5G1ZA

Plasmodium vivax n-myristoyltransferase in complex with a quinoline inhibitor (compound 1)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
385
structure length
385
Chain Sequence
IDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided optimization of quinoline inhibitors of Plasmodium N-myristoyltransferase.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 116
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2016-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5g1zA00
4UFXA 4B12A 4B10A 5A28A 3IWEA 4CGNA 2WUUA 4UCMA 4C7IA 3IU2A 2YNEA 4A2ZA 5G22A 4CGOA 5AG4A 4A31A 4C2XA 3H5ZA 4UFVA 4CAFA 5AG7A 2YNDA 5AG5A 4A32A 4CGMA 4B14A 4C68A 4CGLA 2YNCC 4CYNA 4CYOA 4A30A 5AGEA 4CYQA 4BBHA 4UFWA 3JTKA 5G20A 4A95A 4B11A 4C2YA 4CYPA 4CAEA 5G21A 5G1ZA 4UCPA 4B13A 4C2ZA 2WSAA 5AG6A 4CGPA 5A27A 4C7HA 4A33A 4UCNA 3IU1A 2YNCA
chains in the Genus database with same CATH superfamily
3F5BA 4RUHA 2OZGA 3IWWA 4NGNA 4KLWA 1PUAA 3RO0A 2B5GA 1TXRA 3FMCA 4NGPA 4YWYA 3FH4A 2IJZA 3TE4A 2PJAA 4CAFA 1NSLA 2ZOFA 2JEVA 4OC5A 2J8MA 4KOVA 4A30A 1R43A 4ZY2A 3B3TA 5KTDA 4CAVA 4JYWA 2FSRA 5HXDA 4UCPA 2C6CA 3NFZA 3BXMA 3PFEA 4FD6A 4J3GA 2PJCA 4MHNA 4B5OA 2J9AA 4RN7A 2FL4A 4DJLA 3QNVA 4RS2A 2PIYA 1VHSA 5KTCA 3K9UA 2FXFA 2Q7BA 2JDCA 4BD9A 4O23A 5G22A 1WWZA 3FBUA 1MK4A 1TKFA 1Z5RA 2G3TA 3D66A 2G0BA 3V38A 2EUIA 2PJ3A 3SXOA 3LACA 4PXCA 5EBVA 4OC3A 3NA6A 1ELMP 2ZEOA 3DLJA 4OC2A 2GLFA 4XPDC 1A2ZA 1OZPA 1I12A 4GS4A 2IMOA 4OADA 4PQAA 2B4DA 1NSAA 1ZG9A 2PJ8A 3A9LA 3IGRA 4JZ0A 1XMTA 3KZWA 4IHMA 4CAWA 1IIDA 1AMPA 2JBJA 2OB0A 4PK3A 2I79A 2PVWA 1SQHA 2PJ1A 2C1CA 3D4UA 3V8IA 1LRZA 4UCNA 4YRHA 4MI4A 4EWTA 4P6YA 1F57A 4F9VA 1HDUA 2REFA 4UF4A 1XOVA 3GYAA 4UWJA 5H84A 5J1QA 4FD7A 4KVOE 1YREA 4A38A 1U6MA 3DNSA 1JQGA 1Z8LA 2CNSA 5IB9A 3NE7A 4X2TA 4AG9A 3KHZA 3MRUA 2VXKA 4XPDB 4F0YA 1KUXA 4XPKA 2PJ7A 1TF8A 3B3CA 3L2NA 2NMTA 4L89A 1CX8A 4NEXA 2K5TA 4ONUA 1Y9KA 1K4JA 2ATRA 4E0AA 3JUWA 5EC4A 2PDOA 3I1UA 2QVPA 4XPLA 2ZEEA 5HVFA 3SJXA 1CP6A 5I4MA 3F8KA 5ISVA 5K8OA 4B12A 2KCWA 4U9YA 4MFZA 3SI2A 4NJQA 4U9ZA 5CBMA 3FIXA 2PRQA 3MGDA 5K8PA 2PJ2A 4OC1A 2Q04A 4X8IA 4UEEA 2WPXA 4KVME 1YW4A 3TX8A 2OH1A 2ZW5A 4P45A 2POKA 1FT7A 2Z3LA 3KHXA 3NH8A 4CYPA 4ZY0A 5HVHA 2V8HA 1LAMA 1XRYA 2CNMA 4OKOA 4FUUA 4MBUA 3B8GA 1BPNA 2AJ6A 4IK2A 1UWYA 2ZELA 1ARLA 2C6PA 4MFJA 2EVNA 1VGYA 5BWAB 5KTAA 1XEBA 1BPMA 2QYVA 3HUVA 3NH5A 4B14A 2ZW7A 3TOAA 3T8WA 2HV2A 3T9YA 1I21A 1Q2CA 4A37A 5A28A 2ZW6A 3MN8A 2WUUA 3S6FA 8CPAA 2IL4A 1DTDA 2VL1A 2BL1A 4BMHA 2XEIA 1L0CA 5AG4A 2REEA 5FVJA 4CS0B 3DDDA 3N5FA 4M6HA 4MXUA 4B5PA 2ZEDA 7CPAA 1IOIA 3CDXA 2EO8A 3DGVA 2Q43A 4ONWA 4NF1A 4ZGYB 2PRBA 3PBBA 1Q7LA 1PCAA 4R57A 5AGEA 3W6SA 2ABZA 3ZZIA 2J8RA 2XEFA 2PJ5A 3P2HA 3FVLA 4DYOA 1P0HA 4LUAA 1S7FA 1Z8WA 4HNYB 3B7IA 3TTHA 2ZEGA 3DSBA 3TC8A 4DUKA 1S7NA 1F2PA 2DF5A 2FVGA 4NCZA 3GUXA 2ZENA 4P4DA 4ZYQA 3UY5A 3FX6A 3D68A 4A39A 3FXTA 3TCVA 2YNEA 1Y7EA 1S7LA 2EK9A 2A4NA 3H5ZA 3S6GA 2ZEFA 4LX9A 4F6AA 3KR4A 4H6UA 3PEIA 4MY0A 4CYNA 4CGMA 2PSWA 4RI1A 2R7HA 1X10A 4EMEA 4QC6A 3EXNA 3H4QA 1CP7A 4F8ZA 3CXQA 3FNCA 2VI7A 3RYOA 1QQ9A 1ZLIA 4AXVA 4MY3A 4TWEA 1KUVA 4B13A 4FD5A 1LOKA 3S6HA 2O4HA 4MCPA 1RTQA 3SI0A 3B3SA 2FIWA 4IF5A 3NE8A 4NGTA 5JGFA 1KWMA 2D4OA 4UEZA 