5G1ZA

Plasmodium vivax n-myristoyltransferase in complex with a quinoline inhibitor (compound 1)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
385
structure length
385
Chain Sequence
IDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Structure-guided optimization of quinoline inhibitors of Plasmodium N-myristoyltransferase.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 116
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2016-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5g1zA00
2WSAA 5G22A 4A32A 4CGPA 4CGOA 4C7HA 4CYNA 4A30A 4UFWA 5G20A 4CGLA 4B12A 4B10A 5A27A 2YNDA 4BBHA 4B11A 2YNCC 3IU1A 4UFXA 3H5ZA 2WUUA 4UCPA 4C2XA 4CYPA 3JTKA 5AG7A 4B13A 4UCNA 4C2ZA 5AG5A 4C68A 4CAEA 4CYOA 5A28A 2YNEA 5G21A 3IU2A 4A2ZA 5AGEA 4CAFA 5AG4A 3IWEA 4B14A 4A31A 4A95A 2YNCA 4A33A 4C7IA 4C2YA 4UFVA 4CGNA 5AG6A 4UCMA 4CYQA 5G1ZA 4CGMA
chains in the Genus database with same CATH superfamily
2ZEEA 4A94A 4CGOA 8CPAA 4OIDA 4AG9A 5HVFA 1XMTA 3W6XA 5ISVA 2EK9A 2FS5A 2BL1A 2ZOFA 3R1KA 4NGMA 1MJBA 4JYWA 3TOBA 2JLMA 4MBUA 4UFXA 2C1CA 1Y0RA 4HNWB 2B4BA 5J8CA 1I21A 2PQ8A 2J8RA 2EO8A 2B3VA 4PXBA 4TWEA 4FD6A 3PEIA 3F0AA 1BAVA 4OAEA 2ZEOA 1YSJA 2IMOA 3IWEA 4A38A 4CS0B 3FECA 3BJ8A 3KI9A 4R9MA 4MFKA 3WC6A 1ZLHA 4MRIA 4P4BA 4UCMA 1KWMA 1Z4EA 3S6KA 5LYIA 5IB9A 2ZEFA 4KVOE 2PDOA 4IUSA 1HDUA 7CPAA 1IY7A 2BO9A 4MXUA 5D8NA 5BWAB 2AFWA 4XPDC 4H6ZA 4HNYB 3JUWA 1LRZA 1Z8LA 2D4PA 2BSWA 2I79A 3T90A 4KOVA 1LOKA 4U9YA 1VHEA 4X8IA 4K30A 3V38A 4IF5A 5K8MA 4A37A 1PU9A 4C2ZA 4PXCA 1JQGA 2GIVA 4UEFA 2YNEA 3N5FA 2GFQA 2VBQA 1VKCA 1P0HA 1QSRA 4IHMA 4ONUA 2Q7BA 2YNCA 3P2HA 1ON0A 4UFVA 3SXOA 1AMPA 3DR6A 4MFPA 4XPLA 3EO4A 1RXTA 1QSTA 4B5PA 4DUKA 5C82A 1Z2LA 2WPXA 1I12A 1NSAA 1Y7RA 4P45A 3R9GA 1Q2DA 2PIYA 2ZW4A 4M6GA 1VGYA 2PJAA 4OC5A 1ARLA 2EVNA 1XFOA 1S60A 2YGWA 3RZAA 3D7FA 3W6SA 1LAMA 4X2TA 1R3NA 4P44A 2Q43A 3CXPA 4A39A 4MHYA 1XBUA 2PE3A 3FMCA 3MRUA 1WWZA 4GS4A 2CNMA 5LYFA 5F47A 2ATRA 2ZEHA 4KORA 4CAEA 5JH9A 3S9LA 2REEA 1YR0A 2Y0MA 1Z4RA 3KQZA 4P4FA 1LCPA 1CP6A 1X10A 2V8DA 1XRYA 5ELYA 4FD5A 4OKOA 1S3ZA 3WABA 4Y49B 5G1ZA 2ZXVA 4EFDA 4NGNA 5A28A 2PJ7A 3TO7A 2VEZA 1GHEA 4QBJA 5JPHA 2HUZA 3EC4A 4ZX9A 4LX9A 3KASA 2ZPAA 3CXQA 2Z10A 2K5TA 3KZWA 4YU9A 5I4MA 2DXQA 3PRTA 4P10A 2OZUA 1XMBA 2Q7SA 2PVWA 2G9DA 2AFOA 3BLNA 1MJAA 2CNSA 3FJUA 3VATA 1Y9KA 2NMTA 3B3WA 4C68A 1K4JA 2B4DA 4FWUA 4F6AA 1P4NA 2AFZA 2FVGA 3KHZA 3NH8A 1YK3A 2OH1A 3WT4A 4R3LA 3LMSA 4KLWA 3LODA 1TKFA 5CPAA 4RN7A 4PK2A 1EE3P 1IU8A 3KKWA 4A30A 3SI0A 1CM0A 4KZTA 1X12A 2PIZA 2F8HA 1H8LA 3FXTA 1OBRA 1XE4A 2ZENA 5A27A 1TF9A 4OC1A 2QECA 3D68A 2QMLA 3CPAA 2PJCA 4KOTA 4JXQA 4OADA 2BOAA 2C6PA 2V8HA 1U6MA 1YVOA 4R76A 5LYDA 2PVVA 1OZPA 2PJBA 4U5YA 3B3CA 3H8GA 4B14A 4AXVA 5K8PA 3OWCA 4FD7A 4LQ6A 2CY2A 4KOUA 3FB3A 3S6HA 2G0BA 5IV0A 1M4IA 3A9LA 5KTCA 4Q7AA 4DNCA 3CZXA 4ZGYB 4FUUA 3FVLA 2GE3A 2D4OA 3F8KA 4M6HA 2ANPA 5F46A 5KTDA 3IEHA 4NFRA 4CAVA 2WPWA 1Y7EA 5F48A 2ZEMA 3TOAA 3IJ3A 2FIAA 3KR4A 2P6FA 4L8AA 4P4IA 3VWDA 1Q2CA 5HXDA 2G3TA 3PB7X 4M6IA 3TT2A 1Q7LA 4FD4A 3IWWA 3D7HA 3K2KA 4R8FA 5DWNA 4BBHA 4EVYA 2QJ8A 4C2XA 1BPNA 2B58A 4OMEA 4B13A 4BD9A 2F5IA 1KUVA 1F57A 1IYKA 4MCPA 4CYOA 2XEGA 4II9A 2I00A 2C6CA 2Q51A 1IOIA 5AG4A 4H6UA 1S7FA 1QMUA 4MY3A 