5G1QA

Compressed conformation of francisella tularensis clpp at 2.84 a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
190
structure length
181
Chain Sequence
LVPTVIEKTAGGERAFDIYSRLLKERIVFLNGEVNDHSANLVIAQLLFLESEDPDKDIYFYINSPGGMVTAGMGVYDTMQFIKPDVSTICIGLAASMGSLLLAGGAKGKRYSLPSSQIMIHQPLGEIHAKNILRIKDRLNKVLAHHTGQDLETIVKDTDRDNFMMADEAKAYGLIDHVIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Open and compressed conformations of Francisella tularensis ClpP.
pubmed doi rcsb
source organism Francisella tularensis
molecule tags Hydrolase
molecule keywords CLP PROTEASE PROTEOLYTIC SUBUNIT P
total genus 57
structure length 181
sequence length 190
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 5g1qA00
3FF6A 5DUCA 1JXZA 4FZWC 2Q34A 4I42A 3SWXA 2PPYA 3R6HA 4JFCA 4Z0MA 4JCQA 4B3JA 3U9TB 1FC9A 4FN8A 1WDLA 4ZDBA 1FC7A 3R9TA 3BPPA 3P2LA 2VREA 3SLLA 3Q1TA 1OD4A 2VSSA 2QQ3A 4NEKA 2VX2A 4JSBA 2J5IA 4U0GA 3T8BA 4OG1A 3HINA 2ZL3A 3T3WA 1TG6A 1TYFA 4JYJA 4FNDA 3T89A 5KDRA 3BF0A 4U19A 4LK5A 4ELWA 1XO6A 3G64A 4RCNA 3P85A 3U9RB 1K32A 3TRRA 3KTGA 5INFA 1UYTA 3R0OA 1UYRA 3V5IA 2ZQQA 3LKEA 2DEOA 2F9IB 1ON9A 3K50A 3QREA 2C8TA 4Q1IA 4MOUA 3ZW9A 3R9SA 3ZWAA 2VSSF 5DU4A 3KTKA 4G2RA 1VRGA 3K8XA 4KD6A 3PZKA 5DUFA 4NNQA 1WZ8A 5JBWA 4U18A 2W3PA 1EF8A 3QK8A 3BEZA 1ON3A 3MFMA 1Q51A 5E0NX 3NJDA 4WZ8B 5E0SA 3OC7A 1N6EA 5DL1A 3DJAA 4JYLA 3TT6A 4DI1A 3ZWBA 5DZKH 1HNUA 4FJWD 4HNKA 2J5GA 4RYFA 4JCSA 4FB8A 5IKLB 4GM2A 3N6RB 3MYBA 3OT6A 4U0HA 2EJ5A 3FDUA 3QMJA 5CTCA 4ZDDA 5DTPA 3KTIA 5JBXA 3RRVA 4U1AA 1XX4A 2CBYA 4Q0GA 2PBPA 5DU6A 4JWVA 4ZDEA 1Q52A 1J7XA 3QKAA 3GMAA 3KTHA 4ELSA 3TVWA 1SG4A 3HLN1 2FBMA 2Q35A 1WDKA 3R9QA 1Y7OA 4I52A 2CE3A 4JOTA 2J5IB 3TVUA 1XNYA 3STAA 4FNBA 2F6QA 4HC8A 3QYRA 4OLQA 4B3HA 2F9YB 2VSUC 3M6NA 4L6WA 3TLFA 1PJHA 4B3IA 1RJNA 3H81A 3H0SA 1O8UA 4F47A 2VSUE 3P5MA 3PE8A 3TV5A 2A81A 2J5SA 1FC6A 3MOYA 1YG8A 4MI2A 3GLMA 3ZW8A 4MXIA 1NZYA 3MT6A 3TZ3A 1XNVA 3GKBA 2F9IA 5G1QA 3GF7A 1EY3A 4GHNA 3IBBA 2FW2A 2DUBA 4WCZA 4U0GH 3QXIA 1N6DA 1K39A 2A7KA 3HE2A 3QXZA 1DCIA 4OMRA 2VSSE 3V5EA 3KTJA 3ISAA 4EMMA 3RSTA 4QFEA 5KDRB 3H0UA 3TT7A 3KQFA 2J5II 3Q7HA 5E0SH 3ST9A 3ZWCA 