5G22A

Plasmodium vivax n-myristoyltransferase in complex with a quinoline inhibitor (compound 26)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
385
structure length
385
Chain Sequence
b'IDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
molecule tags Transferase
source organism Plasmodium vivax
publication title Structure-guided optimization of quinoline inhibitors of Plasmodium N-myristoyltransferase.
pubmed doi rcsb
total genus 113
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2016-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5g22A00
4CGLA 2YNDA 4UFWA 4CYOA 5G1ZA 4C68A 4C7HA 4UFXA 4B11A 5AG7A 4CYNA 4BBHA 2YNEA 4CGMA 4CYQA 4UFVA 4UCMA 5AGEA 4CGPA 4A95A 4B13A 4B12A 4B10A 4C2YA 5G21A 5G22A 5G20A 4A33A 5AG6A 2WSAA 3JTKA 4A32A 4B14A 4UCNA 4C7IA 4CYPA 4UCPA 4CAFA 4A30A 2YNCA 4CGOA 4A31A 2YNCC 3IWEA 2WUUA 3IU2A 3IU1A 4A2ZA 4C2ZA 4C2XA 5A28A 4CGNA 5AG4A 3H5ZA 4CAEA 5A27A 5AG5A
chains in the Genus database with same CATH superfamily
3L2NA 3TOBA 2X7BA 4ZI6A 5JPHA 2ABZA 4OC1A 2ZENA 3DR6A 3T8WA 1S5KA 5HVFA 2C6GA 1OBRA 2CTBA 4BBHA 1WK4A 3PZJA 4PQAA 2PE3A 1FY7A 1S7NA 4GM5A 4NJQA 5FVJA 5K8PA 1HDQA 1R43A 2FL4A 3IC1A 4NGPA 4Y49B 1F57A 2CNSA 2PJ6A 3KQXA 4X3RA 1ZLIA 3JTKA 2PCUA 1N71A 4M6GA 5F47A 3BJ7A 2Q0YA 2GLJA 3TX8A 4CAFA 3VATA 3B7IA 2AJ6A 3VWEA 4A37A 4MBUA 1VHEA 2PJ3A 4MFZA 4NGTA 1KUXA 1UFHA 4PSWA 2Q51A 4KLVA 1XBUA 3B8GA 3KHZA 3V8IA 2G0BA 1Q2DA 4C2XA 4CS0B 2DF5A 5A27A 3NH5A 4OC0A 3TO9A 4X8IA 2C6CA 4NGSA 2BO9A 3PB7X 3QAHA 5DWNA 4MXUA 3TT2A 1CPSA 1KUYA 3H4QA 3NE7A 4F0XA 1V0CA 4CYQA 4AVCA 2WPXA 1Z8LA 1TKJA 2NYQA 2V8DA 2G3TA 3NH8A 4Y49C 1KZFA 2PC1A 2FS5A 1CX8A 2H5MA 4JD6A 4KVXA 4MFQA 4P6YA 4YWYA 4B10A 2PIZA 4EFDA 3BHXA 3SI1A 4A32A 5THWA 5KTAA 1FNOA 5CNPA 4QVTA 2GREA 2AE6A 1RO5A 2VXKA 3NFZA 4NSQA 4R57A 3WC6A 4UEEA 2YNCC 2B4BA 1Z2LA 3IWEA 4XPDB 4MCRA 3IWGA 5DS0A 4C2ZA 2B5GB 2EWBA 1GHEA 1YK3A 4KLWA 1YR0A 2REEA 2Z3OA 5H86A 4OP4A 1CG2A 2EUIA 5G1ZA 4M85A 3S6GA 1ZG7A 3IEHA 3I3GA 3DDDA 3GYAA 2PJ8A 4KOYA 1CM0A 4FD4A 4NF1A 3KR5A 3B2YA 4R7MA 3SXOA 3TCVA 1JWQA 3V38A 4EWTA 5IB9A 2B5GA 4NGNA 4X5KA 2AFUA 3CXPA 3FIXA 1L0CA 1IYKA 1ON0A 2WSAA 1ZLHA 3QNVA 1M4IA 2V8GA 3KHXA 3DNSA 4U5YA 3RNZA 2ANPA 4DYOA 3BJ8A 4RN7A 4MRIA 2EO8A 4CGOA 1ARLA 3GUXA 4FWUA 1Y7RA 3FH4A 2J8MA 4P4DA 2FSRA 2OR4A 4DUKA 2HV2A 1QSTA 1XJOA 2PVWA 1S3ZA 1IIDA 4M6IA 2I79A 4U9ZA 4WJBA 4FBEA 3FB3A 3B3SA 4KUBA 4OKOA 4ZX8A 4PXBA 2J8RA 3W6SA 2J8NA 5JQ4A 3CT9A 4R3LA 4CGMA 4UA3A 2XEJA 4MMOA 2WZNA 3PB8X 2OZGA 3TO6A 4B12A 2PR1A 5DWMA 3FBUA 2QYVA 4FD7A 2ZW5A 2VZZA 3CPXA 3ISXA 4H6ZA 4LQGA 3D2MA 4UWJA 3TOAA 4YRHA 1YREA 2G3AA 2PJ4A 3GB0A 1YGHA 4LQ6A 4PSXA 4R3KA 4RUHA 4Z65A 3WT4A 1LAPA 3TO7A 5HXDA 4LUAA 1YVOA 1TXRA 3D67A 1NSLA 3D8PA 3R1KA 3RAMA 4UIBA 1YVKA 4CPAA 3B3WA 3IO1A 2GFQA 5CBMA 5HVHA 2AFZA 5E96A 4Q38A 3IIBA 3D4UA 4IF5A 3K9UA 4F0YA 4B5PA 5CPAA 2GE3A 4PK3A 4H6UA 2YGWA 2PJ7A 4RI1A 4W9YA 4CAXA 4WWVA 3PFOA 1DE4C 5AGEA 1LANA 1MJ9A 2Z0ZA 3MRUA 3PB4X 4P4IA 1XRYA 5EMIA 5KTCA 4HNYB 1X10A 6CPAA 2PJ5A 2AFXA 1CP6A 4ZY1A 2F8HA 2PQ8A 1TF8A 2Z3LA 4H89A 3TFYA 2PJ1A 2PVVA 3G8WA 4KVME 3OWCA 5LRKA 1S7LA 2B4DA 3P2FA 4KORA 5JH9A 1IYLA 3DLJA 5HMNA 1YSJA 2QIRA 2WUUA 3PB9X 4KOUA 1ELMP 2O4HA 2ZOGA 3BLNA 2OOTA 3EO4A 2I00A 2C6PA 2Q4VA 