2PR1A 3B3WA 3WR7A 3LODA 4EVYA 3CXSA 1QSTA 2HB6A 2ODFA 3JVNA 5H86A 1Y0YA 4AVAA 3KI9A 2QJ8A 2FS5A 3VWEA 1Q2DA 1IU8A 3KL9A 4CYOA 2CIJA 1ON0A 1UFHA 2BEIA 3TOBA 2J8NA 4KUBA 4KS9A 4Q38A 2GREA 2AFOA 1BAVA 1XF8A 3KKWA 4P4IA 5G21A 3H8FA 4OIDA 3WT4A 5AG6A 4NJRA 3B35A 4II9A 2F8HA 3WC6A 4LQ6A 2Q44A 3BI0A 3TO9A 4FBEA 1QMUA 2EBJA 3JRUA 2B5GB 2PCUA 4XNHC 3TO7A 4CAEA 4X5KA 1ZG7A 2OZUA 2ZEMA 4PXEA 5IX3A 2HQYA 3ZJ0A 4UWIA 4UCMA 1GYTA 2DPTA 3FF3A 2CY2A 4M85A 1VHOA 4PSWA 4OP4A 3PB8X 1ZLHA 4R8FA 4UFVA 3R9GA 4Q7AA 1MJ9A 3FEDA 2DEAA 2YNDA 2Q0YA 3EO4A 2AFUA 3H8EA 5C82A 3W6XA 4NGSA 2PR8A 2PJ6A 3K2KA 3EFAA 4R3LA 5D29A 5LRKA 5IB0A 4C2YA 4KOTA 4ZY1A 4JD6A 3CPXA 1MJAA 1Z4EA 1I1DA 5G1ZA 4FAIA 1YVKA 3K9TA 1VIXA 5K8NA 3P2FA 3T90A 4MFKA 3EY5A 2O53A 5LYIA 4L8AA 4C7HA 1MJBA 2RC4A 2JEWA 5CNPA 2ZEPA 2RFHA 1ARMA 4B10A 1YMEA 3KR5A 5GCNA 3GIUA 5LYDA 4HKFA 4P4FA 4TNUA 3B3VA 3LWUA 2CNTA 2WPWA 3I3GA 4KLVA 4MMOA 1OBRA 2ZOGA 1AYEA 2Q4ZA 3LD2A 3D8PA 4A32A 1KZFA 4FD4A 2B4DB 1RXTA 1S60A 4JXRA 4MCQA 2D4PA 2V8DA 2VEZA 4BBHA 3R9EA 4B11A 6CPAA 3PB4X 2PQ8A 4A94A 4AVBA 1GHEA 2CTCA 4M3SA 4OIWA 1LAPA 2PJ0A 4W9YA 3VATA 4PXBA 1XBUA 2GE3A 3D67A 2BCOA 1QSRA 3IFEA 1YVOA 3ISXA 4KOXA 4OC0A 1PYTB 1IYKA 2IQ6A 4H6ZA 4NSQA 1HEEA 4R76A 4WJBA 1TIQA 4C7IA 3VWDA 2Z3MA 2GFQA 4NFRA 1NMTA 4FWUA 2Q51A 5ELYA 3S9NA 1IYLA 3FYNA 1QSMA 2Q4VA 3S6KA 3D7FA 2AFXA 4KORA 4A95A 2BOAA 2QECA 4QBJA 4YFJA 4B6ZA 2Q4YA 2OZHA 5JPHA 2Z11A 5IV0A 2NSMA 4WWVA 5F09A 3PP9A 4C2ZA 5F48A 2QMLA 3G3SA 4MCSA 5HVGA 4AB7A 4NGQA 1IICA 4JWPA 2YNCA 3FB3A 4CAXA 1IY7A 1CM0A 3FECA 1ZG8A 3R1KA 3SXNA 3BHXA 2AFMA 2PJ4A 4BINA 2PJ9A 1CJWA 4C2XA 4UIBA 4ZBGA 1TKJA 5DS0A 3RZAA 1M44A 2P0WA 4IUSA 4KOYA 2ZPAA 2YNCC 1KUYA 1YQEA 2Z3NA 3W91A 2X7BA 1M4LA 3BJ7A 1V0CA 3IEHA 4UIAA 4YGOA 2AFSA 5HMNA 1Y0RA 3SJGA 4KOUA 1HDQA 5EMIA 2G3AA 1M4GA 4MHPA 1XJOA 2F7VA 4P10A 1YSJA 1R57A 1S7KA 1P4NA 4E8OA 1QSNA 2VBQA 1CG2A 1EE3P 4P4JA 4PV6A 2YGWA 4K3NA 4XNHB 5CPAA 4E2AA 5LYLA 1DE4C 4Y49B 1QSOA 2B3VA 2PIZA 4NXYA 1J4JA 1YK3A 2CXAA 4JLYA 4CGOA 2F5IA 1XIXA 2QIRA 1M4IA 1M4DA 4CRYB 2B3UA 1PU9A 4K30A 1S3ZA 2V8GA 2JBKA 4KSAA 2R98A 4QB9A 1BO4A 2WZNA 4ZX9A 4ZX8A 3PRTA 2I3CA 2DPSA 1YW6A 4KVXA 4PXDA 1VHEA 3IO1A 4G1PA 4U5YA 2ZXVA 3BJ8A 3E0KA 2CF4A 5A27A 2BUEA 1N71A 4HPSA 4MFLA 3R95A 2XEGA 2OU2A 3IIBA 2PJBA 2Z3OA 2EK8A 3SI1A 3IWEA 2VZZA 4CGNA 2P6FA 2Z3KA 2B58A 3D7DA 3GLJA 4ORFA 4GXHA 4A31A 3IC1A 4MCRA 3KASA 3S9LA 2O28A 5AG5A 1CPSA 4C68A 3EC4A 5JM6A 1WK4A 1BOBA 1Z8TA 3SJFA 3GY9A 5G20A 4X3RA 1YX0A 2Y0MA 5F46A 2WSAA 4OMEA 3PB6X 3RAMA 4R87A 4CGPA 3VH9A 1B87A 4MFPA 2C27A 2Z10A 4A33A 4P4EA 4MHDA 3BLNA 3QAYA 1CBXA 4H89A 3IJ3A 3C26A 2B4BA 1F2OA 1R3NA 2EWBA 3IU2A 3CT9A 2OOTA 4Y49C 2FE7A 1ZO0A 4KSFA 5I0CA 3VARA 2DXQA 1LANA 1Y9WA 2VZYA 1XE4A 5HH1A 2C6GA 2GIVA 4MRIA 1Z2LA 2H5MA 2GLJA 2AFZA 5DWMA 5AG7A 5LRGA 4QUSA 4P44A 1YR0A 3B2YA 3CXPA 4EFDA 4AG7A 4CYQA 2GANA 2P6GA 5LRJA 4GM5A 3R96A 3WC5A 3SJEA 2V77A 3JTKA 4I49A 4UFWA 4CRZB 4M6GA 3HLPA 3D7GA 2BSWA 2Z0ZA 4OAEA 3CZXA 3DR8A 3FEEA 1IB1E 1M1DA 4OLLA 1VKCA 3WC7A 3KQXA 2FT0A 4JJXA 1S5KA 3FJUA 1LFWA 3F0AA 1B6BA 2PVVA 3G8WA 2Q7SA 4R7MA 4KOSA 4LQGA 5DWNA 3RBUA 2HUZA 3S9MA 4R9MA 1CPXA 3IU1A 5D8NA 1Z8XA 2CTBA 3NH4A 1TKHA 4PK2A 5J8CA 2FCKA 5C88A 5LYFA 2AE6A 3WABA 1TF9A 4HNWB 2ARHA 3D7HA 