4YLHA 1XNWA 3PGQA 3T88A 4JCRA 1UIYA 2PG8A 4IZCA 5DTWA 1HZDA 1HNOA 2ZL4A 1EF9A 3T8AA 3I47A 1N6FA 5INIA 3RSIA 4K3WA 5INGA 2IEXA 4IZDA 2Q2XA 1YG6A 3Q0JA 5KJPA 4K2NA 2FZSA 3QWDA 5FUSA 2X24A 1UYSA 4EMLA 4I4ZA 4ZU2A 3U9SB 4KNPA 2J5GD 1DUBA 1FCFA 3HP0A 3H0QA 3L3SA 4JCTA 4FN7A 2VSUA 2HW5A 2NP9A 3M6MA 4KWBA 3GF3A 1SZOA 4K29A 1NZYB 3PEAA 1RJMA 5MGBA 1OD2A 2D3TA 1X0UA 3Q0GA 5DZKA 4ZDCA 5DKPA 2F6IA 5C90A 5C9GA 3H0JA 4JVTA 2ZL0A 3DORA 3OMEA 2A7SA 5G1SA 5FIFA 1MJ3A 3JU1A 3LAOA 5DU8A 4ZDFA 4L8KA 4WYOB 1PIXA 4JJTA 1WDMA 4QIIA 4EMPA 1W2XA 3H02A 2WTBA 2F9YA 2VSUF 4ELXA 3WG5A 4QIJA 1UYVA 5G1RA 5CTBA 2X58A 4FZWA 4ASIA 3HRXA 3IAVA 2ZQRA 3IB9A 2BZRA 4IZBA 3NJBA 2GTRA 2ZL2A 4RYFH 2UZFA 3VIVA 3TDCA 4KPKA
chains in the Genus database with same CATH superfamily
3FF6A 5DUCA 1JXZA 4FZWC 2Q34A 4I42A 3SWXA 2PPYA 3R6HA 4JFCA 4Z0MA 4JCQA 4B3JA 3U9TB 1FC9A 4FN8A 1WDLA 4ZDBA 1FC7A 3R9TA 3BPPA 3P2LA 2VREA 3SLLA 3Q1TA 1OD4A 2VSSA 2QQ3A 4NEKA 2VX2A 4JSBA 2J5IA 4U0GA 3T8BA 4OG1A 3HINA 2ZL3A 3T3WA 1TG6A 1TYFA 4JYJA 4FNDA 3T89A 5KDRA 3BF0A 4U19A 4LK5A 4ELWA 1XO6A 3G64A 4RCNA 3P85A 3U9RB 1K32A 3TRRA 3KTGA 5INFA 1UYTA 3R0OA 1UYRA 3V5IA 2ZQQA 3LKEA 2DEOA 2F9IB 1ON9A 3K50A 3QREA 2C8TA 4Q1IA 4MOUA 3ZW9A 3R9SA 3ZWAA 2VSSF 5DU4A 3KTKA 4G2RA 1VRGA 3K8XA 4KD6A 3PZKA 5DUFA 4NNQA 1WZ8A 5JBWA 4U18A 2W3PA 1EF8A 3QK8A 3BEZA 1ON3A 3MFMA 1Q51A 5E0NX 3NJDA 4WZ8B 5E0SA 3OC7A 1N6EA 5DL1A 3DJAA 4JYLA 3TT6A 4DI1A 3ZWBA 5DZKH 1HNUA 4FJWD 4HNKA 2J5GA 4RYFA 4JCSA 3BPTA 4FB8A 5IKLB 4GM2A 3N6RB 3MYBA 3OT6A 4U0HA 2EJ5A 3FDUA 3QMJA 5CTCA 4ZDDA 5DTPA 3KTIA 5JBXA 3RRVA 4U1AA 1XX4A 2CBYA 4Q0GA 2PBPA 5DU6A 4JWVA 4ZDEA 1Q52A 1J7XA 3QKAA 3GMAA 3KTHA 4ELSA 3TVWA 1SG4A 3HLN1 4J2UA 2FBMA 2Q35A 1WDKA 3R9QA 1Y7OA 4I52A 2CE3A 4JOTA 2J5IB 3TVUA 1XNYA 3STAA 4FNBA 2F6QA 4HC8A 3QYRA 4OLQA 4B3HA 2F9YB 2VSUC 3M6NA 4L6WA 3TLFA 1PJHA 4B3IA 1RJNA 3H81A 3H0SA 1O8UA 4F47A 2VSUE 3P5MA 3PE8A 3TV5A 2A81A 2J5SA 1FC6A 3MOYA 1YG8A 4MI2A 3GLMA 3ZW8A 4MXIA 1NZYA 3MT6A 3TZ3A 1XNVA 3GKBA 2F9IA 5G1QA 3GF7A 1EY3A 4GHNA 3IBBA 2FW2A 2DUBA 4WCZA 4U0GH 3QXIA 1N6DA 1K39A 2A7KA 3HE2A 3QXZA 1DCIA 4OMRA 2VSSE 3V5EA 3KTJA 3ISAA 4EMMA 3RSTA 4QFEA 5KDRB 