 5THSA 4Q3SA 2ZAVA 2VQOA 3MZ7A 4IU0A 5EF7A 4FCKA 5DC7A 3Q9BA 1R1OA 3EZPA 5FUEA 4A69A 4MYLA 3RQDA 3PZLA 4IE1A 4QA0A 1C3RA 3Q9CA 3ZNSA 2VCGA 3MFVA 4BZ9A 4HZEA 4GWCA 5JI5A 1T4RA 4QA5A 3F80A 3E6KA 1C3PA 4QA1A 3C10A 3EWFA 4GWDA 1ZZ3A 2V5WA 4BZ8A 2V5XA 2A0MA 5EFHA 4IU5A 3MZ3A 5EF8A 2AEBA 5EEKA 1T4SA 5A2SA 5DC8A 4Q40A 4QA7A 4Q3TA 4Q3RA 5EFBD 4Q42A 4FCIA 5IX0A 3E8QA 4QA3A 5DC5A 3MJLA 4RHLA 5G3WA
chains in the Genus database with same CATH topology
5FCWA 5G0XA 5G17A 4RN2A 2VQJA 4BZ6A 4RN1A 5G1AA 5BWZA 1ZZ1A 1VKGA 3MAXA 4BZ7A 5DC6A 5G0JA 5G0HA 5THVA 3SFFA 5THUA 4CBTA 3MENA 3SFHA 1C3SA 5D1DA 5EEFA 1T64A 5EENA 4ZURA 5G12A 3ZNRA 5G13A 2VQVA 4ZUPA 4ZUOA 1ZZ0A 4QA6A 3F0RA 5G11A 5LI3A 1T69A 4ZUMA 4BKXB 1W22A 5EFJD 4ZUQA 2VQQA 3Q9EA 4BZ5A 3MZ6A 4ZUNA 4LY1A 5G0IA 5EEIA 5G10A 3EW8A 5G0GA 5THTA 3Q9FA 2GH6A 3C0YA 1T67A 5D1BA 2VQWG 5EFGA 4RN0A 5EFNA 5EFKB 5IWGA 5D1CA 3EZTA 5G0YA 3MZ4A 4LXZA 5ICNB 4QA2A 4QA4A 4CQFA 2VQMA 5EEMA 3C0ZA 3F06A 5G1BA 4CBYA 3F07A 5G1CA 5THSA 3MZ7A 2VQOA 5EF7A 5DC7A 3Q9BA 3EZPA 5FUEA 4A69A 3RQDA 4QA0A 1C3RA 3Q9CA 3ZNSA 2VCGA 4BZ9A 5JI5A 4QA5A 1C3PA 4QA1A 3C10A 3EWFA 1ZZ3A 2V5WA 4BZ8A 2V5XA 5EFHA 3MZ3A 5EF8A 5EEKA 5A2SA 5DC8A 4QA7A 5EFBD 5IX0A 5DC5A 4QA3A 5G3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FCW A;  5G0X A;  5G17 A;  4RN2 A;  2VQJ A;  4BZ6 A;  4RN1 A;  5G1A A;  5BWZ A;  1ZZ1 A;  1VKG A;  3MAX A;  4BZ7 A;  5DC6 A;  5G0J A;  5G0H A;  5THV A;  3SFF A;  5THU A;  4CBT A;  3MEN A;  3SFH A;  1C3S A;  5D1D A;  5EEF A;  1T64 A;  5EEN A;  4ZUR A;  5G12 A;  3ZNR A;  5G13 A;  2VQV A;  4ZUP A;  4ZUO A;  1ZZ0 A;  4QA6 A;  3F0R A;  5G11 A;  5LI3 A;  1T69 A;  4ZUM A;  4BKX B;  1W22 A;  5EFJ D;  4ZUQ A;  2VQQ A;  3Q9E A;  4BZ5 A;  3MZ6 A;  4ZUN A;  4LY1 A;  5G0I A;  5EEI A;  5G10 A;  3EW8 A;  5G0G A;  5THT A;  3Q9F A;  2GH6 A;  3C0Y A;  1T67 A;  5D1B A;  2VQW G;  5EFG A;  4RN0 A;  5EFN A;  5EFK B;  5IWG A;  5D1C A;  3EZT A;  5G0Y A;  3MZ4 A;  4LXZ A;  5ICN B;  4QA2 A;  4QA4 A;  4CQF A;  2VQM A;  5EEM A;  3C0Z A;  3F06 A;  5G1B