5G22A

Plasmodium vivax n-myristoyltransferase in complex with a quinoline inhibitor (compound 26)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
385
structure length
385
Chain Sequence
IDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Structure-guided optimization of quinoline inhibitors of Plasmodium N-myristoyltransferase.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 113
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2016-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5g22A00
4UFVA 4B13A 4B11A 5AGEA 3H5ZA 4A95A 5AG6A 4B10A 4C2YA 4C7HA 4B12A 4UCMA 4CYQA 2YNDA 4BBHA 4B14A 4CGPA 3IWEA 4UFWA 5AG7A 4A32A 4C2XA 5A27A 5A28A 5AG4A 4C2ZA 3IU2A 4A31A 2WUUA 2YNCC 4C7IA 3IU1A 5G21A 4C68A 4UFXA 4A2ZA 4CGMA 4UCPA 3JTKA 2YNCA 5G1ZA 4CGOA 4CGLA 5G22A 4UCNA 4A33A 2YNEA 4CAEA 4CYPA 4A30A 4CAFA 5AG5A 4CYOA 5G20A 4CGNA 2WSAA 4CYNA
chains in the Genus database with same CATH superfamily
2PJ9A 4AVBA 1VHEA 4FWUA 4UCMA 3R9GA 2CF4A 4G1PA 3FVLA 4U5YA 1X12A 2JEVA 4YRHA 4E0AA 2CNTA 3KKWA 1RTQA 1KUVA 3CXPA 3DLJA 2ZENA 2HV2A 1LAPA 2ZW6A 2BCOA 2NMTA 2CY2A 2PIZA 2JBJA 3FJUA 1QSOA 3F8KA 4M6GA 2Q4YA 3FIXA 3CZXA 4UA3A 3DGVA 2OR4A 2PCUA 4A33A 2ZPAA 3W6XA 4B5OA 3SXNA 3CT9A 4NGMA 5C88A 3N7ZA 5G20A 3D7HA 3TX8A 2PJ7A 5HXDA 3CXSA 4AXVA 2BUEA 4UFVA 3FH4A 4MFZA 5EC4A 1YSJA 2O4HA 4X8IA 5CNPA 2WZNA 4KUBA 4NSQA 2BO9A 3FB3A 5I4MA 5GCNA 4XPKA 1YR0A 1VHSA 3HLPA 5K8PA 2AFUA 2C6GA 3TE4A 4OC1A 4Y49C 4UFWA 4CS0B 2ANPA 2OH1A 1BOBA 2VXKA 3FMCA 4CRZB 3IU1A 3V8IA 4GS4A 4R3KA 4DNCA 2Z10A 5THWA 2PJCA 5LRJA 2RFHA 3T8WA 5BWAB 2XEFA 4OC5A 4OLLA 3GB0A 3VH9A 2C6CA 4MHYA 3GKRA 1PU9A 2JDCA 1ZLIA 1X10A 2AFWA 1SQHA 2ZXVA 3PEIA 3KR4A 4A39A 4L89A 1QSRA 1Y9WA 3OWCA 5HMNA 2AFOA 5K8MA 2PVWA 2RC4A 2V77A 4DJLA 5F46A 1M1DA 4KVOE 1TIQA 2AFSA 3BXMA 1CM0A 4KOUA 3IGRA 4OIWA 4AG9A 4B5PA 1CP6A 6CPAA 2QYVA 2OB0A 3GIUA 2B4DA 4CAVA 5J8FA 1YMEA 1ZLHA 3B3WA 1YW4A 4X3RA 4ORFA 4BINA 1FT7A 2OU2A 5AG7A 2Q04A 3JUWA 3RZAA 1YK3A 4AG7A 4PXDA 1H8LA 4F9VA 4A31A 3L2NA 2PJ5A 5ELYA 3S6GA 5IB0A 4MCSA 4OC3A 4JZ0A 1V0CA 2BSWA 4UEFA 4P4IA 4M6HA 3KQXA 2VI7A 1NE9A 4CAWA 3D66A 3D7FA 1IYLA 2ZEOA 2G3AA 2RB7A 3SJFA 4JYWA 4AVAA 1Y9KA 3PFEA 1ELMP 1M4IA 1OBRA 2CNSA 3IFEA 4FD5A 2JEWA 2ZEHA 3R9FA 2B3VA 4ZY0A 5ISVA 2DF5A 1XJOA 4AVCA 1BO4A 5F09A 4KUAA 5HH1A 1ZG8A 4UEEA 1RXTA 3IIBA 4F0YA 5AG4A 1HEEA 4A37A 3IU2A 3S6KA 2F5IA 4EVYA 4UFXA 4JXRA 1Q2DA 3D8PA 4MHZA 4MFQA 5G22A 1M4GA 2ZEFA 1B87A 1YX0A 2G0BA 2FXFA 5JQ4A 3BI1A 4MHPA 2FSRA 3W6SA 4KSIA 4GXHA 4KZTA 2QVPA 4MY3A 5D29A 1KWMA 1YVOA 3BHXA 4MXUA 4OIDA 5HVFA 4QB9A 2EUIA 4R7MA 5AGEA 4P4BA 2Z0ZA 5AG6A 4P4JA 1PCAA 3F0AA 4ONWA 3QAHA 3PRTA 2ABZA 3PFOA 1Z4EA 4YGOA 3K2KA 4BD9A 5LYLA 3IWEA 5LYDA 4Z65A 3S6FA 2ZOFA 1JQGA 1PYTB 3PZJA 2PC1A 3GUXA 4UWJA 5F49A 4C7IA 2ZEMA 4CGMA 2IMOA 2J8RA 4IAVA 3SJGA 5JM6A 3S6HA 2B3UA 2EBJA 1QMUA 1Z8XA 2PJ8A 3B8GA 4NGRA 4OADA 4OKOA 3EO4A 4UIAA 5EBVA 4M85A 4NCZA 3SXOA 5HVGA 3JVNA 4MFJA 3LMSA 1Q2YA 3DSBA 4OAEA 1FNOA 1QSMA 3R96A 4FAIA 1R3NA 4NJQA 3RYOA 4B11A 3FYNA 2BEIA 3TT2A 1LCPA 4LQGA 4OP4A 4II9A 4B12A 4NGPA 1CJWA 4MRIA 2PJ3A 4H6ZA 2Y0MA 4X5KA 4ZYQA 4DUKA 2Q51A 3H8FA 4R57A 2R7HA 2QIRA 3KGQA 3PB6X 2ZW7A 4NEXA 2CNMA 3T90A 3QB8A 2Q4VA 3SI0A 3G8WA 1BAVA 4P4EA 3B3SA 3ISZA 