4KUAA 3D2PA 4R3KA 4QVTA 3KQZA 4P4BA 4CPAA 3PGPA 2FIAA 3N7ZA 1XFOA 4MFQA 3FRMA 2PE3A 3KGQA 2P6EA 3ISZA 1FY7A 1YGHA 5E96A 3OWCA 3D2MA 1H8LA 4F9UA 1FNOA 2BO9A 4OC4A 3H8GA 3QB8A 4ZI6A 2ZW4A 4KZTA 2GU2A 1AUGA 1X12A 3PB9X 3PFOA 4KOWA 4NGRA 3SHPA 5JH9A 2PC1A 3PZJA 1ELLP 5J8FA 1IGBA 3V7ZA 3IWGA 1Y7RA 2R8VA 4KSIA 3RNZA 1JWQA 2JLMA 3GKRA 4UFXA 2VQYA 3TT2A 4JXQA 4H2KA 4MHZA 2RB7A 4YU9A 2JDDA 4MHYA 4M6IA 4UEFA 4B5PB 5THWA 4A2ZA 3PB7X 1NE9A 4UA3A 1BLLE 2AFWA 1Z9UA 2I00A 2ANPA 2Z3PA 3TFYA 2OR4A 2NYQA 2G9DA 4Z65A 1IOFA 3R9FA 4CGLA 4NGMA 3QAHA 1XMBA 1Q2YA 4UBRA 4HNXB 1LCPA 3D3SA 3TO6A 3CPAA 2WYRA 3LMSA 4PSXA 1Z4RA 5F47A 4AVCA 3I9SA 3DR6A 5F49A 5JQ4A 2V8VA 2ZEHA 5K8MA 1RO5A 4PPZA 2XEJA 3PBEA 4Q36A 4DNCA 4R6TA 3GB0A 2HC9A 4MJ8A 3BI1A 4IAVA 2R1IA 1YLOA 1YLEA 4F0XA
chains in the Genus database with same CATH topology
3F5BA 2OZGA 4KLWA 1PUAA 2B5GA 3TE4A 4CAFA 1NSLA 2JEVA 2J8MA 4KOVA 4A30A 5KTDA 4CAVA 2FSRA 4UCPA 4FD6A 4J3GA 4B5OA 2FL4A 4RS2A 5KTCA 1VHSA 3K9UA 2FXFA 2Q7BA 2JDCA 5G22A 1WWZA 3FBUA 1MK4A 2G3TA 2G0BA 2EUIA 3SXOA 5EBVA 4XPDC 1OZPA 4GS4A 1I12A 4OADA 2B4DA 3A9LA 3IGRA 1XMTA 4CAWA 1IIDA 2OB0A 4PK3A 2I79A 1SQHA 3V8IA 1LRZA 4UCNA 4YRHA 4MI4A 2REFA 3GYAA 5H84A 4UWJA 4FD7A 4KVOE 1YREA 1U6MA 3DNSA 2CNSA 3NE7A 4AG9A 2VXKA 4XPDB 4F0YA 1KUXA 4XPKA 4L89A 2NMTA 4NEXA 2K5TA 4ONUA 1Y9KA 1K4JA 2ATRA 4E0AA 3JUWA 5EC4A 2PDOA 4XPLA 3F8KA 5ISVA 4B12A 2KCWA 4U9YA 4MFZA 4U9ZA 3FIXA 3MGDA 2Q04A 2WPXA 4KVME 2OH1A 2ZW5A 2Z3LA 4CYPA 2CNMA 4MBUA 3B8GA 2AJ6A 4MFJA 2EVNA 5BWAB 5KTAA 1XEBA 4B14A 2ZW7A 3TOAA 2HV2A 3T9YA 1I21A 1Q2CA 5A28A 2ZW6A 3S6FA 2WUUA 2IL4A 4BMHA 2BL1A 1L0CA 5AG4A 2REEA 5FVJA 4CS0B 3DDDA 4B5PA 4NF1A 4ZGYB 2PRBA 4R57A 5AGEA 3W6SA 3ZZIA 2J8RA 3P2HA 1P0HA 4LUAA 1S7FA 4HNYB 3TTHA 3DSBA 1S7NA 4NCZA 3UY5A 3FXTA 3TCVA 2YNEA 1S7LA 2A4NA 3H5ZA 3S6GA 4LX9A 4F6AA 4H6UA 4MY0A 4CYNA 4CGMA 2PSWA 4RI1A 2R7HA 4QC6A 3EXNA 3H4QA 3CXQA 3FNCA 2VI7A 3RYOA 4MY3A 1KUVA 4B13A 4FD5A 3S6HA 4IF5A 2FIWA 2D4OA 2PR1A 3WR7A 3LODA 4EVYA 3CXSA 1QSTA 3JVNA 5H86A 4AVAA 2FS5A 3VWEA 1Q2DA 4CYOA 1ON0A 1UFHA 2BEIA 3TOBA 2J8NA 4KUBA 4KS9A 4Q38A 1XF8A 3KKWA 5G21A 5AG6A 4II9A 2Q44A 3TO9A 4XNHC 2B5GB 3TO7A 4CAEA 4X5KA 2OZUA 5IX3A 2HQYA 3ZJ0A 4UWIA 4UCMA 2DPTA 2CY2A 4M85A 4PSWA 4UFVA 3R9GA 1MJ9A 3EO4A 2YNDA 2Q0YA 5C82A 3W6XA 2PR8A 3EFAA 4R3LA 5IB0A 4C2YA 4KOTA 4JD6A 1MJAA 1Z4EA 1I1DA 5G1ZA 1YVKA 3P2FA 3T90A 4MFKA 3EY5A 4L8AA 4C7HA 1MJBA 2RC4A 5CNPA 4B10A 5GCNA 4HKFA 2CNTA 2WPWA 3I3GA 4KLVA 4A32A 3LD2A 3D8PA 1KZFA 4FD4A 2B4DB 1RXTA 1S60A 4JXRA 2D4PA 2VEZA 4BBHA 3R9EA 4B11A 2PQ8A 4AVBA 1GHEA 4M3SA 2GE3A 1QSRA 4KOXA 1YVOA 1IYKA 4C7IA 4H6ZA 4NSQA 1TIQA 3VWDA 2Z3MA 1NMTA 1IYLA 3FYNA 1QSMA 2Q4VA 3S6KA 4KORA 4A95A 4QBJA 2QECA 4YFJA 2Q4YA 2OZHA 5JPHA 2Z11A 5IV0A 3PP9A 4C2ZA 5F48A 2QMLA 3G3SA 4AB7A 1IICA 4JWPA 2YNCA 3FB3A 4CAXA 1CM0A 3R1KA 3SXNA 1CJWA 4C2XA 4ZBGA 1M44A 2P0WA 4IUSA 4KOYA 2ZPAA 2YNCC 1KUYA 2Z3NA 3W91A 2X7BA 3BJ7A 1V0CA 4YGOA 5HMNA 4KOUA 2G3AA 1M4GA 1R57A 1S7KA 1P4NA 4E8OA 1QSNA 2VBQA 4PV6A 2YGWA 4XNHB 4E2AA 4Y49B 1QSOA 2B3VA 4NXYA 1J4JA 1YK3A 2CXAA 4JLYA 4CGOA 2F5IA 1XIXA 2QIRA 1M4IA 1M4DA 4CRYB 2B3UA 1PU9A 4K30A 1S3ZA 4KSAA 2R98A 4QB9A 1BO4A 2DPSA 4KVXA 4U5YA 2ZXVA 3BJ8A 3E0KA 5A27A 2BUEA 1N71A 4MFLA 3R95A 