5G1QA

Compressed conformation of francisella tularensis clpp at 2.84 a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
190
structure length
181
Chain Sequence
LVPTVIEKTAGGERAFDIYSRLLKERIVFLNGEVNDHSANLVIAQLLFLESEDPDKDIYFYINSPGGMVTAGMGVYDTMQFIKPDVSTICIGLAASMGSLLLAGGAKGKRYSLPSSQIMIHQPLGEIHAKNILRIKDRLNKVLAHHTGQDLETIVKDTDRDNFMMADEAKAYGLIDHVIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Open and compressed conformations of Francisella tularensis ClpP.
pubmed doi rcsb
source organism Francisella tularensis
molecule tags Hydrolase
molecule keywords CLP PROTEASE PROTEOLYTIC SUBUNIT P
total genus 57
structure length 181
sequence length 190
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 5g1qA00
3QYRA 1DUBA 4B3IA 3ISAA 4ELSA 4IZDA 4RCNA 4K3WA 3K50A 3M6NA 3N6RB 5DZKH 2J5IA 1WDMA 4K2NA 4KD6A 3K8XA 3LAOA 4JCQA 4DI1A 2C8TA 3PE8A 2DEOA 1XNYA 1EF8A 2VX2A 2F9IA 2EJ5A 4U1AA 2BZRA 1X0UA 2VSUE 3KTHA 3NJDA 3OMEA 4EMMA 3U9SB 3HP0A 2ZQRA 5FUSA 3HE2A 3H0QA 5MGBA 2FZSA 4I4ZA 3KTIA 5DU4A 2W3PA 2J5GA 3GMAA 4F47A 1Q52A 1XX4A 3T8BA 5G1RA 2F9IB 5CTCA 1RJNA 4QIIA 3PGQA 1OD4A 3QREA 5C9GA 2F6QA 4B3HA 3Q0GA 1FCFA 4ZDBA 4YLHA 3U9TB 2D3TA 3TZ3A 4B3JA 5KDRA 3R0OA 1WDKA 4L8KA 3L3SA 1NZYB 5G1QA 3ZW8A 3QXZA 1OD2A 2PBPA 4Q0GA 4KWBA 1TG6A 3IBBA 4JCTA 4FNBA 3KTJA 3Q7HA 3BPPA 5JBXA 2A81A 3QKAA 2CBYA 2J5GD 4EMLA 2VSUF 3R9TA 4I42A 3M6MA 1K39A 3U9RB 3SWXA 1DCIA 3I47A 1Y7OA 3T8AA 1SZOA 1HZDA 3MYBA 4IZBA 5DU6A 3T89A 3Q0JA 3TT6A 4U19A 3TV5A 1ON3A 3ZWBA 5CTBA 4L6WA 1N6DA 2Q2XA 1FC9A 4ZDDA 3R9SA 3GLMA 3MOYA 2J5SA 2PPYA 3DJAA 4EMPA 2A7KA 3GF7A 3TDCA 3HRXA 4Z0MA 3TVUA 3NJBA 2WTBA 4NNQA 2Q35A 3IB9A 4U18A 1EF9A 3SLLA 3R6HA 1HNUA 5DTPA 4JVTA 2F9YA 2DUBA 1ON9A 3H0UA 2VSUA 4FJWD 2QQ3A 2ZL3A 3PZKA 4K29A 1EY3A 2Q34A 1SG4A 4NEKA 3OC7A 3V5EA 1UYRA 4OG1A 1FC6A 3H0JA 2VREA 4ZDFA 3QWDA 5DZKA 3KTKA 4GM2A 3H81A 3V5IA 4ZU2A 2ZQQA 5DUCA 5C90A 1PIXA 2PG8A 4ZDCA 3TT7A 1YG8A 5FIFA 3FDUA 5JBWA 4JYJA 4ELWA 4JFCA 4WYOB 1J7XA 5DL1A 3STAA 3PEAA 3P85A 3QMJA 2HW5A 2A7SA 2J5II 4FZWC 3ZWCA 2J5IB 4U0GA 3WG5A 3QK8A 3GF3A 1UYSA 4JWVA 4G2RA 2F9YB 2CE3A 4MXIA 4RYFH 1NZYA 4MOUA 1MJ3A 5E0NX 3QXIA 1XO6A 2F6IA 3VIVA 