3H0UA 3TT7A 3KQFA 2J5II 3Q7HA 5E0SH 3ST9A 3ZWCA 4YLHA 1XNWA 3PGQA 3T88A 4JCRA 1UIYA 2PG8A 4IZCA 5DTWA 1HZDA 1HNOA 2ZL4A 1EF9A 3T8AA 3I47A 1N6FA 5INIA 3RSIA 4K3WA 5INGA 2IEXA 4IZDA 2Q2XA 1YG6A 3Q0JA 5KJPA 4K2NA 2FZSA 3QWDA 5FUSA 2X24A 1UYSA 2YJGA 4EMLA 4I4ZA 4ZU2A 3U9SB 4KNPA 2J5GD 1DUBA 1FCFA 3HP0A 3H0QA 3L3SA 4JCTA 4FN7A 4NARA 2VSUA 2HW5A 2NP9A 3M6MA 5HUQA 4KWBA 3GF3A 1SZOA 4K29A 1NZYB 3PEAA 1RJMA 5MGBA 1OD2A 2D3TA 1X0UA 3Q0GA 5DZKA 4ZDCA 5DKPA 2F6IA 5C90A 5C9GA 3H0JA 4JVTA 2ZL0A 3DORA 3OMEA 2A7SA 5G1SA 5FIFA 1MJ3A 3JU1A 3LAOA 5DU8A 4HDTA 4ZDFA 4L8KA 4WYOB 1PIXA 4JJTA 1WDMA 4QIIA 4EMPA 1W2XA 3H02A 2WTBA 2F9YA 2VSUF 4ELXA 3WG5A 4QIJA 1UYVA 5G1RA 5CTBA 2X58A 4FZWA 4ASIA 3HRXA 3IAVA 2ZQRA 3IB9A 2BZRA 4IZBA 3NJBA 2GTRA 2ZL2A 4RYFH 2UZFA 3VIVA 3TDCA 4KPKA
chains in the Genus database with same CATH topology
3FF6A 5DUCA 1JXZA 4FZWC 2Q34A 4I42A 3SWXA 2PPYA 3R6HA 4JFCA 4Z0MA 4JCQA 4B3JA 3U9TB 1FC9A 4FN8A 1WDLA 4ZDBA 1FC7A 3R9TA 3BPPA 3P2LA 2VREA 3SLLA 3Q1TA 1OD4A 2VSSA 2QQ3A 4NEKA 2VX2A 4JSBA 2J5IA 4U0GA 3T8BA 4OG1A 3HINA 2ZL3A 3T3WA 1TG6A 1TYFA 4JYJA 4FNDA 3T89A 5KDRA 3BF0A 4U19A 4LK5A 4ELWA 1XO6A 3G64A 4RCNA 3P85A 3U9RB 1K32A 3TRRA 3KTGA 5INFA 1UYTA 3R0OA 1UYRA 3V5IA 2ZQQA 3LKEA 2DEOA 2F9IB 1ON9A 3K50A 3QREA 2C8TA 4Q1IA 4MOUA 3ZW9A 3R9SA 3ZWAA 2VSSF 5DU4A 3KTKA 4G2RA 1VRGA 3K8XA 4KD6A 3PZKA 5DUFA 4NNQA 1WZ8A 5JBWA 4U18A 2W3PA 1EF8A 3QK8A 3BEZA 1ON3A 3MFMA 1Q51A 5E0NX 3NJDA 4WZ8B 5E0SA 3OC7A 1N6EA 5DL1A 3DJAA 4JYLA 3TT6A 4DI1A 3ZWBA 5DZKH 1HNUA 4FJWD 4HNKA 2J5GA 4RYFA 4JCSA 3BPTA 4FB8A 5IKLB 4GM2A 3N6RB 3MYBA 3OT6A 4U0HA 2EJ5A 3FDUA 3QMJA 5CTCA 4ZDDA 5DTPA 3KTIA 5JBXA 3RRVA 4U1AA 1XX4A 2CBYA 4Q0GA 2PBPA 5DU6A 4JWVA 4ZDEA 1Q52A 1J7XA 3QKAA 3GMAA 3KTHA 4ELSA 3TVWA 1SG4A 3HLN1 4J2UA 2FBMA 2Q35A 1WDKA 3R9QA 1Y7OA 4I52A 2CE3A 4JOTA 2J5IB 3TVUA 1XNYA 3STAA 4FNBA 2F6QA 4HC8A 3QYRA 4OLQA 4B3HA 2F9YB 2VSUC 3M6NA 4L6WA 3TLFA 1PJHA 4B3IA 1RJNA 3H81A 3H0SA 1O8UA 4F47A 2VSUE 3P5MA 3PE8A 3TV5A 2A81A 2J5SA 1FC6A 3MOYA 1YG8A 4MI2A 3GLMA 3ZW8A 4MXIA 1NZYA 3MT6A 3TZ3A 1XNVA 3GKBA 2F9IA 5G1QA 3GF7A 1EY3A 4GHNA 3IBBA 2FW2A 2DUBA 4WCZA 4U0GH 3QXIA 1N6DA 1K39A 2A7KA 3HE2A 