2OU2A 2Z3OA 3IWEA 2VZZA 4CGNA 2P6FA 2Z3KA 2B58A 4ORFA 4A31A 2O28A 5AG5A 4C68A 3EC4A 1WK4A 1BOBA 3GY9A 5G20A 1YX0A 2Y0MA 5F46A 2WSAA 4CGPA 4R87A 1B87A 4MFPA 2C27A 2Z10A 4A33A 4MHDA 3BLNA 4H89A 3C26A 2B4BA 3IU2A 4Y49C 2FE7A 4KSFA 1ZO0A 5I0CA 2DXQA 1Y9WA 2VZYA 1XE4A 5HH1A 2GIVA 2H5MA 5DWMA 5AG7A 4QUSA 1YR0A 3CXPA 4AG7A 4CYQA 2GANA 2P6GA 3R96A 4I49A 3JTKA 4UFWA 4CRZB 2BSWA 2Z0ZA 4OAEA 3DR8A 1IB1E 1M1DA 4OLLA 1VKCA 2FT0A 4JJXA 1S5KA 3F0AA 1B6BA 3G8WA 4KOSA 5DWNA 2HUZA 4R9MA 3IU1A 4PK2A 5J8CA 2FCKA 5C88A 2AE6A 4HNWB 2ARHA 4KUAA 3D2PA 4R3KA 4QVTA 3PGPA 2FIAA 3N7ZA 4MFQA 3FRMA 2P6EA 1FY7A 1YGHA 5E96A 3OWCA 3D2MA 3QB8A 2ZW4A 4KZTA 3SHPA 4KOWA 2PC1A 3PZJA 5J8FA 3IWGA 1Y7RA 2R8VA 2JLMA 3GKRA 4UFXA 2VQYA 3TT2A 4JXQA 2JDDA 4B5PB 4A2ZA 1NE9A 4UA3A 1Z9UA 2I00A 3TFYA 2Z3PA 3R9FA 4CGLA 3QAHA 1Q2YA 4UBRA 4HNXB 3TO6A 3D3SA 4PSXA 1Z4RA 5F47A 4AVCA 3I9SA 3DR6A 5F49A 5JQ4A 1RO5A 4Q36A 4DNCA 4MJ8A 2R1IA 1YLEA 4F0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UFX A;  4B12 A;  4B10 A;  5A28 A;  3IWE A;  4CGN A;  2WUU A;  4UCM A;  4C7I A;  3IU2 A;  2YNE A;  4A2Z A;  5G22 A;  4CGO A;  5AG4 A;  4A31 A;  4C2X A;  3H5Z A;  4UFV A;  4CAF A;  5AG7 A;  2YND A;  5AG5 A;  4A32 A;  4CGM A;  4B14 A;  4C68 A;  4CGL A;  2YNC C;  4CYN A;  4CYO A;  4A30 A;  5AGE A;  4CYQ A;  4BBH A;  4UFW A;  3JTK A;  5G20 A;  4A95 A;  4B11 A;  4C2Y A;  4CYP A;  4CAE A;  5G21 A;  5G1Z A;  4UCP A;  4B13 A;  4C2Z A;  2WSA A;  5AG6 A;  4CGP A;  5A27 A;  4C7H A;  4A33 A;  4UCN A;  3IU1 A;  2YNC A; 
#chains in the Genus database with same CATH topology
 3F5B A;  4RUH A;  2OZG A;  3IWW A;  4NGN A;  4KLW A;  1PUA A;  3RO0 A;  2B5G A;  1TXR A;  3FMC A;  4NGP A;  4YWY A;  3FH4 A;  2IJZ A;  3TE4 A;  2PJA A;  4CAF A;  1NSL A;  2ZOF A;  2JEV A;  4OC5 A;  2J8M A;  4KOV A;  4A30 A;  1R43 A;  4ZY2 A;  3B3T A;  5KTD A;  4CAV A;  4JYW A;  2FSR A;  5HXD A;  4UCP A;  2C6C A;  3NFZ A;  3BXM A;  3PFE A;  4FD6 A;  4J3G A;  2PJC A;  4MHN A;  4B5O A;  2J9A A;  4RN7 A;  2FL4 A;  4DJL A;  3QNV A;  4RS2 A;  2PIY A;  1VHS A;  5KTC A;  3K9U A;  2FXF A;  2Q7B A;  2JDC A;  4BD9 A;  4O23 A;  5G22 A;  1WWZ A;  3FBU A;  1MK4 A;  1TKF A;  1Z5R A;  2G3T A;  3D66 A;  2G0B A;  3V38 A;  2EUI A;  2PJ3 A;  3SXO A;  3LAC A;  4PXC A;  5EBV A;  4OC3 A;  3NA6 A;  1ELM P;  2ZEO A;  3DLJ A;  4OC2 A;  2GLF A;  4XPD C;  1A2Z A;  1OZP A;  1I12 A;  4GS4 A;  2IMO A;  4OAD A;  4PQA A;  2B4D A;  1NSA A;  1ZG9 A;  2PJ8 A;  3A9L A;  3IGR A;  4JZ0 A;  1XMT A;  3KZW A;  4IHM A;  4CAW A;  1IID A;  1AMP A;  2JBJ A;  2OB0 A;  4PK3 A;  2I79 A;  2PVW A;  1SQH A;  2PJ1 A;  2C1C A;  3D4U A;  3V8I A;  1LRZ A;  4UCN A;  4YRH A;  4MI4 A;  4EWT A;  4P6Y A;  1F57 A;  4F9V A;  1HDU A;  2REF A;  4UF4 A;  1XOV A;  3GYA A;  4UWJ A;  5H84 A;  5J1Q A;  4FD7 A;  4KVO E;  1YRE A;  4A38 A;  1U6M A;  3DNS A;  1JQG A;  1Z8L A;  2CNS A;  5IB9 A;  3NE7 A;  4X2T A;  4AG9 A;  3KHZ A;  3MRU A;  2VXK A;  4XPD B;  4F0Y A;  1KUX A;  4XPK A;  2PJ7 A;  1TF8 A;  3B3C A;  3L2N A;  2NMT A;  4L89 A;  1CX8 A;  4NEX A;  2K5T A;  4ONU A;  1Y9K A;  1K4J A;  2ATR A;  4E0A A;  3JUW A;  5EC4 A;  2PDO A;  3I1U A;  2QVP A;  4XPL A;  2ZEE A;  5HVF A;  3SJX A;  1CP6 A;  5I4M A;  3F8K A;  5ISV A;  5K8O A;  4B12 