3PP9A 1XJOA 1HDQA 1V0CA 2C27A 4UWJA 4A33A 2JBJA 4DJLA 3RBUA 1QQ9A 2IL4A 2P6EA 3PBBA 4AVBA 5LYLA 1TKHA 2R8VA 1KUXA 3SI1A 3PGPA 4MFQA 2RB7A 2CTBA 4AVCA 4JD6A 2R7HA 4F9UA 1XOVA 1ZG7A 2PR1A 3L2NA 2ZELA 2FIWA 3F5BA 2C6GA 4UEEA 5CNPA 4P4DA 4B5PB 1MK4A 3PB9X 4ZBGA 4NJRA 4ZY0A 4MCRA 2EBJA 3GYAA 4UCPA 3RAMA 3JTKA 2PRQA 1KUYA 1B87A 1FNOA 1GYTA 1YREA 2ZW5A 1J4JA 2Q0YA 2PJ0A 4X3RA 1I1DA 6CPAA 3FBUA 1PCAA 3PB8X 1XEBA 3BI1A 1VIXA 5F09A 3N7ZA 3QB8A 1KZFA 4PXEA 4RS2A 2JEWA 4UIAA 2RC4A 3GIUA 5HH1A 4NGQA 3SXNA 5IX3A 4UIBA 2OZHA 2QIRA 4MI4A 3H8EA 2CIJA 1IB1E 2EWBA 3TC8A 4CYNA 4Q38A 4B6ZA 3EFAA 1ZG9A 4MMOA 3ISZA 4ORFA 4CGLA 4R7MA 1YGHA 3SJFA 1YW6A 4P4EA 4XNHB 4F0YA 4BMHA 3QAHA 2GLFA 1XIXA 4OLLA 4MHZA 2ZEDA 4JJXA 5THWA 3PBEA 4AB7A 3B3TA 1XF8A 4KVXA 2FT0A 2Q44A 4A2ZA 1F2OA 2JDCA 3S9NA 2PCUA 2VZYA 4A31A 1MJ9A 4FBEA 5KTAA 4G1PA 3IFEA 3RO0A 5AG6A 4LQGA 3GUXA 4RI1A 3UY5A 3I9SA 2ZOGA 2OR4A 4OC4A 4UA3A 4KSIA 4RUHA 1ELLP 1F2PA 3NH4A 4K3NA 1CX8A 3K9TA 2Z3PA 4B5OA 3NE7A 2BUEA 5K8OA 4UF4A 2DPTA 3D8PA 3IC1A 4WWVA 1NE9A 2BEIA 3HLPA 1BPMA 2V8GA 4Q36A 2XEFA 1NMTA 3WC7A 3KL9A 4NGRA 4UCNA 1A2ZA 3LACA 1ZO0A 2VZZA 3BXMA 1S7NA 2G3AA 3D2PA 5JGFA 2PJ3A 4YWYA 1YMEA 2DF5A 3GKRA 4A95A 5C88A 3VWEA 3SJXA 3D2MA 1CBXA 1SQHA 2O4HA 4C2YA 3IWGA 2FXFA 4YGOA 4CYPA 1IGBA 1CG2A 3D7GA 2B5GA 3IIBA 3K9UA 4R57A 4KSAA 4U9ZA 4UWIA 1TF8A 3PZJA 3NFZA 4OC2A 3PB4X 3ZZIA 5H86A 3R95A 4UFWA 4CAWA 4KUBA 2V77A 3B35A 1S5KA 3KR5A 4Y49C 5G20A 4P4JA 3R96A 2ABZA 1IIDA 3NA6A 1BOBA 2X7BA 1PYTB 4E2AA 3TCVA 1CJWA 2JEVA 3DR8A 4KOSA 3NE8A 4OIWA 4I49A 5AG7A 2H5MA 2VI7A 3B8GA 3VH9A 4PV6A 1CPXA 2Z11A 4F9VA 1M4LA 2ZEGA 3SI2A 2OZGA 2R1IA 2P0WA 1Z8WA 2GU2A 3FX6A 2IJZA 2PC1A 4H2KA 4HPSA 4UEZA 5I0CA 4J3GA 4NEXA 2Q4YA 1LFWA 3DGVA 2EUIA 2Q4ZA 1QSOA 4CPAA 2ZW6A 2PJ9A 3BHXA 1AYEA 2JBKA 4MJ8A 2J8NA 2WYRA 4NCZA 2PR8A 1YQEA 2BCOA 1QSNA 3SJGA 2FE7A 4B11A 1S7KA 1Y9WA 1YX0A 1B6BA 2IQ6A 4NJQA 5JM6A 2J8MA 2HQYA 4JLYA 4MFLA 5GCNA 3SJEA 1Y0YA 4BINA 2ZW7A 2CF4A 2Q4VA 2AE6A 5JQ4A 2NSMA 1IOFA 4ZY1A 4TNUA 1TXRA 5DS0A 1Z9UA 4OC3A 4EMEA 4XPDB 4HNXB 1Z5RA 1CPSA 5D29A 3MN8A 2GANA 4ZY2A 2J9AA 2WSAA 4A32A 4MHNA 3CXSA 2HB6A 3FNCA 4C7HA 1DE4C 2V8VA 3IO1A 4UBRA 3DNSA 4YFJA 3C26A 3FIXA 4H89A 3D7DA 4MFZA 4XPKA 2B3UA 3KHXA 2I3CA 3FRMA 2KCWA 2JDDA 3TTHA 3WR7A 3PFOA 2HV2A 3S6GA 3V7ZA 1M4DA 3P2FA 3R9FA 4OP4A 2Z3NA 2FL4A 4CAFA 5AGEA 3PB6X 2Z3LA 4PSXA 2AFXA 5LRGA 1YW4A 1YLOA 3QAYA 3KGQA 5K8NA 3GB0A 5EC4A 4NF1A 2CXAA 2RFHA 3FYNA 4P6YA 4E8OA 4MHPA 3R9EA 2NYQA 4KVME 1ELMP 1LAPA 1N71A 4JWPA 3H8FA 2AFSA 4QC6A 2EK8A 1Z8XA 3TO6A 4B12A 3JRUA 4CAXA 1BO4A 4CRZB 2YNCC 4X5KA 1BLLE 2FCKA 2OB0A 2QYVA 2VQYA 3D67A 3H4QA 4PQAA 4F8ZA 4AVAA 3IGRA 1AUGA 4OC0A 5HVHA 4KOWA 2PRBA 2XEJA 3JVNA 1Q2YA 3IU2A 4MCSA 4KOYA 3I1UA 3EY5A 3GY9A 3G3SA 1R43A 2OU2A 4GM5A 4C7IA 2AFMA 4MCQA 4KOXA 1Z8TA 1UFHA 3NH5A 5J8FA 1VHSA 1RTQA 4R87A 2Z3OA 3TX8A 4E0AA 3BJ7A 1M44A 2B4DB 4QB9A 1TIQA 5G22A 4IAVA 4CGPA 4QUSA 1R57A 1UWYA 4M3SA 5CBMA 4W9YA 1HEEA 1M1DA 1TKJA 2REFA 1IICA 1ZLIA 4B10A 4R3KA 2B5GB 3ISXA 3KQXA 3IU1A 3H5ZA 2A4NA 5HVGA 2DEAA 5LRJA 2PJ6A 2PSWA 3EXNA 4PPZA 4PSWA 3TE4A 3DDDA 1LANA 1L0CA 3CT9A 4XNHC 3T9YA 4CRYB 3E0KA 4ZYQA 2Z3KA 4JZ0A 4PXDA 4CGNA 1YVKA 3PFEA 3B2YA 4ONWA 1FY7A 1IYLA 3SHPA 2QVPA 4KSFA 2AJ6A 3RYOA 