4OMRA 5INIA 2FBMA 4WZ8B 2VSSF 1XNVA 5DU8A 1Q51A 4HNKA 4JJTA 3TVWA 3OT6A 2FW2A 4RYFA 4LK5A 2IEXA 1YG6A 3KQFA 3RRVA 1XNWA 2VSSA 2ZL2A 3BEZA 3P2LA 3RSTA 3T3WA 5INFA 3ZWAA 4ASIA 2GTRA 2X58A 5DTWA 3Q1TA 4U0GH 1UIYA 1FC7A 1UYVA 5E0SH 1O8UA 1K32A 4ZDEA 5DUFA 4QFEA 4JOTA 4ELXA 3KTGA 5G1SA 1UYTA 2ZL0A 3H0SA 4FB8A 5KDRB 3DORA 5E0SA 4IZCA 4OLQA 3R9QA 4QIJA 1HNOA 4JCRA 4JYLA 4KPKA 4Q1IA 2VSUC 3JU1A 3ST9A 3RSIA 1W2XA 3TLFA 5IKLB 3HINA 4FZWA 4GHNA 2X24A 1RJMA 4FN7A 4MI2A 3G64A 3MFMA 2NP9A 3H02A 1TYFA 3FF6A 4JSBA 3LKEA 3IAVA 2VSSE 4U0HA 5DKPA 1WZ8A 3GKBA 4JCSA 4WCZA 1JXZA 4HC8A 2UZFA 4I52A 3MT6A 1N6EA 3TRRA 1VRGA 1N6FA 4FNDA 1WDLA 4KNPA 3HLN1 5INGA 2ZL4A 5KJPA 3BF0A 3P5MA 3T88A 1PJHA 4FN8A 3ZW9A
chains in the Genus database with same CATH superfamily
3QYRA 1DUBA 4B3IA 3ISAA 4ELSA 4IZDA 4RCNA 4K3WA 3K50A 3M6NA 3N6RB 5DZKH 2J5IA 1WDMA 4K2NA 4KD6A 3K8XA 3LAOA 4JCQA 4DI1A 2C8TA 3PE8A 2DEOA 1XNYA 1EF8A 2VX2A 2F9IA 2EJ5A 4U1AA 2BZRA 1X0UA 2VSUE 3KTHA 3NJDA 3OMEA 4EMMA 3U9SB 3HP0A 2ZQRA 5FUSA 3HE2A 3H0QA 5MGBA 2FZSA 4I4ZA 3KTIA 5DU4A 2W3PA 2J5GA 3GMAA 4F47A 1Q52A 1XX4A 3T8BA 5G1RA 2F9IB 5CTCA 1RJNA 4QIIA 3PGQA 1OD4A 3QREA 5C9GA 2F6QA 4B3HA 3Q0GA 1FCFA 4ZDBA 4YLHA 3U9TB 2D3TA 4J2UA 3TZ3A 4B3JA 5KDRA 3R0OA 1WDKA 4L8KA 3L3SA 1NZYB 5G1QA 3ZW8A 3QXZA 1OD2A 2PBPA 4Q0GA 4KWBA 1TG6A 3IBBA 4JCTA 4FNBA 3KTJA 3Q7HA 3BPPA 5JBXA 2A81A 3QKAA 2CBYA 2J5GD 4EMLA 2VSUF 3R9TA 4I42A 3M6MA 1K39A 3U9RB 3SWXA 1DCIA 3I47A 1Y7OA 3T8AA 1SZOA 1HZDA 3MYBA 4IZBA 5DU6A 3T89A 3Q0JA 3TT6A 4U19A 3TV5A 1ON3A 3ZWBA 5CTBA 4L6WA 1N6DA 2Q2XA 1FC9A 4ZDDA 3R9SA 3GLMA 3MOYA 2J5SA 2PPYA 3DJAA 4EMPA 2A7KA 3GF7A 3TDCA 3HRXA 4Z0MA 3TVUA 3NJBA 2WTBA 4NNQA 2Q35A 3IB9A 4U18A 2YJGA 1EF9A 3SLLA 3R6HA 1HNUA 5DTPA 4JVTA 2F9YA 2DUBA 1ON9A 3H0UA 2VSUA 4FJWD 2QQ3A 2ZL3A 3PZKA 4K29A 1EY3A 2Q34A 1SG4A 4NEKA 3OC7A 3V5EA 1UYRA 4OG1A 1FC6A 3H0JA 2VREA 4ZDFA 3QWDA 5DZKA 3KTKA 4GM2A 3H81A 3V5IA 4ZU2A 2ZQQA 5DUCA 5C90A 1PIXA 2PG8A 4ZDCA 3TT7A 1YG8A 5FIFA 3FDUA 5JBWA 4JYJA 4ELWA 4JFCA 4WYOB 1J7XA 5DL1A 3STAA 3PEAA 3P85A 3QMJA 2HW5A 2A7SA 2J5II 4FZWC 3ZWCA 2J5IB 4U0GA 3WG5A 3QK8A 3GF3A 1UYSA 4JWVA 4G2RA 2F9YB 4NARA 2CE3A 4MXIA 