2VQYA 4CYOA 1PYTB 1BO4A 1F2OA 3FNCA 1M1DA 2PJ2A 4TNUA 3S9NA 4C68A 4H2KA 4C7HA 3LACA 1Z4RA 4R8FA 1OZPA 2DPSA 3FECA 3FEEA 1K4JA 3F0AA 4CGPA 4C2YA 5G21A 3H8FA 2ZOFA 3LD2A 2EBJA 2BCOA 4P4FA 4YU9A 3KKWA 2IMOA 5F48A 2FVGA 4DJLA 2QVPA 4QB9A 2ZEFA 3TTHA 1ZO0A 4B6ZA 4CAEA 2FE7A 4HPSA 3SHPA 3I1UA 4AB7A 2F7VA 2XEFA 2AFWA 1FT7A 3IWWA 4UFXA 4NJRA 4EMEA 3FYNA 2Z3KA 3K2KA 2ZEDA 4KZTA 4AXVA 4CRYB 4IAVA 4UEFA 2WPWA 1P4NA 1I1DA 3CDXA 4UWIA 3S6KA 5EBVA 2V8VA 1ZG9A 3GY9A 1EE3P 4NFRA 1VGYA 1XMBA 3V7ZA 3KASA 4OIDA 2C27A 4Q36A 2ZEHA 1YQEA 1NE9A 2G9DA 2B4DB 1JQGA 4JYWA 1IY7A 1LRZA 1YX0A 3KL9A 4MHNA 4KOVA 4MJ8A 4PPZA 5GCNA 1F2PA 3D7DA 1S7FA 2ZW7A 4KSAA 1S60A 1QSOA 4CGLA 3DR8A 1AUGA 1YW6A 1U6MA 1MJBA 1R57A 1Y0RA 1YLOA 1KWMA 2JBKA 3NA6A 4CRZB 2PJ0A 2Q4YA 2ZEGA 2BOAA 4L8AA 4OAEA 2FIAA 4XPDC 5C88A 1LOKA 1BAVA 4JJXA 5I4MA 4J3GA 3TE4A 4BINA 3VWDA 2PJ9A 3D7GA 4UIAA 4PXEA 5EC4A 2I3CA 3EY5A 4R87A 4P4JA 2P6EA 4LX9A 4ONUA 4HNXB 2XEGA 3B35A 5JGFA 5IB0A 1IU8A 2D4OA 2YNCA 1XF8A 5LYDA 2O28A 4RS2A 4R9MA 4NXYA 3IU2A 3SJXA 1X12A 4I49A 4HKFA 4BMHA 4B5OA 1RTQA 2OB0A 1NSAA 4OLLA 2ARHA 2ZEOA 1CJWA 3SI2A 3ZZIA 3WC5A 4MFPA 2ZEPA 1QMUA 3D3SA 4E2AA 1CP7A 3JVNA 3HLPA 2EK9A 1Z9UA 3D66A 2AFOA 3I9SA 5J8CA 2ZXVA 4IUSA 3JRUA 1CBXA 1Y0YA 3PRTA 4ONWA 4A39A 3FX6A 1YMEA 4A33A 2ZPAA 3KZWA 3H8EA 1XIXA 2JDCA 4ZBGA 1DTDA 3DSBA 2FIWA 5HH1A 2CNTA 3TC8A 4II9A 3WR7A 3CPAA 2B3UA 1WWZA 3CZXA 1BOBA 3A9LA 4P4BA 2ZELA 1IICA 1B6BA 4K3NA 4NGQA 4XNHB 1RXTA 4P10A 2CIJA 2ZEEA 1XOVA 2AFSA 2V8HA 2JDDA 2IJZA 3D7FA 5J8FA 4YFJA 4AVBA 5ELYA 2YNEA 3RBUA 5JM6A 2P6GA 2RC4A 4ZGYB 2PJCA 2DXQA 4U9YA 2CTCA 4OMEA 2OZUA 3SJEA 2FCKA 3C26A 4B14A 2O53A 2PR8A 4PXCA 2VZYA 4UCPA 4CYPA 5K8NA 2HQYA 2IL4A 4OADA 1Q2CA 3GLJA 2GLFA 4A30A 2EK8A 3GIUA 4MHDA 3LODA 3W6XA 2QECA 3MGDA 3D68A 4IK2A 4GS4A 4ORFA 2PRQA 2R98A 5K8OA 1BPMA 3PB6X 1GYTA 2BL1A 8CPAA 3S6FA 2B58A 3CXQA 2K5TA 2P0WA 3FF3A 3KI9A 1Y9KA 3B3TA 4R76A 4F9VA 1YLEA 4KOXA 4L89A 3BI0A 4A95A 5K8MA 4KOTA 3T90A 3SJFA 3BXMA 2R1IA 5LRGA 5F49A 5H84A 3NH4A 4UEZA 1ELLP 5HVGA 5C82A 1Z4EA 3B3CA 1R3NA 2PJBA 2REFA 3DGVA 2D4PA 3FRMA 3FXTA 3K9TA 4NGRA 5D8NA 4ZX9A 4F9UA 2PJAA 1I21A 4MY0A 4A2ZA 5A28A 3H5ZA 4P44A 1Z8WA 2PSWA 4PK2A 1UWYA 2OH1A 3EFAA 4MFKA 4MCSA 2Y0MA 5ISVA 2CF4A 1Z8TA 3PBBA 3IFEA 1P0HA 4UFVA 4QC6A 2B3VA 3PBEA 1PCAA 1TF9A 4FAIA 1MK4A 4DNCA 1QQ9A 4MFJA 5AG6A 3S9MA 3QAYA 4MI4A 4MCQA 4K30A 1NMTA 3R95A 3G3SA 1IOFA 5LYFA 1TKFA 1AMPA 1A2ZA 2PDOA 2QMLA 1H8LA 4MHYA 4A31A 1IOIA 3RZAA 2Q4ZA 4CAVA 2J9AA 1M4GA 2CNMA 1IB1E 2JBJA 2GIVA 5IV0A 3PP9A 5J1QA 4G1PA 1Q7LA 3EC4A 1YW4A 2EVNA 4Q7AA 4ZYQA 1Y7EA 4CAWA 4B11A 5AG7A 1HDUA 1QSMA 2R7HA 4CYNA 2PRBA 3CXSA 1SQHA 2OZHA 2Z10A 3PGPA 5F46A 3R9EA 4JXRA 4OC2A 4F8ZA 2RB7A 4JZ0A 4HNWB 4MCPA 4R6TA 4AVAA 3N5FA 3KR4A 4UCNA 3RO0A 2JEWA 3KGQA 4MY3A 4KSIA 3D7HA 1J4JA 3SJGA 4KUAA 7CPAA 2HB6A 4M6HA 4A38A 2ODFA 1CPXA 4JWPA 2NMTA 2Z3PA 3FVLA 2GU2A 3EXNA 3F5BA 4XPLA 4XPKA 3SXNA 3BI1A 2OU2A 4AG9A 1S7KA 4ZY2A 5AG5A 1Z8XA 2VI7A 4MFLA 2BUEA 3HUVA 3LWUA 5F09A 4UFWA 5LYLA 2ZW6A 4BD9A 4F6AA 2BEIA 3IGRA 4OC4A 4NGMA 4MHZA 3VH9A 1XMTA 3PFEA 4E0AA 4NEXA 5LRJA 3T9YA 4UF4A 3D2PA 2C1CA 2Q43A 1VHSA 3FEDA 3N7ZA 4KVOE 4YGOA 5G22A 3R9GA 2Q44A 4OC5A 3JUWA 1IGBA 4NCZA 2Z3NA 1Y9WA 1HEEA 2A4NA 1LFWA 2Q7SA 2QJ8A 2Z3MA 1BPNA 