3QXZA 1DCIA 4OMRA 2VSSE 3V5EA 3KTJA 3ISAA 4EMMA 3RSTA 4QFEA 5KDRB 3H0UA 3TT7A 3KQFA 2J5II 3Q7HA 5E0SH 3ST9A 3ZWCA 4YLHA 1XNWA 3PGQA 3T88A 4JCRA 1UIYA 2PG8A 4IZCA 5DTWA 1HZDA 1HNOA 2ZL4A 1EF9A 3T8AA 3I47A 1N6FA 5INIA 3RSIA 4K3WA 5INGA 2IEXA 4IZDA 2Q2XA 1YG6A 3Q0JA 5KJPA 4K2NA 2FZSA 3QWDA 5FUSA 2X24A 1UYSA 2YJGA 4EMLA 4I4ZA 4ZU2A 3U9SB 4KNPA 2J5GD 1DUBA 1FCFA 3HP0A 3H0QA 3L3SA 4JCTA 4FN7A 4NARA 2VSUA 2HW5A 2NP9A 3M6MA 5HUQA 4KWBA 3GF3A 1SZOA 4K29A 1NZYB 3PEAA 1RJMA 5MGBA 1OD2A 2D3TA 1X0UA 3Q0GA 5DZKA 4ZDCA 5DKPA 2F6IA 5C90A 5C9GA 3H0JA 4JVTA 2ZL0A 3DORA 3OMEA 2A7SA 5G1SA 5FIFA 1MJ3A 3JU1A 3LAOA 5DU8A 4HDTA 4ZDFA 4L8KA 4WYOB 1PIXA 4JJTA 1WDMA 4QIIA 4EMPA 1W2XA 3H02A 2WTBA 2F9YA 2VSUF 4ELXA 3WG5A 4QIJA 1UYVA 5G1RA 5CTBA 2X58A 4FZWA 4ASIA 3HRXA 3IAVA 2ZQRA 3IB9A 2BZRA 4IZBA 3NJBA 2GTRA 2ZL2A 4RYFH 2UZFA 3VIVA 3TDCA 4KPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FF6 A;  5DUC A;  1JXZ A;  4FZW C;  2Q34 A;  4I42 A;  3SWX A;  2PPY A;  3R6H A;  4JFC A;  4Z0M A;  4JCQ A;  4B3J A;  3U9T B;  1FC9 A;  4FN8 A;  1WDL A;  4ZDB A;  1FC7 A;  3R9T A;  3BPP A;  3P2L A;  2VRE A;  3SLL A;  3Q1T A;  1OD4 A;  2VSS A;  2QQ3 A;  4NEK A;  2VX2 A;  4JSB A;  2J5I A;  4U0G A;  3T8B A;  4OG1 A;  3HIN A;  2ZL3 A;  3T3W A;  1TG6 A;  1TYF A;  4JYJ A;  4FND A;  3T89 A;  5KDR A;  3BF0 A;  4U19 A;  4LK5 A;  4ELW A;  1XO6 A;  3G64 A;  4RCN A;  3P85 A;  3U9R B;  1K32 A;  3TRR A;  3KTG A;  5INF A;  1UYT A;  3R0O A;  1UYR A;  3V5I A;  2ZQQ A;  3LKE A;  2DEO A;  2F9I B;  1ON9 A;  3K50 A;  3QRE A;  2C8T A;  4Q1I A;  4MOU A;  3ZW9 A;  3R9S A;  3ZWA A;  2VSS F;  5DU4 A;  3KTK A;  4G2R A;  1VRG A;  3K8X A;  4KD6 A;  3PZK A;  5DUF A;  4NNQ A;  1WZ8 A;  5JBW A;  4U18 A;  2W3P A;  1EF8 A;  3QK8 A;  3BEZ A;  1ON3 A;  3MFM A;  1Q51 A;  5E0N X;  3NJD A;  4WZ8 B;  5E0S A;  3OC7 A;  1N6E A;  5DL1 A;  3DJA A;  4JYL A;  3TT6 A;  4DI1 A;  3ZWB A;  5DZK H;  1HNU A;  4FJW D;  4HNK A;  2J5G A;  4RYF A;  4JCS A;  4FB8 A;  5IKL B;  4GM2 A;  3N6R B;  3MYB A;  3OT6 A;  4U0H A;  2EJ5 A;  3FDU A;  3QMJ A;  5CTC A;  4ZDD A;  5DTP A;  3KTI A;  5JBX A;  3RRV A;  4U1A A;  1XX4 A;  2CBY A;  4Q0G A;  2PBP A;  