4RYFH 1NZYA 4MOUA 1MJ3A 5E0NX 3QXIA 1XO6A 2F6IA 3VIVA 3BPTA 4OMRA 5INIA 2FBMA 4WZ8B 2VSSF 1XNVA 5DU8A 1Q51A 4HNKA 4JJTA 3TVWA 3OT6A 2FW2A 4RYFA 4LK5A 2IEXA 1YG6A 3KQFA 3RRVA 1XNWA 2VSSA 2ZL2A 3BEZA 3P2LA 3RSTA 3T3WA 5INFA 3ZWAA 4ASIA 2GTRA 2X58A 5DTWA 3Q1TA 4U0GH 1UIYA 1FC7A 1UYVA 5E0SH 1O8UA 1K32A 4ZDEA 5DUFA 4QFEA 4JOTA 4ELXA 3KTGA 5G1SA 1UYTA 2ZL0A 3H0SA 4FB8A 5KDRB 3DORA 5E0SA 4IZCA 4OLQA 3R9QA 4QIJA 1HNOA 4JCRA 4JYLA 4KPKA 4Q1IA 2VSUC 3JU1A 3ST9A 3RSIA 1W2XA 3TLFA 5IKLB 3HINA 4FZWA 4GHNA 2X24A 1RJMA 4FN7A 4MI2A 3G64A 3MFMA 2NP9A 3H02A 5HUQA 1TYFA 3FF6A 4JSBA 3LKEA 3IAVA 2VSSE 4U0HA 5DKPA 1WZ8A 3GKBA 4JCSA 4WCZA 1JXZA 4HC8A 2UZFA 4I52A 3MT6A 1N6EA 3TRRA 1VRGA 1N6FA 4HDTA 4FNDA 1WDLA 4KNPA 3HLN1 5INGA 2ZL4A 5KJPA 3BF0A 3P5MA 3T88A 1PJHA 4FN8A 3ZW9A
chains in the Genus database with same CATH topology
3QYRA 1DUBA 4B3IA 3ISAA 4ELSA 4IZDA 4RCNA 4K3WA 3K50A 3M6NA 3N6RB 5DZKH 2J5IA 1WDMA 4K2NA 4KD6A 3K8XA 3LAOA 4JCQA 4DI1A 2C8TA 3PE8A 2DEOA 1XNYA 1EF8A 2VX2A 2F9IA 2EJ5A 4U1AA 2BZRA 1X0UA 2VSUE 3KTHA 3NJDA 3OMEA 4EMMA 3U9SB 3HP0A 2ZQRA 5FUSA 3HE2A 3H0QA 5MGBA 2FZSA 4I4ZA 3KTIA 5DU4A 2W3PA 2J5GA 3GMAA 4F47A 1Q52A 1XX4A 3T8BA 5G1RA 2F9IB 5CTCA 1RJNA 4QIIA 3PGQA 1OD4A 3QREA 5C9GA 2F6QA 4B3HA 3Q0GA 1FCFA 4ZDBA 4YLHA 3U9TB 2D3TA 4J2UA 3TZ3A 4B3JA 5KDRA 3R0OA 1WDKA 4L8KA 3L3SA 1NZYB 5G1QA 3ZW8A 3QXZA 1OD2A 2PBPA 4Q0GA 4KWBA 1TG6A 3IBBA 4JCTA 4FNBA 3KTJA 3Q7HA 3BPPA 5JBXA 2A81A 3QKAA 2CBYA 2J5GD 4EMLA 2VSUF 3R9TA 4I42A 3M6MA 1K39A 3U9RB 3SWXA 1DCIA 3I47A 1Y7OA 3T8AA 1SZOA 1HZDA 3MYBA 4IZBA 5DU6A 3T89A 3Q0JA 3TT6A 4U19A 3TV5A 1ON3A 3ZWBA 5CTBA 4L6WA 1N6DA 2Q2XA 1FC9A 4ZDDA 3R9SA 3GLMA 3MOYA 2J5SA 2PPYA 3DJAA 4EMPA 2A7KA 3GF7A 3TDCA 3HRXA 4Z0MA 3TVUA 3NJBA 2WTBA 4NNQA 2Q35A 3IB9A 4U18A 2YJGA 1EF9A 3SLLA 3R6HA 1HNUA 5DTPA 4JVTA 2F9YA 2DUBA 1ON9A 3H0UA 2VSUA 4FJWD 2QQ3A 2ZL3A 3PZKA 4K29A 1EY3A 2Q34A 1SG4A 4NEKA 3OC7A 3V5EA 1UYRA 4OG1A 1FC6A 3H0JA 2VREA 4ZDFA 3QWDA 5DZKA 3KTKA 4GM2A 3H81A 3V5IA 4ZU2A 2ZQQA 5DUCA 5C90A 1PIXA 2PG8A 4ZDCA 3TT7A 1YG8A 5FIFA 3FDUA 5JBWA 4JYJA 4ELWA 4JFCA 4WYOB 1J7XA 5DL1A 3STAA 3PEAA 3P85A 3QMJA 2HW5A 2A7SA 2J5II 4FZWC 3ZWCA 2J5IB 