3TO9A 2Z3PA 2GFQA 3QNVA 4CYPA 5AG5A 2JLMA 1Y7EA 2EK9A 2B5GB 3DR8A 4RI1A 3VWEA 4E2AA 4R87A 4TWEA 2PJ2A 4NF1A 3TO7A 3DR6A 3D3SA 2F7VA 2PJ4A 4P6YA 4R76A 3KI9A 1K4JA 2XEGA 1MJBA 4PV6A 4ZY1A 2OZUA 3TOBA 5IV0A 4LQ6A 1NSAA 4Q36A 4YU9A 1S7NA 1VGYA 1LRZA 4NJRA 3NH4A 2GLJA 2O53A 1IIDA 1CX8A 2CTCA 4CAEA 1A2ZA 2X7BA 4A38A 4LX9A 4CAFA 4CYOA 1QQ9A 4HKFA 4ZY2A 4K3NA 4PQAA 1S3ZA 2EO8A 2G3TA 2OZHA 2AFXA 2CTBA 4MI4A 5JH9A 1M4DA 2DPSA 1Z8LA 4KOYA 1NMTA 3KL9A 4KSFA 1UFHA 2QECA 3B7IA 5I0CA 1VHOA 4B10A 4CRYB 3D4UA 3TTHA 1AUGA 1R43A 2I3CA 3D68A 3WABA 4MCQA 2P6FA 1WK4A 2ZELA 1TXRA 4KORA 3LODA 2EK8A 5A27A 5LRKA 2D4OA 1Q7LA 4R9MA 4WJBA 1ARMA 1GYTA 3H8EA 2DEAA 2YNCC 1S7LA 4OC4A 4A2ZA 4RS2A 1N71A 2AE6A 1F2OA 4MFPA 3RO0A 4RUHA 1AMPA 3R1KA 2FS5A 2R98A 5FVJA 2H5MA 4QVTA 3WC5A 2JDDA 3D2MA 3RNZA 3FX6A 1S7KA 2JBKA 2GANA 2EWBA 2HQYA 2OOTA 1CP7A 2GLFA 2R1IA 1LOKA 2ZEPA 3B3VA 4OMEA 4R6TA 4W9YA 3SJEA 3TOAA 3CPXA 3P2FA 2PRQA 2VQYA 4C7HA 5KTDA 1P0HA 3K9TA 4X2TA 2Z3NA 2Q7BA 4C2XA 2PSWA 2Q43A 4QUSA 2PIYA 4DYOA 5F48A 2B4DB 2NYQA 3FF3A 4MHDA 4CAXA 2C1CA 2WUUA 3WC6A 2AJ6A 3H8GA 3D7DA 5C82A 1L0CA 4FD4A 4XPLA 1ZG7A 4OC0A 3BLNA 4A30A 2D4PA 1XMBA 2C27A 2IQ6A 4MFLA 3RAMA 1R57A 3W91A 3NA6A 2F8HA 2WPXA 4NGTA 3KZWA 4F8ZA 4R3LA 1Z8WA 1BLLE 5LRGA 4JJXA 4MCRA 2FIWA 1IYKA 3NFZA 3FECA 2HC9A 2DPTA 4NXYA 4ZX8A 3LD2A 1ON0A 2KCWA 4B14A 1MJ9A 4PXBA 4H89A 4F9UA 4B6ZA 4C2ZA 1TKJA 4FUUA 4A94A 1LANA 3KHXA 4MFKA 4H6UA 4PK2A 4EWTA 1TF8A 1Z4RA 4F6AA 2ZOGA 1XBUA 4UCPA 3KASA 5E96A 2P6GA 3CDXA 3E0KA 3JTKA 1I12A 1BPNA 1IB1E 1XFOA 2QJ8A 5H84A 2ATRA 3GYAA 2PJ6A 4KOWA 4B13A 4HNXB 4NFRA 4PSWA 3R95A 3F5BA 3I3GA 3IO1A 3SJXA 3VARA 2GU2A 2XEIA 2FVGA 3KHZA 1YGHA 2Q0YA 3FNCA 3D2PA 3LWUA 4ONUA 4IUSA 4PXCA 5A28A 2CIJA 2IJZA 3C26A 3EC4A 1TKHA 1YLEA 4P4FA 2O28A 1NSLA 1IU8A 1XMTA 2REEA 4C68A 3NE7A 2B5GA 3I9SA 4FD6A 3PB9X 3S9NA 1P4NA 1JWQA 3BJ7A 5JGFA 2B4BA 8CPAA 4MBUA 2VZZA 1OZPA 2I00A 3UY5A 1KZFA 1IOIA 3H4QA 4ZI6A 3NH8A 4O23A 2WSAA 4RN7A 2GREA 1AYEA 4KSAA 4KOTA 4MHNA 5HVHA 4OC2A 3GY9A 2FCKA 4E8OA 2AFMA 1I21A 3B2YA 4KVXA 4A95A 5DS0A 2CXAA 3VATA 1Q2CA 2AFZA 4FBEA 4L8AA 3EFAA 1CG2A 5DWNA 2I79A 1IY7A 2YNDA 1U6MA 1M4LA 3TO6A 3DDDA 4BBHA 4EFDA 3HUVA 3DNSA 1DE4C 3PB8X 2A4NA 2Z3OA 2YGWA 4JXQA 2EVNA 1FY7A 2P0WA 4NGNA 4NGQA 4UF4A 1VIXA 4MMOA 3GLJA 2FE7A 3FBUA 4UEZA 2ZW4A 2HUZA 4UCNA 2PQ8A 3SI1A 1YVKA 4GM5A 5K8OA 2ARHA 1MK4A 4UWIA 1ZG9A 2FIAA 3KR5A 4NGSA 3V7ZA 4ZBGA 1M44A 1XF8A 2PDOA 3IEHA 1Y7RA 2Z3MA 4P44A 4CYNA 3T9YA 5K8NA 1Z5RA 4PSXA 1QSNA 2HB6A 2VL1A 2V8GA 3H5ZA 4P10A 2P6EA 4P4DA 2POKA 4U9YA 3MRUA 1YREA 3PBEA 4QBJA 2VBQA 3N5FA 3ZZIA 3S9LA 4KOXA 4FD7A 3R9EA 3IJ3A 3ISXA 2Z3KA 1LFWA 4A32A 3CPAA 2Z11A 4KOSA 1XOVA 2WPWA 3D67A 1HDQA 4Q7AA 3JRUA 2G9DA 3LACA 2PRBA 4IK2A 1XIXA 4YFJA 2PR1A 4Q38A 1HDUA 1MJAA 2DXQA 2Q7SA 3QAYA 3MN8A 3NH5A 4PPZA 2QMLA 4UBRA 5G1ZA 1TKFA 4H2KA 2J9AA 5KTCA 3TFYA 2Z3LA 1UWYA 3WR7A 1LAMA 5IX3A 4IHMA 3K9UA 3I1UA 4I49A 4CGNA 4KS9A 4JLYA 3IC1A 4KLVA 1B6BA 2VEZA 3G3SA 4XNHB 4K30A 1PUAA 4UIBA 1F2PA 3PP9A 1Z9UA 4U9ZA 2ZEEA 2FL4A 4XPDB 4MY0A 2PJ1A 1TF9A 3B35A 5F47A 1KUYA 3FRMA 3A9LA 4TNUA 1YLOA 3B3TA 3PB4X 3VWDA 5IB9A 4MCPA 4B5PB 1I1DA 4KOVA 1XRYA 4HNWB 5J1QA 1CPXA 2BOAA 1XEBA 1KUXA 5LYFA 1CBXA 4M3SA 2REFA 1CPSA 4WWVA 1S7FA 2ZEGA 3PBBA 2BL1A 