5G1BA

Bordetella alcaligenes hdah native
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
371
structure length
371
Chain Sequence
HHHAIGYVWNTLYGWVDTGTGSLAAANLTARMQPISHHLAHPDTKRRFHELVCASGQIEHLTPIAAVAATDADILRAHSAAHLENMKRVSNLPTGGDTGDGITMMGNGGLEIARLSAGGAVELTRRVATGELSAGYALVNPPGHHAPHNAAMGFCIFNNTSVAAGYARAVLGMERVAILDWDVHHGNGTQDIWWNDPSVLTISLHQHLCFPPDSGYSTERGAGNGHGYNINVPLPPGSGNAAYLHAMDQVVLPALRAYRPQLIIVGSGFDASMLDPLARMMVTADGFRQMARRTIDCAADICDGRIVFVQEGGYSPHYLPFCGLAVIEELTGVRSLPDPYHEFLAGMGGNTLLDAERAAIEEIVPLLADIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE DEACETYLASE-LIKE AMIDOHYDROLASE
publication title The thermodynamic signature of ligand binding to histone deacetylase-like amidohydrolases is most sensitive to the flexibility in the L2-loop lining the active site pocket.
pubmed doi rcsb
source organism Alcaligenes
molecule tags Hydrolase
total genus 139
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 3.5.1.4: Amidase.
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00850 Hist_deacetyl Histone deacetylase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.20 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Histone deacetylase domain 5g1bA00
5D1BA 3MENA 4QA7A 5EFHA 2VQWG 2VQMA 4CBTA 3Q9BA 3SFFA 5G0XA 3C0YA 1C3PA 4QA0A 5FUEA 5G0YA 5ICNB 5EFNA 5EF7A 3ZNSA 4ZUQA 2GH6A 5EFJD 5THVA 3F0RA 2V5XA 5G1BA 5THTA 4QA3A 5EFKB 4ZUMA 4RN1A 2VQOA 5EFBD 4QA5A 5EENA 5G11A 1C3SA 5G17A 1ZZ0A 5LI3A 3EWFA 5D1CA 5G1CA 3Q9FA 4LY1A 1T64A 2VQJA 1T67A 3EW8A 5DC8A 4ZURA 5G0GA 4RN2A 3Q9EA 3Q9CA 4A69A 4ZUOA 3C10A 1C3RA 3SFHA 5DC6A 5G12A 5D1DA 4QA4A 5G0JA 4RN0A 4QA6A 4ZUPA 5EEIA 4ZUNA 5EF8A 5EFGA 5A2SA 4CBYA 4QA2A 1VKGA 2VQVA 5G0IA 5THSA 1ZZ1A 1ZZ3A 4BZ5A 3ZNRA 3C0ZA 4BKXB 4BZ7A 5EEFA 5IWGA 5THUA 5G10A 5FCWA 3EZPA 1T69A 4CQFA 3RQDA 5G13A 5EEMA 5G3WA 4BZ6A 5JI5A 5G0HA 3MAXA 3F07A 5G1AA 5IX0A 3MZ3A 4BZ9A 5DC5A 4QA1A 3MZ4A 2V5WA 5DC7A 4LXZA 5BWZA 1W22A 5EEKA 3F06A 3EZTA 3MZ6A 2VQQA 3MZ7A 4BZ8A 2VCGA
chains in the Genus database with same CATH superfamily