4U0GA 3WG5A 3QK8A 3GF3A 1UYSA 4JWVA 4G2RA 2F9YB 4NARA 2CE3A 4MXIA 4RYFH 1NZYA 4MOUA 1MJ3A 5E0NX 3QXIA 1XO6A 2F6IA 3VIVA 3BPTA 4OMRA 5INIA 2FBMA 4WZ8B 2VSSF 1XNVA 5DU8A 1Q51A 4HNKA 4JJTA 3TVWA 3OT6A 2FW2A 4RYFA 4LK5A 2IEXA 1YG6A 3KQFA 3RRVA 1XNWA 2VSSA 2ZL2A 3BEZA 3P2LA 3RSTA 3T3WA 5INFA 3ZWAA 4ASIA 2GTRA 2X58A 5DTWA 3Q1TA 4U0GH 1UIYA 1FC7A 1UYVA 5E0SH 1O8UA 1K32A 4ZDEA 5DUFA 4QFEA 4JOTA 4ELXA 3KTGA 5G1SA 1UYTA 2ZL0A 3H0SA 4FB8A 5KDRB 3DORA 5E0SA 4IZCA 4OLQA 3R9QA 4QIJA 1HNOA 4JCRA 4JYLA 4KPKA 4Q1IA 2VSUC 3JU1A 3ST9A 3RSIA 1W2XA 3TLFA 5IKLB 3HINA 4FZWA 4GHNA 2X24A 1RJMA 4FN7A 4MI2A 3G64A 3MFMA 2NP9A 3H02A 5HUQA 1TYFA 3FF6A 4JSBA 3LKEA 3IAVA 2VSSE 4U0HA 5DKPA 1WZ8A 3GKBA 4JCSA 4WCZA 1JXZA 4HC8A 2UZFA 4I52A 3MT6A 1N6EA 3TRRA 1VRGA 1N6FA 4HDTA 4FNDA 1WDLA 4KNPA 3HLN1 5INGA 2ZL4A 5KJPA 3BF0A 3P5MA 3T88A 1PJHA 4FN8A 3ZW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QYR A;  1DUB A;  4B3I A;  3ISA A;  4ELS A;  4IZD A;  4RCN A;  4K3W A;  3K50 A;  3M6N A;  3N6R B;  5DZK H;  2J5I A;  1WDM A;  4K2N A;  4KD6 A;  3K8X A;  3LAO A;  4JCQ A;  4DI1 A;  2C8T A;  3PE8 A;  2DEO A;  1XNY A;  1EF8 A;  2VX2 A;  2F9I A;  2EJ5 A;  4U1A A;  2BZR A;  1X0U A;  2VSU E;  3KTH A;  3NJD A;  3OME A;  4EMM A;  3U9S B;  3HP0 A;  2ZQR A;  5FUS A;  3HE2 A;  3H0Q A;  5MGB A;  2FZS A;  4I4Z A;  3KTI A;  5DU4 A;  2W3P A;  2J5G A;  3GMA A;  4F47 A;  1Q52 A;  1XX4 A;  3T8B A;  5G1R A;  2F9I B;  5CTC A;  1RJN A;  4QII A;  3PGQ A;  1OD4 A;  3QRE A;  5C9G A;  2F6Q A;  4B3H A;  3Q0G A;  1FCF A;  4ZDB A;  4YLH A;  3U9T B;  2D3T A;  3TZ3 A;  4B3J A;  5KDR A;  3R0O A;  1WDK A;  4L8K A;  3L3S A;  1NZY B;  5G1Q A;  3ZW8 A;  3QXZ A;  1OD2 A;  2PBP A;  4Q0G A;  4KWB A;  1TG6 A;  3IBB A;  4JCT A;  4FNB A;  3KTJ A;  3Q7H A;  3BPP A;  5JBX A;  2A81 A;  3QKA A;  2CBY A;  2J5G D;  4EML A;  2VSU F;  3R9T A;  4I42 A;  3M6M A;  1K39 A;  3U9R B;  3SWX A;  1DCI A;  3I47 A;  1Y7O A;  3T8A A;  1SZO A;  1HZD A;  3MYB A;  4IZB A;  5DU6 A;  3T89 A;  3Q0J A;  3TT6 A;  4U19 A;  3TV5 A;  1ON3 A;  3ZWB A;  5CTB A;  4L6W A;  1N6D A;  2Q2X A;  1FC9 A;  4ZDD A;  3R9S A;  3GLM A;  3MOY A;  2J5S A;  2PPY A;  3DJA A;  