5G1QA

Compressed conformation of francisella tularensis clpp at 2.84 a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
190
structure length
181
Chain Sequence
b'LVPTVIEKTAGGERAFDIYSRLLKERIVFLNGEVNDHSANLVIAQLLFLESEDPDKDIYFYINSPGGMVTAGMGVYDTMQFIKPDVSTICIGLAASMGSLLLAGGAKGKRYSLPSSQIMIHQPLGEIHAKNILRIKDRLNKVLAHHTGQDLETIVKDTDRDNFMMADEAKAYGLIDHVIES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLP PROTEASE PROTEOLYTIC SUBUNIT P
publication title Open and compressed conformations of Francisella tularensis ClpP.
pubmed doi rcsb
source organism Francisella tularensis
molecule tags Hydrolase
total genus 57
structure length 181
sequence length 190
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 5g1qA00
4Q0GA 4U18A 2CE3A 4JCQA 3P85A 1XNYA 2VSUC 2VX2A 3K50A 1UIYA 4KD6A 1OD2A 5KDRA 3NJDA 4ELSA 3TVUA 3TZ3A 4U0GH 5DKPA 2X24A 1XNVA 3ZWAA 3HINA 3U9TB 1O8UA 5DU8A 1FC6A 3Q0JA 3T8BA 4MXIA 3LKEA 4K2NA 4WYOB 4NEKA 3RSIA 3Q7HA 2PBPA 4B3IA 1Q52A 1DCIA 3G64A 1UYVA 3IBBA 5INIA 3BEZA 4HC8A 1N6FA 4FZWA 2X58A 3H0UA 4LK5A 4Z0MA 2FZSA 2A7KA 3M6NA 3P5MA 4RYFH 4U0GA 1XX4A 4U1AA 4JCRA 1N6DA 3TRRA 2VSUF 1MJ3A 2C8TA 3H0JA 1PIXA 3U9SB 1K32A 2F9IA 3IAVA 4FNBA 2Q34A 5KJPA 3Q0GA 3WG5A 3BPPA 5MGBA 3PZKA 3NJBA 3KTHA 2PPYA 4OMRA 2EJ5A 4WCZA 2DEOA 1EY3A 2J5IA 3H02A 3PE8A 4ELXA 1RJMA 3BF0A 2BZRA 3DORA 3KTIA 4L6WA 3HLN1 3ZW9A 4YLHA 5E0SA 2FBMA 2ZL0A 4EMPA 4JYLA 4ZU2A 4NNQA 3TT7A 4I42A 4QFEA 3KQFA 4ZDFA 2QQ3A 1Q51A 2VREA 2ZQRA 3OMEA 2J5GA 2VSUE 1EF9A 5INGA 5DUFA 5DZKH 3QREA 3GMAA 4OG1A 4FN8A 4IZBA 3PEAA 3MFMA 3KTKA 3RRVA 2ZL3A 4ZDBA 3V5IA 3ST9A 3K8XA 4ZDEA 3TLFA 4KNPA 3TDCA 4F47A 3DJAA 5CTCA 4ELWA 1TYFA 3MT6A 2GTRA 4JWVA 5DZKA 4U19A 1HNUA 3R9TA 2F9YB 2VSUA 3ZWCA 3KTGA 3TV5A 1ON3A 3FDUA 5G1RA 3V5EA 5DU6A 4I4ZA 2UZFA 1WDMA 3R6HA 4MI2A 3M6MA 3QXIA 4U0HA 4WZ8B 4ASIA 5FUSA 4B3JA 1XNWA 3I47A 3Q1TA 2J5GD 1EF8A 3T3WA 4ZDCA 3JU1A 1WDLA 1VRGA 4JFCA 3ZWBA 4FN7A 1NZYB 3QKAA 4RYFA 3TT6A 2ZL2A 3U9RB 5E0NX 4JJTA 5IKLB 1DUBA 3H0QA 3OT6A 4HNKA 2CBYA 5DTPA 4IZDA 2ZQQA 4QIJA 4ZDDA 3QXZA 3T88A 1OD4A 4EMMA 3RSTA 4IZCA 3P2LA 5G1QA 1XO6A 3SWXA 1TG6A 4L8KA 2DUBA 4FB8A 2IEXA 3OC7A 1YG6A 2F6IA 3R9SA 1YG8A 