5IB0A 3T8WA 4AG7A 3V8IA 5LRKA 2ARHA 2O28A 2Z3MA 1CP7A 3D66A 3GLJA 2O53A 2R98A 5EBVA 2GREA 1PUAA 4M85A 2PJ5A 2PJ2A 5FVJA 2CNTA 4QVTA 5H84A 4O23A 2PJ4A 1FT7A 3TO9A 1WK4A 1M4GA 3W91A 3CPXA 4NSQA 4F0XA 2ODFA 2VXKA 5AG5A 2OOTA 3RNZA 3I3GA 4NGTA 2ZEPA 3DLJA 2AFUA 4NXYA 4KLVA 4JXRA 4WJBA 2Z0ZA 1YLEA 1ZG8A 3B3SA 3BI0A 2F7VA 3B7IA 3D4UA 3LD2A 4CYQA 4MHDA 4Z65A 3HUVA 2FSRA 3FH4A 3ZJ0A 3G8WA 2XEIA 3MGDA 4DYOA 2CTCA 1VHOA 1DTDA 4HKFA 5F49A 3B3VA 2GLJA 3QNVA 4NGSA 1JWQA 2YNDA 3LWUA 3D3SA 2HC9A 4MFJA 5J1QA 2DPSA 4FAIA 2VL1A 3S9MA 2WUUA 5E96A 1RO5A 2PJ8A 3S6FA 2P6GA 4KUAA 2PJ1A 3FEEA 4L89A 4PK3A 5G21A 1NSLA 5DWMA 3FF3A 4ZX8A 4ZI6A 2POKA 4R6TA 4EWTA 1ARMA 4IK2A 3WC5A 4KS9A 4LUAA 3DSBA 1S7LA 4MY0A 4NGPA 4YRHA 2WZNA 5HMNA 3TFYA 3CDXA 3FEDA 5EMIA 1QSMA 3VARA 4GXHA 2Q04A 4CGMA
chains in the Genus database with same CATH topology
4CGOA 4AG9A 1XMTA 3W6XA 5ISVA 2FS5A 2BL1A 3R1KA 1MJBA 3TOBA 2JLMA 4MBUA 4UFXA 4HNWB 2B4BA 5J8CA 1I21A 2PQ8A 2J8RA 2B3VA 4FD6A 3F0AA 4OAEA 3IWEA 4CS0B 3BJ8A 4R9MA 4MFKA 4UCMA 1Z4EA 3S6KA 4KVOE 2PDOA 4IUSA 5BWAB 4XPDC 4H6ZA 4HNYB 3JUWA 1LRZA 2D4PA 2BSWA 2I79A 3T90A 4KOVA 4U9YA 4K30A 4IF5A 1PU9A 4C2ZA 2GIVA 2YNEA 2VBQA 1VKCA 1P0HA 1QSRA 4ONUA 2Q7BA 2YNCA 3P2HA 1ON0A 4UFVA 3SXOA 3DR6A 4MFPA 4XPLA 3EO4A 1RXTA 1QSTA 4B5PA 5C82A 2WPXA 1I12A 1Y7RA 3R9GA 1Q2DA 2ZW4A 2EVNA 2YGWA 1S60A 3W6SA 3CXPA 1WWZA 4GS4A 2CNMA 5F47A 2ATRA 4KORA 4CAEA 2REEA 1YR0A 2Y0MA 1Z4RA 4FD5A 1S3ZA 4Y49B 5G1ZA 2ZXVA 3TO7A 2VEZA 1GHEA 4QBJA 5JPHA 2HUZA 3EC4A 4LX9A 2ZPAA 3CXQA 2Z10A 2K5TA 2DXQA 2OZUA 3BLNA 1MJAA 2CNSA 1Y9KA 2NMTA 4C68A 1K4JA 2B4DA 4F6AA 5A28A 1P4NA 1YK3A 2OH1A 4R3LA 4KLWA 3LODA 4PK2A 3KKWA 4A30A 1CM0A 4KZTA 3FXTA 1XE4A 5A27A 2QECA 2QMLA 4KOTA 4JXQA 4OADA 1U6MA 1YVOA 1OZPA 4U5YA 4B14A 3OWCA 4FD7A 5IV0A 2CY2A 4KOUA 3FB3A 3S6HA 2G0BA 5KTCA 1M4IA 3A9LA 4DNCA 4ZGYB 2GE3A 2D4OA 3F8KA 5F46A 5KTDA 4CAVA 2WPWA 3TOAA 5F48A 2FIAA 2P6FA 4L8AA 3VWDA 1Q2CA 2G3TA 3TT2A 4BBHA 4FD4A 5DWNA 4EVYA 4C2XA 2B58A 4B13A 2F5IA 1KUVA 4CYOA 1IYKA 4II9A 2I00A 5AG4A 4H6UA 1S7FA 4MY3A 3PP9A 1V0CA 2C27A 4UWJA 4A33A 2IL4A 2P6EA 4AVBA 2R8VA 1KUXA 3PGPA 4MFQA 4AVCA 4JD6A 2R7HA 2PR1A 2FIWA 3F5BA 4B5PB 5CNPA 1MK4A 4ZBGA 3GYAA 4UCPA 3JTKA 2ZW5A 1KUYA 1B87A 1YREA 1J4JA 2Q0YA 1I1DA 3FBUA 1XEBA 3N7ZA 3QB8A 1KZFA 4RS2A 2RC4A 5HH1A 5IX3A 3SXNA 2OZHA 2QIRA 4MI4A 1IB1E 4CYNA 4Q38A 3EFAA 4ORFA 4CGLA 1YGHA 4XNHB 4F0YA 4BMHA 3QAHA 4OLLA 1XIXA 4JJXA 4AB7A 1XF8A 4KVXA 2FT0A 2Q44A 4A2ZA 2JDCA 2VZYA 1QSMA 1MJ9A 4A31A 5KTAA 5AG6A 4RI1A 3UY5A 3I9SA 4UA3A 2Z3PA 4B5OA 3NE7A 2BUEA 2DPTA 3D8PA 1NE9A 2BEIA 4Q36A 1NMTA 4UCNA 1ZO0A 2VZZA 1S7NA 2G3AA 3D2PA 5C88A 4A95A 3VWEA 3D2MA 1SQHA 4C2YA 3IWGA 2FXFA 4YGOA 4CYPA 2B5GA 4UWIA 3K9UA 4R57A 4KSAA 4U9ZA 3PZJA 3ZZIA 5H86A 3R95A 4UFWA 4CAWA 4KUBA 4Y49C 5G20A 1S5KA 3R96A 1IIDA 1BOBA 2X7BA 4E2AA 3TCVA 1CJWA 2JEVA 3DR8A 4KOSA 5AG7A 4I49A 2H5MA 2VI7A 3B8GA 4PV6A 2Z11A 2OZGA 2R1IA 2P0WA 2PC1A 5I0CA 4J3GA 4NEXA 2Q4YA 2EUIA 1QSOA 2ZW6A 4MJ8A 2J8NA 4NCZA 2PR8A 1QSNA 2FE7A 4B11A 1S7KA 1Y9WA 1YX0A 1B6BA 2J8MA 2HQYA 4JLYA 4MFLA 5GCNA 2ZW7A 2Q4VA 2AE6A 5JQ4A 1Z9UA 4XPDB 4HNXB 2GANA 2WSAA 4A32A 3CXSA 3FNCA 4C7HA 4UBRA 3DNSA 4YFJA 3C26A 3FIXA 4H89A 4MFZA 4XPKA 2B3UA 3FRMA 2KCWA 2JDDA 3TTHA 3WR7A 2HV2A 