4EMP A;  2A7K A;  3GF7 A;  3TDC A;  3HRX A;  4Z0M A;  3TVU A;  3NJB A;  2WTB A;  4NNQ A;  2Q35 A;  3IB9 A;  4U18 A;  1EF9 A;  3SLL A;  3R6H A;  1HNU A;  5DTP A;  4JVT A;  2F9Y A;  2DUB A;  1ON9 A;  3H0U A;  2VSU A;  4FJW D;  2QQ3 A;  2ZL3 A;  3PZK A;  4K29 A;  1EY3 A;  2Q34 A;  1SG4 A;  4NEK A;  3OC7 A;  3V5E A;  1UYR A;  4OG1 A;  1FC6 A;  3H0J A;  2VRE A;  4ZDF A;  3QWD A;  5DZK A;  3KTK A;  4GM2 A;  3H81 A;  3V5I A;  4ZU2 A;  2ZQQ A;  5DUC A;  5C90 A;  1PIX A;  2PG8 A;  4ZDC A;  3TT7 A;  1YG8 A;  5FIF A;  3FDU A;  5JBW A;  4JYJ A;  4ELW A;  4JFC A;  4WYO B;  1J7X A;  5DL1 A;  3STA A;  3PEA A;  3P85 A;  3QMJ A;  2HW5 A;  2A7S A;  2J5I I;  4FZW C;  3ZWC A;  2J5I B;  4U0G A;  3WG5 A;  3QK8 A;  3GF3 A;  1UYS A;  4JWV A;  4G2R A;  2F9Y B;  2CE3 A;  4MXI A;  4RYF H;  1NZY A;  4MOU A;  1MJ3 A;  5E0N X;  3QXI A;  1XO6 A;  2F6I A;  3VIV A;  4OMR A;  5INI A;  2FBM A;  4WZ8 B;  2VSS F;  1XNV A;  5DU8 A;  1Q51 A;  4HNK A;  4JJT A;  3TVW A;  3OT6 A;  2FW2 A;  4RYF A;  4LK5 A;  2IEX A;  1YG6 A;  3KQF A;  3RRV A;  1XNW A;  2VSS A;  2ZL2 A;  3BEZ A;  3P2L A;  3RST A;  3T3W A;  5INF A;  3ZWA A;  4ASI A;  2GTR A;  2X58 A;  5DTW A;  3Q1T A;  4U0G H;  1UIY A;  1FC7 A;  1UYV A;  5E0S H;  1O8U A;  1K32 A;  4ZDE A;  5DUF A;  4QFE A;  4JOT A;  4ELX A;  3KTG A;  5G1S A;  1UYT A;  2ZL0 A;  3H0S A;  4FB8 A;  5KDR B;  3DOR A;  5E0S A;  4IZC A;  4OLQ A;  3R9Q A;  4QIJ A;  1HNO A;  4JCR A;  4JYL A;  4KPK A;  4Q1I A;  2VSU C;  3JU1 A;  3ST9 A;  3RSI A;  1W2X A;  3TLF A;  5IKL B;  3HIN A;  4FZW A;  4GHN A;  2X24 A;  1RJM A;  4FN7 A;  4MI2 A;  3G64 A;  3MFM A;  2NP9 A;  3H02 A;  1TYF A;  3FF6 A;  4JSB A;  3LKE A;  3IAV A;  2VSS E;  4U0H A;  5DKP A;  1WZ8 A;  3GKB A;  4JCS A;  4WCZ A;  1JXZ A;  4HC8 A;  2UZF A;  4I52 A;  3MT6 A;  1N6E A;  3TRR A;  1VRG A;  1N6F A;  4FND A;  1WDL A;  4KNP A;  3HLN 1;  5ING A;  2ZL4 A;  5KJP A;  3BF0 A;  3P5M A;  3T88 A;  1PJH A;  4FN8 A;  3ZW9 A; 
#chains in the Genus database with same CATH topology
