5G2HA

S. enterica hisa with mutation l169r
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
244
structure length
231
Chain Sequence
MIIPALDLIDGTVVRLQRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIGSTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVRCTDISRTLAVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SULFATE ION
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Isomerase
total genus 79
structure length 231
sequence length 244
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5g2hA00
5I3FA 5AB3A 1L6WA 2GUUA 3W72A 3RMJA 4HNNA 4O8RA 1W0MA 4N4QA 5HINA 5BMWA 4O1CA 4UMCA 1EX5A 1HL2A 4QISA 1JRBA 5EY5A 3FYPA 1FCVA 2GPTA 4DQWA 4Y96A 3DGRA 1K7FA 5EMUA 4JIPA 3W1RA 5FF2A 1VLWA 1NF0A 4I9AA 2Z2UA 3E49A 1DJQA 3MW7A 5DELA 1IXPA 3O06A 5FF7A 4GNJA 3RNDA 1EWEA 5D2XA 3I6RA 3VI2A 1W5MA 3K30A 3B03A 4EF9A 4ZQPA 4RLIA 3EXTA 3NQDA 4XTIA 4FNSA 4MKNA 4LVAA 3I7RA 5DXYA 3S0CA 3HPXA 4RCXA 3ATYA 5F1VA 2YGYA 1GTHA 2F7FA 4AF0A 1N8FA 2DP3A 3PUEA 2DZPA 3T55A 2A6NA 2E6AA 4D2JA 3DZ1A 2UV8G 3MBDA 4X9SA 1ADOA 3A9IA 3W74A 5KITA 5LHFA 4ADSA 4O4VA 4TO8A 1W3NA 3ZFHA 3MP3A 1NVMA 1AMKA 3NG3A 4XZ9A 3IIZA 1AW5A 3SI9A 1K8ZA 1SSGA 4HPXA 3G1SA 2FB3A 3GB6A 2QCFA 1Q6RA 3RK8A 2JGQA 3H53A 3A22A 1ZY9A 3QH2A 3UWQA 4LUJA 1ICPA 3LCWA 4DPQA 1WQ5A 1YTEA 2ZRVA 1I2NA 2DZXA 1D9EA 4WXYA 4YLWA 4X22A 4KFOA 3NQFA 4N9CA 2E6DA 2ABBA 3UXDA 2W6RA 3W73A 1TREA 1YTKA 2A7PA 3Q2DA 1ME7A 3RLVA 3G1AA 4UFIA 2CLHA 3EX1A 2E77A 3PVFA 2YW4A 5U4NA 4IX0A 4AB4A 1VYSX 4MOZA 3NXFA 2Y62A 1TV8A 1TRIA 1FDZA 4FNPA 1M7PA 3DFPA 1DORA 3O6DA 4UNLA 4K36A 1ZALA 4NZFA 4JTHA 4P2VA 3W84A 4IXHA 2ISSA 3P8IA 3EWYA 3BO9A 2Z1BA 4RZ4A 6TIMA 1H1YA 4JX6A 5CZ0A 3NQMA 1X1OA 1KBIA 3GVGA 2YDAA 2QUUA 5LNUA 5AHLA 3FEMA 2EPHA 1XDMA 3PB2A 3LI1A 1S5TA 3C0JA 2R14A 1FXQA 2BX7A 3KFTA 1RD5A 3I7QA 3P62A 3MMTA 3O6CA 3INPA 1OHLA 3MWAA 3NQ8A 2YCEA 3P8JA 3PBVA 1M6JA 4PTNA 2GJNA 3DAQA 2I9EA 5SWUA 1XC4A 5DLCA 3V75A 2YYTA 1XM3A 2A2IA 4IPIA 3M41A 3P84A 5CSSA 2LLEA 1B3OA 5HUOA 4GUFA 1FWRA 1TJPA 5G4WA 2QDGA 4O57A 3BARA 2H6RA 1BWKA 1ICQA 3NL6A 2VEKA 1XBVA 4O1BA 4GUJA 1H7PA 4NZJA 3W7RA 4OHQA 5DXXA 1GG0A 2FPVA 1A5SA 1IGSA 1TPFA 2R94A 1VR6A 2J9XA 3L9CA 3QJAA 4MY9A 5CSRA 2WSQA 2CU0A 1H61A 1SFLA 