A;  2KCW A;  4U9Y A;  4MFZ A;  3SI2 A;  4NJQ A;  4U9Z A;  5CBM A;  3FIX A;  2PRQ A;  3MGD A;  5K8P A;  2PJ2 A;  4OC1 A;  2Q04 A;  4X8I A;  4UEE A;  2WPX A;  4KVM E;  1YW4 A;  3TX8 A;  2OH1 A;  2ZW5 A;  4P45 A;  2POK A;  1FT7 A;  2Z3L A;  3KHX A;  3NH8 A;  4CYP A;  4ZY0 A;  5HVH A;  2V8H A;  1LAM A;  1XRY A;  2CNM A;  4OKO A;  4FUU A;  4MBU A;  3B8G A;  1BPN A;  2AJ6 A;  4IK2 A;  1UWY A;  2ZEL A;  1ARL A;  2C6P A;  4MFJ A;  2EVN A;  1VGY A;  5BWA B;  5KTA A;  1XEB A;  1BPM A;  2QYV A;  3HUV A;  3NH5 A;  4B14 A;  2ZW7 A;  3TOA A;  3T8W A;  2HV2 A;  3T9Y A;  1I21 A;  1Q2C A;  4A37 A;  5A28 A;  2ZW6 A;  3MN8 A;  2WUU A;  3S6F A;  8CPA A;  2IL4 A;  1DTD A;  2VL1 A;  2BL1 A;  4BMH A;  2XEI A;  1L0C A;  5AG4 A;  2REE A;  5FVJ A;  4CS0 B;  3DDD A;  3N5F A;  4M6H A;  4MXU A;  4B5P A;  2ZED A;  7CPA A;  1IOI A;  3CDX A;  2EO8 A;  3DGV A;  2Q43 A;  4ONW A;  4NF1 A;  4ZGY B;  2PRB A;  3PBB A;  1Q7L A;  1PCA A;  4R57 A;  5AGE A;  3W6S A;  2ABZ A;  3ZZI A;  2J8R A;  2XEF A;  2PJ5 A;  3P2H A;  3FVL A;  4DYO A;  1P0H A;  4LUA A;  1S7F A;  1Z8W A;  4HNY B;  3B7I A;  3TTH A;  2ZEG A;  3DSB A;  3TC8 A;  4DUK A;  1S7N A;  1F2P A;  2DF5 A;  2FVG A;  4NCZ A;  3GUX A;  2ZEN A;  4P4D A;  4ZYQ A;  3UY5 A;  3FX6 A;  3D68 A;  4A39 A;  3FXT A;  3TCV A;  2YNE A;  1Y7E A;  1S7L A;  2EK9 A;  2A4N A;  3H5Z A;  3S6G A;  2ZEF A;  4LX9 A;  4F6A A;  3KR4 A;  4H6U A;  3PEI A;  4MY0 A;  4CYN A;  4CGM A;  2PSW A;  4RI1 A;  2R7H A;  1X10 A;  4EME A;  4QC6 A;  3EXN A;  3H4Q A;  1CP7 A;  4F8Z A;  3CXQ A;  3FNC A;  2VI7 A;  3RYO A;  1QQ9 A;  1ZLI A;  4AXV A;  4MY3 A;  4TWE A;  1KUV A;  4B13 A;  4FD5 A;  1LOK A;  3S6H A;  2O4H A;  4MCP A;  1RTQ A;  3SI0 A;  3B3S A;  2FIW A;  4IF5 A;  3NE8 A;  4NGT A;  5JGF A;  1KWM A;  2D4O A;  4UEZ A;  2PR1 A;  3B3W A;  3WR7 A;  3LOD A;  4EVY A;  3CXS A;  1QST A;  2HB6 A;  2ODF A;  3JVN A;  5H86 A;  1Y0Y A;  4AVA A;  3KI9 A;  2QJ8 A;  2FS5 A;  3VWE A;  1Q2D A;  1IU8 A;  3KL9 A;  4CYO A;  2CIJ A;  1ON0 A;  1UFH A;  2BEI A;  3TOB A;  2J8N A;  4KUB A;  4KS9 A;  4Q38 A;  2GRE A;  2AFO A;  1BAV A;  1XF8 A;  3KKW A;  4P4I A;  5G21 A;  3H8F A;  4OID A;  3WT4 A;  5AG6 A;  4NJR A;  3B35 A;  4II9 A;  2F8H A;  3WC6 A;  4LQ6 A;  2Q44 A;  3BI0 A;  3TO9 A;  4FBE A;  1QMU A;  2EBJ A;  3JRU A;  2B5G B;  2PCU A;  4XNH C;  3TO7 A;  4CAE A;  4X5K A;  1ZG7 A;  2OZU A;  2ZEM A;  4PXE A;  5IX3 A;  2HQY A;  3ZJ0 A;  4UWI A;  4UCM A;  1GYT A;  2DPT A;  3FF3 A;  2CY2 A;  4M85 A;  1VHO A;  4PSW A;  4OP4 A;  3PB8 X;  1ZLH A;  4R8F A;  4UFV A;  3R9G A;  4Q7A A;  1MJ9 A;  3FED A;  2DEA A;  2YND A;  2Q0Y A;  3EO4 A;  2AFU A;  3H8E A;  5C82 A;  3W6X A;  4NGS A;  2PR8 A;  2PJ6 A;  3K2K A;  3EFA A;  4R3L A;  5D29 A;  5LRK A;  5IB0 A;  4C2Y A;  4KOT A;  4ZY1 A;  4JD6 A;  3CPX A;  1MJA A;  1Z4E A;  1I1D A;  5G1Z A;  4FAI A;  1YVK A;  3K9T A;  1VIX A;  5K8N A;  3P2F A;  3T90 A;  4MFK A;  3EY5 A;  2O53 A;  5LYI A;  4L8A A;  4C7H A;  1MJB A;  2RC4 A;  2JEW A;  5CNP A;  2ZEP A;  2RFH A;  1ARM A;  4B10 A;  1YME A;  3KR5 A;  5GCN A;  3GIU A;  5LYD A;  4HKF A;  4P4F A;  4TNU A;  3B3V A;  3LWU A;  2CNT A;  2WPW A;  3I3G A;  4KLV A;  4MMO A;  1OBR A;  2ZOG A;  1AYE A;  2Q4Z A;  3LD2 A;  3D8P A;  4A32 A;  