 3QYR A;  1DUB A;  4B3I A;  3ISA A;  4ELS A;  4IZD A;  4RCN A;  4K3W A;  3K50 A;  3M6N A;  3N6R B;  5DZK H;  2J5I A;  1WDM A;  4K2N A;  4KD6 A;  3K8X A;  3LAO A;  4JCQ A;  4DI1 A;  2C8T A;  3PE8 A;  2DEO A;  1XNY A;  1EF8 A;  2VX2 A;  2F9I A;  2EJ5 A;  4U1A A;  2BZR A;  1X0U A;  2VSU E;  3KTH A;  3NJD A;  3OME A;  4EMM A;  3U9S B;  3HP0 A;  2ZQR A;  5FUS A;  3HE2 A;  3H0Q A;  5MGB A;  2FZS A;  4I4Z A;  3KTI A;  5DU4 A;  2W3P A;  2J5G A;  3GMA A;  4F47 A;  1Q52 A;  1XX4 A;  3T8B A;  5G1R A;  2F9I B;  5CTC A;  1RJN A;  4QII A;  3PGQ A;  1OD4 A;  3QRE A;  5C9G A;  2F6Q A;  4B3H A;  3Q0G A;  1FCF A;  4ZDB A;  4YLH A;  3U9T B;  2D3T A;  4J2U A;  3TZ3 A;  4B3J A;  5KDR A;  3R0O A;  1WDK A;  4L8K A;  3L3S A;  1NZY B;  5G1Q A;  3ZW8 A;  3QXZ A;  1OD2 A;  2PBP A;  4Q0G A;  4KWB A;  1TG6 A;  3IBB A;  4JCT A;  4FNB A;  3KTJ A;  3Q7H A;  3BPP A;  5JBX A;  2A81 A;  3QKA A;  2CBY A;  2J5G D;  4EML A;  2VSU F;  3R9T A;  4I42 A;  3M6M A;  1K39 A;  3U9R B;  3SWX A;  1DCI A;  3I47 A;  1Y7O A;  3T8A A;  1SZO A;  1HZD A;  3MYB A;  4IZB A;  5DU6 A;  3T89 A;  3Q0J A;  3TT6 A;  4U19 A;  3TV5 A;  1ON3 A;  3ZWB A;  5CTB A;  4L6W A;  1N6D A;  2Q2X A;  1FC9 A;  4ZDD A;  3R9S A;  3GLM A;  3MOY A;  2J5S A;  2PPY A;  3DJA A;  4EMP A;  2A7K A;  3GF7 A;  3TDC A;  3HRX A;  4Z0M A;  3TVU A;  3NJB A;  2WTB A;  4NNQ A;  2Q35 A;  3IB9 A;  4U18 A;  2YJG A;  1EF9 A;  3SLL A;  3R6H A;  1HNU A;  5DTP A;  4JVT A;  2F9Y A;  2DUB A;  1ON9 A;  3H0U A;  2VSU A;  4FJW D;  2QQ3 A;  2ZL3 A;  3PZK A;  4K29 A;  1EY3 A;  2Q34 A;  1SG4 A;  4NEK A;  3OC7 A;  3V5E A;  1UYR A;  4OG1 A;  1FC6 A;  3H0J A;  2VRE A;  4ZDF A;  3QWD A;  5DZK A;  3KTK A;  4GM2 A;  3H81 A;  3V5I A;  4ZU2 A;  2ZQQ A;  5DUC A;  5C90 A;  1PIX A;  2PG8 A;  4ZDC A;  3TT7 A;  1YG8 A;  5FIF A;  3FDU A;  5JBW A;  4JYJ A;  4ELW A;  4JFC A;  4WYO B;  1J7X A;  5DL1 A;  3STA A;  3PEA A;  3P85 A;  3QMJ A;  2HW5 A;  2A7S A;  2J5I I;  4FZW C;  3ZWC A;  2J5I B;  4U0G A;  3WG5 A;  3QK8 A;  3GF3 A;  1UYS A;  4JWV A;  4G2R A;  2F9Y B;  4NAR A;  2CE3 A;  4MXI A;  4RYF H;  1NZY A;  4MOU A;  1MJ3 A;  5E0N X;  3QXI A;  1XO6 A;  2F6I A;  3VIV A;  3BPT A;  4OMR A;  5INI A;  2FBM A;  4WZ8 B;  2VSS F;  1XNV A;  5DU8 A;  1Q51 A;  4HNK A;  4JJT A;  3TVW A;  3OT6 A;  2FW2 A;  4RYF A;  4LK5 A;  