3QWDA 5DTWA 3QMJA 3L3SA 2A81A 3H81A 1N6EA 4FNDA 4JSBA 3PGQA 1X0UA 1J7XA 2VSSF 4FZWC 1Y7OA 4JOTA 3VIVA 3FF6A 3MOYA 5KDRB 3TVWA 1JXZA 3ISAA 4B3HA 1UYSA 3HP0A 5DU4A 5JBWA 1K39A 2F9YA 5C90A 2W3PA 4KWBA 3ZW8A 2HW5A 4RCNA 2J5II 3N6RB 3KTJA 4JVTA 3GF3A 3HRXA 3SLLA 3H0SA 5C9GA 2PG8A 1W2XA 5INFA 4KPKA 3GKBA 5JBXA 2Q2XA 4FJWD 3T89A 5DL1A 4OLQA 4Q1IA 1ON9A 2F6QA 3MYBA 4JCSA 5DUCA 2NP9A 3STAA 4K29A 1NZYA 3IB9A 4GM2A 2F9IB 5E0SH 2A7SA 3GLMA 1SZOA 2VSSE 1RJNA 1WZ8A 3HE2A 1SG4A 4K3WA 2J5SA 3QYRA 4QIIA 2WTBA 3GF7A 5CTBA 4GHNA 5G1SA 2J5IB 1WDKA 2D3TA 4JYJA 1FCFA 1HZDA 1FC7A 4JCTA 1UYRA 3LAOA 5FIFA 4EMLA 3R0OA 1HNOA 4G2RA 4I52A 1FC9A 3R9QA 3QK8A 2FW2A 2Q35A 4MOUA 3T8AA 2ZL4A 1UYTA 2VSSA 1PJHA 4DI1A
chains in the Genus database with same CATH superfamily
4Q0GA 4U18A 2CE3A 3BPTA 4JCQA 3P85A 1XNYA 2VSUC 2VX2A 3K50A 1UIYA 4KD6A 1OD2A 5KDRA 3NJDA 4ELSA 3TVUA 3TZ3A 4U0GH 5DKPA 2X24A 1XNVA 3ZWAA 3HINA 3U9TB 1O8UA 5DU8A 1FC6A 3Q0JA 3T8BA 4MXIA 3LKEA 4K2NA 4WYOB 4NEKA 3RSIA 3Q7HA 2PBPA 4B3IA 1Q52A 1DCIA 3G64A 1UYVA 3IBBA 5INIA 3BEZA 4HC8A 1N6FA 4FZWA 2X58A 3H0UA 4LK5A 4Z0MA 2FZSA 2A7KA 3M6NA 3P5MA 4RYFH 4U0GA 1XX4A 4U1AA 4JCRA 1N6DA 3TRRA 2VSUF 1MJ3A 2C8TA 3H0JA 1PIXA 3U9SB 1K32A 2F9IA 5HUQA 3IAVA 4FNBA 2Q34A 5KJPA 3Q0GA 3WG5A 3BPPA 4NARA 5MGBA 3PZKA 3NJBA 3KTHA 2PPYA 4OMRA 2EJ5A 4WCZA 2DEOA 1EY3A 2J5IA 3H02A 3PE8A 4ELXA 1RJMA 3BF0A 2BZRA 3DORA 3KTIA 4HDTA 4L6WA 3HLN1 3ZW9A 4YLHA 5E0SA 2FBMA 2ZL0A 4EMPA 4JYLA 4ZU2A 4NNQA 3TT7A 4I42A 4QFEA 3KQFA 4ZDFA 2QQ3A 1Q51A 2VREA 2ZQRA 3OMEA 2J5GA 2VSUE 1EF9A 5INGA 5DUFA 5DZKH 3QREA 3GMAA 4OG1A 4FN8A 4IZBA 3PEAA 3MFMA 3KTKA 3RRVA 2ZL3A 4ZDBA 3V5IA 3ST9A 3K8XA 4ZDEA 3TLFA 4KNPA 3TDCA 4F47A 3DJAA 5CTCA 4ELWA 1TYFA 3MT6A 2GTRA 4JWVA 5DZKA 4U19A 1HNUA 3R9TA 2F9YB 2VSUA 3ZWCA 3KTGA 3TV5A 1ON3A 3FDUA 5G1RA 3V5EA 5DU6A 2YJGA 4I4ZA 2UZFA 1WDMA 3R6HA 4MI2A 3M6MA 3QXIA 4U0HA 4WZ8B 4ASIA 5FUSA 4B3JA 1XNWA 3I47A 3Q1TA 2J5GD 1EF8A 3T3WA 4ZDCA 3JU1A 1WDLA 1VRGA 4JFCA 3ZWBA 4FN7A 1NZYB 3QKAA 4RYFA 3TT6A 2ZL2A 3U9RB 5E0NX 4JJTA 5IKLB 1DUBA 3H0QA 3OT6A 4HNKA 2CBYA 5DTPA 4IZDA 2ZQQA 4QIJA 4ZDDA 3QXZA 3T88A 1OD4A 4EMMA 3RSTA 4IZCA 3P2LA 5G1QA 1XO6A 