3KQZA 1M4DA 1M44A 2ZW4A 2KCWA 4EVYA 3E0KA 4FD5A 2R8VA 4X2TA 4P4EA 2POKA 3GKRA 4OIWA 1BLLE 3W91A 4AG7A 1Q2YA 1LCPA 1Z5RA 2ATRA 1VHOA 4IHMA 2YNDA 2Z11A 3QB8A 3LMSA 4TWEA 4OC3A 2VEZA 2XEIA 3H8GA 4A94A 3MN8A 4B13A 2FT0A 3IJ3A 3FJUA 3R9FA 3UY5A 4QBJA 2DEAA 5G20A 2HUZA 2P6FA 1PU9A 2VBQA 2Q7BA 3NE8A 3B3VA 5BWAB 2BSWA 1XFOA 4E8OA 5LYIA 2VL1A 2DPTA 1MJAA 4ZY0A 5I0CA 2IQ6A 2V77A 3IU1A 2JLMA 4CGNA 4KS9A 5AG4A 3S6HA 2Q04A 2ZEMA 3FMCA 1QSRA 1TKHA 4UBRA 4XNHC 3VARA 3ZJ0A 4KSFA 4GXHA 5D29A 4FD6A 4P45A 4KOSA 1QSNA 1VKCA 3WC7A 2FXFA 3PEIA 3S9LA 1M4LA 4O23A 4UCMA 1ARMA 1KUVA 3R96A 2AFMA 4M3SA 1B87A 2JEVA 2RFHA 4KOWA 4PV6A 2PIYA 2F5IA 1I12A 1VIXA 1XE4A 2CY2A 2NSMA 4JLYA 4QUSA 3RYOA 4C7IA 5KTDA 1AYEA 2GANA 4PXDA 4B5PB 1LAMA 2WYRA 1ZG8A 4MHPA 3WABA 2CXAA 3ISZA 1TIQA 5IX3A 1XEBA 3P2HA 4FUUA 1PUAA 3SI0A 4JXQA 2HC9A 3F8KA
chains in the Genus database with same CATH topology
3TOBA 2X7BA 5JPHA 3DR6A 1S5KA 4BBHA 1WK4A 3PZJA 5FVJA 1FY7A 1S7NA 2FL4A 4Y49B 2CNSA 3JTKA 1N71A 5F47A 3BJ7A 2Q0YA 4CAFA 2AJ6A 3VWEA 4MBUA 4MFZA 1KUXA 1UFHA 4PSWA 4KLVA 3B8GA 4C2XA 3V8IA 2G0BA 1Q2DA 4CS0B 5A27A 3TO9A 3QAHA 5DWNA 3TT2A 1KUYA 3H4QA 3NE7A 4F0XA 1V0CA 4CYQA 4AVCA 2WPXA 2G3TA 4Y49C 1KZFA 2PC1A 2FS5A 4KVXA 2H5MA 4JD6A 4MFQA 4B10A 4A32A 5KTAA 5CNPA 4QVTA 2AE6A 1RO5A 2VXKA 4NSQA 4R57A 2YNCC 2B4BA 3IWEA 4XPDB 3IWGA 4C2ZA 2B5GB 1YK3A 1GHEA 4KLWA 1YR0A 2REEA 2Z3OA 5H86A 2EUIA 5G1ZA 4M85A 3S6GA 3I3GA 3DDDA 3GYAA 4KOYA 4NF1A 1CM0A 4FD4A 3SXOA 3TCVA 2B5GA 4X5KA 3CXPA 3FIXA 1L0CA 1IYKA 1ON0A 2WSAA 1M4IA 4U5YA 3DNSA 3BJ8A 4CGOA 1Y7RA 2J8MA 2FSRA 2HV2A 1QSTA 1S3ZA 1IIDA 2I79A 4U9ZA 3FB3A 4KUBA 3W6SA 2J8RA 2J8NA 4CGMA 4UA3A 2OZGA 3TO6A 4B12A 2PR1A 5DWMA 3FBUA 4FD7A 4H6ZA 2ZW5A 2VZZA 3TOAA 4UWJA 3D2MA 4YRHA 1YREA 2G3AA 1YGHA 4PSXA 4R3KA 3TO7A 1YVOA 1NSLA 3D8PA 3R1KA 1YVKA 5E96A 4Q38A 4IF5A 3K9UA 4F0YA 4B5PA 2GE3A 4PK3A 4H6UA 2YGWA 4CAXA 4RI1A 5AGEA 1MJ9A 2Z0ZA 5KTCA 4HNYB 2PQ8A 2Z3LA 4H89A 3TFYA 3G8WA 4KVME 3OWCA 1S7LA 2B4DA 3P2FA 4KORA 1IYLA 5HMNA 2QIRA 2WUUA 4KOUA 3BLNA 3EO4A 2I00A 2Q4VA 2VQYA 4CYOA 1BO4A 3FNCA 1M1DA 4C68A 4C7HA 1Z4RA 1OZPA 2DPSA 1K4JA 3F0AA 4CGPA 4C2YA 5G21A 3LD2A 3KKWA 5F48A 4QB9A 3TTHA 1ZO0A 4CAEA 2FE7A 3SHPA 4AB7A 4UFXA 3FYNA 2Z3KA 4KZTA 4CRYB 2WPWA 1P4NA 1I1DA 3S6KA 4UWIA 5EBVA 3GY9A 2C27A 4Q36A 1NE9A 2B4DB 1LRZA 1YX0A 4KOVA 4MJ8A 5GCNA 1S7FA 2ZW7A 4KSAA 1S60A 1QSOA 4CGLA 3DR8A 1U6MA 1MJBA 1R57A 4CRZB 2Q4YA 4L8AA 4OAEA 2FIAA 4XPDC 5C88A 4JJXA 4J3GA 3TE4A 3VWDA 5EC4A 3EY5A 4R87A 2P6EA 4LX9A 4ONUA 4HNXB 5IB0A 2D4OA 2YNCA 1XF8A 2O28A 4RS2A 4R9MA 4NXYA 3IU2A 4I49A 4HKFA 4BMHA 4B5OA 2OB0A 4OLLA 2ARHA 1CJWA 3ZZIA 4MFPA 3D3SA 4E2AA 3JVNA 1Z9UA 3I9SA 5J8CA 2ZXVA 4IUSA 4A33A 2ZPAA 1XIXA 2JDCA 4ZBGA 3DSBA 2FIWA 5HH1A 2CNTA 4II9A 3WR7A 2B3UA 1WWZA 1BOBA 3A9LA 1IICA 1B6BA 4XNHB 1RXTA 2JDDA 5J8FA 4YFJA 4AVBA 2YNEA 2P6GA 2RC4A 4ZGYB 2DXQA 4U9YA 2OZUA 2FCKA 3C26A 4B14A 2PR8A 2VZYA 4UCPA 4CYPA 2HQYA 2IL4A 4OADA 1Q2CA 4A30A 4MHDA 3LODA 3W6XA 2QECA 3MGDA 4ORFA 4GS4A 2R98A 2BL1A 3S6FA 2B58A 3CXQA 2K5TA 2P0WA 1Y9KA 1YLEA 4KOXA 4L89A 4A95A 4KOTA 3T90A 2R1IA 5F49A 5H84A 5C82A 1Z4EA 3FRMA 3FXTA 2REFA 5JQ4A 2D4PA 1I21A 4MY0A 4A2ZA 5A28A 3H5ZA 2PSWA 4PK2A 2OH1A 3EFAA 4MFKA 2Y0MA 5ISVA 1P0HA 4UFVA 4QC6A 2B3VA 1MK4A 4DNCA 