A;  4CBY A;  3F07 A;  5G1C A;  5THS A;  3MZ7 A;  2VQO A;  5EF7 A;  5DC7 A;  3Q9B A;  3EZP A;  5FUE A;  4A69 A;  3RQD A;  4QA0 A;  1C3R A;  3Q9C A;  3ZNS A;  2VCG A;  4BZ9 A;  5JI5 A;  4QA5 A;  1C3P A;  4QA1 A;  3C10 A;  3EWF A;  1ZZ3 A;  2V5W A;  4BZ8 A;  2V5X A;  5EFH A;  3MZ3 A;  5EF8 A;  5EEK A;  5A2S A;  5DC8 A;  4QA7 A;  5EFB D;  5IX0 A;  5DC5 A;  4QA3 A;  5G3W A; 
#chains in the Genus database with same CATH topology
 5FCW A;  5G0X A;  4IU4 A;  5G17 A;  4Q3U A;  4RN2 A;  2VQJ A;  1P8R A;  2CEV A;  3THJ A;  4BZ6 A;  4G3H A;  4RN1 A;  5G1A A;  5BWZ A;  1D3V A;  3RLA A;  1ZZ1 A;  1VKG A;  3MAX A;  4IE3 A;  4IXU A;  4BZ7 A;  3LHL A;  5DC6 A;  1P8Q A;  4MXR A;  4ITY A;  5G0H A;  5G0J A;  5THV A;  4I06 A;  2PHO A;  1WVB A;  4HWW A;  3SFF A;  2PHA A;  4RHJ A;  5THU A;  3SL0 A;  4CBT A;  3MEN A;  3MMR A;  4Q3R C;  3SFH A;  1C3S A;  5D1D A;  3SKK A;  5EEF A;  1T64 A;  3E6V A;  4Q3V A;  5EEN A;  5CEV A;  1WOG A;  4ZUR A;  3DJ8 A;  5G12 A;  1GQ7 A;  5G13 A;  2VQV A;  4ZUP A;  3ZNR A;  1T5F A;  4ZUO A;  3NIP A;  1ZZ0 A;  1TBH A;  4QA6 A;  3F0R A;  1HQX A;  4MYK A;  1CEV A;  1HQ5 A;  1TBJ A;  2PLL A;  5HJ9 A;  4RHM A;  5G11 A;  1T69 A;  5LI3 A;  4CEV A;  4Q3Q A;  4ZUM A;  3THH A;  4BKX B;  1W22 A;  3NIO A;  3TF3 A;  4IU1 A;  1PQ3 A;  5EFJ D;  4ZUQ A;  1T4T A;  1P8P A;  1RLA A;  2VQQ A;  3Q9E A;  4RHK A;  3MZ6 A;  4HXQ A;  4ZUN A;  1HQF A;  4GSZ A;  4LY1 A;  4BZ5 A;  5G0I A;  1XFK A;  5EEI A;  5G10 A;  3GN0 A;  1P8O A;  3EW8 A;  5G0G A;  4RHI A;  5THT A;  3CEV A;  3KV2 A;  3LP4 A;  4Q3P A;  5RLA A;  3Q9F A;  2RLA A;  3THE A;  2GH6 A;  3E9B A;  3C0Y A;  1T67 A;  5D1B A;  1T4P A;  4DZ4 A;  1TBL A;  4Q41 A;  2VQW G;  5EFG A;  1ZPG A;  4RN0 A;  1P8N A;  4IXV A;  5EFN A;  2EIV A;  2EF5 A;  5EFK B;  4RHQ A;  5IWG A;  5D1C A;  4GSV A;  1P8S A;  4RLA A;  3EZT A;  3M1R A;  5G0Y A;  3MZ4 A;  4MYF A;  4LXZ A;  3SL1 A;  5ICN B;  4QA2 A;  3E8Z A;  4QA4 A;  1TA1 A;  1HQH A;  3GMZ A;  3NIQ A;  1GQ6 A;  4IE2 A;  5HJA A;  4CQF A;  4GSM A;  2VQM A;  5EEM A;  