3S6GA 1M4DA 3P2FA 3R9FA 2Z3NA 2FL4A 4CAFA 5AGEA 2Z3LA 4PSXA 5EC4A 4NF1A 2CXAA 3FYNA 4E8OA 3R9EA 4KVME 1N71A 4JWPA 4QC6A 3TO6A 4B12A 4CAXA 1BO4A 2YNCC 4X5KA 2FCKA 4CRZB 2OB0A 2VQYA 3H4QA 4AVAA 3IGRA 4KOWA 2PRBA 3JVNA 1Q2YA 3IU2A 4KOYA 3EY5A 3GY9A 3G3SA 2OU2A 4C7IA 4KOXA 1UFHA 5J8FA 1VHSA 4R87A 2Z3OA 4E0AA 3BJ7A 1M44A 2B4DB 4QB9A 1TIQA 5G22A 4CGPA 4QUSA 1R57A 4M3SA 1M1DA 2REFA 1IICA 4B10A 4R3KA 2B5GB 3IU1A 3H5ZA 2A4NA 2PSWA 3EXNA 4PSWA 3TE4A 3DDDA 4XNHC 1L0CA 3T9YA 4CRYB 3E0KA 2Z3KA 4CGNA 1YVKA 1FY7A 1IYLA 3SHPA 4KSFA 2AJ6A 3RYOA 5IB0A 4AG7A 3V8IA 2ARHA 2O28A 2Z3MA 5EBVA 2R98A 1PUAA 4M85A 5FVJA 2CNTA 4QVTA 5H84A 3TO9A 1WK4A 1M4GA 3W91A 4NSQA 4F0XA 2VXKA 5AG5A 3I3GA 4NXYA 4KLVA 4JXRA 2Z0ZA 1YLEA 3LD2A 4CYQA 4MHDA 3ZJ0A 2FSRA 3G8WA 3MGDA 5F49A 4HKFA 2YNDA 4MFJA 3D3SA 2DPSA 2WUUA 5E96A 1RO5A 3S6FA 2P6GA 4KUAA 4L89A 4PK3A 1NSLA 5G21A 5DWMA 4KS9A 4LUAA 3DSBA 1S7LA 4MY0A 4YRHA 5HMNA 3TFYA 3GKRA 2Q04A 4CGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSA A;  5G22 A;  4A32 A;  4CGP A;  4CGO A;  4C7H A;  4CYN A;  4A30 A;  4UFW A;  5G20 A;  4CGL A;  4B12 A;  4B10 A;  5A27 A;  2YND A;  4BBH A;  4B11 A;  2YNC C;  3IU1 A;  4UFX A;  3H5Z A;  2WUU A;  4UCP A;  4C2X A;  4CYP A;  3JTK A;  5AG7 A;  4B13 A;  4UCN A;  4C2Z A;  5AG5 A;  4C68 A;  4CAE A;  4CYO A;  5A28 A;  2YNE A;  5G21 A;  3IU2 A;  4A2Z A;  5AGE A;  4CAF A;  5AG4 A;  3IWE A;  4B14 A;  4A31 A;  4A95 A;  2YNC A;  4A33 A;  4C7I A;  4C2Y A;  4UFV A;  4CGN A;  5AG6 A;  4UCM A;  4CYQ A;  5G1Z A;  4CGM A; 
#chains in the Genus database with same CATH topology
 2ZEE A;  4A94 A;  4CGO A;  8CPA A;  4OID A;  4AG9 A;  5HVF A;  1XMT A;  3W6X A;  5ISV A;  2EK9 A;  2FS5 A;  2BL1 A;  2ZOF A;  3R1K A;  4NGM A;  1MJB A;  4JYW A;  3TOB A;  2JLM A;  4MBU A;  4UFX A;  2C1C A;  1Y0R A;  4HNW B;  2B4B A;  5J8C A;  1I21 A;  2PQ8 A;  2J8R A;  2EO8 A;  2B3V A;  4PXB A;  4TWE A;  4FD6 A;  3PEI A;  3F0A A;  1BAV A;  4OAE A;  2ZEO A;  1YSJ A;  2IMO A;  3IWE A;  4A38 A;  4CS0 B;  3FEC A;  3BJ8 A;  3KI9 A;  4R9M A;  4MFK A;  3WC6 A;  1ZLH A;  4MRI A;  4P4B A;  4UCM A;  1KWM A;  1Z4E A;  3S6K A;  5LYI A;  5IB9 A;  2ZEF A;  4KVO E;  2PDO A;  4IUS A;  1HDU A;  7CPA A;  1IY7 A;  2BO9 A;  4MXU A;  5D8N A;  5BWA B;  2AFW A;  4XPD C;  4H6Z A;  4HNY B;  3JUW A;  1LRZ A;  1Z8L A;  2D4P A;  2BSW A;  2I79 A;  3T90 A;  4KOV A;  1LOK A;  4U9Y A;  1VHE A;  4X8I A;  4K30 A;  3V38 A;  4IF5 A;  5K8M A;  4A37 A;  1PU9 A;  4C2Z A;  4PXC A;  1JQG A;  2GIV A;  4UEF A;  2YNE A;  3N5F A;  2GFQ A;  2VBQ A;  1VKC A;  1P0H A;  1QSR A;  4IHM A;  4ONU A;  2Q7B A;  2YNC A;  3P2H A;  1ON0 A;  4UFV A;  3SXO A;  1AMP A;  3DR6 A;  4MFP A;  4XPL A;  3EO4 A;  1RXT A;  1QST A;  4B5P A;  4DUK A;  5C82 A;  1Z2L A;  2WPX A;  1I12 A;  1NSA A;  1Y7R A;  4P45 A;  3R9G A;  1Q2D A;  2PIY A;  2ZW4 A;  4M6G A;  1VGY A;  2PJA A;  4OC5 A;  1ARL A;  2EVN A;  1XFO A;  1S60 A;  2YGW A;  3RZA A;  3D7F A;  3W6S A;  1LAM A;  4X2T A;  1R3N A;  4P44 A;  2Q43 A;  3CXP A;  4A39 A;  4MHY A;  1XBU A;  2PE3 A;  3FMC A;  3MRU A;  1WWZ A;  4GS4 A;  2CNM A;  5LYF A;  5F47 A;  2ATR A;  2ZEH A;  4KOR A;  4CAE A;  5JH9 A;  3S9L A;  2REE A;  1YR0 A;  2Y0M A;  1Z4R A;  3KQZ A;  4P4F A;  1LCP A;  1CP6 A;  