3SWXA 1TG6A 4L8KA 2DUBA 4FB8A 2IEXA 3OC7A 1YG6A 2F6IA 3R9SA 1YG8A 3QWDA 5DTWA 3QMJA 3L3SA 2A81A 3H81A 1N6EA 4FNDA 4JSBA 3PGQA 1X0UA 1J7XA 2VSSF 4FZWC 1Y7OA 4JOTA 3VIVA 3FF6A 3MOYA 5KDRB 3TVWA 1JXZA 3ISAA 4B3HA 1UYSA 3HP0A 5DU4A 5JBWA 1K39A 2F9YA 5C90A 2W3PA 4KWBA 3ZW8A 2HW5A 4RCNA 2J5II 3N6RB 3KTJA 4JVTA 3GF3A 3HRXA 3SLLA 3H0SA 5C9GA 2PG8A 1W2XA 5INFA 4KPKA 3GKBA 5JBXA 2Q2XA 4FJWD 3T89A 5DL1A 4OLQA 4Q1IA 1ON9A 2F6QA 3MYBA 4JCSA 5DUCA 2NP9A 3STAA 4K29A 1NZYA 3IB9A 4GM2A 2F9IB 5E0SH 2A7SA 3GLMA 1SZOA 2VSSE 1RJNA 1WZ8A 3HE2A 1SG4A 4K3WA 2J5SA 3QYRA 4QIIA 2WTBA 3GF7A 5CTBA 4GHNA 5G1SA 2J5IB 1WDKA 2D3TA 4JYJA 1FCFA 1HZDA 1FC7A 4JCTA 1UYRA 3LAOA 4J2UA 5FIFA 4EMLA 3R0OA 1HNOA 4G2RA 4I52A 1FC9A 3R9QA 3QK8A 2FW2A 2Q35A 4MOUA 3T8AA 2ZL4A 1UYTA 2VSSA 1PJHA 4DI1A
chains in the Genus database with same CATH topology
4Q0GA 4U18A 2CE3A 3BPTA 4JCQA 3P85A 1XNYA 2VSUC 2VX2A 3K50A 1UIYA 4KD6A 1OD2A 5KDRA 3NJDA 4ELSA 3TVUA 3TZ3A 4U0GH 5DKPA 2X24A 1XNVA 3ZWAA 3HINA 3U9TB 1O8UA 5DU8A 1FC6A 3Q0JA 3T8BA 4MXIA 3LKEA 4K2NA 4WYOB 4NEKA 3RSIA 3Q7HA 2PBPA 4B3IA 1Q52A 1DCIA 3G64A 1UYVA 3IBBA 5INIA 3BEZA 4HC8A 1N6FA 4FZWA 2X58A 3H0UA 4LK5A 4Z0MA 2FZSA 2A7KA 3M6NA 3P5MA 4RYFH 4U0GA 1XX4A 4U1AA 4JCRA 1N6DA 3TRRA 2VSUF 1MJ3A 2C8TA 3H0JA 1PIXA 3U9SB 1K32A 2F9IA 5HUQA 3IAVA 4FNBA 2Q34A 5KJPA 3Q0GA 3WG5A 3BPPA 4NARA 5MGBA 3PZKA 3NJBA 3KTHA 2PPYA 4OMRA 2EJ5A 4WCZA 2DEOA 1EY3A 2J5IA 3H02A 3PE8A 4ELXA 1RJMA 3BF0A 2BZRA 3DORA 3KTIA 4HDTA 4L6WA 3HLN1 3ZW9A 4YLHA 5E0SA 2FBMA 2ZL0A 4EMPA 4JYLA 4ZU2A 4NNQA 3TT7A 4I42A 4QFEA 3KQFA 4ZDFA 2QQ3A 1Q51A 2VREA 2ZQRA 3OMEA 2J5GA 2VSUE 1EF9A 5INGA 5DUFA 5DZKH 3QREA 3GMAA 4OG1A 4FN8A 4IZBA 3PEAA 3MFMA 3KTKA 3RRVA 2ZL3A 4ZDBA 3V5IA 3ST9A 3K8XA 4ZDEA 3TLFA 4KNPA 3TDCA 4F47A 3DJAA 5CTCA 4ELWA 1TYFA 3MT6A 2GTRA 4JWVA 5DZKA 4U19A 1HNUA 3R9TA 2F9YB 2VSUA 3ZWCA 3KTGA 3TV5A 1ON3A 3FDUA 5G1RA 3V5EA 5DU6A 2YJGA 4I4ZA 2UZFA 1WDMA 3R6HA 4MI2A 3M6MA 3QXIA 4U0HA 4WZ8B 4ASIA 5FUSA 4B3JA 1XNWA 3I47A 3Q1TA 2J5GD 1EF8A 3T3WA 4ZDCA 3JU1A 1WDLA 1VRGA 4JFCA 3ZWBA 4FN7A 1NZYB 3QKAA 4RYFA 3TT6A 2ZL2A 3U9RB 5E0NX 4JJTA 5IKLB 1DUBA 3H0QA 3OT6A 4HNKA 2CBYA 5DTPA 4IZDA 2ZQQA 