5DU6 A;  4JWV A;  4ZDE A;  1Q52 A;  1J7X A;  3QKA A;  3GMA A;  3KTH A;  4ELS A;  3TVW A;  1SG4 A;  3HLN 1;  2FBM A;  2Q35 A;  1WDK A;  3R9Q A;  1Y7O A;  4I52 A;  2CE3 A;  4JOT A;  2J5I B;  3TVU A;  1XNY A;  3STA A;  4FNB A;  2F6Q A;  4HC8 A;  3QYR A;  4OLQ A;  4B3H A;  2F9Y B;  2VSU C;  3M6N A;  4L6W A;  3TLF A;  1PJH A;  4B3I A;  1RJN A;  3H81 A;  3H0S A;  1O8U A;  4F47 A;  2VSU E;  3P5M A;  3PE8 A;  3TV5 A;  2A81 A;  2J5S A;  1FC6 A;  3MOY A;  1YG8 A;  4MI2 A;  3GLM A;  3ZW8 A;  4MXI A;  1NZY A;  3MT6 A;  3TZ3 A;  1XNV A;  3GKB A;  2F9I A;  5G1Q A;  3GF7 A;  1EY3 A;  4GHN A;  3IBB A;  2FW2 A;  2DUB A;  4WCZ A;  4U0G H;  3QXI A;  1N6D A;  1K39 A;  2A7K A;  3HE2 A;  3QXZ A;  1DCI A;  4OMR A;  2VSS E;  3V5E A;  3KTJ A;  3ISA A;  4EMM A;  3RST A;  4QFE A;  5KDR B;  3H0U A;  3TT7 A;  3KQF A;  2J5I I;  3Q7H A;  5E0S H;  3ST9 A;  3ZWC A;  4YLH A;  1XNW A;  3PGQ A;  3T88 A;  4JCR A;  1UIY A;  2PG8 A;  4IZC A;  5DTW A;  1HZD A;  1HNO A;  2ZL4 A;  1EF9 A;  3T8A A;  3I47 A;  1N6F A;  5INI A;  3RSI A;  4K3W A;  5ING A;  2IEX A;  4IZD A;  2Q2X A;  1YG6 A;  3Q0J A;  5KJP A;  4K2N A;  2FZS A;  3QWD A;  5FUS A;  2X24 A;  1UYS A;  4EML A;  4I4Z A;  4ZU2 A;  3U9S B;  4KNP A;  2J5G D;  1DUB A;  1FCF A;  3HP0 A;  3H0Q A;  3L3S A;  4JCT A;  4FN7 A;  2VSU A;  2HW5 A;  2NP9 A;  3M6M A;  4KWB A;  3GF3 A;  1SZO A;  4K29 A;  1NZY B;  3PEA A;  1RJM A;  5MGB A;  1OD2 A;  2D3T A;  1X0U A;  3Q0G A;  5DZK A;  4ZDC A;  5DKP A;  2F6I A;  5C90 A;  5C9G A;  3H0J A;  4JVT A;  2ZL0 A;  3DOR A;  3OME A;  2A7S A;  5G1S A;  5FIF A;  1MJ3 A;  3JU1 A;  3LAO A;  5DU8 A;  4ZDF A;  4L8K A;  4WYO B;  1PIX A;  4JJT A;  1WDM A;  4QII A;  4EMP A;  1W2X A;  3H02 A;  2WTB A;  2F9Y A;  2VSU F;  4ELX A;  3WG5 A;  4QIJ A;  1UYV A;  5G1R A;  5CTB A;  2X58 A;  4FZW A;  4ASI A;  3HRX A;  3IAV A;  2ZQR A;  3IB9 A;  2BZR A;  4IZB A;  3NJB A;  2GTR A;  2ZL2 A;  4RYF H;  2UZF A;  3VIV A;  3TDC A;  4KPK A; 
#chains in the Genus database with same CATH topology