4MFJA 5AG6A 4MI4A 4K30A 1NMTA 3R95A 3G3SA 2QMLA 2PDOA 4A31A 4CAVA 1M4GA 2CNMA 1IB1E 2GIVA 5IV0A 3PP9A 3EC4A 2EVNA 4CAWA 4B11A 5AG7A 1QSMA 4CYNA 2R7HA 2PRBA 3CXSA 1SQHA 2OZHA 2Z10A 3PGPA 5F46A 3R9EA 4JXRA 4HNWB 4AVAA 4UCNA 4MY3A 1J4JA 4KUAA 4JWPA 2NMTA 2Z3PA 3EXNA 3F5BA 4XPLA 4XPKA 3SXNA 4AG9A 2OU2A 1S7KA 5AG5A 2VI7A 4MFLA 2BUEA 4UFWA 2ZW6A 4F6AA 2BEIA 3IGRA 4E0AA 1XMTA 4NEXA 3T9YA 3D2PA 3N7ZA 4YGOA 1VHSA 5G22A 4KVOE 3R9GA 2Q44A 3JUWA 4NCZA 2Z3NA 1Y9WA 2A4NA 4LUAA 2Z3MA 4R3LA 4EVYA 1M4DA 1M44A 2ZW4A 2KCWA 3E0KA 4FD5A 2R8VA 3GKRA 3W91A 4AG7A 1Q2YA 2ATRA 2YNDA 2Z11A 3QB8A 2VEZA 4B13A 2FT0A 3R9FA 3UY5A 4QBJA 5G20A 2HUZA 2P6FA 1PU9A 2VBQA 2Q7BA 5BWAB 2BSWA 4E8OA 2DPTA 1MJAA 5I0CA 3IU1A 2JLMA 4CGNA 4KS9A 5AG4A 3S6HA 2Q04A 3ZJ0A 1QSRA 4UBRA 4XNHC 4KSFA 4FD6A 4KOSA 1QSNA 1VKCA 2FXFA 3R96A 4UCMA 1KUVA 4M3SA 1B87A 2JEVA 4KOWA 4PV6A 2F5IA 1I12A 1XE4A 2CY2A 4QUSA 4JLYA 3RYOA 4C7IA 5KTDA 2GANA 4B5PB 2CXAA 1TIQA 5IX3A 1XEBA 3P2HA 1PUAA 4JXQA 3F8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGL A;  2YND A;  4UFW A;  4CYO A;  5G1Z A;  4C68 A;  4C7H A;  4UFX A;  4B11 A;  5AG7 A;  4CYN A;  4BBH A;  2YNE A;  4CGM A;  4CYQ A;  4UFV A;  4UCM A;  5AGE A;  4CGP A;  4A95 A;  4B13 A;  4B12 A;  4B10 A;  4C2Y A;  5G21 A;  5G22 A;  5G20 A;  4A33 A;  5AG6 A;  2WSA A;  3JTK A;  4A32 A;  4B14 A;  4UCN A;  4C7I A;  4CYP A;  4UCP A;  4CAF A;  4A30 A;  2YNC A;  4CGO A;  4A31 A;  2YNC C;  3IWE A;  2WUU A;  3IU2 A;  3IU1 A;  4A2Z A;  4C2Z A;  4C2X A;  5A28 A;  4CGN A;  5AG4 A;  3H5Z A;  4CAE A;  5A27 A;  5AG5 A; 
#chains in the Genus database with same CATH topology
 3L2N A;  3TOB A;  2X7B A;  4ZI6 A;  5JPH A;  2ABZ A;  4OC1 A;  2ZEN A;  3DR6 A;  3T8W A;  1S5K A;  5HVF A;  2C6G A;  1OBR A;  2CTB A;  4BBH A;  1WK4 A;  3PZJ A;  4PQA A;  2PE3 A;  1FY7 A;  1S7N A;  4GM5 A;  4NJQ A;  5FVJ A;  5K8P A;  1HDQ A;  1R43 A;  2FL4 A;  3IC1 A;  4NGP A;  4Y49 B;  1F57 A;  2CNS A;  2PJ6 A;  3KQX A;  4X3R A;  1ZLI A;  3JTK A;  2PCU A;  1N71 A;  4M6G A;  5F47 A;  3BJ7 A;  2Q0Y A;  2GLJ A;  3TX8 A;  4CAF A;  3VAT A;  3B7I A;  2AJ6 A;  3VWE A;  4A37 A;  4MBU A;  1VHE A;  2PJ3 A;  4MFZ A;  4NGT A;  1KUX A;  1UFH A;  4PSW A;  2Q51 A;  4KLV A;  1XBU A;  3B8G A;  3KHZ A;  3V8I A;  2G0B A;  1Q2D A;  4C2X A;  4CS0 B;  2DF5 A;  5A27 A;  3NH5 A;  4OC0 A;  3TO9 A;  4X8I A;  2C6C A;  4NGS A;  2BO9 A;  3PB7 X;  3QAH A;  5DWN A;  4MXU A;  3TT2 A;  1CPS A;  1KUY A;  3H4Q A;  3NE7 A;  4F0X A;  1V0C A;  4CYQ A;  4AVC A;  2WPX A;  1Z8L A;  1TKJ A;  2NYQ A;  2V8D A;  2G3T A;  3NH8 A;  4Y49 C;  1KZF A;  2PC1 A;  2FS5 A;  1CX8 A;  2H5M A;  4JD6 A;  4KVX A;  4MFQ A;  4P6Y A;  4YWY A;  4B10 A;  2PIZ A;  4EFD A;  3BHX A;  3SI1 A;  4A32 A;  5THW A;  5KTA A;  1FNO A;  5CNP A;  4QVT A;  2GRE A;  2AE6 A;  1RO5 A;  2VXK A;  3NFZ A;  4NSQ A;  4R57 A;  3WC6 A;  4UEE A;  2YNC C;  2B4B A;  1Z2L A;  3IWE A;  4XPD B;  4MCR A;  3IWG A;  5DS0 A;  4C2Z A;  2B5G B;  2EWB A;  1GHE A;  1YK3 A;  4KLW A;  1YR0 A;  2REE A;  2Z3O A;  5H86 A;  4OP4 A;  1CG2 A;  2EUI A;  5G1Z A;  4M85 A;  3S6G A;  1ZG7 A;  3IEH A;  3I3G A;  3DDD A;  3GYA A;  2PJ8 A;  4KOY A;  1CM0 A;  4FD4 A;  4NF1 A;  3KR5 A;  3B2Y A;  4R7M A;  3SXO A;  3TCV A;  1JWQ A;  3V38 A;  4EWT