2GE3A 4KVME 3WT4A 3FEEA 2V8DA 2OZGA 5EMIA 4R8FA 3TCVA 3ZJ0A 2Q4ZA 4LUAA 4EMEA 1IOFA 4P45A 1EE3P 4AB7A 2GIVA 3SHPA 1XE4A 1ZO0A 4C2YA 4IF5A 2PJAA 2PJ0A 4MJ8A 4YWYA 4CPAA 2PE3A 4CYQA 1IICA 2Q44A 5H86A 5KTAA 3MGDA 2J8NA 5JPHA 3B3CA 3P2HA 2R8VA 1IGBA 1S5KA 5DWMA 4CGLA 4F0XA 3EY5A 4XNHC 4ZX9A 1YW6A 1DTDA 1RO5A 5LYIA 3TC8A 4PK3A 1ELLP 3FXTA 3BJ8A 3PB7X 4XPDC 1Y0RA 3V38A 3RBUA 2J8MA 1GHEA 3S9MA 1J4JA 1QSTA 5D8NA 3D7GA 1F57A 3IWWA 2FT0A 2PVVA 5CBMA 2VZYA 2B58A 4ZGYB 2ZW5A 4JWPA 1YQEA 2ODFA 3PGPA 2C6PA 1BPMA 2IL4A 4PXEA 1Y0YA 2PR8A 4CGPA 3CXQA 5J8CA 2NSMA 4M6IA 4QC6A 3IWGA 3FEDA 2ZEDA 3NE8A 2V8HA 5G21A 4HPSA 3EXNA 4JD6A 1WWZA 3SI2A 4J3GA 4KLWA 3WC7A 2V8VA 2K5TA 2YNCA 4CGOA 2WYRA 1Z8TA 4HNYB 4Y49B 2YNEA 2XEJA 3BI0A 1ARLA 1Z2LA 2PJBA 5CPAA 7CPAA 4BMHA 3KQZA 1S60A 1VKCA
chains in the Genus database with same CATH topology
4AVBA 4UCMA 3R9GA 4U5YA 2JEVA 4E0AA 4YRHA 2CNTA 3KKWA 1KUVA 3CXPA 2HV2A 2ZW6A 2NMTA 2CY2A 1QSOA 3F8KA 2Q4YA 3FIXA 4UA3A 4A33A 2ZPAA 3W6XA 4B5OA 3SXNA 5C88A 3N7ZA 1VKCA 5G20A 3CXSA 2BUEA 4UFVA 4MFZA 5EC4A 5CNPA 4KUBA 4NSQA 3FB3A 5GCNA 4XPKA 1YR0A 1VHSA 3TE4A 4Y49C 4UFWA 4CS0B 2OH1A 1BOBA 2VXKA 4CRZB 3IU1A 3V8IA 4GS4A 4R3KA 4DNCA 2Z10A 5BWAB 4OLLA 3GKRA 2JDCA 2ZXVA 1SQHA 4L89A 1QSRA 1Y9WA 3OWCA 5HMNA 2RC4A 5F46A 1M1DA 4KVOE 1TIQA 1CM0A 4KOUA 3IGRA 4B5PA 4AG9A 2OB0A 2B4DA 4CAVA 5J8FA 4ORFA 2OU2A 5AG7A 2Q04A 3JUWA 1YK3A 4AG7A 4A31A 3S6GA 5IB0A 1V0CA 2BSWA 2VI7A 1NE9A 4CAWA 1IYLA 2G3AA 4AVAA 1Y9KA 1M4IA 2CNSA 4FD5A 3R9FA 2B3VA 5ISVA 4AVCA 1BO4A 4KUAA 5HH1A 1RXTA 4F0YA 5AG4A 3IU2A 3S6KA 2F5IA 4EVYA 4UFXA 4JXRA 1Q2DA 3D8PA 4MFQA 5G22A 1M4GA 1B87A 1YX0A 2G0BA 2FXFA 5JQ4A 2FSRA 3W6SA 4KZTA 4MY3A 1YVOA 4QB9A 2EUIA 5AGEA 2Z0ZA 5AG6A 3F0AA 3QAHA 1Z4EA 4YGOA 3IWEA 3S6FA 3PZJA 2PC1A 4UWJA 5F49A 4C7IA 4CGMA 2J8RA 3S6HA 2B3UA 3B8GA 4OADA 3EO4A 3SXOA 5EBVA 4M85A 4NCZA 3JVNA 4MFJA 1Q2YA 3DSBA 4OAEA 1QSMA 3R96A 3RYOA 4B11A 3FYNA 2BEIA 3TT2A 4II9A 4B12A 1CJWA 4H6ZA 2Y0MA 4X5KA 4R57A 2R7HA 2QIRA 2ZW7A 4NEXA 2CNMA 3T90A 3QB8A 2Q4VA 3G8WA 3TO9A 2Z3PA 4CYPA 5AG5A 2JLMA 3DR8A 4E2AA 2B5GB 4RI1A 3VWEA 4R87A 4NF1A 3TO7A 3DR6A 3D3SA 1K4JA 1MJBA 4PV6A 2OZUA 3TOBA 5IV0A 4Q36A 1S7NA 1LRZA 1IIDA 4CAEA 4CYOA 2X7BA 4CAFA 4LX9A 4HKFA 1S3ZA 2G3TA 2OZHA 4MI4A 1M4DA 2DPSA 4KOYA 1NMTA 4KSFA 1UFHA 2QECA 5I0CA 4B10A 4CRYB 3TTHA 2P6FA 1WK4A 4KORA 3LODA 5A27A 2D4OA 4R9MA 2YNCC 1S7LA 4A2ZA 4RS2A 1N71A 2AE6A 4MFPA 3R1KA 2FS5A 2R98A 5FVJA 2H5MA 4QVTA 2JDDA 3D2MA 1S7KA 2GANA 2HQYA 2R1IA 3TOAA 3P2FA 2VQYA 4C7HA 5KTDA 1P0HA 2Z3NA 2Q7BA 4C2XA 2PSWA 4QUSA 5F48A 2B4DB 4MHDA 4CAXA 2WUUA 2AJ6A 5C82A 1L0CA 4FD4A 4XPLA 3BLNA 4A30A 2D4PA 2C27A 4MFLA 1R57A 3W91A 2WPXA 4R3LA 4JJXA 2FIWA 1IYKA 2DPTA 4NXYA 3LD2A 1ON0A 2KCWA 4B14A 1MJ9A 4H89A 4C2ZA 4MFKA 4H6UA 4PK2A 1Z4RA 4F6AA 4UCPA 5E96A 2P6GA 3JTKA 3E0KA 1I12A 1IB1E 5H84A 2ATRA 3GYAA 4KOWA 4B13A 4HNXB 4PSWA 3R95A 3F5BA 3I3GA 1YGHA 2Q0YA 3FNCA 3D2PA 5A28A 4ONUA 4IUSA 3C26A 3EC4A 1YLEA 2O28A 1NSLA 1XMTA 2REEA 4C68A 3NE7A 2B5GA 3I9SA 4FD6A 1P4NA 3BJ7A 2B4BA 4MBUA 2VZZA 1OZPA 2I00A 3UY5A 1KZFA 3H4QA 2WSAA 4KSAA 4KOTA 3GY9A 2FCKA 4E8OA 1I21A 4KVXA 4A95A 2CXAA 1Q2CA 4L8AA 3EFAA 5DWNA 2I79A 2YNDA 3TO6A 1U6MA 4BBHA 3DDDA 3DNSA 2A4NA 2Z3OA 2YGWA 4JXQA 2EVNA 1FY7A 2P0WA 