1X10 A;  2V8D A;  1XRY A;  5ELY A;  4FD5 A;  4OKO A;  1S3Z A;  3WAB A;  4Y49 B;  5G1Z A;  2ZXV A;  4EFD A;  4NGN A;  5A28 A;  2PJ7 A;  3TO7 A;  2VEZ A;  1GHE A;  4QBJ A;  5JPH A;  2HUZ A;  3EC4 A;  4ZX9 A;  4LX9 A;  3KAS A;  2ZPA A;  3CXQ A;  2Z10 A;  2K5T A;  3KZW A;  4YU9 A;  5I4M A;  2DXQ A;  3PRT A;  4P10 A;  2OZU A;  1XMB A;  2Q7S A;  2PVW A;  2G9D A;  2AFO A;  3BLN A;  1MJA A;  2CNS A;  3FJU A;  3VAT A;  1Y9K A;  2NMT A;  3B3W A;  4C68 A;  1K4J A;  2B4D A;  4FWU A;  4F6A A;  1P4N A;  2AFZ A;  2FVG A;  3KHZ A;  3NH8 A;  1YK3 A;  2OH1 A;  3WT4 A;  4R3L A;  3LMS A;  4KLW A;  3LOD A;  1TKF A;  5CPA A;  4RN7 A;  4PK2 A;  1EE3 P;  1IU8 A;  3KKW A;  4A30 A;  3SI0 A;  1CM0 A;  4KZT A;  1X12 A;  2PIZ A;  2F8H A;  1H8L A;  3FXT A;  1OBR A;  1XE4 A;  2ZEN A;  5A27 A;  1TF9 A;  4OC1 A;  2QEC A;  3D68 A;  2QML A;  3CPA A;  2PJC A;  4KOT A;  4JXQ A;  4OAD A;  2BOA A;  2C6P A;  2V8H A;  1U6M A;  1YVO A;  4R76 A;  5LYD A;  2PVV A;  1OZP A;  2PJB A;  4U5Y A;  3B3C A;  3H8G A;  4B14 A;  4AXV A;  5K8P A;  3OWC A;  4FD7 A;  4LQ6 A;  2CY2 A;  4KOU A;  3FB3 A;  3S6H A;  2G0B A;  5IV0 A;  1M4I A;  3A9L A;  5KTC A;  4Q7A A;  4DNC A;  3CZX A;  4ZGY B;  4FUU A;  3FVL A;  2GE3 A;  2D4O A;  3F8K A;  4M6H A;  2ANP A;  5F46 A;  5KTD A;  3IEH A;  4NFR A;  4CAV A;  2WPW A;  1Y7E A;  5F48 A;  2ZEM A;  3TOA A;  3IJ3 A;  2FIA A;  3KR4 A;  2P6F A;  4L8A A;  4P4I A;  3VWD A;  1Q2C A;  5HXD A;  2G3T A;  3PB7 X;  4M6I A;  3TT2 A;  1Q7L A;  4FD4 A;  3IWW A;  3D7H A;  3K2K A;  4R8F A;  5DWN A;  4BBH A;  4EVY A;  2QJ8 A;  4C2X A;  1BPN A;  2B58 A;  4OME A;  4B13 A;  4BD9 A;  2F5I A;  1KUV A;  1F57 A;  1IYK A;  4MCP A;  4CYO A;  2XEG A;  4II9 A;  2I00 A;  2C6C A;  2Q51 A;  1IOI A;  5AG4 A;  4H6U A;  1S7F A;  1QMU A;  4MY3 A;  3PP9 A;  1XJO A;  1HDQ A;  1V0C A;  2C27 A;  4UWJ A;  4A33 A;  2JBJ A;  4DJL A;  3RBU A;  1QQ9 A;  2IL4 A;  2P6E A;  3PBB A;  4AVB A;  5LYL A;  1TKH A;  2R8V A;  1KUX A;  3SI1 A;  3PGP A;  4MFQ A;  2RB7 A;  2CTB A;  4AVC A;  4JD6 A;  2R7H A;  4F9U A;  1XOV A;  1ZG7 A;  2PR1 A;  3L2N A;  2ZEL A;  2FIW A;  3F5B A;  2C6G A;  4UEE A;  5CNP A;  4P4D A;  4B5P B;  1MK4 A;  3PB9 X;  4ZBG A;  4NJR A;  4ZY0 A;  4MCR A;  2EBJ A;  3GYA A;  4UCP A;  3RAM A;  3JTK A;  2PRQ A;  1KUY A;  1B87 A;  1FNO A;  1GYT A;  1YRE A;  2ZW5 A;  1J4J A;  2Q0Y A;  2PJ0 A;  4X3R A;  1I1D A;  6CPA A;  3FBU A;  1PCA A;  3PB8 X;  1XEB A;  3BI1 A;  1VIX A;  5F09 A;  3N7Z A;  3QB8 A;  1KZF A;  4PXE A;  4RS2 A;  2JEW A;  4UIA A;  2RC4 A;  3GIU A;  5HH1 A;  4NGQ A;  3SXN A;  5IX3 A;  4UIB A;  2OZH A;  2QIR A;  4MI4 A;  3H8E A;  2CIJ A;  1IB1 E;  2EWB A;  3TC8 A;  4CYN A;  4Q38 A;  4B6Z A;  3EFA A;  1ZG9 A;  4MMO A;  3ISZ A;  4ORF A;  4CGL A;  4R7M A;  1YGH A;  3SJF A;  1YW6 A;  4P4E A;  4XNH B;  4F0Y A;  4BMH A;  3QAH A;  2GLF A;  1XIX A;  4OLL A;  4MHZ A;  2ZED A;  4JJX A;  5THW A;  3PBE A;  4AB7 A;  3B3T A;  1XF8 A;  4KVX A;  2FT0 A;  2Q44 A;  4A2Z A;  1F2O A;  2JDC A;  3S9N A;  2PCU A;  2VZY A;  4A31 A;  1MJ9 A;  4FBE A;  5KTA A;  4G1P A;  3IFE A;  3RO0 A;  5AG6 A;  4LQG A;  3GUX A;  4RI1 A;  3UY5 A;  3I9S A;  2ZOG A;  2OR4 A;  4OC4 A;  4UA3 A;  4KSI A;  4RUH A;  1ELL P;  1F2P A;  3NH4 A;  4K3N A;  1CX8 A;  3K9T A;  2Z3P A;  4B5O A;  3NE7 A;  2BUE A;  5K8O A;  4UF4 A;  2DPT A;  3D8P A;  3IC1 A;  4WWV A;  1NE9 A;  2BEI A;  3HLP A;  1BPM A;  2V8G A;  4Q36 A;  2XEF A;  1NMT A;  3WC7 A;  3KL9 A;  4NGR A;  4UCN A;  1A2Z A;  3LAC A;  1ZO0 A;  2VZZ A;  3BXM A;  1S7N A;  2G3A A;  3D2P A;  5JGF A;  2PJ3 A;  4YWY A;  1YME A;  2DF5 A;  3GKR A;  4A95 A;  5C88 A;  3VWE A;  3SJX A;  3D2M A;  1CBX A;  1SQH A;  2O4H A;  4C2Y A;  3IWG A;  2FXF A;  4YGO A;  4CYP A;  1IGB A;  1CG2 A;  3D7G A;  2B5G A;  3IIB A;  3K9U A;  4R57 A;  4KSA A;  4U9Z A;  4UWI A;  1TF8 A;  3PZJ A;  3NFZ A;  4OC2 A;  3PB4 X;  3ZZI A;  5H86 A;  3R95 A;  4UFW A;  4CAW A;  4KUB A;  2V77 A;  3B35 A;  1S5K A;  3KR5 A;  4Y49 C;  5G20 A;  4P4J A;  3R96 A;  2ABZ A;  1IID A;  3NA6 A;  1BOB A;  2X7B A;  1PYT B;  4E2A A;  3TCV A;  1CJW A;  2JEV A;  3DR8 A;  4KOS A;  3NE8 A;  4OIW A;  4I49 A;  5AG7 A;  2H5M A;  2VI7 A;  3B8G A;  3VH9 A;  4PV6 A;  1CPX A;  2Z11 A;  4F9V A;  1M4L A;  2ZEG A;  3SI2 A;  2OZG A;  2R1I A;  2P0W A;  1Z8W A;  2GU2 A;  3FX6 A;  2IJZ A;  2PC1 A;  4H2K A;  4HPS A;  4UEZ A;  5I0C A;  4J3G A;  4NEX A;  2Q4Y A;  1LFW A;  3DGV A;  2EUI A;  2Q4Z A;  1QSO A;  4CPA A;  2ZW6 A;  2PJ9 A;  3BHX A;  1AYE A;  2JBK A;  4MJ8 A;  2J8N A;  2WYR A;  4NCZ A;  2PR8 A;  1YQE A;  2BCO A;  1QSN A;  3SJG A;  2FE7 A;  4B11 A;  1S7K A;  1Y9W A;  1YX0 A;  1B6B A;  2IQ6 A;  4NJQ A;  5JM6 A;  2J8M A;  2HQY A;  4JLY A;  4MFL A;  5GCN A;  3SJE A;  1Y0Y A;  4BIN A;  2ZW7 A;  2CF4 A;  2Q4V A;  2AE6 A;  5JQ4 A;  2NSM A;  1IOF A;  4ZY1 A;  4TNU A;  1TXR A;  5DS0 A;  1Z9U A;  4OC3 A;  4EME A;  4XPD B;  4HNX B;  1Z5R A;  1CPS A;  5D29 A;  3MN8 A;  2GAN A;  4ZY2 A;  2J9A A;  2WSA A;  4A32 A;  4MHN A;  3CXS A;  2HB6 A;  3FNC A;  4C7H A;  1DE4 C;  2V8V A;  3IO1 A;  4UBR A;  3DNS A;  4YFJ A;  3C26 A;  3FIX A;  4H89 A;  3D7D A;  4MFZ A;  4XPK A;  2B3U A;  3KHX A;  2I3C A;  3FRM A;  2KCW A;  2JDD A;  3TTH A;  3WR7 A;  3PFO A;  2HV2 A;  3S6G A;  3V7Z A;  1M4D A;  3P2F A;  3R9F A;  4OP4 A;  2Z3N A;  2FL4 A;  4CAF A;  5AGE A;  3PB6 X;  2Z3L A;  4PSX A;  2AFX A;  5LRG A;  1YW4 A;  1YLO A;  3QAY A;  3KGQ A;  5K8N A;  3GB0 A;  5EC4 A;  4NF1 A;  2CXA A;  2RFH A;  3FYN A;  4P6Y A;  4E8O A;  4MHP A;  3R9E A;  2NYQ A;  4KVM E;  1ELM P;  1LAP A;  1N71 A;  4JWP A;  3H8F A;  2AFS A;  4QC6 A;  2EK8 A;  1Z8X A;  3TO6 A;  4B12 A;  3JRU A;  4CAX A;  1BO4 A;  4CRZ B;  2YNC C;  4X5K A;  1BLL E;  2FCK A;  2OB0 A;  2QYV A;  2VQY A;  3D67 A;  3H4Q A;  4PQA A;  4F8Z A;  4AVA A;  3IGR A;  1AUG A;  4OC0 A;  5HVH A;  4KOW A;  2PRB A;  2XEJ A;  3JVN A;  1Q2Y A;  3IU2 A;  4MCS A;  4KOY A;  3I1U A;  3EY5 A;  3GY9 A;  3G3S A;  1R43 A;  2OU2 A;  4GM5 A;  4C7I A;  2AFM A;  4MCQ A;  4KOX A;  1Z8T A;  1UFH A;  3NH5 A;  5J8F A;  1VHS A;  1RTQ A;  4R87 A;  2Z3O A;  3TX8 A;  4E0A A;  3BJ7 A;  1M44 A;  2B4D B;  4QB9 A;  1TIQ A;  5G22 A;  4IAV A;  4CGP A;  4QUS A;  1R57 A;  1UWY A;  4M3S A;  5CBM A;  4W9Y A;  1HEE A;  1M1D A;  1TKJ A;  2REF A;  1IIC A;  1ZLI A;  4B10 A;  4R3K A;  2B5G B;  3ISX A;  3KQX A;  3IU1 A;  3H5Z A;  2A4N A;  5HVG A;  2DEA A;  5LRJ A;  2PJ6 A;  2PSW A;  3EXN A;  4PPZ A;  4PSW A;  3TE4 A;  3DDD A;  1LAN A;  1L0C A;  3CT9 A;  4XNH C;  3T9Y A;  