2IEX A;  1YG6 A;  3KQF A;  3RRV A;  1XNW A;  2VSS A;  2ZL2 A;  3BEZ A;  3P2L A;  3RST A;  3T3W A;  5INF A;  3ZWA A;  4ASI A;  2GTR A;  2X58 A;  5DTW A;  3Q1T A;  4U0G H;  1UIY A;  1FC7 A;  1UYV A;  5E0S H;  1O8U A;  1K32 A;  4ZDE A;  5DUF A;  4QFE A;  4JOT A;  4ELX A;  3KTG A;  5G1S A;  1UYT A;  2ZL0 A;  3H0S A;  4FB8 A;  5KDR B;  3DOR A;  5E0S A;  4IZC A;  4OLQ A;  3R9Q A;  4QIJ A;  1HNO A;  4JCR A;  4JYL A;  4KPK A;  4Q1I A;  2VSU C;  3JU1 A;  3ST9 A;  3RSI A;  1W2X A;  3TLF A;  5IKL B;  3HIN A;  4FZW A;  4GHN A;  2X24 A;  1RJM A;  4FN7 A;  4MI2 A;  3G64 A;  3MFM A;  2NP9 A;  3H02 A;  5HUQ A;  1TYF A;  3FF6 A;  4JSB A;  3LKE A;  3IAV A;  2VSS E;  4U0H A;  5DKP A;  1WZ8 A;  3GKB A;  4JCS A;  4WCZ A;  1JXZ A;  4HC8 A;  2UZF A;  4I52 A;  3MT6 A;  1N6E A;  3TRR A;  1VRG A;  1N6F A;  4HDT A;  4FND A;  1WDL A;  4KNP A;  3HLN 1;  5ING A;  2ZL4 A;  5KJP A;  3BF0 A;  3P5M A;  3T88 A;  1PJH A;  4FN8 A;  3ZW9 A; 
#chains in the Genus database with same CATH homology
 3QYR A;  1DUB A;  4B3I A;  3ISA A;  4ELS A;  4IZD A;  4RCN A;  4K3W A;  3K50 A;  3M6N A;  3N6R B;  5DZK H;  2J5I A;  1WDM A;  4K2N A;  4KD6 A;  3K8X A;  3LAO A;  4JCQ A;  4DI1 A;  2C8T A;  3PE8 A;  2DEO A;  1XNY A;  1EF8 A;  2VX2 A;  2F9I A;  2EJ5 A;  4U1A A;  2BZR A;  1X0U A;  2VSU E;  3KTH A;  3NJD A;  3OME A;  4EMM A;  3U9S B;  3HP0 A;  2ZQR A;  5FUS A;  3HE2 A;  3H0Q A;  5MGB A;  2FZS A;  4I4Z A;  3KTI A;  5DU4 A;  2W3P A;  2J5G A;  3GMA A;  4F47 A;  1Q52 A;  1XX4 A;  3T8B A;  5G1R A;  2F9I B;  5CTC A;  1RJN A;  4QII A;  3PGQ A;  1OD4 A;  3QRE A;  5C9G A;  2F6Q A;  4B3H A;  3Q0G A;  1FCF A;  4ZDB A;  4YLH A;  3U9T B;  2D3T A;  4J2U A;  3TZ3 A;  4B3J A;  5KDR A;  3R0O A;  1WDK A;  4L8K A;  3L3S A;  1NZY B;  5G1Q A;  3ZW8 A;  3QXZ A;  1OD2 A;  2PBP A;  4Q0G A;  4KWB A;  1TG6 A;  3IBB A;  4JCT A;  4FNB A;  3KTJ A;  3Q7H A;  3BPP A;  5JBX A;  2A81 A;  3QKA A;  2CBY A;  2J5G D;  4EML A;  2VSU F;  3R9T A;  4I42 A;  3M6M A;  1K39 A;  3U9R B;  3SWX A;  1DCI A;  3I47 A;  1Y7O A;  3T8A A;  1SZO A;  1HZD A;  3MYB A;  4IZB A;  5DU6 A;  3T89 A;  3Q0J A;  3TT6 A;  4U19 A;  3TV5 A;  1ON3 A;  3ZWB A;  5CTB