2FE7A 3FBUA 2ZW4A 2HUZA 4UCNA 2PQ8A 1YVKA 2ARHA 1MK4A 4UWIA 2FIAA 4ZBGA 1M44A 1XF8A 2PDOA 4CYNA 1Y7RA 2Z3MA 3T9YA 4PSXA 1QSNA 4U9YA 3H5ZA 2P6EA 1YREA 4QBJA 2VBQA 3ZZIA 4KOXA 4FD7A 3R9EA 2Z3KA 4A32A 2Z11A 4KOSA 2WPWA 2PRBA 1XIXA 4YFJA 2PR1A 4Q38A 1MJAA 2DXQA 5G1ZA 3TFYA 2QMLA 4UBRA 5KTCA 2Z3LA 3WR7A 5IX3A 3K9UA 4I49A 4CGNA 4KS9A 4JLYA 4KLVA 1B6BA 2VEZA 3G3SA 4XNHB 4K30A 1PUAA 3PP9A 1Z9UA 4U9ZA 4XPDB 2FL4A 4MY0A 5F47A 1KUYA 3FRMA 3A9LA 3VWDA 4B5PB 1I1DA 4KOVA 4HNWB 1XEBA 1KUXA 4M3SA 2REFA 1S7FA 2BL1A 2GE3A 4KVME 2OZGA 3TCVA 3ZJ0A 4LUAA 4AB7A 2GIVA 3SHPA 1XE4A 1ZO0A 4C2YA 4IF5A 4MJ8A 4CYQA 1IICA 2Q44A 5H86A 5KTAA 3MGDA 2J8NA 5JPHA 3P2HA 2R8VA 1S5KA 5DWMA 4CGLA 4F0XA 3EY5A 4XNHC 1RO5A 4PK3A 3FXTA 3BJ8A 4XPDC 2J8MA 1GHEA 1J4JA 1QSTA 2FT0A 2VZYA 2B58A 4ZGYB 2ZW5A 4JWPA 3PGPA 2IL4A 2PR8A 4CGPA 3CXQA 5J8CA 4QC6A 3IWGA 5G21A 3EXNA 4JD6A 1WWZA 4J3GA 4KLWA 2K5TA 2YNCA 4CGOA 4HNYB 4Y49B 2YNEA 4BMHA 1S60A 1PU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UFV A;  4B13 A;  4B11 A;  5AGE A;  3H5Z A;  4A95 A;  5AG6 A;  4B10 A;  4C2Y A;  4C7H A;  4B12 A;  4UCM A;  4CYQ A;  2YND A;  4BBH A;  4B14 A;  4CGP A;  3IWE A;  4UFW A;  5AG7 A;  4A32 A;  4C2X A;  5A27 A;  5A28 A;  5AG4 A;  4C2Z A;  3IU2 A;  4A31 A;  2WUU A;  2YNC C;  4C7I A;  3IU1 A;  5G21 A;  4C68 A;  4UFX A;  4A2Z A;  4CGM A;  4UCP A;  3JTK A;  2YNC A;  5G1Z A;  4CGO A;  4CGL A;  5G22 A;  4UCN A;  4A33 A;  2YNE A;  4CAE A;  4CYP A;  4A30 A;  4CAF A;  5AG5 A;  4CYO A;  5G20 A;  4CGN A;  2WSA A;  4CYN A; 
#chains in the Genus database with same CATH topology
 2PJ9 A;  4AVB A;  1VHE A;  4FWU A;  4UCM A;  3R9G A;  2CF4 A;  4G1P A;  3FVL A;  4U5Y A;  1X12 A;  2JEV A;  4YRH A;  4E0A A;  2CNT A;  3KKW A;  1RTQ A;  1KUV A;  3CXP A;  3DLJ A;  2ZEN A;  2HV2 A;  1LAP A;  2ZW6 A;  2BCO A;  2NMT A;  2CY2 A;  2PIZ A;  2JBJ A;  3FJU A;  1QSO A;  3F8K A;  4M6G A;  2Q4Y A;  3FIX A;  3CZX A;  4UA3 A;  3DGV A;  2OR4 A;  2PCU A;  4A33 A;  2ZPA A;  3W6X A;  4B5O A;  3SXN A;  3CT9 A;  4NGM A;  5C88 A;  3N7Z A;  5G20 A;  3D7H A;  3TX8 A;  2PJ7 A;  5HXD A;  3CXS A;  4AXV A;  2BUE A;  4UFV A;  3FH4 A;  4MFZ A;  5EC4 A;  1YSJ A;  2O4H A;  4X8I A;  5CNP A;  2WZN A;  4KUB A;  4NSQ A;  2BO9 A;  3FB3 A;  5I4M A;  5GCN A;  4XPK A;  1YR0 A;  1VHS A;  3HLP A;  5K8P A;  2AFU A;  2C6G A;  3TE4 A;  4OC1 A;  4Y49 C;  4UFW A;  4CS0 B;  2ANP A;  2OH1 A;  1BOB A;  2VXK A;  3FMC A;  4CRZ B;  3IU1 A;  3V8I A;  4GS4 A;  4R3K A;  4DNC A;  2Z10 A;  5THW A;  2PJC A;  5LRJ A;  2RFH A;  3T8W A;  5BWA B;  2XEF A;  4OC5 A;  4OLL A;  3GB0 A;  3VH9 A;  2C6C A;  4MHY A;  3GKR A;  1PU9 A;  2JDC A;  1ZLI A;  1X10 A;  2AFW A;  1SQH A;  2ZXV A;  3PEI A;  3KR4 A;  4A39 A;  4L89 A;  1QSR A;  1Y9W A;  3OWC A;  5HMN A;  2AFO A;  5K8M A;  2PVW A;  2RC4 A;  2V77 A;  4DJL A;  5F46 A;  1M1D A;  4KVO E;  1TIQ A;  2AFS A;  3BXM A;  1CM0 A;  4KOU A;  3IGR A;  4OIW A;  4AG9 A;  4B5P A;  1CP6 A;  6CPA A;  2QYV A;  2OB0 A;  3GIU A;  2B4D A;  4CAV A;  5J8F A;  1YME A;  1ZLH A;  3B3W A;  1YW4 A;  4X3R A;  4ORF A;  4BIN A;  1FT7 A;  2OU2 A;  5AG7 A;  2Q04 A;  3JUW A;  3RZA A;  1YK3 A;  4AG7 A;  4PXD A;  1H8L A;  4F9V A;  4A31 A;  3L2N A;  2PJ5 A;  5ELY A;  3S6G A;  5IB0 A;  4MCS