 3FF6 A;  5DUC A;  1JXZ A;  4FZW C;  2Q34 A;  4I42 A;  3SWX A;  2PPY A;  3R6H A;  4JFC A;  4Z0M A;  4JCQ A;  4B3J A;  3U9T B;  1FC9 A;  4FN8 A;  1WDL A;  4ZDB A;  1FC7 A;  3R9T A;  3BPP A;  3P2L A;  2VRE A;  3SLL A;  3Q1T A;  1OD4 A;  2VSS A;  2QQ3 A;  4NEK A;  2VX2 A;  4JSB A;  2J5I A;  4U0G A;  3T8B A;  4OG1 A;  3HIN A;  2ZL3 A;  3T3W A;  1TG6 A;  1TYF A;  4JYJ A;  4FND A;  3T89 A;  5KDR A;  3BF0 A;  4U19 A;  4LK5 A;  4ELW A;  1XO6 A;  3G64 A;  4RCN A;  3P85 A;  3U9R B;  1K32 A;  3TRR A;  3KTG A;  5INF A;  1UYT A;  3R0O A;  1UYR A;  3V5I A;  2ZQQ A;  3LKE A;  2DEO A;  2F9I B;  1ON9 A;  3K50 A;  3QRE A;  2C8T A;  4Q1I A;  4MOU A;  3ZW9 A;  3R9S A;  3ZWA A;  2VSS F;  5DU4 A;  3KTK A;  4G2R A;  1VRG A;  3K8X A;  4KD6 A;  3PZK A;  5DUF A;  4NNQ A;  1WZ8 A;  5JBW A;  4U18 A;  2W3P A;  1EF8 A;  3QK8 A;  3BEZ A;  1ON3 A;  3MFM A;  1Q51 A;  5E0N X;  3NJD A;  4WZ8 B;  5E0S A;  3OC7 A;  1N6E A;  5DL1 A;  3DJA A;  4JYL A;  3TT6 A;  4DI1 A;  3ZWB A;  5DZK H;  1HNU A;  4FJW D;  4HNK A;  2J5G A;  4RYF A;  4JCS A;  3BPT A;  4FB8 A;  5IKL B;  4GM2 A;  3N6R B;  3MYB A;  3OT6 A;  4U0H A;  2EJ5 A;  3FDU A;  3QMJ A;  5CTC A;  4ZDD A;  5DTP A;  3KTI A;  5JBX A;  3RRV A;  4U1A A;  1XX4 A;  2CBY A;  4Q0G A;  2PBP A;  5DU6 A;  4JWV A;  4ZDE A;  1Q52 A;  1J7X A;  3QKA A;  3GMA A;  3KTH A;  4ELS A;  3TVW A;  1SG4 A;  3HLN 1;  4J2U A;  2FBM A;  2Q35 A;  1WDK A;  3R9Q A;  1Y7O A;  4I52 A;  2CE3 A;  4JOT A;  2J5I B;  3TVU A;  1XNY A;  3STA A;  4FNB A;  2F6Q A;  4HC8 A;  3QYR A;  4OLQ A;  4B3H A;  2F9Y B;  2VSU C;  3M6N A;  4L6W A;  3TLF A;  1PJH A;  4B3I A;  1RJN A;  3H81 A;  3H0S A;  1O8U A;  4F47 A;  2VSU E;  3P5M A;  3PE8 A;  3TV5 A;  2A81 A;  2J5S A;  1FC6 A;  3MOY A;  1YG8 A;  4MI2 A;  3GLM A;  3ZW8 A;  4MXI A;  1NZY A;  3MT6 A;  3TZ3 A;  1XNV A;  3GKB A;  2F9I A;  5G1Q A;  3GF7 A;  1EY3 A;  4GHN A;  3IBB A;  2FW2 A;  2DUB A;  4WCZ A;  4U0G H;  3QXI A;  1N6D A;  1K39 A;  2A7K A;  3HE2 A;  3QXZ A;  1DCI A;  4OMR A;  2VSS E;  3V5E A;  3KTJ A;  3ISA A;  4EMM A;  3RST A;  4QFE A;  5KDR B;  3H0U A;  3TT7 A;  3KQF A;  2J5I I;  3Q7H A;  5E0S H;  3ST9 A;  3ZWC A;  4YLH A;  1XNW A;  3PGQ A;  3T88 A;  4JCR A;  1UIY A;  2PG8 A;  4IZC A;  5DTW A;  1HZD A;  1HNO A;  2ZL4 A;  1EF9 A;  3T8A A;  3I47 A;  1N6F A;  5INI A;  