4CRY B;  3E0K A;  4ZYQ A;  2Z3K A;  4JZ0 A;  4PXD A;  4CGN A;  1YVK A;  3PFE A;  3B2Y A;  4ONW A;  1FY7 A;  1IYL A;  3SHP A;  2QVP A;  4KSF A;  2AJ6 A;  3RYO A;  5IB0 A;  3T8W A;  4AG7 A;  3V8I A;  5LRK A;  2ARH A;  2O28 A;  2Z3M A;  1CP7 A;  3D66 A;  3GLJ A;  2O53 A;  2R98 A;  5EBV A;  2GRE A;  1PUA A;  4M85 A;  2PJ5 A;  2PJ2 A;  5FVJ A;  2CNT A;  4QVT A;  5H84 A;  4O23 A;  2PJ4 A;  1FT7 A;  3TO9 A;  1WK4 A;  1M4G A;  3W91 A;  3CPX A;  4NSQ A;  4F0X A;  2ODF A;  2VXK A;  5AG5 A;  2OOT A;  3RNZ A;  3I3G A;  4NGT A;  2ZEP A;  3DLJ A;  2AFU A;  4NXY A;  4KLV A;  4JXR A;  4WJB A;  2Z0Z A;  1YLE A;  1ZG8 A;  3B3S A;  3BI0 A;  2F7V A;  3B7I A;  3D4U A;  3LD2 A;  4CYQ A;  4MHD A;  4Z65 A;  3HUV A;  2FSR A;  3FH4 A;  3ZJ0 A;  3G8W A;  2XEI A;  3MGD A;  4DYO A;  2CTC A;  1VHO A;  1DTD A;  4HKF A;  5F49 A;  3B3V A;  2GLJ A;  3QNV A;  4NGS A;  1JWQ A;  2YND A;  3LWU A;  3D3S A;  2HC9 A;  4MFJ A;  5J1Q A;  2DPS A;  4FAI A;  2VL1 A;  3S9M A;  2WUU A;  5E96 A;  1RO5 A;  2PJ8 A;  3S6F A;  2P6G A;  4KUA A;  2PJ1 A;  3FEE A;  4L89 A;  4PK3 A;  5G21 A;  1NSL A;  5DWM A;  3FF3 A;  4ZX8 A;  4ZI6 A;  2POK A;  4R6T A;  4EWT A;  1ARM A;  4IK2 A;  3WC5 A;  4KS9 A;  4LUA A;  3DSB A;  1S7L A;  4MY0 A;  4NGP A;  4YRH A;  2WZN A;  5HMN A;  3TFY A;  3CDX A;  3FED A;  5EMI A;  1QSM A;  3VAR A;  4GXH A;  2Q04 A;  4CGM A; 
#chains in the Genus database with same CATH homology
 4CGO A;  4AG9 A;  1XMT A;  3W6X A;  5ISV A;  2FS5 A;  2BL1 A;  3R1K A;  1MJB A;  3TOB A;  2JLM A;  4MBU A;  4UFX A;  4HNW B;  2B4B A;  5J8C A;  1I21 A;  2PQ8 A;  2J8R A;  2B3V A;  4FD6 A;  3F0A A;  4OAE A;  3IWE A;  4CS0 B;  3BJ8 A;  4R9M A;  4MFK A;  4UCM A;  1Z4E A;  3S6K A;  4KVO E;  2PDO A;  4IUS A;  5BWA B;  4XPD C;  4H6Z A;  4HNY B;  3JUW A;  1LRZ A;  2D4P A;  2BSW A;  2I79 A;  3T90 A;  4KOV A;  4U9Y A;  4K30 A;  4IF5 A;  1PU9 A;  4C2Z A;  2GIV A;  2YNE A;  2VBQ A;  1VKC A;  1P0H A;  1QSR A;  4ONU A;  2Q7B A;  2YNC A;  3P2H A;  1ON0 A;  4UFV A;  3SXO A;  3DR6 A;  4MFP A;  4XPL A;  3EO4 A;  1RXT A;  1QST A;  4B5P A;  5C82 A;  2WPX A;  1I12 A;  1Y7R A;  3R9G A;  1Q2D A;  2ZW4 A;  2EVN A;  2YGW A;  1S60 A;  3W6S A;  3CXP A;  1WWZ A;  4GS4 A;  2CNM A;  5F47 A;  2ATR A;  4KOR A;  4CAE A;  2REE A;  1YR0 A;  2Y0M A;  1Z4R A;  4FD5 A;  1S3Z A;  4Y49 B;  5G1Z A;  2ZXV A;  3TO7 A;  2VEZ A;  1GHE A;  4QBJ A;  5JPH A;  2HUZ A;  3EC4 A;  4LX9 A;  2ZPA A;  3CXQ A;  2Z10 A;  2K5T A;  2DXQ A;  2OZU A;  3BLN A;  1MJA A;  2CNS A;  1Y9K A;  2NMT A;  4C68 A;  1K4J A;  2B4D A;  4F6A A;  5A28 A;  1P4N A;  1YK3 A;  2OH1 A;  4R3L A;  4KLW A;  3LOD A;  4PK2 A;  3KKW A;  4A30 A;  1CM0 A;  4KZT A;  3FXT A;  1XE4 A;  5A27 A;  2QEC A;  2QML A;  4KOT A;  4JXQ A;  4OAD A;  1U6M A;  1YVO A;  1OZP A;  4U5Y A;  4B14 A;  3OWC A;  4FD7 A;  5IV0 A;  2CY2 A;  4KOU A;  3FB3 A;  3S6H A;  2G0B A;  5KTC A;  1M4I A;  3A9L A;  4DNC A;  4ZGY B;  2GE3 A;  2D4O A;  3F8K A;  5F46 A;  5KTD A;  4CAV A;  2WPW A;  3TOA A;  5F48 A;  2FIA A;  2P6F A;  4L8A A;  3VWD A;  1Q2C A;  2G3T A;  3TT2 A;  4BBH A;  4FD4 A;  5DWN A;  4EVY A;  4C2X A;  2B58 A;  4B13 A;  2F5I A;  1KUV A;  4CYO A;  1IYK A;  4II9 A;  2I00 A;  5AG4 A;  4H6U A;  1S7F A;  4MY3 A;  3PP9 A;  1V0C A;  