A;  4OC3 A;  4JZ0 A;  1V0C A;  2BSW A;  4UEF A;  4P4I A;  4M6H A;  3KQX A;  2VI7 A;  1NE9 A;  4CAW A;  3D66 A;  3D7F A;  1IYL A;  2ZEO A;  2G3A A;  2RB7 A;  3SJF A;  4JYW A;  4AVA A;  1Y9K A;  3PFE A;  1ELM P;  1M4I A;  1OBR A;  2CNS A;  3IFE A;  4FD5 A;  2JEW A;  2ZEH A;  3R9F A;  2B3V A;  4ZY0 A;  5ISV A;  2DF5 A;  1XJO A;  4AVC A;  1BO4 A;  5F09 A;  4KUA A;  5HH1 A;  1ZG8 A;  4UEE A;  1RXT A;  3IIB A;  4F0Y A;  5AG4 A;  1HEE A;  4A37 A;  3IU2 A;  3S6K A;  2F5I A;  4EVY A;  4UFX A;  4JXR A;  1Q2D A;  3D8P A;  4MHZ A;  4MFQ A;  5G22 A;  1M4G A;  2ZEF A;  1B87 A;  1YX0 A;  2G0B A;  2FXF A;  5JQ4 A;  3BI1 A;  4MHP A;  2FSR A;  3W6S A;  4KSI A;  4GXH A;  4KZT A;  2QVP A;  4MY3 A;  5D29 A;  1KWM A;  1YVO A;  3BHX A;  4MXU A;  4OID A;  5HVF A;  4QB9 A;  2EUI A;  4R7M A;  5AGE A;  4P4B A;  2Z0Z A;  5AG6 A;  4P4J A;  1PCA A;  3F0A A;  4ONW A;  3QAH A;  3PRT A;  2ABZ A;  3PFO A;  1Z4E A;  4YGO A;  3K2K A;  4BD9 A;  5LYL A;  3IWE A;  5LYD A;  4Z65 A;  3S6F A;  2ZOF A;  1JQG A;  1PYT B;  3PZJ A;  2PC1 A;  3GUX A;  4UWJ A;  5F49 A;  4C7I A;  2ZEM A;  4CGM A;  2IMO A;  2J8R A;  4IAV A;  3SJG A;  5JM6 A;  3S6H A;  2B3U A;  2EBJ A;  1QMU A;  1Z8X A;  2PJ8 A;  3B8G A;  4NGR A;  4OAD A;  4OKO A;  3EO4 A;  4UIA A;  5EBV A;  4M85 A;  4NCZ A;  3SXO A;  5HVG A;  3JVN A;  4MFJ A;  3LMS A;  1Q2Y A;  3DSB A;  4OAE A;  1FNO A;  1QSM A;  3R96 A;  4FAI A;  1R3N A;  4NJQ A;  3RYO A;  4B11 A;  3FYN A;  2BEI A;  3TT2 A;  1LCP A;  4LQG A;  4OP4 A;  4II9 A;  4B12 A;  4NGP A;  1CJW A;  4MRI A;  2PJ3 A;  4H6Z A;  2Y0M A;  4X5K A;  4ZYQ A;  4DUK A;  2Q51 A;  3H8F A;  4R57 A;  2R7H A;  2QIR A;  3KGQ A;  3PB6 X;  2ZW7 A;  4NEX A;  2CNM A;  3T90 A;  3QB8 A;  2Q4V A;  3SI0 A;  3G8W A;  1BAV A;  4P4E A;  3B3S A;  3ISZ A;  3TO9 A;  2Z3P A;  2GFQ A;  3QNV A;  4CYP A;  5AG5 A;  2JLM A;  1Y7E A;  2EK9 A;  2B5G B;  3DR8 A;  4RI1 A;  3VWE A;  4E2A A;  4R87 A;  4TWE A;  2PJ2 A;  4NF1 A;  3TO7 A;  3DR6 A;  3D3S A;  2F7V A;  2PJ4 A;  4P6Y A;  4R76 A;  3KI9 A;  1K4J A;  2XEG A;  1MJB A;  4PV6 A;  4ZY1 A;  2OZU A;  3TOB A;  5IV0 A;  4LQ6 A;  1NSA A;  4Q36 A;  4YU9 A;  1S7N A;  1VGY A;  1LRZ A;  4NJR A;  3NH4 A;  2GLJ A;  2O53 A;  1IID A;  1CX8 A;  2CTC A;  4CAE A;  1A2Z A;  2X7B A;  4A38 A;  4LX9 A;  4CAF A;  4CYO A;  1QQ9 A;  4HKF A;  4ZY2 A;  4K3N A;  4PQA A;  1S3Z A;  2EO8 A;  2G3T A;  2OZH A;  2AFX A;  2CTB A;  4MI4 A;  5JH9 A;  1M4D A;  2DPS A;  1Z8L A;  4KOY A;  1NMT A;  3KL9 A;  4KSF A;  1UFH A;  2QEC A;  3B7I A;  5I0C A;  1VHO A;  4B10 A;  4CRY B;  3D4U A;  3TTH A;  1AUG A;  1R43 A;  2I3C A;  3D68 A;  3WAB A;  4MCQ A;  2P6F A;  1WK4 A;  2ZEL A;  1TXR A;  4KOR A;  3LOD A;  2EK8 A;  5A27 A;  5LRK A;  2D4O A;  1Q7L A;  4R9M A;  4WJB A;  1ARM A;  1GYT A;  3H8E A;  2DEA A;  2YNC C;  1S7L A;  4OC4 A;  4A2Z A;  4RS2 A;  1N71 A;  2AE6 A;  1F2O A;  4MFP A;  3RO0 A;  4RUH A;  1AMP A;  3R1K A;  2FS5 A;  2R98 A;  5FVJ A;  2H5M A;  4QVT A;  3WC5 A;  2JDD A;  3D2M A;  3RNZ A;  3FX6 A;  1S7K A;  2JBK A;  2GAN A;  2EWB A;  2HQY A;  2OOT A;  1CP7 A;  2GLF A;  2R1I A;  1LOK A;  2ZEP A;  3B3V A;  4OME A;  4R6T A;  4W9Y A;  3SJE A;  3TOA A;  3CPX A;  3P2F A;  2PRQ A;  2VQY A;  4C7H A;  5KTD A;  1P0H A;  3K9T A;  4X2T