4QIJA 4ZDDA 3QXZA 3T88A 1OD4A 4EMMA 3RSTA 4IZCA 3P2LA 5G1QA 1XO6A 3SWXA 1TG6A 4L8KA 2DUBA 4FB8A 2IEXA 3OC7A 1YG6A 2F6IA 3R9SA 1YG8A 3QWDA 5DTWA 3QMJA 3L3SA 2A81A 3H81A 1N6EA 4FNDA 4JSBA 3PGQA 1X0UA 1J7XA 2VSSF 4FZWC 1Y7OA 4JOTA 3VIVA 3FF6A 3MOYA 5KDRB 3TVWA 1JXZA 3ISAA 4B3HA 1UYSA 3HP0A 5DU4A 5JBWA 1K39A 2F9YA 5C90A 2W3PA 4KWBA 3ZW8A 2HW5A 4RCNA 2J5II 3N6RB 3KTJA 4JVTA 3GF3A 3HRXA 3SLLA 3H0SA 5C9GA 2PG8A 1W2XA 5INFA 4KPKA 3GKBA 5JBXA 2Q2XA 4FJWD 3T89A 5DL1A 4OLQA 4Q1IA 1ON9A 2F6QA 3MYBA 4JCSA 5DUCA 2NP9A 3STAA 4K29A 1NZYA 3IB9A 4GM2A 2F9IB 5E0SH 2A7SA 3GLMA 1SZOA 2VSSE 1RJNA 1WZ8A 3HE2A 1SG4A 4K3WA 2J5SA 3QYRA 4QIIA 2WTBA 3GF7A 5CTBA 4GHNA 5G1SA 2J5IB 1WDKA 2D3TA 4JYJA 1FCFA 1HZDA 1FC7A 4JCTA 1UYRA 3LAOA 4J2UA 5FIFA 4EMLA 3R0OA 1HNOA 4G2RA 4I52A 1FC9A 3R9QA 3QK8A 2FW2A 2Q35A 4MOUA 3T8AA 2ZL4A 1UYTA 2VSSA 1PJHA 4DI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q0G A;  4U18 A;  2CE3 A;  4JCQ A;  3P85 A;  1XNY A;  2VSU C;  2VX2 A;  3K50 A;  1UIY A;  4KD6 A;  1OD2 A;  5KDR A;  3NJD A;  4ELS A;  3TVU A;  3TZ3 A;  4U0G H;  5DKP A;  2X24 A;  1XNV A;  3ZWA A;  3HIN A;  3U9T B;  1O8U A;  5DU8 A;  1FC6 A;  3Q0J A;  3T8B A;  4MXI A;  3LKE A;  4K2N A;  4WYO B;  4NEK A;  3RSI A;  3Q7H A;  2PBP A;  4B3I A;  1Q52 A;  1DCI A;  3G64 A;  1UYV A;  3IBB A;  5INI A;  3BEZ A;  4HC8 A;  1N6F A;  4FZW A;  2X58 A;  3H0U A;  4LK5 A;  4Z0M A;  2FZS A;  2A7K A;  3M6N A;  3P5M A;  4RYF H;  4U0G A;  1XX4 A;  4U1A A;  4JCR A;  1N6D A;  3TRR A;  2VSU F;  1MJ3 A;  2C8T A;  3H0J A;  1PIX A;  3U9S B;  1K32 A;  2F9I A;  3IAV A;  4FNB A;  2Q34 A;  5KJP A;  3Q0G A;  3WG5 A;  3BPP A;  5MGB A;  3PZK A;  3NJB A;  3KTH A;  2PPY A;  4OMR A;  2EJ5 A;  4WCZ A;  2DEO A;  1EY3 A;  2J5I A;  3H02 A;  3PE8 A;  4ELX A;  1RJM A;  3BF0 A;  2BZR A;  3DOR A;  3KTI A;  4L6W A;  3HLN 1;  3ZW9 A;  4YLH A;  5E0S A;  2FBM A;  2ZL0 A;  4EMP A;  4JYL A;  4ZU2 A;  4NNQ A;  3TT7 A;  4I42 A;  4QFE A;  3KQF A;  4ZDF A;  2QQ3 A;  1Q51 A;  2VRE A;  2ZQR A;  3OME A;  2J5G A;  2VSU E;  1EF9 A;  5ING A;  5DUF A;  5DZK H;  3QRE A;  3GMA A;  4OG1 A;  4FN8 A;  4IZB A;  3PEA A;  3MFM A;  3KTK A;  3RRV A;  2ZL3 A;  