4RHLA 3E9BA 2EF4A 3F80A 3LP4A 5D1BA 3E6KA 4Q41A 1TA1A 3MENA 4IU1A 1GQ7A 4IXUA 4MYLA 4QA7A 2VQWG 5EFHA 2VQMA 4DZ4A 4Q3SA 1P8OA 3MFVA 4FCKA 4IE2A 4CBTA 3Q9BA 4CEVA 1T4PA 1HQXA 3SFFA 3THJA 5G0XA 3C0YA 2ZAVA 1XFKA 4Q3PA 2CEVA 1C3PA 4QA0A 5FUEA 5G0YA 1ZPGA 4IU0A 1WVAA 1T4RA 1HQ5A 5ICNB 3E6VA 5EFNA 1GQ6A 5EF7A 4HXQA 3ZNSA 4ZUQA 2GH6A 3TF3A 5EFJD 4I06A 3MJLA 3RLAA 4Q3RA 5THVA 2V5XA 3F0RA 5G1BA 5THTA 4QA3A 3GMZA 3NIQA 4Q3UA 3SJTA 5EFKB 4ZUMA 4RN1A 2VQOA 3SL1A 4RHQA 1TBHA 5EFBD 4QA5A 4MXRA 1T4TA 5EENA 2PHOA 5G11A 5HJ9A 1C3SA 2PHAA 5G17A 2PLLA 1ZZ0A 4Q42A 3MMRA 5LI3A 4HWWA 1PQ3A 3EWFA 3NIPA 5D1CA 5G1CA 3Q9FA 1P8NA 4LY1A 4IXVA 1HQHA 5HJAA 4Q3RC 1T5FA 1T64A 1HQFA 3NIOA 4RHKA 2VQJA 5RLAA 3SKKA 1T67A 3EW8A 5DC8A 4G3HA 1TBJA 3THHA 4ZURA 5G0GA 4RN2A 3E8QA 3Q9EA 3Q9CA 4A69A 4ZUOA 3C10A 1C3RA 3SFHA 5DC6A 5G12A 4GSMA 3LHLA 5D1DA 2RLAA 3LP7A 4HZEA 4GSVA 4QA4A 5G0JA 1T4SA 4RN0A 4MYKA 4QA6A 4ZUPA 4Q3QA 1P8PA 4GSZA 5EEIA 1WOGA 4ZUNA 5EF8A 5EFGA 4RHIA 4RHJA 4RHMA 5A2SA 4CBYA 4IE1A 4QA2A 4ITYA 3TH7A 1VKGA 1WVBA 2VQVA 3E8ZA 3THEA 4GWDA 5G0IA 5THSA 1T5GA 1ZZ1A 1P8MA 1ZZ3A 3DJ8A 4BZ5A 1ZPEA 4RLAA 3ZNRA 2EIVA 3C0ZA 1D3VA 4BKXB 4IE3A 5EEFA 4BZ7A 4GWCA 1P8RA 5IWGA 5THUA 5G10A 5FCWA 3EZPA 1T69A 4CQFA 3RQDA 1P8QA 3M1RA 4IU4A 5G13A 5EEMA 5G3WA 1WOIA 1R1OA 4IU5A 4BZ6A 5JI5A 3CEVA 2EF5A 4Q40A 5G0HA 3MAXA 3F07A 5G1AA 3PZLA 4MYFA 4Q3TA 5IX0A 5CEVA 3MZ3A 4BZ9A 1WOHA 5DC5A 4Q3VA 4QA1A 3GN0A 3MZ4A 2V5WA 5DC7A 4LXZA 5BWZA 1TBLA 2A0MA 4FCIA 1CEVA 1W22A 3SL0A 2AEBA 3MFWA 1HQGA 5EEKA 4MYNA 1RLAA 1P8SA 3F06A 3EZTA 3KV2A 3MZ6A 2VQQA 3MZ7A 4BZ8A 2VCGA
chains in the Genus database with same CATH topology
5D1BA 3MENA 4QA7A 5EFHA 2VQWG 2VQMA 4CBTA 3Q9BA 3SFFA 5G0XA 3C0YA 1C3PA 4QA0A 5FUEA 5G0YA 5ICNB 5EFNA 5EF7A 3ZNSA 4ZUQA 2GH6A 5EFJD 5THVA 3F0RA 2V5XA 5G1BA 5THTA 4QA3A 5EFKB 4ZUMA 4RN1A 2VQOA 5EFBD 4QA5A 5EENA 5G11A 1C3SA 5G17A 1ZZ0A 5LI3A 3EWFA 5D1CA 5G1CA 3Q9FA 4LY1A 1T64A 2VQJA 1T67A 3EW8A 5DC8A 4ZURA 5G0GA 4RN2A 3Q9EA 3Q9CA 4A69A 4ZUOA 3C10A 1C3RA 3SFHA 5DC6A 5G12A 5D1DA 4QA4A 5G0JA 4RN0A 4QA6A 4ZUPA 5EEIA 4ZUNA 5EF8A 5EFGA 5A2SA 4CBYA 4QA2A 1VKGA 2VQVA 5G0IA 5THSA 1ZZ1A 1ZZ3A 4BZ5A 3ZNRA 3C0ZA 4BKXB 4BZ7A 5EEFA 5IWGA 5THUA 5G10A 5FCWA 3EZPA 1T69A 4CQFA 3RQDA 5G13A 5EEMA 5G3WA 4BZ6A 5JI5A 5G0HA 3MAXA 3F07A 5G1AA 5IX0A 3MZ3A 4BZ9A 5DC5A 4QA1A 3MZ4A 2V5WA 5DC7A 4LXZA 5BWZA 1W22A 5EEKA 3F06A 3EZTA 3MZ6A 2VQQA 3MZ7A 4BZ8A 2VCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D1B A;  3MEN A;  4QA7 A;  5EFH A;  2VQW G;  2VQM A;  4CBT A;  3Q9B A;  3SFF A;  5G0X A;  3C0Y A;  1C3P A;  4QA0 A;  5FUE A;  5G0Y A;  5ICN B;  5EFN A;  5EF7 A;  