A;  2Z3N A;  2Q7B A;  4C2X A;  2PSW A;  2Q43 A;  4QUS A;  2PIY A;  4DYO A;  5F48 A;  2B4D B;  2NYQ A;  3FF3 A;  4MHD A;  4CAX A;  2C1C A;  2WUU A;  3WC6 A;  2AJ6 A;  3H8G A;  3D7D A;  5C82 A;  1L0C A;  4FD4 A;  4XPL A;  1ZG7 A;  4OC0 A;  3BLN A;  4A30 A;  2D4P A;  1XMB A;  2C27 A;  2IQ6 A;  4MFL A;  3RAM A;  1R57 A;  3W91 A;  3NA6 A;  2F8H A;  2WPX A;  4NGT A;  3KZW A;  4F8Z A;  4R3L A;  1Z8W A;  1BLL E;  5LRG A;  4JJX A;  4MCR A;  2FIW A;  1IYK A;  3NFZ A;  3FEC A;  2HC9 A;  2DPT A;  4NXY A;  4ZX8 A;  3LD2 A;  1ON0 A;  2KCW A;  4B14 A;  1MJ9 A;  4PXB A;  4H89 A;  4F9U A;  4B6Z A;  4C2Z A;  1TKJ A;  4FUU A;  4A94 A;  1LAN A;  3KHX A;  4MFK A;  4H6U A;  4PK2 A;  4EWT A;  1TF8 A;  1Z4R A;  4F6A A;  2ZOG A;  1XBU A;  4UCP A;  3KAS A;  5E96 A;  2P6G A;  3CDX A;  3E0K A;  3JTK A;  1I12 A;  1BPN A;  1IB1 E;  1XFO A;  2QJ8 A;  5H84 A;  2ATR A;  3GYA A;  2PJ6 A;  4KOW A;  4B13 A;  4HNX B;  4NFR A;  4PSW A;  3R95 A;  3F5B A;  3I3G A;  3IO1 A;  3SJX A;  3VAR A;  2GU2 A;  2XEI A;  2FVG A;  3KHZ A;  1YGH A;  2Q0Y A;  3FNC A;  3D2P A;  3LWU A;  4ONU A;  4IUS A;  4PXC A;  5A28 A;  2CIJ A;  2IJZ A;  3C26 A;  3EC4 A;  1TKH A;  1YLE A;  4P4F A;  2O28 A;  1NSL A;  1IU8 A;  1XMT A;  2REE A;  4C68 A;  3NE7 A;  2B5G A;  3I9S A;  4FD6 A;  3PB9 X;  3S9N A;  1P4N A;  1JWQ A;  3BJ7 A;  5JGF A;  2B4B A;  8CPA A;  4MBU A;  2VZZ A;  1OZP A;  2I00 A;  3UY5 A;  1KZF A;  1IOI A;  3H4Q A;  4ZI6 A;  3NH8 A;  4O23 A;  2WSA A;  4RN7 A;  2GRE A;  1AYE A;  4KSA A;  4KOT A;  4MHN A;  5HVH A;  4OC2 A;  3GY9 A;  2FCK A;  4E8O A;  2AFM A;  1I21 A;  3B2Y A;  4KVX A;  4A95 A;  5DS0 A;  2CXA A;  3VAT A;  1Q2C A;  2AFZ A;  4FBE A;  4L8A A;  3EFA A;  1CG2 A;  5DWN A;  2I79 A;  1IY7 A;  2YND A;  1U6M A;  1M4L A;  3TO6 A;  3DDD A;  4BBH A;  4EFD A;  3HUV A;  3DNS A;  1DE4 C;  3PB8 X;  2A4N A;  2Z3O A;  2YGW A;  4JXQ A;  2EVN A;  1FY7 A;  2P0W A;  4NGN A;  4NGQ A;  4UF4 A;  1VIX A;  4MMO A;  3GLJ A;  2FE7 A;  3FBU A;  4UEZ A;  2ZW4 A;  2HUZ A;  4UCN A;  2PQ8 A;  3SI1 A;  1YVK A;  4GM5 A;  5K8O A;  2ARH A;  1MK4 A;  4UWI A;  1ZG9 A;  2FIA A;  3KR5 A;  4NGS A;  3V7Z A;  4ZBG A;  1M44 A;  1XF8 A;  2PDO A;  3IEH A;  1Y7R A;  2Z3M A;  4P44 A;  4CYN A;  3T9Y A;  5K8N A;  1Z5R A;  4PSX A;  1QSN A;  2HB6 A;  2VL1 A;  2V8G A;  3H5Z A;  4P10 A;  2P6E A;  4P4D A;  2POK A;  4U9Y A;  3MRU A;  1YRE A;  3PBE A;  4QBJ A;  2VBQ A;  3N5F A;  3ZZI A;  3S9L A;  4KOX A;  4FD7 A;  3R9E A;  3IJ3 A;  3ISX A;  2Z3K A;  1LFW A;  4A32 A;  3CPA A;  2Z11 A;  4KOS A;  1XOV A;  2WPW A;  3D67 A;  1HDQ A;  4Q7A A;  3JRU A;  2G9D A;  3LAC A;  2PRB A;  4IK2 A;  1XIX A;  4YFJ A;  2PR1 A;  4Q38 A;  1HDU A;  1MJA A;  2DXQ A;  2Q7S A;  3QAY A;  3MN8 A;  3NH5 A;  4PPZ A;  2QML A;  4UBR A;  5G1Z A;  1TKF A;  4H2K A;  2J9A A;  5KTC A;  3TFY A;  2Z3L A;  1UWY A;  3WR7 A;  1LAM A;  5IX3 A;  4IHM A;  3K9U A;  3I1U A;  4I49 A;  4CGN A;  4KS9 A;  4JLY A;  3IC1 A;  4KLV A;  1B6B A;  2VEZ A;  3G3S A;  4XNH B;  4K30 A;  1PUA A;  4UIB A;  1F2P A;  3PP9 A;  1Z9U A;  4U9Z A;  2ZEE A;  2FL4 A;  4XPD B;  4MY0 A;  2PJ1 A;  1TF9 A;  3B35 A;  5F47 A;  1KUY A;  3FRM A;  3A9L A;  4TNU A;  1YLO A;  3B3T A;  3PB4 X;  3VWD A;  5IB9 A;  4MCP A;  4B5P B;  1I1D A;  