4ZDB A;  3V5I A;  3ST9 A;  3K8X A;  4ZDE A;  3TLF A;  4KNP A;  3TDC A;  4F47 A;  3DJA A;  5CTC A;  4ELW A;  1TYF A;  3MT6 A;  2GTR A;  4JWV A;  5DZK A;  4U19 A;  1HNU A;  3R9T A;  2F9Y B;  2VSU A;  3ZWC A;  3KTG A;  3TV5 A;  1ON3 A;  3FDU A;  5G1R A;  3V5E A;  5DU6 A;  4I4Z A;  2UZF A;  1WDM A;  3R6H A;  4MI2 A;  3M6M A;  3QXI A;  4U0H A;  4WZ8 B;  4ASI A;  5FUS A;  4B3J A;  1XNW A;  3I47 A;  3Q1T A;  2J5G D;  1EF8 A;  3T3W A;  4ZDC A;  3JU1 A;  1WDL A;  1VRG A;  4JFC A;  3ZWB A;  4FN7 A;  1NZY B;  3QKA A;  4RYF A;  3TT6 A;  2ZL2 A;  3U9R B;  5E0N X;  4JJT A;  5IKL B;  1DUB A;  3H0Q A;  3OT6 A;  4HNK A;  2CBY A;  5DTP A;  4IZD A;  2ZQQ A;  4QIJ A;  4ZDD A;  3QXZ A;  3T88 A;  1OD4 A;  4EMM A;  3RST A;  4IZC A;  3P2L A;  5G1Q A;  1XO6 A;  3SWX A;  1TG6 A;  4L8K A;  2DUB A;  4FB8 A;  2IEX A;  3OC7 A;  1YG6 A;  2F6I A;  3R9S A;  1YG8 A;  3QWD A;  5DTW A;  3QMJ A;  3L3S A;  2A81 A;  3H81 A;  1N6E A;  4FND A;  4JSB A;  3PGQ A;  1X0U A;  1J7X A;  2VSS F;  4FZW C;  1Y7O A;  4JOT A;  3VIV A;  3FF6 A;  3MOY A;  5KDR B;  3TVW A;  1JXZ A;  3ISA A;  4B3H A;  1UYS A;  3HP0 A;  5DU4 A;  5JBW A;  1K39 A;  2F9Y A;  5C90 A;  2W3P A;  4KWB A;  3ZW8 A;  2HW5 A;  4RCN A;  2J5I I;  3N6R B;  3KTJ A;  4JVT A;  3GF3 A;  3HRX A;  3SLL A;  3H0S A;  5C9G A;  2PG8 A;  1W2X A;  5INF A;  4KPK A;  3GKB A;  5JBX A;  2Q2X A;  4FJW D;  3T89 A;  5DL1 A;  4OLQ A;  4Q1I A;  1ON9 A;  2F6Q A;  3MYB A;  4JCS A;  5DUC A;  2NP9 A;  3STA A;  4K29 A;  1NZY A;  3IB9 A;  4GM2 A;  2F9I B;  5E0S H;  2A7S A;  3GLM A;  1SZO A;  2VSS E;  1RJN A;  1WZ8 A;  3HE2 A;  1SG4 A;  4K3W A;  2J5S A;  3QYR A;  4QII A;  2WTB A;  3GF7 A;  5CTB A;  4GHN A;  5G1S A;  2J5I B;  1WDK A;  2D3T A;  4JYJ A;  1FCF A;  1HZD A;  1FC7 A;  4JCT A;  1UYR A;  3LAO A;  5FIF A;  4EML A;  3R0O A;  1HNO A;  4G2R A;  4I52 A;  1FC9 A;  3R9Q A;  3QK8 A;  2FW2 A;  2Q35 A;  4MOU A;  3T8A A;  2ZL4 A;  1UYT A;  2VSS A;  1PJH A;  4DI1 A; 
#chains in the Genus database with same CATH topology