3ZNS A;  4ZUQ A;  2GH6 A;  5EFJ D;  5THV A;  3F0R A;  2V5X A;  5G1B A;  5THT A;  4QA3 A;  5EFK B;  4ZUM A;  4RN1 A;  2VQO A;  5EFB D;  4QA5 A;  5EEN A;  5G11 A;  1C3S A;  5G17 A;  1ZZ0 A;  5LI3 A;  3EWF A;  5D1C A;  5G1C A;  3Q9F A;  4LY1 A;  1T64 A;  2VQJ A;  1T67 A;  3EW8 A;  5DC8 A;  4ZUR A;  5G0G A;  4RN2 A;  3Q9E A;  3Q9C A;  4A69 A;  4ZUO A;  3C10 A;  1C3R A;  3SFH A;  5DC6 A;  5G12 A;  5D1D A;  4QA4 A;  5G0J A;  4RN0 A;  4QA6 A;  4ZUP A;  5EEI A;  4ZUN A;  5EF8 A;  5EFG A;  5A2S A;  4CBY A;  4QA2 A;  1VKG A;  2VQV A;  5G0I A;  5THS A;  1ZZ1 A;  1ZZ3 A;  4BZ5 A;  3ZNR A;  3C0Z A;  4BKX B;  4BZ7 A;  5EEF A;  5IWG A;  5THU A;  5G10 A;  5FCW A;  3EZP A;  1T69 A;  4CQF A;  3RQD A;  5G13 A;  5EEM A;  5G3W A;  4BZ6 A;  5JI5 A;  5G0H A;  3MAX A;  3F07 A;  5G1A A;  5IX0 A;  3MZ3 A;  4BZ9 A;  5DC5 A;  4QA1 A;  3MZ4 A;  2V5W A;  5DC7 A;  4LXZ A;  5BWZ A;  1W22 A;  5EEK A;  3F06 A;  3EZT A;  3MZ6 A;  2VQQ A;  3MZ7 A;  4BZ8 A;  2VCG A; 
#chains in the Genus database with same CATH topology
 4RHL A;  3E9B A;  2EF4 A;  3F80 A;  3LP4 A;  5D1B A;  3E6K A;  4Q41 A;  1TA1 A;  3MEN A;  4IU1 A;  1GQ7 A;  4IXU A;  4MYL A;  4QA7 A;  2VQW G;  5EFH A;  2VQM A;  4DZ4 A;  4Q3S A;  1P8O A;  3MFV A;  4FCK A;  4IE2 A;  4CBT A;  3Q9B A;  4CEV A;  1T4P A;  1HQX A;  3SFF A;  3THJ A;  5G0X A;  3C0Y A;  2ZAV A;  1XFK A;  4Q3P A;  2CEV A;  1C3P A;  4QA0 A;  5FUE A;  5G0Y A;  1ZPG A;  4IU0 A;  1WVA A;  1T4R A;  1HQ5 A;  5ICN B;  3E6V A;  5EFN A;  1GQ6 A;  5EF7 A;  4HXQ A;  3ZNS A;  4ZUQ A;  2GH6 A;  3TF3 A;  5EFJ D;  4I06 A;  3MJL A;  3RLA A;  4Q3R A;  5THV A;  2V5X A;  3F0R A;  5G1B A;  5THT A;  4QA3 A;  3GMZ A;  3NIQ A;  4Q3U A;  3SJT A;  5EFK B;  4ZUM A;  4RN1 A;  2VQO A;  3SL1 A;  4RHQ A;  1TBH A;  5EFB D;  4QA5 A;  4MXR A;  1T4T A;  5EEN A;  2PHO A;  5G11 A;  5HJ9 A;  1C3S A;  2PHA A;  5G17 A;  2PLL A;  1ZZ0 A;  4Q42 A;  3MMR A;  5LI3 A;  4HWW A;  1PQ3 A;  3EWF A;  3NIP A;  5D1C A;  5G1C A;  3Q9F A;  1P8N A;  4LY1 A;  4IXV A;  1HQH A;  5HJA A;  4Q3R C;  1T5F A;  1T64 A;  1HQF A;  3NIO A;  4RHK A;  2VQJ A;  5RLA A;  3SKK A;  1T67 A;  3EW8 A;  5DC8 A;  4G3H A;  1TBJ A;  3THH A;  4ZUR A;  5G0G A;  4RN2 A;  3E8Q A;  3Q9E A;  3Q9C A;  4A69 A;  4ZUO A;  3C10 A;  1C3R A;  3SFH A;  5DC6 A;  5G12 A;  4GSM A;  3LHL A;  5D1D A;  2RLA A;  3LP7 A;  4HZE