4KOV A;  1XRY A;  4HNW B;  5J1Q A;  1CPX A;  2BOA A;  1XEB A;  1KUX A;  5LYF A;  1CBX A;  4M3S A;  2REF A;  1CPS A;  4WWV A;  1S7F A;  2ZEG A;  3PBB A;  2BL1 A;  2GE3 A;  4KVM E;  3WT4 A;  3FEE A;  2V8D A;  2OZG A;  5EMI A;  4R8F A;  3TCV A;  3ZJ0 A;  2Q4Z A;  4LUA A;  4EME A;  1IOF A;  4P45 A;  1EE3 P;  4AB7 A;  2GIV A;  3SHP A;  1XE4 A;  1ZO0 A;  4C2Y A;  4IF5 A;  2PJA A;  2PJ0 A;  4MJ8 A;  4YWY A;  4CPA A;  2PE3 A;  4CYQ A;  1IIC A;  2Q44 A;  5H86 A;  5KTA A;  3MGD A;  2J8N A;  5JPH A;  3B3C A;  3P2H A;  2R8V A;  1IGB A;  1S5K A;  5DWM A;  4CGL A;  4F0X A;  3EY5 A;  4XNH C;  4ZX9 A;  1YW6 A;  1DTD A;  1RO5 A;  5LYI A;  3TC8 A;  4PK3 A;  1ELL P;  3FXT A;  3BJ8 A;  3PB7 X;  4XPD C;  1Y0R A;  3V38 A;  3RBU A;  2J8M A;  1GHE A;  3S9M A;  1J4J A;  1QST A;  5D8N A;  3D7G A;  1F57 A;  3IWW A;  2FT0 A;  2PVV A;  5CBM A;  2VZY A;  2B58 A;  4ZGY B;  2ZW5 A;  4JWP A;  1YQE A;  2ODF A;  3PGP A;  2C6P A;  1BPM A;  2IL4 A;  4PXE A;  1Y0Y A;  2PR8 A;  4CGP A;  3CXQ A;  5J8C A;  2NSM A;  4M6I A;  4QC6 A;  3IWG A;  3FED A;  2ZED A;  3NE8 A;  2V8H A;  5G21 A;  4HPS A;  3EXN A;  4JD6 A;  1WWZ A;  3SI2 A;  4J3G A;  4KLW A;  3WC7 A;  2V8V A;  2K5T A;  2YNC A;  4CGO A;  2WYR A;  1Z8T A;  4HNY B;  4Y49 B;  2YNE A;  2XEJ A;  3BI0 A;  1ARL A;  1Z2L A;  2PJB A;  5CPA A;  7CPA A;  4BMH A;  3KQZ A;  1S60 A;  1VKC A; 
#chains in the Genus database with same CATH homology
 4AVB A;  4UCM A;  3R9G A;  4U5Y A;  2JEV A;  4E0A A;  4YRH A;  2CNT A;  3KKW A;  1KUV A;  3CXP A;  2HV2 A;  2ZW6 A;  2NMT A;  2CY2 A;  1QSO A;  3F8K A;  2Q4Y A;  3FIX A;  4UA3 A;  4A33 A;  2ZPA A;  3W6X A;  4B5O A;  3SXN A;  5C88 A;  3N7Z A;  1VKC A;  5G20 A;  3CXS A;  2BUE A;  4UFV A;  4MFZ A;  5EC4 A;  5CNP A;  4KUB A;  4NSQ A;  3FB3 A;  5GCN A;  4XPK A;  1YR0 A;  1VHS A;  3TE4 A;  4Y49 C;  4UFW A;  4CS0 B;  2OH1 A;  1BOB A;  2VXK A;  4CRZ B;  3IU1 A;  3V8I A;  4GS4 A;  4R3K A;  4DNC A;  2Z10 A;  5BWA B;  4OLL A;  3GKR A;  2JDC A;  2ZXV A;  1SQH A;  4L89 A;  1QSR A;  1Y9W A;  3OWC A;  5HMN A;  2RC4 A;  5F46 A;  1M1D A;  4KVO E;  1TIQ A;  1CM0 A;  4KOU A;  3IGR A;  4B5P A;  4AG9 A;  2OB0 A;  2B4D A;  4CAV A;  5J8F A;  4ORF A;  2OU2 A;  5AG7 A;  2Q04 A;  3JUW A;  1YK3 A;  4AG7 A;  4A31 A;  3S6G A;  5IB0 A;  1V0C A;  2BSW A;  2VI7 A;  1NE9 A;  4CAW A;  1IYL A;  2G3A A;  4AVA A;  1Y9K A;  1M4I A;  2CNS A;  4FD5 A;  3R9F A;  2B3V A;  5ISV A;  4AVC A;  1BO4 A;  4KUA A;  5HH1 A;  1RXT A;  4F0Y A;  5AG4 A;  3IU2 A;  3S6K A;  2F5I A;  4EVY A;  4UFX A;  4JXR A;  1Q2D A;  3D8P A;  4MFQ A;  5G22 A;  1M4G A;  1B87 A;  1YX0 A;  2G0B A;  2FXF A;  5JQ4 A;  2FSR A;  3W6S A;  4KZT A;  4MY3 A;  1YVO A;  4QB9 A;  2EUI A;  5AGE A;  2Z0Z A;  5AG6 A;  3F0A A;  3QAH A;  1Z4E A;  4YGO A;  3IWE A;  3S6F A;  3PZJ A;  2PC1 A;  4UWJ A;  5F49 A;  4C7I A;  4CGM A;  2J8R A;  3S6H A;  2B3U A;  3B8G A;  4OAD A;  3EO4 A;  3SXO A;  5EBV A;  4M85 A;  4NCZ A;  3JVN A;  4MFJ A;  1Q2Y A;  3DSB A;  4OAE A;  1QSM A;  3R96 A;  3RYO A;  4B11 A;  3FYN A;  2BEI A;  3TT2 A;  4II9 A;  4B12 A;  1CJW A;  4H6Z A;  2Y0M A;  4X5K A;  4R57 A;  2R7H A;  2QIR A;  2ZW7 A;  4NEX A;  2CNM A;  3T90 A;  3QB8 A;  2Q4V A;  3G8W A;  3TO9 A;  2Z3P A;  4CYP A;  5AG5 A;  2JLM A;  