 4Q0G A;  4U18 A;  2CE3 A;  3BPT A;  4JCQ A;  3P85 A;  1XNY A;  2VSU C;  2VX2 A;  3K50 A;  1UIY A;  4KD6 A;  1OD2 A;  5KDR A;  3NJD A;  4ELS A;  3TVU A;  3TZ3 A;  4U0G H;  5DKP A;  2X24 A;  1XNV A;  3ZWA A;  3HIN A;  3U9T B;  1O8U A;  5DU8 A;  1FC6 A;  3Q0J A;  3T8B A;  4MXI A;  3LKE A;  4K2N A;  4WYO B;  4NEK A;  3RSI A;  3Q7H A;  2PBP A;  4B3I A;  1Q52 A;  1DCI A;  3G64 A;  1UYV A;  3IBB A;  5INI A;  3BEZ A;  4HC8 A;  1N6F A;  4FZW A;  2X58 A;  3H0U A;  4LK5 A;  4Z0M A;  2FZS A;  2A7K A;  3M6N A;  3P5M A;  4RYF H;  4U0G A;  1XX4 A;  4U1A A;  4JCR A;  1N6D A;  3TRR A;  2VSU F;  1MJ3 A;  2C8T A;  3H0J A;  1PIX A;  3U9S B;  1K32 A;  2F9I A;  5HUQ A;  3IAV A;  4FNB A;  2Q34 A;  5KJP A;  3Q0G A;  3WG5 A;  3BPP A;  4NAR A;  5MGB A;  3PZK A;  3NJB A;  3KTH A;  2PPY A;  4OMR A;  2EJ5 A;  4WCZ A;  2DEO A;  1EY3 A;  2J5I A;  3H02 A;  3PE8 A;  4ELX A;  1RJM A;  3BF0 A;  2BZR A;  3DOR A;  3KTI A;  4HDT A;  4L6W A;  3HLN 1;  3ZW9 A;  4YLH A;  5E0S A;  2FBM A;  2ZL0 A;  4EMP A;  4JYL A;  4ZU2 A;  4NNQ A;  3TT7 A;  4I42 A;  4QFE A;  3KQF A;  4ZDF A;  2QQ3 A;  1Q51 A;  2VRE A;  2ZQR A;  3OME A;  2J5G A;  2VSU E;  1EF9 A;  5ING A;  5DUF A;  5DZK H;  3QRE A;  3GMA A;  4OG1 A;  4FN8 A;  4IZB A;  3PEA A;  3MFM A;  3KTK A;  3RRV A;  2ZL3 A;  4ZDB A;  3V5I A;  3ST9 A;  3K8X A;  4ZDE A;  3TLF A;  4KNP A;  3TDC A;  4F47 A;  3DJA A;  5CTC A;  4ELW A;  1TYF A;  3MT6 A;  2GTR A;  4JWV A;  5DZK A;  4U19 A;  1HNU A;  3R9T A;  2F9Y B;  2VSU A;  3ZWC A;  3KTG A;  3TV5 A;  1ON3 A;  3FDU A;  5G1R A;  3V5E A;  5DU6 A;  2YJG A;  4I4Z A;  2UZF A;  1WDM A;  3R6H A;  4MI2 A;  3M6M A;  3QXI A;  4U0H A;  4WZ8 B;  4ASI A;  5FUS A;  4B3J A;  1XNW A;  3I47 A;  3Q1T A;  2J5G D;  1EF8 A;  3T3W A;  4ZDC A;  3JU1 A;  1WDL A;  1VRG A;  4JFC A;  3ZWB A;  4FN7 A;  1NZY B;  3QKA A;  4RYF A;  3TT6 A;  2ZL2 A;  3U9R B;  5E0N X;  4JJT A;  5IKL B;  1DUB A;  3H0Q A;  3OT6 A;  4HNK A;  2CBY A;  5DTP A;  4IZD A;  2ZQQ A;  4QIJ A;  4ZDD A;  3QXZ A;  3T88 A;  1OD4 A;  4EMM A;  3RST A;  4IZC A;  3P2L A;  5G1Q A;  1XO6 A;  3SWX A;  1TG6 A;  4L8K A;  2DUB A;  4FB8 A;  2IEX A;  3OC7 A;  1YG6 A;  2F6I A;  3R9S A;  1YG8 A;  3QWD A;  5DTW A;  3QMJ A;  3L3S A;  2A81 A;  3H81 A;  1N6E A;  4FND A;  4JSB A;  3PGQ A;  1X0U A;  1J7X A;  2VSS F;  4FZW C;  