A;  5IB9 A;  2B5G A;  4NGN A;  4X5K A;  2AFU A;  3CXP A;  3FIX A;  1L0C A;  1IYK A;  1ON0 A;  2WSA A;  1ZLH A;  3QNV A;  1M4I A;  2V8G A;  3KHX A;  3DNS A;  4U5Y A;  3RNZ A;  2ANP A;  4DYO A;  3BJ8 A;  4RN7 A;  4MRI A;  2EO8 A;  4CGO A;  1ARL A;  3GUX A;  4FWU A;  1Y7R A;  3FH4 A;  2J8M A;  4P4D A;  2FSR A;  2OR4 A;  4DUK A;  2HV2 A;  1QST A;  1XJO A;  2PVW A;  1S3Z A;  1IID A;  4M6I A;  2I79 A;  4U9Z A;  4WJB A;  4FBE A;  3FB3 A;  3B3S A;  4KUB A;  4OKO A;  4ZX8 A;  4PXB A;  2J8R A;  3W6S A;  2J8N A;  5JQ4 A;  3CT9 A;  4R3L A;  4CGM A;  4UA3 A;  2XEJ A;  4MMO A;  2WZN A;  3PB8 X;  2OZG A;  3TO6 A;  4B12 A;  2PR1 A;  5DWM A;  3FBU A;  2QYV A;  4FD7 A;  2ZW5 A;  2VZZ A;  3CPX A;  3ISX A;  4H6Z A;  4LQG A;  3D2M A;  4UWJ A;  3TOA A;  4YRH A;  1YRE A;  2G3A A;  2PJ4 A;  3GB0 A;  1YGH A;  4LQ6 A;  4PSX A;  4R3K A;  4RUH A;  4Z65 A;  3WT4 A;  1LAP A;  3TO7 A;  5HXD A;  4LUA A;  1YVO A;  1TXR A;  3D67 A;  1NSL A;  3D8P A;  3R1K A;  3RAM A;  4UIB A;  1YVK A;  4CPA A;  3B3W A;  3IO1 A;  2GFQ A;  5CBM A;  5HVH A;  2AFZ A;  5E96 A;  4Q38 A;  3IIB A;  3D4U A;  4IF5 A;  3K9U A;  4F0Y A;  4B5P A;  5CPA A;  2GE3 A;  4PK3 A;  4H6U A;  2YGW A;  2PJ7 A;  4RI1 A;  4W9Y A;  4CAX A;  4WWV A;  3PFO A;  1DE4 C;  5AGE A;  1LAN A;  1MJ9 A;  2Z0Z A;  3MRU A;  3PB4 X;  4P4I A;  1XRY A;  5EMI A;  5KTC A;  4HNY B;  1X10 A;  6CPA A;  2PJ5 A;  2AFX A;  1CP6 A;  4ZY1 A;  2F8H A;  2PQ8 A;  1TF8 A;  2Z3L A;  4H89 A;  3TFY A;  2PJ1 A;  2PVV A;  3G8W A;  4KVM E;  3OWC A;  5LRK A;  1S7L A;  2B4D A;  3P2F A;  4KOR A;  5JH9 A;  1IYL A;  3DLJ A;  5HMN A;  1YSJ A;  2QIR A;  2WUU A;  3PB9 X;  4KOU A;  1ELM P;  2O4H A;  2ZOG A;  3BLN A;  2OOT A;  3EO4 A;  2I00 A;  2C6P A;  2Q4V A;  2VQY A;  4CYO A;  1PYT B;  1BO4 A;  1F2O A;  3FNC A;  1M1D A;  2PJ2 A;  4TNU A;  3S9N A;  4C68 A;  4H2K A;  4C7H A;  3LAC A;  1Z4R A;  4R8F A;  1OZP A;  2DPS A;  3FEC A;  3FEE A;  1K4J A;  3F0A A;  4CGP A;  4C2Y A;  5G21 A;  3H8F A;  2ZOF A;  3LD2 A;  2EBJ A;  2BCO A;  4P4F A;  4YU9 A;  3KKW A;  2IMO A;  5F48 A;  2FVG A;  4DJL A;  2QVP A;  4QB9 A;  2ZEF A;  3TTH A;  1ZO0 A;  4B6Z A;  4CAE A;  2FE7 A;  4HPS A;  3SHP A;  3I1U A;  4AB7 A;  2F7V A;  2XEF A;  2AFW A;  1FT7 A;  3IWW A;  4UFX A;  4NJR A;  4EME A;  3FYN A;  2Z3K A;  3K2K A;  2ZED A;  4KZT A;  4AXV A;  4CRY B;  4IAV A;  4UEF A;  2WPW A;  1P4N A;  1I1D A;  3CDX A;  4UWI A;  3S6K A;  5EBV A;  2V8V A;  1ZG9 A;  3GY9 A;  1EE3 P;  4NFR A;  1VGY A;  1XMB A;  3V7Z A;  3KAS A;  4OID A;  2C27 A;  4Q36 A;  2ZEH A;  1YQE A;  1NE9 A;  2G9D A;  2B4D B;  1JQG A;  4JYW A;  1IY7 A;  1LRZ A;  1YX0 A;  3KL9 A;  4MHN A;  4KOV A;  4MJ8 A;  4PPZ A;  5GCN A;  1F2P A;  3D7D A;  1S7F A;  2ZW7 A;  4KSA A;  1S60 A;  1QSO A;  4CGL A;  3DR8 A;  1AUG A;  1YW6 A;  1U6M A;  1MJB A;  1R57 A;  1Y0R A;  1YLO A;  1KWM A;  2JBK A;  3NA6 A;  4CRZ B;  2PJ0 A;  2Q4Y A;  2ZEG A;  2BOA A;  4L8A A;  4OAE A;  2FIA A;  4XPD C;  5C88 A;  1LOK A;  1BAV A;  4JJX A;  5I4M A;  4J3G A;  3TE4 A;  4BIN A;  3VWD A;  2PJ9 A;  3D7G A;  4UIA A;  4PXE A;  5EC4 A;  2I3C A;  3EY5 A;  4R87 A;  4P4J A;  2P6E A;  4LX9 A;  4ONU A;  4HNX B;  2XEG A;  3B35 A;  5JGF A;  5IB0 A;  1IU8 A;  2D4O A;  2YNC A;  1XF8 A;  5LYD A;  2O28 A;  