A;  4L6W A;  1N6D A;  2Q2X A;  1FC9 A;  4ZDD A;  3R9S A;  3GLM A;  3MOY A;  2J5S A;  2PPY A;  3DJA A;  4EMP A;  2A7K A;  3GF7 A;  3TDC A;  3HRX A;  4Z0M A;  3TVU A;  3NJB A;  2WTB A;  4NNQ A;  2Q35 A;  3IB9 A;  4U18 A;  2YJG A;  1EF9 A;  3SLL A;  3R6H A;  1HNU A;  5DTP A;  4JVT A;  2F9Y A;  2DUB A;  1ON9 A;  3H0U A;  2VSU A;  4FJW D;  2QQ3 A;  2ZL3 A;  3PZK A;  4K29 A;  1EY3 A;  2Q34 A;  1SG4 A;  4NEK A;  3OC7 A;  3V5E A;  1UYR A;  4OG1 A;  1FC6 A;  3H0J A;  2VRE A;  4ZDF A;  3QWD A;  5DZK A;  3KTK A;  4GM2 A;  3H81 A;  3V5I A;  4ZU2 A;  2ZQQ A;  5DUC A;  5C90 A;  1PIX A;  2PG8 A;  4ZDC A;  3TT7 A;  1YG8 A;  5FIF A;  3FDU A;  5JBW A;  4JYJ A;  4ELW A;  4JFC A;  4WYO B;  1J7X A;  5DL1 A;  3STA A;  3PEA A;  3P85 A;  3QMJ A;  2HW5 A;  2A7S A;  2J5I I;  4FZW C;  3ZWC A;  2J5I B;  4U0G A;  3WG5 A;  3QK8 A;  3GF3 A;  1UYS A;  4JWV A;  4G2R A;  2F9Y B;  4NAR A;  2CE3 A;  4MXI A;  4RYF H;  1NZY A;  4MOU A;  1MJ3 A;  5E0N X;  3QXI A;  1XO6 A;  2F6I A;  3VIV A;  3BPT A;  4OMR A;  5INI A;  2FBM A;  4WZ8 B;  2VSS F;  1XNV A;  5DU8 A;  1Q51 A;  4HNK A;  4JJT A;  3TVW A;  3OT6 A;  2FW2 A;  4RYF A;  4LK5 A;  2IEX A;  1YG6 A;  3KQF A;  3RRV A;  1XNW A;  2VSS A;  2ZL2 A;  3BEZ A;  3P2L A;  3RST A;  3T3W A;  5INF A;  3ZWA A;  4ASI A;  2GTR A;  2X58 A;  5DTW A;  3Q1T A;  4U0G H;  1UIY A;  1FC7 A;  1UYV A;  5E0S H;  1O8U A;  1K32 A;  4ZDE A;  5DUF A;  4QFE A;  4JOT A;  4ELX A;  3KTG A;  5G1S A;  1UYT A;  2ZL0 A;  3H0S A;  4FB8 A;  5KDR B;  3DOR A;  5E0S A;  4IZC A;  4OLQ A;  3R9Q A;  4QIJ A;  1HNO A;  4JCR A;  4JYL A;  4KPK A;  4Q1I A;  2VSU C;  3JU1 A;  3ST9 A;  3RSI A;  1W2X A;  3TLF A;  5IKL B;  3HIN A;  4FZW A;  4GHN A;  2X24 A;  1RJM A;  4FN7 A;  4MI2 A;  3G64 A;  3MFM A;  2NP9 A;  3H02 A;  5HUQ A;  1TYF A;  3FF6 A;  4JSB A;  3LKE A;  3IAV A;  2VSS E;  4U0H A;  5DKP A;  1WZ8 A;  3GKB A;  4JCS A;  4WCZ A;  1JXZ A;  4HC8 A;  2UZF A;  4I52 A;  3MT6 A;  1N6E A;  3TRR A;  1VRG A;  1N6F A;  4HDT A;  4FND A;  1WDL A;  4KNP A;  3HLN 1;  5ING A;  2ZL4 A;  5KJP A;  3BF0 A;  3P5M A;  3T88 A;  1PJH A;  4FN8 A;  3ZW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...