1Y7O A;  4JOT A;  3VIV A;  3FF6 A;  3MOY A;  5KDR B;  3TVW A;  1JXZ A;  3ISA A;  4B3H A;  1UYS A;  3HP0 A;  5DU4 A;  5JBW A;  1K39 A;  2F9Y A;  5C90 A;  2W3P A;  4KWB A;  3ZW8 A;  2HW5 A;  4RCN A;  2J5I I;  3N6R B;  3KTJ A;  4JVT A;  3GF3 A;  3HRX A;  3SLL A;  3H0S A;  5C9G A;  2PG8 A;  1W2X A;  5INF A;  4KPK A;  3GKB A;  5JBX A;  2Q2X A;  4FJW D;  3T89 A;  5DL1 A;  4OLQ A;  4Q1I A;  1ON9 A;  2F6Q A;  3MYB A;  4JCS A;  5DUC A;  2NP9 A;  3STA A;  4K29 A;  1NZY A;  3IB9 A;  4GM2 A;  2F9I B;  5E0S H;  2A7S A;  3GLM A;  1SZO A;  2VSS E;  1RJN A;  1WZ8 A;  3HE2 A;  1SG4 A;  4K3W A;  2J5S A;  3QYR A;  4QII A;  2WTB A;  3GF7 A;  5CTB A;  4GHN A;  5G1S A;  2J5I B;  1WDK A;  2D3T A;  4JYJ A;  1FCF A;  1HZD A;  1FC7 A;  4JCT A;  1UYR A;  3LAO A;  4J2U A;  5FIF A;  4EML A;  3R0O A;  1HNO A;  4G2R A;  4I52 A;  1FC9 A;  3R9Q A;  3QK8 A;  2FW2 A;  2Q35 A;  4MOU A;  3T8A A;  2ZL4 A;  1UYT A;  2VSS A;  1PJH A;  4DI1 A; 
#chains in the Genus database with same CATH homology
 4Q0G A;  4U18 A;  2CE3 A;  3BPT A;  4JCQ A;  3P85 A;  1XNY A;  2VSU C;  2VX2 A;  3K50 A;  1UIY A;  4KD6 A;  1OD2 A;  5KDR A;  3NJD A;  4ELS A;  3TVU A;  3TZ3 A;  4U0G H;  5DKP A;  2X24 A;  1XNV A;  3ZWA A;  3HIN A;  3U9T B;  1O8U A;  5DU8 A;  1FC6 A;  3Q0J A;  3T8B A;  4MXI A;  3LKE A;  4K2N A;  4WYO B;  4NEK A;  3RSI A;  3Q7H A;  2PBP A;  4B3I A;  1Q52 A;  1DCI A;  3G64 A;  1UYV A;  3IBB A;  5INI A;  3BEZ A;  4HC8 A;  1N6F A;  4FZW A;  2X58 A;  3H0U A;  4LK5 A;  4Z0M A;  2FZS A;  2A7K A;  3M6N A;  3P5M A;  4RYF H;  4U0G A;  1XX4 A;  4U1A A;  4JCR A;  1N6D A;  3TRR A;  2VSU F;  1MJ3 A;  2C8T A;  3H0J A;  1PIX A;  3U9S B;  1K32 A;  2F9I A;  5HUQ A;  3IAV A;  4FNB A;  2Q34 A;  5KJP A;  3Q0G A;  3WG5 A;  3BPP A;  4NAR A;  5MGB A;  3PZK A;  3NJB A;  3KTH A;  2PPY A;  4OMR A;  2EJ5 A;  4WCZ A;  2DEO A;  1EY3 A;  2J5I A;  3H02 A;  3PE8 A;  4ELX A;  1RJM A;  3BF0 A;  2BZR A;  3DOR A;  3KTI A;  4HDT A;  4L6W A;  3HLN 1;  3ZW9 A;  4YLH A;  5E0S A;  2FBM A;  2ZL0 A;  4EMP A;  4JYL A;  4ZU2 A;  4NNQ A;  3TT7 A;  4I42 A;  4QFE A;  3KQF A;  4ZDF A;  2QQ3 A;  1Q51 A;  2VRE A;  2ZQR A;  3OME A;  2J5G A;  2VSU