4RS2 A;  4R9M A;  4NXY A;  3IU2 A;  3SJX A;  1X12 A;  4I49 A;  4HKF A;  4BMH A;  4B5O A;  1RTQ A;  2OB0 A;  1NSA A;  4OLL A;  2ARH A;  2ZEO A;  1CJW A;  3SI2 A;  3ZZI A;  3WC5 A;  4MFP A;  2ZEP A;  1QMU A;  3D3S A;  4E2A A;  1CP7 A;  3JVN A;  3HLP A;  2EK9 A;  1Z9U A;  3D66 A;  2AFO A;  3I9S A;  5J8C A;  2ZXV A;  4IUS A;  3JRU A;  1CBX A;  1Y0Y A;  3PRT A;  4ONW A;  4A39 A;  3FX6 A;  1YME A;  4A33 A;  2ZPA A;  3KZW A;  3H8E A;  1XIX A;  2JDC A;  4ZBG A;  1DTD A;  3DSB A;  2FIW A;  5HH1 A;  2CNT A;  3TC8 A;  4II9 A;  3WR7 A;  3CPA A;  2B3U A;  1WWZ A;  3CZX A;  1BOB A;  3A9L A;  4P4B A;  2ZEL A;  1IIC A;  1B6B A;  4K3N A;  4NGQ A;  4XNH B;  1RXT A;  4P10 A;  2CIJ A;  2ZEE A;  1XOV A;  2AFS A;  2V8H A;  2JDD A;  2IJZ A;  3D7F A;  5J8F A;  4YFJ A;  4AVB A;  5ELY A;  2YNE A;  3RBU A;  5JM6 A;  2P6G A;  2RC4 A;  4ZGY B;  2PJC A;  2DXQ A;  4U9Y A;  2CTC A;  4OME A;  2OZU A;  3SJE A;  2FCK A;  3C26 A;  4B14 A;  2O53 A;  2PR8 A;  4PXC A;  2VZY A;  4UCP A;  4CYP A;  5K8N A;  2HQY A;  2IL4 A;  4OAD A;  1Q2C A;  3GLJ A;  2GLF A;  4A30 A;  2EK8 A;  3GIU A;  4MHD A;  3LOD A;  3W6X A;  2QEC A;  3MGD A;  3D68 A;  4IK2 A;  4GS4 A;  4ORF A;  2PRQ A;  2R98 A;  5K8O A;  1BPM A;  3PB6 X;  1GYT A;  2BL1 A;  8CPA A;  3S6F A;  2B58 A;  3CXQ A;  2K5T A;  2P0W A;  3FF3 A;  3KI9 A;  1Y9K A;  3B3T A;  4R76 A;  4F9V A;  1YLE A;  4KOX A;  4L89 A;  3BI0 A;  4A95 A;  5K8M A;  4KOT A;  3T90 A;  3SJF A;  3BXM A;  2R1I A;  5LRG A;  5F49 A;  5H84 A;  3NH4 A;  4UEZ A;  1ELL P;  5HVG A;  5C82 A;  1Z4E A;  3B3C A;  1R3N A;  2PJB A;  2REF A;  3DGV A;  2D4P A;  3FRM A;  3FXT A;  3K9T A;  4NGR A;  5D8N A;  4ZX9 A;  4F9U A;  2PJA A;  1I21 A;  4MY0 A;  4A2Z A;  5A28 A;  3H5Z A;  4P44 A;  1Z8W A;  2PSW A;  4PK2 A;  1UWY A;  2OH1 A;  3EFA A;  4MFK A;  4MCS A;  2Y0M A;  5ISV A;  2CF4 A;  1Z8T A;  3PBB A;  3IFE A;  1P0H A;  4UFV A;  4QC6 A;  2B3V A;  3PBE A;  1PCA A;  1TF9 A;  4FAI A;  1MK4 A;  4DNC A;  1QQ9 A;  4MFJ A;  5AG6 A;  3S9M A;  3QAY A;  4MI4 A;  4MCQ A;  4K30 A;  1NMT A;  3R95 A;  3G3S A;  1IOF A;  5LYF A;  1TKF A;  1AMP A;  1A2Z A;  2PDO A;  2QML A;  1H8L A;  4MHY A;  4A31 A;  1IOI A;  3RZA A;  2Q4Z A;  4CAV A;  2J9A A;  1M4G A;  2CNM A;  1IB1 E;  2JBJ A;  2GIV A;  5IV0 A;  3PP9 A;  5J1Q A;  4G1P A;  1Q7L A;  3EC4 A;  1YW4 A;  2EVN A;  4Q7A A;  4ZYQ A;  1Y7E A;  4CAW A;  4B11 A;  5AG7 A;  1HDU A;  1QSM A;  2R7H A;  4CYN A;  2PRB A;  3CXS A;  1SQH A;  2OZH A;  2Z10 A;  3PGP A;  5F46 A;  3R9E A;  4JXR A;  4OC2 A;  4F8Z A;  2RB7 A;  4JZ0 A;  4HNW B;  4MCP A;  4R6T A;  4AVA A;  3N5F A;  3KR4 A;  4UCN A;  3RO0 A;  2JEW A;  3KGQ A;  4MY3 A;  4KSI A;  3D7H A;  1J4J A;  3SJG A;  4KUA A;  7CPA A;  2HB6 A;  4M6H A;  4A38 A;  2ODF A;  1CPX A;  4JWP A;  2NMT A;  2Z3P A;  3FVL A;  2GU2 A;  3EXN A;  3F5B A;  4XPL A;  4XPK A;  3SXN A;  3BI1 A;  2OU2 A;  4AG9 A;  1S7K A;  4ZY2 A;  5AG5 A;  1Z8X A;  2VI7 A;  4MFL A;  2BUE A;  3HUV A;  3LWU A;  5F09 A;  4UFW A;  5LYL A;  2ZW6 A;  4BD9 A;  4F6A A;  2BEI A;  3IGR A;  4OC4 A;  4NGM A;  4MHZ A;  3VH9 A;  1XMT A;  3PFE A;  4E0A A;  4NEX A;  5LRJ A;  3T9Y A;  4UF4 A;  3D2P A;  2C1C A;  2Q43 A;  1VHS A;  3FED A;  3N7Z A;  4KVO E;  4YGO A;  5G22 A;  3R9G A;  2Q44 A;  4OC5 