1KZF A;  4FD4 A;  2B4D B;  1RXT A;  1S60 A;  4JXR A;  4MCQ A;  2D4P A;  2V8D A;  2VEZ A;  4BBH A;  3R9E A;  4B11 A;  6CPA A;  3PB4 X;  2PQ8 A;  4A94 A;  4AVB A;  1GHE A;  2CTC A;  4M3S A;  4OIW A;  1LAP A;  2PJ0 A;  4W9Y A;  3VAT A;  4PXB A;  1XBU A;  2GE3 A;  3D67 A;  2BCO A;  1QSR A;  3IFE A;  1YVO A;  3ISX A;  4KOX A;  4OC0 A;  1PYT B;  1IYK A;  2IQ6 A;  4H6Z A;  4NSQ A;  1HEE A;  4R76 A;  4WJB A;  1TIQ A;  4C7I A;  3VWD A;  2Z3M A;  2GFQ A;  4NFR A;  1NMT A;  4FWU A;  2Q51 A;  5ELY A;  3S9N A;  1IYL A;  3FYN A;  1QSM A;  2Q4V A;  3S6K A;  3D7F A;  2AFX A;  4KOR A;  4A95 A;  2BOA A;  2QEC A;  4QBJ A;  4YFJ A;  4B6Z A;  2Q4Y A;  2OZH A;  5JPH A;  2Z11 A;  5IV0 A;  2NSM A;  4WWV A;  5F09 A;  3PP9 A;  4C2Z A;  5F48 A;  2QML A;  3G3S A;  4MCS A;  5HVG A;  4AB7 A;  4NGQ A;  1IIC A;  4JWP A;  2YNC A;  3FB3 A;  4CAX A;  1IY7 A;  1CM0 A;  3FEC A;  1ZG8 A;  3R1K A;  3SXN A;  3BHX A;  2AFM A;  2PJ4 A;  4BIN A;  2PJ9 A;  1CJW A;  4C2X A;  4UIB A;  4ZBG A;  1TKJ A;  5DS0 A;  3RZA A;  1M44 A;  2P0W A;  4IUS A;  4KOY A;  2ZPA A;  2YNC C;  1KUY A;  1YQE A;  2Z3N A;  3W91 A;  2X7B A;  1M4L A;  3BJ7 A;  1V0C A;  3IEH A;  4UIA A;  4YGO A;  2AFS A;  5HMN A;  1Y0R A;  3SJG A;  4KOU A;  1HDQ A;  5EMI A;  2G3A A;  1M4G A;  4MHP A;  1XJO A;  2F7V A;  4P10 A;  1YSJ A;  1R57 A;  1S7K A;  1P4N A;  4E8O A;  1QSN A;  2VBQ A;  1CG2 A;  1EE3 P;  4P4J A;  4PV6 A;  2YGW A;  4K3N A;  4XNH B;  5CPA A;  4E2A A;  5LYL A;  1DE4 C;  4Y49 B;  1QSO A;  2B3V A;  2PIZ A;  4NXY A;  1J4J A;  1YK3 A;  2CXA A;  4JLY A;  4CGO A;  2F5I A;  1XIX A;  2QIR A;  1M4I A;  1M4D A;  4CRY B;  2B3U A;  1PU9 A;  4K30 A;  1S3Z A;  2V8G A;  2JBK A;  4KSA A;  2R98 A;  4QB9 A;  1BO4 A;  2WZN A;  4ZX9 A;  4ZX8 A;  3PRT A;  2I3C A;  2DPS A;  1YW6 A;  4KVX A;  4PXD A;  1VHE A;  3IO1 A;  4G1P A;  4U5Y A;  2ZXV A;  3BJ8 A;  3E0K A;  2CF4 A;  5A27 A;  2BUE A;  1N71 A;  4HPS A;  4MFL A;  3R95 A;  2XEG A;  2OU2 A;  3IIB A;  2PJB A;  2Z3O A;  2EK8 A;  3SI1 A;  3IWE A;  2VZZ A;  4CGN A;  2P6F A;  2Z3K A;  2B58 A;  3D7D A;  3GLJ A;  4ORF A;  4GXH A;  4A31 A;  3IC1 A;  4MCR A;  3KAS A;  3S9L A;  2O28 A;  5AG5 A;  1CPS A;  4C68 A;  3EC4 A;  5JM6 A;  1WK4 A;  1BOB A;  1Z8T A;  3SJF A;  3GY9 A;  5G20 A;  4X3R A;  1YX0 A;  2Y0M A;  5F46 A;  2WSA A;  4OME A;  3PB6 X;  3RAM A;  4R87 A;  4CGP A;  3VH9 A;  1B87 A;  4MFP A;  2C27 A;  2Z10 A;  4A33 A;  4P4E A;  4MHD A;  3BLN A;  3QAY A;  1CBX A;  4H89 A;  3IJ3 A;  3C26 A;  2B4B A;  1F2O A;  1R3N A;  2EWB A;  3IU2 A;  3CT9 A;  2OOT A;  4Y49 C;  2FE7 A;  1ZO0 A;  4KSF A;  5I0C A;  3VAR A;  2DXQ A;  1LAN A;  1Y9W A;  2VZY A;  1XE4 A;  5HH1 A;  2C6G A;  2GIV A;  4MRI A;  1Z2L A;  2H5M A;  2GLJ A;  2AFZ A;  5DWM A;  5AG7 A;  5LRG A;  4QUS A;  4P44 A;  1YR0 A;  3B2Y A;  3CXP A;  4EFD A;  4AG7 A;  4CYQ A;  2GAN A;  2P6G A;  5LRJ A;  4GM5 A;  3R96 A;  3WC5 A;  3SJE A;  2V77 A;  3JTK A;  4I49 A;  4UFW A;  4CRZ B;  4M6G A;  3HLP A;  3D7G A;  2BSW A;  2Z0Z A;  4OAE A;  3CZX A;  3DR8 A;  3FEE A;  1IB1 E;  1M1D A;  4OLL A;  1VKC A;  3WC7 A;  3KQX A;  2FT0 A;  4JJX A;  1S5K A;  3FJU A;  1LFW A;  3F0A A;  1B6B A;  2PVV A;  3G8W A;  2Q7S A;  4R7M A;  4KOS A;  4LQG A;  5DWN A;  3RBU A;  2HUZ A;  3S9M