2C27 A;  4UWJ A;  4A33 A;  2IL4 A;  2P6E A;  4AVB A;  2R8V A;  1KUX A;  3PGP A;  4MFQ A;  4AVC A;  4JD6 A;  2R7H A;  2PR1 A;  2FIW A;  3F5B A;  4B5P B;  5CNP A;  1MK4 A;  4ZBG A;  3GYA A;  4UCP A;  3JTK A;  2ZW5 A;  1KUY A;  1B87 A;  1YRE A;  1J4J A;  2Q0Y A;  1I1D A;  3FBU A;  1XEB A;  3N7Z A;  3QB8 A;  1KZF A;  4RS2 A;  2RC4 A;  5HH1 A;  5IX3 A;  3SXN A;  2OZH A;  2QIR A;  4MI4 A;  1IB1 E;  4CYN A;  4Q38 A;  3EFA A;  4ORF A;  4CGL A;  1YGH A;  4XNH B;  4F0Y A;  4BMH A;  3QAH A;  4OLL A;  1XIX A;  4JJX A;  4AB7 A;  1XF8 A;  4KVX A;  2FT0 A;  2Q44 A;  4A2Z A;  2JDC A;  2VZY A;  1QSM A;  1MJ9 A;  4A31 A;  5KTA A;  5AG6 A;  4RI1 A;  3UY5 A;  3I9S A;  4UA3 A;  2Z3P A;  4B5O A;  3NE7 A;  2BUE A;  2DPT A;  3D8P A;  1NE9 A;  2BEI A;  4Q36 A;  1NMT A;  4UCN A;  1ZO0 A;  2VZZ A;  1S7N A;  2G3A A;  3D2P A;  5C88 A;  4A95 A;  3VWE A;  3D2M A;  1SQH A;  4C2Y A;  3IWG A;  2FXF A;  4YGO A;  4CYP A;  2B5G A;  4UWI A;  3K9U A;  4R57 A;  4KSA A;  4U9Z A;  3PZJ A;  3ZZI A;  5H86 A;  3R95 A;  4UFW A;  4CAW A;  4KUB A;  4Y49 C;  5G20 A;  1S5K A;  3R96 A;  1IID A;  1BOB A;  2X7B A;  4E2A A;  3TCV A;  1CJW A;  2JEV A;  3DR8 A;  4KOS A;  5AG7 A;  4I49 A;  2H5M A;  2VI7 A;  3B8G A;  4PV6 A;  2Z11 A;  2OZG A;  2R1I A;  2P0W A;  2PC1 A;  5I0C A;  4J3G A;  4NEX A;  2Q4Y A;  2EUI A;  1QSO A;  2ZW6 A;  4MJ8 A;  2J8N A;  4NCZ A;  2PR8 A;  1QSN A;  2FE7 A;  4B11 A;  1S7K A;  1Y9W A;  1YX0 A;  1B6B A;  2J8M A;  2HQY A;  4JLY A;  4MFL A;  5GCN A;  2ZW7 A;  2Q4V A;  2AE6 A;  5JQ4 A;  1Z9U A;  4XPD B;  4HNX B;  2GAN A;  2WSA A;  4A32 A;  3CXS A;  3FNC A;  4C7H A;  4UBR A;  3DNS A;  4YFJ A;  3C26 A;  3FIX A;  4H89 A;  4MFZ A;  4XPK A;  2B3U A;  3FRM A;  2KCW A;  2JDD A;  3TTH A;  3WR7 A;  2HV2 A;  3S6G A;  1M4D A;  3P2F A;  3R9F A;  2Z3N A;  2FL4 A;  4CAF A;  5AGE A;  2Z3L A;  4PSX A;  5EC4 A;  4NF1 A;  2CXA A;  3FYN A;  4E8O A;  3R9E A;  4KVM E;  1N71 A;  4JWP A;  4QC6 A;  3TO6 A;  4B12 A;  4CAX A;  1BO4 A;  2YNC C;  4X5K A;  2FCK A;  4CRZ B;  2OB0 A;  2VQY A;  3H4Q A;  4AVA A;  3IGR A;  4KOW A;  2PRB A;  3JVN A;  1Q2Y A;  3IU2 A;  4KOY A;  3EY5 A;  3GY9 A;  3G3S A;  2OU2 A;  4C7I A;  4KOX A;  1UFH A;  5J8F A;  1VHS A;  4R87 A;  2Z3O A;  4E0A A;  3BJ7 A;  1M44 A;  2B4D B;  4QB9 A;  1TIQ A;  5G22 A;  4CGP A;  4QUS A;  1R57 A;  4M3S A;  1M1D A;  2REF A;  1IIC A;  4B10 A;  4R3K A;  2B5G B;  3IU1 A;  3H5Z A;  2A4N A;  2PSW A;  3EXN A;  4PSW A;  3TE4 A;  3DDD A;  4XNH C;  1L0C A;  3T9Y A;  4CRY B;  3E0K A;  2Z3K A;  4CGN A;  1YVK A;  1FY7 A;  1IYL A;  3SHP A;  4KSF A;  2AJ6 A;  3RYO A;  5IB0 A;  4AG7 A;  3V8I A;  2ARH A;  2O28 A;  2Z3M A;  5EBV A;  2R98 A;  1PUA A;  4M85 A;  5FVJ A;  2CNT A;  4QVT A;  5H84 A;  3TO9 A;  1WK4 A;  1M4G A;  3W91 A;  4NSQ A;  4F0X A;  2VXK A;  5AG5 A;  3I3G A;  4NXY A;  4KLV A;  4JXR A;  2Z0Z A;  1YLE A;  3LD2 A;  4CYQ A;  4MHD A;  3ZJ0 A;  2FSR A;  3G8W A;  3MGD A;  5F49 A;  4HKF A;  2YND A;  4MFJ A;  3D3S A;  2DPS A;  2WUU A;  5E96 A;  1RO5 A;  3S6F A;  2P6G A;  4KUA A;  4L89 A;  4PK3 A;  1NSL A;  5G21 A;  5DWM A;  4KS9 A;  4LUA A;  3DSB A;  1S7L A;  4MY0 A;  4YRH A;  5HMN A;  3TFY A;  3GKR A;  2Q04 A;  4CGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...