A;  3JUW A;  1IGB A;  4NCZ A;  2Z3N A;  1Y9W A;  1HEE A;  2A4N A;  1LFW A;  2Q7S A;  2QJ8 A;  2Z3M A;  1BPN A;  3KQZ A;  1M4D A;  1M44 A;  2ZW4 A;  2KCW A;  4EVY A;  3E0K A;  4FD5 A;  2R8V A;  4X2T A;  4P4E A;  2POK A;  3GKR A;  4OIW A;  1BLL E;  3W91 A;  4AG7 A;  1Q2Y A;  1LCP A;  1Z5R A;  2ATR A;  1VHO A;  4IHM A;  2YND A;  2Z11 A;  3QB8 A;  3LMS A;  4TWE A;  4OC3 A;  2VEZ A;  2XEI A;  3H8G A;  4A94 A;  3MN8 A;  4B13 A;  2FT0 A;  3IJ3 A;  3FJU A;  3R9F A;  3UY5 A;  4QBJ A;  2DEA A;  5G20 A;  2HUZ A;  2P6F A;  1PU9 A;  2VBQ A;  2Q7B A;  3NE8 A;  3B3V A;  5BWA B;  2BSW A;  1XFO A;  4E8O A;  5LYI A;  2VL1 A;  2DPT A;  1MJA A;  4ZY0 A;  5I0C A;  2IQ6 A;  2V77 A;  3IU1 A;  2JLM A;  4CGN A;  4KS9 A;  5AG4 A;  3S6H A;  2Q04 A;  2ZEM A;  3FMC A;  1QSR A;  1TKH A;  4UBR A;  4XNH C;  3VAR A;  3ZJ0 A;  4KSF A;  4GXH A;  5D29 A;  4FD6 A;  4P45 A;  4KOS A;  1QSN A;  1VKC A;  3WC7 A;  2FXF A;  3PEI A;  3S9L A;  1M4L A;  4O23 A;  4UCM A;  1ARM A;  1KUV A;  3R96 A;  2AFM A;  4M3S A;  1B87 A;  2JEV A;  2RFH A;  4KOW A;  4PV6 A;  2PIY A;  2F5I A;  1I12 A;  1VIX A;  1XE4 A;  2CY2 A;  2NSM A;  4JLY A;  4QUS A;  3RYO A;  4C7I A;  5KTD A;  1AYE A;  2GAN A;  4PXD A;  4B5P B;  1LAM A;  2WYR A;  1ZG8 A;  4MHP A;  3WAB A;  2CXA A;  3ISZ A;  1TIQ A;  5IX3 A;  1XEB A;  3P2H A;  4FUU A;  1PUA A;  3SI0 A;  4JXQ A;  2HC9 A;  3F8K A; 
#chains in the Genus database with same CATH homology
 3TOB A;  2X7B A;  5JPH A;  3DR6 A;  1S5K A;  4BBH A;  1WK4 A;  3PZJ A;  5FVJ A;  1FY7 A;  1S7N A;  2FL4 A;  4Y49 B;  2CNS A;  3JTK A;  1N71 A;  5F47 A;  3BJ7 A;  2Q0Y A;  4CAF A;  2AJ6 A;  3VWE A;  4MBU A;  4MFZ A;  1KUX A;  1UFH A;  4PSW A;  4KLV A;  3B8G A;  4C2X A;  3V8I A;  2G0B A;  1Q2D A;  4CS0 B;  5A27 A;  3TO9 A;  3QAH A;  5DWN A;  3TT2 A;  1KUY A;  3H4Q A;  3NE7 A;  4F0X A;  1V0C A;  4CYQ A;  4AVC A;  2WPX A;  2G3T A;  4Y49 C;  1KZF A;  2PC1 A;  2FS5 A;  4KVX A;  2H5M A;  4JD6 A;  4MFQ A;  4B10 A;  4A32 A;  5KTA A;  5CNP A;  4QVT A;  2AE6 A;  1RO5 A;  2VXK A;  4NSQ A;  4R57 A;  2YNC C;  2B4B A;  3IWE A;  4XPD B;  3IWG A;  4C2Z A;  2B5G B;  1YK3 A;  1GHE A;  4KLW A;  1YR0 A;  2REE A;  2Z3O A;  5H86 A;  2EUI A;  5G1Z A;  4M85 A;  3S6G A;  3I3G A;  3DDD A;  3GYA A;  4KOY A;  4NF1 A;  1CM0 A;  4FD4 A;  3SXO A;  3TCV A;  2B5G A;  4X5K A;  3CXP A;  3FIX A;  1L0C A;  1IYK A;  1ON0 A;  2WSA A;  1M4I A;  4U5Y A;  3DNS A;  3BJ8 A;  4CGO A;  1Y7R A;  2J8M A;  2FSR A;  2HV2 A;  1QST A;  1S3Z A;  1IID A;  2I79 A;  4U9Z A;  3FB3 A;  4KUB A;  3W6S A;  2J8R A;  2J8N A;  4CGM A;  4UA3 A;  2OZG A;  3TO6 A;  4B12 A;  2PR1 A;  5DWM A;  3FBU A;  4FD7 A;  4H6Z A;  2ZW5 A;  2VZZ A;  3TOA A;  4UWJ A;  3D2M A;  4YRH A;  1YRE A;  2G3A A;  1YGH A;  4PSX A;  4R3K A;  3TO7 A;  1YVO A;  1NSL A;  3D8P A;  3R1K A;  1YVK A;  5E96 A;  4Q38 A;  4IF5 A;  3K9U A;  4F0Y A;  4B5P A;  2GE3 A;  4PK3 A;  4H6U A;  2YGW A;  4CAX A;  4RI1 A;  5AGE A;  1MJ9 A;  2Z0Z A;  5KTC A;  4HNY B;  2PQ8 A;  2Z3L A;  4H89 A;  3TFY A;  3G8W A;  4KVM E;  3OWC A;  1S7L A;  2B4D A;  3P2F A;  4KOR A;  1IYL A;  5HMN A;  2QIR A;  2WUU A;  4KOU A;  3BLN A;  3EO4 A;  2I00 A;  2Q4V A;  2VQY A;  4CYO A;  1BO4 A;  3FNC A;  1M1D A;  4C68 A;  4C7H A;  1Z4R A;  1OZP A;  