3RSI A;  4K3W A;  5ING A;  2IEX A;  4IZD A;  2Q2X A;  1YG6 A;  3Q0J A;  5KJP A;  4K2N A;  2FZS A;  3QWD A;  5FUS A;  2X24 A;  1UYS A;  2YJG A;  4EML A;  4I4Z A;  4ZU2 A;  3U9S B;  4KNP A;  2J5G D;  1DUB A;  1FCF A;  3HP0 A;  3H0Q A;  3L3S A;  4JCT A;  4FN7 A;  4NAR A;  2VSU A;  2HW5 A;  2NP9 A;  3M6M A;  5HUQ A;  4KWB A;  3GF3 A;  1SZO A;  4K29 A;  1NZY B;  3PEA A;  1RJM A;  5MGB A;  1OD2 A;  2D3T A;  1X0U A;  3Q0G A;  5DZK A;  4ZDC A;  5DKP A;  2F6I A;  5C90 A;  5C9G A;  3H0J A;  4JVT A;  2ZL0 A;  3DOR A;  3OME A;  2A7S A;  5G1S A;  5FIF A;  1MJ3 A;  3JU1 A;  3LAO A;  5DU8 A;  4HDT A;  4ZDF A;  4L8K A;  4WYO B;  1PIX A;  4JJT A;  1WDM A;  4QII A;  4EMP A;  1W2X A;  3H02 A;  2WTB A;  2F9Y A;  2VSU F;  4ELX A;  3WG5 A;  4QIJ A;  1UYV A;  5G1R A;  5CTB A;  2X58 A;  4FZW A;  4ASI A;  3HRX A;  3IAV A;  2ZQR A;  3IB9 A;  2BZR A;  4IZB A;  3NJB A;  2GTR A;  2ZL2 A;  4RYF H;  2UZF A;  3VIV A;  3TDC A;  4KPK A; 
#chains in the Genus database with same CATH homology
 3FF6 A;  5DUC A;  1JXZ A;  4FZW C;  2Q34 A;  4I42 A;  3SWX A;  2PPY A;  3R6H A;  4JFC A;  4Z0M A;  4JCQ A;  4B3J A;  3U9T B;  1FC9 A;  4FN8 A;  1WDL A;  4ZDB A;  1FC7 A;  3R9T A;  3BPP A;  3P2L A;  2VRE A;  3SLL A;  3Q1T A;  1OD4 A;  2VSS A;  2QQ3 A;  4NEK A;  2VX2 A;  4JSB A;  2J5I A;  4U0G A;  3T8B A;  4OG1 A;  3HIN A;  2ZL3 A;  3T3W A;  1TG6 A;  1TYF A;  4JYJ A;  4FND A;  3T89 A;  5KDR A;  3BF0 A;  4U19 A;  4LK5 A;  4ELW A;  1XO6 A;  3G64 A;  4RCN A;  3P85 A;  3U9R B;  1K32 A;  3TRR A;  3KTG A;  5INF A;  1UYT A;  3R0O A;  1UYR A;  3V5I A;  2ZQQ A;  3LKE A;  2DEO A;  2F9I B;  1ON9 A;  3K50 A;  3QRE A;  2C8T A;  4Q1I A;  4MOU A;  3ZW9 A;  3R9S A;  3ZWA A;  2VSS F;  5DU4 A;  3KTK A;  4G2R A;  1VRG A;  3K8X A;  4KD6 A;  3PZK A;  5DUF A;  4NNQ A;  1WZ8 A;  5JBW A;  4U18 A;  2W3P A;  1EF8 A;  3QK8 A;  3BEZ A;  1ON3 A;  3MFM A;  1Q51 A;  5E0N X;  3NJD A;  4WZ8 B;  5E0S A;  3OC7 A;  1N6E A;  5DL1 A;  3DJA A;  4JYL A;  3TT6 A;  4DI1 A;  3ZWB A;  5DZK H;  1HNU A;  4FJW D;  4HNK A;  2J5G A;  4RYF A;  4JCS A;  3BPT A;  4FB8 A;  5IKL B;  4GM2 A;  3N6R B;  3MYB A;  3OT6 A;  4U0H A;  2EJ5 A;  3FDU A;  3QMJ A;  5CTC A;  4ZDD A;  5DTP A;  3KTI A;  5JBX A;  3RRV A;  4U1A A;  1XX4 A;  2CBY A;  4Q0G A;  2PBP A;  5DU6 A;  4JWV A;  4ZDE A;  1Q52 A;  1J7X A;  3QKA A;  3GMA A;  3KTH A;  4ELS A;  3TVW A;  1SG4 A;  3HLN 1;  4J2U A;  2FBM A;  2Q35 A;  1WDK A;  3R9Q A;  1Y7O A;  4I52 A;  2CE3 A;  4JOT A;  2J5I B;  3TVU A;  1XNY A;  3STA A;  4FNB A;  2F6Q A;  4HC8 A;  3QYR A;  4OLQ A;  4B3H A;  2F9Y B;  2VSU C;  3M6N A;  4L6W A;  3TLF A;  1PJH A;  4B3I A;  1RJN A;  3H81 A;  3H0S A;  1O8U A;  4F47 A;  2VSU E;  3P5M A;  3PE8 A;  3TV5 A;  2A81 A;  2J5S A;  1FC6 A;  3MOY A;  1YG8 A;  4MI2 A;  3GLM A;  3ZW8 A;  4MXI A;  1NZY A;  3MT6 A;  3TZ3 A;  1XNV A;  3GKB A;  2F9I A;  5G1Q A;  3GF7 A;  1EY3 A;  4GHN A;  3IBB A;  2FW2 A;  2DUB A;  4WCZ A;  4U0G H;  3QXI A;  1N6D A;  1K39 A;  2A7K A;  3HE2 A;  3QXZ A;  1DCI A;  4OMR A;  2VSS E;  3V5E A;  3KTJ A;  3ISA A;  4EMM A;  3RST A;  4QFE A;  5KDR B;  3H0U A;  3TT7 A;  3KQF A;  2J5I I;  3Q7H A;  5E0S H;  3ST9 A;  3ZWC A;  4YLH A;  1XNW A;  3PGQ A;  3T88 A;  4JCR A;  1UIY A;  2PG8 A;  4IZC A;  5DTW A;  1HZD A;  1HNO A;  2ZL4 A;  1EF9 A;  3T8A A;  3I47 A;  1N6F A;  5INI A;  3RSI A;  4K3W A;  5ING A;  2IEX A;  4IZD A;  2Q2X A;  1YG6 A;  3Q0J A;  5KJP A;  4K2N A;  2FZS A;  3QWD A;  5FUS A;  2X24 A;  1UYS A;  2YJG A;  4EML A;  4I4Z A;  4ZU2 A;  3U9S B;  4KNP A;  2J5G D;  1DUB A;  1FCF A;  3HP0 A;  3H0Q A;  3L3S A;  4JCT A;  4FN7 A;  4NAR A;  2VSU A;  2HW5 A;  2NP9 A;  3M6M A;  5HUQ A;  4KWB A;  3GF3 A;  1SZO A;  4K29 A;  1NZY B;  3PEA A;  1RJM A;  5MGB A;  1OD2 A;  2D3T A;  1X0U A;  3Q0G A;  5DZK A;  4ZDC A;  5DKP A;  2F6I A;  5C90 A;  5C9G A;  3H0J A;  4JVT A;  2ZL0 A;  3DOR A;  3OME A;  2A7S A;  5G1S A;  5FIF A;  1MJ3 A;  3JU1 A;  3LAO A;  5DU8 A;  4HDT A;  4ZDF A;  4L8K A;  4WYO B;  1PIX A;  4JJT A;  1WDM A;  4QII A;  4EMP A;  1W2X A;  3H02 A;  2WTB A;  2F9Y A;  2VSU F;  4ELX A;  3WG5 A;  4QIJ A;  1UYV A;  5G1R A;  5CTB A;  2X58 A;  4FZW A;  4ASI A;  3HRX A;  3IAV A;  2ZQR A;  3IB9 A;  2BZR A;  4IZB A;  3NJB A;  2GTR A;  2ZL2 A;  4RYF H;  2UZF A;  3VIV A;  3TDC A;  4KPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...