A;  4GSV A;  4QA4 A;  5G0J A;  1T4S A;  4RN0 A;  4MYK A;  4QA6 A;  4ZUP A;  4Q3Q A;  1P8P A;  4GSZ A;  5EEI A;  1WOG A;  4ZUN A;  5EF8 A;  5EFG A;  4RHI A;  4RHJ A;  4RHM A;  5A2S A;  4CBY A;  4IE1 A;  4QA2 A;  4ITY A;  3TH7 A;  1VKG A;  1WVB A;  2VQV A;  3E8Z A;  3THE A;  4GWD A;  5G0I A;  5THS A;  1T5G A;  1ZZ1 A;  1P8M A;  1ZZ3 A;  3DJ8 A;  4BZ5 A;  1ZPE A;  4RLA A;  3ZNR A;  2EIV A;  3C0Z A;  1D3V A;  4BKX B;  4IE3 A;  5EEF A;  4BZ7 A;  4GWC A;  1P8R A;  5IWG A;  5THU A;  5G10 A;  5FCW A;  3EZP A;  1T69 A;  4CQF A;  3RQD A;  1P8Q A;  3M1R A;  4IU4 A;  5G13 A;  5EEM A;  5G3W A;  1WOI A;  1R1O A;  4IU5 A;  4BZ6 A;  5JI5 A;  3CEV A;  2EF5 A;  4Q40 A;  5G0H A;  3MAX A;  3F07 A;  5G1A A;  3PZL A;  4MYF A;  4Q3T A;  5IX0 A;  5CEV A;  3MZ3 A;  4BZ9 A;  1WOH A;  5DC5 A;  4Q3V A;  4QA1 A;  3GN0 A;  3MZ4 A;  2V5W A;  5DC7 A;  4LXZ A;  5BWZ A;  1TBL A;  2A0M A;  4FCI A;  1CEV A;  1W22 A;  3SL0 A;  2AEB A;  3MFW A;  1HQG A;  5EEK A;  4MYN A;  1RLA A;  1P8S A;  3F06 A;  3EZT A;  3KV2 A;  3MZ6 A;  2VQQ A;  3MZ7 A;  4BZ8 A;  2VCG A; 
#chains in the Genus database with same CATH homology
 5D1B A;  3MEN A;  4QA7 A;  5EFH A;  2VQW G;  2VQM A;  4CBT A;  3Q9B A;  3SFF A;  5G0X A;  3C0Y A;  1C3P A;  4QA0 A;  5FUE A;  5G0Y A;  5ICN B;  5EFN A;  5EF7 A;  3ZNS A;  4ZUQ A;  2GH6 A;  5EFJ D;  5THV A;  3F0R A;  2V5X A;  5G1B A;  5THT A;  4QA3 A;  5EFK B;  4ZUM A;  4RN1 A;  2VQO A;  5EFB D;  4QA5 A;  5EEN A;  5G11 A;  1C3S A;  5G17 A;  1ZZ0 A;  5LI3 A;  3EWF A;  5D1C A;  5G1C A;  3Q9F A;  4LY1 A;  1T64 A;  2VQJ A;  1T67 A;  3EW8 A;  5DC8 A;  4ZUR A;  5G0G A;  4RN2 A;  3Q9E A;  3Q9C A;  4A69 A;  4ZUO A;  3C10 A;  1C3R A;  3SFH A;  5DC6 A;  5G12 A;  5D1D A;  4QA4 A;  5G0J A;  4RN0 A;  4QA6 A;  4ZUP A;  5EEI A;  4ZUN A;  5EF8 A;  5EFG A;  5A2S A;  4CBY A;  4QA2 A;  1VKG A;  2VQV A;  5G0I A;  5THS A;  1ZZ1 A;  1ZZ3 A;  4BZ5 A;  3ZNR A;  3C0Z A;  4BKX B;  4BZ7 A;  5EEF A;  5IWG A;  5THU A;  5G10 A;  5FCW A;  3EZP A;  1T69 A;  4CQF A;  3RQD A;  5G13 A;  5EEM A;  5G3W A;  4BZ6 A;  5JI5 A;  5G0H A;  3MAX A;  3F07 A;  5G1A A;  5IX0 A;  3MZ3 A;  4BZ9 A;  5DC5 A;  4QA1 A;  3MZ4 A;  2V5W A;  5DC7 A;  4LXZ A;  5BWZ A;  1W22 A;  5EEK A;  3F06 A;  3EZT A;  3MZ6 A;  2VQQ A;  3MZ7 A;  4BZ8 A;  2VCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...