E;  1EF9 A;  5ING A;  5DUF A;  5DZK H;  3QRE A;  3GMA A;  4OG1 A;  4FN8 A;  4IZB A;  3PEA A;  3MFM A;  3KTK A;  3RRV A;  2ZL3 A;  4ZDB A;  3V5I A;  3ST9 A;  3K8X A;  4ZDE A;  3TLF A;  4KNP A;  3TDC A;  4F47 A;  3DJA A;  5CTC A;  4ELW A;  1TYF A;  3MT6 A;  2GTR A;  4JWV A;  5DZK A;  4U19 A;  1HNU A;  3R9T A;  2F9Y B;  2VSU A;  3ZWC A;  3KTG A;  3TV5 A;  1ON3 A;  3FDU A;  5G1R A;  3V5E A;  5DU6 A;  2YJG A;  4I4Z A;  2UZF A;  1WDM A;  3R6H A;  4MI2 A;  3M6M A;  3QXI A;  4U0H A;  4WZ8 B;  4ASI A;  5FUS A;  4B3J A;  1XNW A;  3I47 A;  3Q1T A;  2J5G D;  1EF8 A;  3T3W A;  4ZDC A;  3JU1 A;  1WDL A;  1VRG A;  4JFC A;  3ZWB A;  4FN7 A;  1NZY B;  3QKA A;  4RYF A;  3TT6 A;  2ZL2 A;  3U9R B;  5E0N X;  4JJT A;  5IKL B;  1DUB A;  3H0Q A;  3OT6 A;  4HNK A;  2CBY A;  5DTP A;  4IZD A;  2ZQQ A;  4QIJ A;  4ZDD A;  3QXZ A;  3T88 A;  1OD4 A;  4EMM A;  3RST A;  4IZC A;  3P2L A;  5G1Q A;  1XO6 A;  3SWX A;  1TG6 A;  4L8K A;  2DUB A;  4FB8 A;  2IEX A;  3OC7 A;  1YG6 A;  2F6I A;  3R9S A;  1YG8 A;  3QWD A;  5DTW A;  3QMJ A;  3L3S A;  2A81 A;  3H81 A;  1N6E A;  4FND A;  4JSB A;  3PGQ A;  1X0U A;  1J7X A;  2VSS F;  4FZW C;  1Y7O A;  4JOT A;  3VIV A;  3FF6 A;  3MOY A;  5KDR B;  3TVW A;  1JXZ A;  3ISA A;  4B3H A;  1UYS A;  3HP0 A;  5DU4 A;  5JBW A;  1K39 A;  2F9Y A;  5C90 A;  2W3P A;  4KWB A;  3ZW8 A;  2HW5 A;  4RCN A;  2J5I I;  3N6R B;  3KTJ A;  4JVT A;  3GF3 A;  3HRX A;  3SLL A;  3H0S A;  5C9G A;  2PG8 A;  1W2X A;  5INF A;  4KPK A;  3GKB A;  5JBX A;  2Q2X A;  4FJW D;  3T89 A;  5DL1 A;  4OLQ A;  4Q1I A;  1ON9 A;  2F6Q A;  3MYB A;  4JCS A;  5DUC A;  2NP9 A;  3STA A;  4K29 A;  1NZY A;  3IB9 A;  4GM2 A;  2F9I B;  5E0S H;  2A7S A;  3GLM A;  1SZO A;  2VSS E;  1RJN A;  1WZ8 A;  3HE2 A;  1SG4 A;  4K3W A;  2J5S A;  3QYR A;  4QII A;  2WTB A;  3GF7 A;  5CTB A;  4GHN A;  5G1S A;  2J5I B;  1WDK A;  2D3T A;  4JYJ A;  1FCF A;  1HZD A;  1FC7 A;  4JCT A;  1UYR A;  3LAO A;  4J2U A;  5FIF A;  4EML A;  3R0O A;  1HNO A;  4G2R A;  4I52 A;  1FC9 A;  3R9Q A;  3QK8 A;  2FW2 A;  2Q35 A;  4MOU A;  3T8A A;  2ZL4 A;  1UYT A;  2VSS A;  1PJH A;  4DI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...