2DPS A;  1K4J A;  3F0A A;  4CGP A;  4C2Y A;  5G21 A;  3LD2 A;  3KKW A;  5F48 A;  4QB9 A;  3TTH A;  1ZO0 A;  4CAE A;  2FE7 A;  3SHP A;  4AB7 A;  4UFX A;  3FYN A;  2Z3K A;  4KZT A;  4CRY B;  2WPW A;  1P4N A;  1I1D A;  3S6K A;  4UWI A;  5EBV A;  3GY9 A;  2C27 A;  4Q36 A;  1NE9 A;  2B4D B;  1LRZ A;  1YX0 A;  4KOV A;  4MJ8 A;  5GCN A;  1S7F A;  2ZW7 A;  4KSA A;  1S60 A;  1QSO A;  4CGL A;  3DR8 A;  1U6M A;  1MJB A;  1R57 A;  4CRZ B;  2Q4Y A;  4L8A A;  4OAE A;  2FIA A;  4XPD C;  5C88 A;  4JJX A;  4J3G A;  3TE4 A;  3VWD A;  5EC4 A;  3EY5 A;  4R87 A;  2P6E A;  4LX9 A;  4ONU A;  4HNX B;  5IB0 A;  2D4O A;  2YNC A;  1XF8 A;  2O28 A;  4RS2 A;  4R9M A;  4NXY A;  3IU2 A;  4I49 A;  4HKF A;  4BMH A;  4B5O A;  2OB0 A;  4OLL A;  2ARH A;  1CJW A;  3ZZI A;  4MFP A;  3D3S A;  4E2A A;  3JVN A;  1Z9U A;  3I9S A;  5J8C A;  2ZXV A;  4IUS A;  4A33 A;  2ZPA A;  1XIX A;  2JDC A;  4ZBG A;  3DSB A;  2FIW A;  5HH1 A;  2CNT A;  4II9 A;  3WR7 A;  2B3U A;  1WWZ A;  1BOB A;  3A9L A;  1IIC A;  1B6B A;  4XNH B;  1RXT A;  2JDD A;  5J8F A;  4YFJ A;  4AVB A;  2YNE A;  2P6G A;  2RC4 A;  4ZGY B;  2DXQ A;  4U9Y A;  2OZU A;  2FCK A;  3C26 A;  4B14 A;  2PR8 A;  2VZY A;  4UCP A;  4CYP A;  2HQY A;  2IL4 A;  4OAD A;  1Q2C A;  4A30 A;  4MHD A;  3LOD A;  3W6X A;  2QEC A;  3MGD A;  4ORF A;  4GS4 A;  2R98 A;  2BL1 A;  3S6F A;  2B58 A;  3CXQ A;  2K5T A;  2P0W A;  1Y9K A;  1YLE A;  4KOX A;  4L89 A;  4A95 A;  4KOT A;  3T90 A;  2R1I A;  5F49 A;  5H84 A;  5C82 A;  1Z4E A;  3FRM A;  3FXT A;  2REF A;  5JQ4 A;  2D4P A;  1I21 A;  4MY0 A;  4A2Z A;  5A28 A;  3H5Z A;  2PSW A;  4PK2 A;  2OH1 A;  3EFA A;  4MFK A;  2Y0M A;  5ISV A;  1P0H A;  4UFV A;  4QC6 A;  2B3V A;  1MK4 A;  4DNC A;  4MFJ A;  5AG6 A;  4MI4 A;  4K30 A;  1NMT A;  3R95 A;  3G3S A;  2QML A;  2PDO A;  4A31 A;  4CAV A;  1M4G A;  2CNM A;  1IB1 E;  2GIV A;  5IV0 A;  3PP9 A;  3EC4 A;  2EVN A;  4CAW A;  4B11 A;  5AG7 A;  1QSM A;  4CYN A;  2R7H A;  2PRB A;  3CXS A;  1SQH A;  2OZH A;  2Z10 A;  3PGP A;  5F46 A;  3R9E A;  4JXR A;  4HNW B;  4AVA A;  4UCN A;  4MY3 A;  1J4J A;  4KUA A;  4JWP A;  2NMT A;  2Z3P A;  3EXN A;  3F5B A;  4XPL A;  4XPK A;  3SXN A;  4AG9 A;  2OU2 A;  1S7K A;  5AG5 A;  2VI7 A;  4MFL A;  2BUE A;  4UFW A;  2ZW6 A;  4F6A A;  2BEI A;  3IGR A;  4E0A A;  1XMT A;  4NEX A;  3T9Y A;  3D2P A;  3N7Z A;  4YGO A;  1VHS A;  5G22 A;  4KVO E;  3R9G A;  2Q44 A;  3JUW A;  4NCZ A;  2Z3N A;  1Y9W A;  2A4N A;  4LUA A;  2Z3M A;  4R3L A;  4EVY A;  1M4D A;  1M44 A;  2ZW4 A;  2KCW A;  3E0K A;  4FD5 A;  2R8V A;  3GKR A;  3W91 A;  4AG7 A;  1Q2Y A;  2ATR A;  2YND A;  2Z11 A;  3QB8 A;  2VEZ A;  4B13 A;  2FT0 A;  3R9F A;  3UY5 A;  4QBJ A;  5G20 A;  2HUZ A;  2P6F A;  1PU9 A;  2VBQ A;  2Q7B A;  5BWA B;  2BSW A;  4E8O A;  2DPT A;  1MJA A;  5I0C A;  3IU1 A;  2JLM A;  4CGN A;  4KS9 A;  5AG4 A;  3S6H A;  2Q04 A;  3ZJ0 A;  1QSR A;  4UBR A;  4XNH C;  4KSF A;  4FD6 A;  4KOS A;  1QSN A;  1VKC A;  2FXF A;  3R96 A;  4UCM A;  1KUV A;  4M3S A;  1B87 A;  2JEV A;  4KOW A;  4PV6 A;  2F5I A;  1I12 A;  1XE4 A;  2CY2 A;  4QUS A;  4JLY A;  3RYO A;  4C7I A;  5KTD A;  2GAN A;  4B5P B;  2CXA A;  1TIQ A;  5IX3 A;  1XEB A;  3P2H A;  1PUA A;  4JXQ A;  3F8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...