1ZPE A;  3MFW A;  1T5G A;  1WOH A;  3C0Z A;  1WVA A;  3F06 A;  5G1B A;  4CBY A;  3F07 A;  4MYN A;  1P8M A;  3TH7 A;  3LP7 A;  5G1C A;  1HQG A;  1WOI A;  2EF4 A;  3SJT A;  5THS A;  4Q3S A;  2ZAV A;  2VQO A;  3MZ7 A;  4IU0 A;  5EF7 A;  4FCK A;  5DC7 A;  3Q9B A;  1R1O A;  3EZP A;  5FUE A;  4A69 A;  4MYL A;  3RQD A;  3PZL A;  4IE1 A;  4QA0 A;  1C3R A;  3Q9C A;  3ZNS A;  2VCG A;  3MFV A;  4BZ9 A;  4HZE A;  4GWC A;  5JI5 A;  1T4R A;  4QA5 A;  3F80 A;  3E6K A;  1C3P A;  4QA1 A;  3C10 A;  3EWF A;  4GWD A;  1ZZ3 A;  2V5W A;  4BZ8 A;  2V5X A;  2A0M A;  5EFH A;  4IU5 A;  3MZ3 A;  5EF8 A;  2AEB A;  5EEK A;  1T4S A;  5A2S A;  5DC8 A;  4Q40 A;  4QA7 A;  4Q3T A;  4Q3R A;  5EFB D;  4Q42 A;  4FCI A;  5IX0 A;  3E8Q A;  4QA3 A;  5DC5 A;  3MJL A;  4RHL A;  5G3W A; 
#chains in the Genus database with same CATH homology
 5FCW A;  5G0X A;  5G17 A;  4RN2 A;  2VQJ A;  4BZ6 A;  4RN1 A;  5G1A A;  5BWZ A;  1ZZ1 A;  1VKG A;  3MAX A;  4BZ7 A;  5DC6 A;  5G0J A;  5G0H A;  5THV A;  3SFF A;  5THU A;  4CBT A;  3MEN A;  3SFH A;  1C3S A;  5D1D A;  5EEF A;  1T64 A;  5EEN A;  4ZUR A;  5G12 A;  3ZNR A;  5G13 A;  2VQV A;  4ZUP A;  4ZUO A;  1ZZ0 A;  4QA6 A;  3F0R A;  5G11 A;  5LI3 A;  1T69 A;  4ZUM A;  4BKX B;  1W22 A;  5EFJ D;  4ZUQ A;  2VQQ A;  3Q9E A;  4BZ5 A;  3MZ6 A;  4ZUN A;  4LY1 A;  5G0I A;  5EEI A;  5G10 A;  3EW8 A;  5G0G A;  5THT A;  3Q9F A;  2GH6 A;  3C0Y A;  1T67 A;  5D1B A;  2VQW G;  5EFG A;  4RN0 A;  5EFN A;  5EFK B;  5IWG A;  5D1C A;  3EZT A;  5G0Y A;  3MZ4 A;  4LXZ A;  5ICN B;  4QA2 A;  4QA4 A;  4CQF A;  2VQM A;  5EEM A;  3C0Z A;  3F06 A;  5G1B A;  4CBY A;  3F07 A;  5G1C A;  5THS A;  3MZ7 A;  2VQO A;  5EF7 A;  5DC7 A;  3Q9B A;  3EZP A;  5FUE A;  4A69 A;  3RQD A;  4QA0 A;  1C3R A;  3Q9C A;  3ZNS A;  2VCG A;  4BZ9 A;  5JI5 A;  4QA5 A;  1C3P A;  4QA1 A;  3C10 A;  3EWF A;  1ZZ3 A;  2V5W A;  4BZ8 A;  2V5X A;  5EFH A;  3MZ3 A;  5EF8 A;  5EEK A;  5A2S A;  5DC8 A;  4QA7 A;  5EFB D;  5IX0 A;  5DC5 A;  4QA3 A;  5G3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...