3DR8 A;  4E2A A;  2B5G B;  4RI1 A;  3VWE A;  4R87 A;  4NF1 A;  3TO7 A;  3DR6 A;  3D3S A;  1K4J A;  1MJB A;  4PV6 A;  2OZU A;  3TOB A;  5IV0 A;  4Q36 A;  1S7N A;  1LRZ A;  1IID A;  4CAE A;  4CYO A;  2X7B A;  4CAF A;  4LX9 A;  4HKF A;  1S3Z A;  2G3T A;  2OZH A;  4MI4 A;  1M4D A;  2DPS A;  4KOY A;  1NMT A;  4KSF A;  1UFH A;  2QEC A;  5I0C A;  4B10 A;  4CRY B;  3TTH A;  2P6F A;  1WK4 A;  4KOR A;  3LOD A;  5A27 A;  2D4O A;  4R9M A;  2YNC C;  1S7L A;  4A2Z A;  4RS2 A;  1N71 A;  2AE6 A;  4MFP A;  3R1K A;  2FS5 A;  2R98 A;  5FVJ A;  2H5M A;  4QVT A;  2JDD A;  3D2M A;  1S7K A;  2GAN A;  2HQY A;  2R1I A;  3TOA A;  3P2F A;  2VQY A;  4C7H A;  5KTD A;  1P0H A;  2Z3N A;  2Q7B A;  4C2X A;  2PSW A;  4QUS A;  5F48 A;  2B4D B;  4MHD A;  4CAX A;  2WUU A;  2AJ6 A;  5C82 A;  1L0C A;  4FD4 A;  4XPL A;  3BLN A;  4A30 A;  2D4P A;  2C27 A;  4MFL A;  1R57 A;  3W91 A;  2WPX A;  4R3L A;  4JJX A;  2FIW A;  1IYK A;  2DPT A;  4NXY A;  3LD2 A;  1ON0 A;  2KCW A;  4B14 A;  1MJ9 A;  4H89 A;  4C2Z A;  4MFK A;  4H6U A;  4PK2 A;  1Z4R A;  4F6A A;  4UCP A;  5E96 A;  2P6G A;  3JTK A;  3E0K A;  1I12 A;  1IB1 E;  5H84 A;  2ATR A;  3GYA A;  4KOW A;  4B13 A;  4HNX B;  4PSW A;  3R95 A;  3F5B A;  3I3G A;  1YGH A;  2Q0Y A;  3FNC A;  3D2P A;  5A28 A;  4ONU A;  4IUS A;  3C26 A;  3EC4 A;  1YLE A;  2O28 A;  1NSL A;  1XMT A;  2REE A;  4C68 A;  3NE7 A;  2B5G A;  3I9S A;  4FD6 A;  1P4N A;  3BJ7 A;  2B4B A;  4MBU A;  2VZZ A;  1OZP A;  2I00 A;  3UY5 A;  1KZF A;  3H4Q A;  2WSA A;  4KSA A;  4KOT A;  3GY9 A;  2FCK A;  4E8O A;  1I21 A;  4KVX A;  4A95 A;  2CXA A;  1Q2C A;  4L8A A;  3EFA A;  5DWN A;  2I79 A;  2YND A;  3TO6 A;  1U6M A;  4BBH A;  3DDD A;  3DNS A;  2A4N A;  2Z3O A;  2YGW A;  4JXQ A;  2EVN A;  1FY7 A;  2P0W A;  2FE7 A;  3FBU A;  2ZW4 A;  2HUZ A;  4UCN A;  2PQ8 A;  1YVK A;  2ARH A;  1MK4 A;  4UWI A;  2FIA A;  4ZBG A;  1M44 A;  1XF8 A;  2PDO A;  4CYN A;  1Y7R A;  2Z3M A;  3T9Y A;  4PSX A;  1QSN A;  4U9Y A;  3H5Z A;  2P6E A;  1YRE A;  4QBJ A;  2VBQ A;  3ZZI A;  4KOX A;  4FD7 A;  3R9E A;  2Z3K A;  4A32 A;  2Z11 A;  4KOS A;  2WPW A;  2PRB A;  1XIX A;  4YFJ A;  2PR1 A;  4Q38 A;  1MJA A;  2DXQ A;  5G1Z A;  3TFY A;  2QML A;  4UBR A;  5KTC A;  2Z3L A;  3WR7 A;  5IX3 A;  3K9U A;  4I49 A;  4CGN A;  4KS9 A;  4JLY A;  4KLV A;  1B6B A;  2VEZ A;  3G3S A;  4XNH B;  4K30 A;  1PUA A;  3PP9 A;  1Z9U A;  4U9Z A;  4XPD B;  2FL4 A;  4MY0 A;  5F47 A;  1KUY A;  3FRM A;  3A9L A;  3VWD A;  4B5P B;  1I1D A;  4KOV A;  4HNW B;  1XEB A;  1KUX A;  4M3S A;  2REF A;  1S7F A;  2BL1 A;  2GE3 A;  4KVM E;  2OZG A;  3TCV A;  3ZJ0 A;  4LUA A;  4AB7 A;  2GIV A;  3SHP A;  1XE4 A;  1ZO0 A;  4C2Y A;  4IF5 A;  4MJ8 A;  4CYQ A;  1IIC A;  2Q44 A;  5H86 A;  5KTA A;  3MGD A;  2J8N A;  5JPH A;  3P2H A;  2R8V A;  1S5K A;  5DWM A;  4CGL A;  4F0X A;  3EY5 A;  4XNH C;  1RO5 A;  4PK3 A;  3FXT A;  3BJ8 A;  4XPD C;  2J8M A;  1GHE A;  1J4J A;  1QST A;  2FT0 A;  2VZY A;  2B58 A;  4ZGY B;  2ZW5 A;  4JWP A;  3PGP A;  2IL4 A;  2PR8 A;  4CGP A;  3CXQ A;  5J8C A;  4QC6 A;  3IWG A;  5G21 A;  3EXN A;  4JD6 A;  1WWZ A;  4J3G A;  4KLW A;  2K5T A;  2YNC A;  4CGO A;  4HNY B;  4Y49 B;  2YNE A;  4BMH A;  1S60 A;  1PU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...