A;  4R9M A;  1CPX A;  3IU1 A;  5D8N A;  1Z8X A;  2CTB A;  3NH4 A;  1TKH A;  4PK2 A;  5J8C A;  2FCK A;  5C88 A;  5LYF A;  2AE6 A;  3WAB A;  1TF9 A;  4HNW B;  2ARH A;  3D7H A;  4KUA A;  3D2P A;  4R3K A;  4QVT A;  3KQZ A;  4P4B A;  4CPA A;  3PGP A;  2FIA A;  3N7Z A;  1XFO A;  4MFQ A;  3FRM A;  2PE3 A;  3KGQ A;  2P6E A;  3ISZ A;  1FY7 A;  1YGH A;  5E96 A;  3OWC A;  3D2M A;  1H8L A;  4F9U A;  1FNO A;  2BO9 A;  4OC4 A;  3H8G A;  3QB8 A;  4ZI6 A;  2ZW4 A;  4KZT A;  2GU2 A;  1AUG A;  1X12 A;  3PB9 X;  3PFO A;  4KOW A;  4NGR A;  3SHP A;  5JH9 A;  2PC1 A;  3PZJ A;  1ELL P;  5J8F A;  1IGB A;  3V7Z A;  3IWG A;  1Y7R A;  2R8V A;  4KSI A;  3RNZ A;  1JWQ A;  2JLM A;  3GKR A;  4UFX A;  2VQY A;  3TT2 A;  4JXQ A;  4H2K A;  4MHZ A;  2RB7 A;  4YU9 A;  2JDD A;  4MHY A;  4M6I A;  4UEF A;  4B5P B;  5THW A;  4A2Z A;  3PB7 X;  1NE9 A;  4UA3 A;  1BLL E;  2AFW A;  1Z9U A;  2I00 A;  2ANP A;  2Z3P A;  3TFY A;  2OR4 A;  2NYQ A;  2G9D A;  4Z65 A;  1IOF A;  3R9F A;  4CGL A;  4NGM A;  3QAH A;  1XMB A;  1Q2Y A;  4UBR A;  4HNX B;  1LCP A;  3D3S A;  3TO6 A;  3CPA A;  2WYR A;  3LMS A;  4PSX A;  1Z4R A;  5F47 A;  4AVC A;  3I9S A;  3DR6 A;  5F49 A;  5JQ4 A;  2V8V A;  2ZEH A;  5K8M A;  1RO5 A;  4PPZ A;  2XEJ A;  3PBE A;  4Q36 A;  4DNC A;  4R6T A;  3GB0 A;  2HC9 A;  4MJ8 A;  3BI1 A;  4IAV A;  2R1I A;  1YLO A;  1YLE A;  4F0X A; 
#chains in the Genus database with same CATH homology
 3F5B A;  2OZG A;  4KLW A;  1PUA A;  2B5G A;  3TE4 A;  4CAF A;  1NSL A;  2JEV A;  2J8M A;  4KOV A;  4A30 A;  5KTD A;  4CAV A;  2FSR A;  4UCP A;  4FD6 A;  4J3G A;  4B5O A;  2FL4 A;  4RS2 A;  5KTC A;  1VHS A;  3K9U A;  2FXF A;  2Q7B A;  2JDC A;  5G22 A;  1WWZ A;  3FBU A;  1MK4 A;  2G3T A;  2G0B A;  2EUI A;  3SXO A;  5EBV A;  4XPD C;  1OZP A;  4GS4 A;  1I12 A;  4OAD A;  2B4D A;  3A9L A;  3IGR A;  1XMT A;  4CAW A;  1IID A;  2OB0 A;  4PK3 A;  2I79 A;  1SQH A;  3V8I A;  1LRZ A;  4UCN A;  4YRH A;  4MI4 A;  2REF A;  3GYA A;  5H84 A;  4UWJ A;  4FD7 A;  4KVO E;  1YRE A;  1U6M A;  3DNS A;  2CNS A;  3NE7 A;  4AG9 A;  2VXK A;  4XPD B;  4F0Y A;  1KUX A;  4XPK A;  4L89 A;  2NMT A;  4NEX A;  2K5T A;  4ONU A;  1Y9K A;  1K4J A;  2ATR A;  4E0A A;  3JUW A;  5EC4 A;  2PDO A;  4XPL A;  3F8K A;  5ISV A;  4B12 A;  2KCW A;  4U9Y A;  4MFZ A;  4U9Z A;  3FIX A;  3MGD A;  2Q04 A;  2WPX A;  4KVM E;  2OH1 A;  2ZW5 A;  2Z3L A;  4CYP A;  2CNM A;  4MBU A;  3B8G A;  2AJ6 A;  4MFJ A;  2EVN A;  5BWA B;  5KTA A;  1XEB A;  4B14 A;  2ZW7 A;  3TOA A;  2HV2 A;  3T9Y A;  1I21 A;  1Q2C A;  5A28 A;  2ZW6 A;  3S6F A;  2WUU A;  2IL4 A;  4BMH A;  2BL1 A;  1L0C A;  5AG4 A;  2REE A;  5FVJ A;  4CS0 B;  3DDD A;  4B5P A;  4NF1 A;  4ZGY B;  2PRB A;  4R57 A;  5AGE A;  3W6S A;  3ZZI A;  2J8R A;  3P2H A;  1P0H A;  4LUA A;  1S7F A;  4HNY B;  3TTH A;  3DSB A;  1S7N A;  4NCZ A;  3UY5 A;  3FXT A;  3TCV A;  2YNE A;  1S7L A;  2A4N A;  3H5Z A;  3S6G A;  4LX9 A;  4F6A A;  4H6U A;  4MY0 A;  4CYN A;  4CGM A;  2PSW A;  4RI1 A;  2R7H A;  4QC6 A;  3EXN A;  3H4Q A;  3CXQ A;  3FNC A;  2VI7 A;  3RYO A;  4MY3 A;  1KUV A;  4B13 A;  4FD5 A;  3S6H A;  4IF5 A;  2FIW A;  2D4O A;  2PR1 A;  3WR7 A;  3LOD A;  4EVY A;  3CXS A;  1QST A;  3JVN A;  5H86 A;  4AVA A;  2FS5 A;  3VWE A;  1Q2D A;  4CYO A;  1ON0 A;  1UFH A;  2BEI A;  3TOB A;  2J8N A;  4KUB A;  4KS9 A;  4Q38 A;  1XF8 A;  3KKW A;  5G21 A;  5AG6 A;  4II9 A;  2Q44 A;  3TO9 A;  4XNH C;  2B5G B;  3TO7 A;  4CAE A;  4X5K A;  2OZU A;  5IX3 A;  2HQY A;  3ZJ0 A;  4UWI A;  4UCM A;  2DPT A;  2CY2 A;  4M85 A;  4PSW A;  4UFV A;  3R9G A;  1MJ9 A;  3EO4 A;  2YND A;  2Q0Y A;  5C82 A;  3W6X A;  2PR8 A;  3EFA A;  4R3L A;  5IB0 A;  4C2Y A;  4KOT A;  4JD6 A;  1MJA A;  1Z4E A;  1I1D A;  5G1Z A;  1YVK A;  3P2F A;  3T90 A;  4MFK A;  3EY5 A;  4L8A A;  4C7H A;  1MJB A;  2RC4 A;  5CNP A;  4B10 A;  5GCN A;  4HKF A;  2CNT A;  2WPW A;  3I3G A;  4KLV A;  4A32 A;  3LD2 A;  3D8P A;  1KZF A;  4FD4 A;  2B4D B;  1RXT A;  1S60 A;  4JXR A;  2D4P A;  2VEZ A;  4BBH A;  3R9E A;  4B11 A;  2PQ8 A;  4AVB A;  1GHE A;  4M3S A;  2GE3 A;  1QSR A;  4KOX A;  1YVO A;  1IYK A;  4C7I A;  4H6Z A;  4NSQ A;  1TIQ A;  3VWD A;  2Z3M A;  1NMT A;  1IYL A;  3FYN A;  1QSM A;  2Q4V A;  3S6K A;  4KOR A;  4A95 A;  4QBJ A;  2QEC A;  4YFJ A;  2Q4Y A;  2OZH A;  5JPH A;  2Z11 A;  5IV0 A;  3PP9 A;  4C2Z A;  5F48 A;  2QML A;  3G3S A;  4AB7 A;  1IIC A;  4JWP A;  2YNC A;  3FB3 A;  4CAX A;  1CM0 A;  3R1K A;  3SXN A;  1CJW A;  4C2X A;  4ZBG A;  1M44 A;  2P0W A;  4IUS A;  4KOY A;  2ZPA A;  2YNC C;  1KUY A;  2Z3N A;  3W91 A;  2X7B A;  3BJ7 A;  1V0C A;  4YGO A;  5HMN A;  4KOU A;  2G3A A;  1M4G A;  1R57 A;  1S7K A;  1P4N A;  4E8O A;  1QSN A;  2VBQ A;  4PV6 A;  2YGW A;  4XNH B;  4E2A A;  4Y49 B;  1QSO A;  2B3V A;  4NXY A;  1J4J A;  1YK3 A;  2CXA A;  4JLY A;  4CGO A;  2F5I A;  1XIX A;  2QIR A;  1M4I A;  1M4D A;  4CRY B;  2B3U A;  1PU9 A;  4K30 A;  1S3Z A;  4KSA A;  2R98 A;  4QB9 A;  1BO4 A;  2DPS A;  4KVX A;  4U5Y A;  2ZXV A;  3BJ8 A;  3E0K A;  5A27 A;  2BUE A;  1N71 A;  4MFL A;  3R95 A;  2OU2 A;  2Z3O A;  3IWE A;  2VZZ A;  4CGN A;  2P6F A;  2Z3K A;  2B58 A;  4ORF A;  4A31 A;  2O28 A;  5AG5 A;  4C68 A;  3EC4 A;  1WK4 A;  1BOB A;  3GY9 A;  5G20 A;  1YX0 A;  2Y0M A;  5F46 A;  2WSA A;  4CGP A;  4R87 A;  1B87 A;  4MFP A;  2C27 A;  2Z10 A;  4A33 A;  4MHD A;  3BLN A;  4H89 A;  3C26 A;  2B4B A;  3IU2 A;  4Y49 C;  2FE7 A;  4KSF A;  1ZO0 A;  5I0C A;  2DXQ A;  1Y9W A;  2VZY A;  1XE4 A;  5HH1 A;  2GIV A;  2H5M A;  5DWM A;  5AG7 A;  4QUS A;  1YR0 A;  3CXP A;  4AG7 A;  4CYQ A;  2GAN A;  2P6G A;  3R96 A;  4I49 A;  3JTK A;  4UFW A;  4CRZ B;  2BSW A;  2Z0Z A;  4OAE A;  3DR8 A;  1IB1 E;  1M1D A;  4OLL A;  1VKC A;  2FT0 A;  4JJX A;  1S5K A;  3F0A A;  1B6B A;  3G8W A;  4KOS A;  5DWN A;  2HUZ A;  4R9M A;  3IU1 A;  4PK2 A;  5J8C A;  2FCK A;  5C88 A;  2AE6 A;  4HNW B;  2ARH A;  4KUA A;  3D2P A;  4R3K A;  4QVT A;  3PGP A;  2FIA A;  3N7Z A;  4MFQ A;  3FRM A;  2P6E A;  1FY7 A;  1YGH A;  5E96 A;  3OWC A;  3D2M A;  3QB8 A;  2ZW4 A;  4KZT A;  3SHP A;  4KOW A;  2PC1 A;  3PZJ A;  5J8F A;  3IWG A;  1Y7R A;  2R8V A;  2JLM A;  3GKR A;  4UFX A;  2VQY A;  3TT2 A;  4JXQ A;  2JDD A;  4B5P B;  4A2Z A;  1NE9 A;  4UA3 A;  1Z9U A;  2I00 A;  3TFY A;  2Z3P A;  3R9F A;  4CGL A;  3QAH A;  1Q2Y A;  4UBR A;  4HNX B;  3TO6 A;  3D3S A;  4PSX A;  1Z4R A;  5F47 A;  4AVC A;  3I9S A;  3DR6 A;  5F49 A;  5JQ4 A;  1RO5 A;  4Q36 A;  4DNC A;  4MJ8 A;  2R1I A;  1YLE A;  4F0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...