2TRSA 3SZ8A 2Y7DA 3UPBA 3KRUA 4OBTA 2VC6A 2HSAA 1X6UA 4O53A 4GE8A 5E0KA 1PCKA 3E96A 3W6YA 3M5XA 4R7JA 2QKFA 3LXCA 3PAJA 3W1TA 3ZS4A 5F4WA 3PBYA 5I3HA 4UFMA 3BW2A 1X1ZA 3P7YA 2ZFAA 3LCXA 3LV5A 1LCOA 1F5ZA 2B7PA 3ABRA 4PH6A 4A2RA 2V8ZA 4MY8A 2QCDA 1FDJA 4OGZA 1W5QA 5D02A 3TQ0A 3W7JA 3EXRA 1OF8A 4UMAA 3UWVA 3W7GA 1KV8A 4Z0JA 4Q32A 3W1PA 2DZTA 2Y70A 1NEYA 3LCHA 3NQGA 1KM6A 4O52A 3W2JA 1QNVA 4BWLC 1NSJA 3VCRA 1O5XA 1VC4A 2FFCA 2JGYA 1KTNA 3BK0A 3DENA 4OE7A 3UY7A 4YCPA 5LNSA 2W0UA 3PBWA 4UTIA 1DBTA 3STGA 4IGHA 4QIUA 4Z1DA 1VCGA 4JTTA 1R46A 2A0NA 5DCDA 4P61A 5FF0A 6ALDA 4RK8A 2VFEA 5AHIA 2QJGA 3EKZA 3CWNA 4WD0A 4FO4A 1WDWA 4JY8A 3HGRA 4GJ1A 1HUVA 3SR7A 2XN1A 3TW7A 3E9AA 4NJKA 4ZL1A 4TMCA 1YXYA 1JQXA 2CWNA 2GVJA 3GK0A 2NX1A 2P10A 4HSNA 1V5XA 2DJLA 1XFBA 5LHEA 5FESA 2ZRZA 3KHJA 1QAPA 5J5RA 2CLIA 4R53A 3A5FA 4FNTA 3N2XA 2ZZ3A 4O11A 3S1UA 3HIJA 1H50A 1JUBA 4UTUA 1ICSA 1YTDA 4AEOA 3VE7A 3NPUA 3DKLA 4PL1A 1JCYA 3WJYA 5G2IA 4LV4A 3GXTA 5K2ZA 1KFEA 2ZDRA 1EPXA 4UTWA 4TIMA 3TFXA 3KVMA 4R33A 1YDOA 4PC8A 3HB9A 3UPWA 4LC6A 3G3DA 4BI6A 3BG5A 2ZQ0A 3NDOA 1OFOA 1Z42A 4O54A 3C6CA 3R12A 2CLMA 2OCZA 4BR1A 1ZENA 3BG3A 5AC6A 2V5BA 2QAFA 3NQ6A 3LCFA 2A1YA 4JGDA 1WA3A 1YYAA 3I65A 3B0VC 1EUAA 4L4LA 4N6EA 1IIHA 5G4EA 3WK1A 4FXSA 2VFIA 3TQKA 4S1FA 5F1UA 2NXGA 2C13A 3QSRA 1QR7A 2QUVA 4NX5A 4H6KA 5J5DA 3EEGA 5D04C 2C14A 2WSYA 1TTJA 2Y61A 4K38A 1M7OA 2I1OA 1QPOA 3W07A 2EHHA 1LM1A 3NAVA 2ZZ5A 2HMCA 3PC0A 4M6VA 1K7XA 2ZA1A 3HG3A 3QMSA 1TV7A 4RJEA 2ZRXA 3I7SA 4WUIA 5IBXC 3P67A 4Z0SA 1GTEA 1QO5A 3IIOA 3L66A 5D30A 1F05A 5E93A 3CEPA 3M43A 4C1LA 1TMHA 2FJKA 5FF4A 2QF7A 5FI8A 3BLFA 2YZRA 3E0IA 2Z6IA 1RPXA 1XUUA 1LLZA 5AHFA 3NL3A 3R5EA 1W56A 3UWWA 3FJ6A 2ALDA 2X2GA 4AH7A 1C9DA 4ZQRA 2WSRA 3LBCA 2DZSA 3KOFA 3CT7A 3NR0A 3ATZA 3S5YA 3MHFA 3QM3A 3NPXA 5CGQA 5LZLA 5BMXA 1QO2A 2JKAA 2A7RA 3SY5A 3N9SA 3PULA 3NA8A 3FFSA 3MBFA 3PR2A 4DF0A 3W75A 1F76A 2NUWA 1XBZA 1IXNA 3IIXA 5L6UA 1RV8A 2YX0A 3DFQA 3L5LA 3HG5A 3LI0A 3P5YA 3L0KA 3NZRA 4JIQA 8TIMA 1DOSA 2E5DA 4LVBA 3WK2A 2GVGA 5TQLA 3LV6A 5D32A 2VEIA 4NUWA 3W9ZA 1RQEA 1OVDA 1YXCA 2DZUA 1L9WA 4FIQA 4LV9A 4UMBA 1GG1A 3GDTA 1P0KA 4NJJA 4TX9A 1KA9F 2WNQA 3C61A 2CLKA 2H8ZA 2AQWA 3Q37A 5C5YA 1TTQA 1OABA 5AHMA 3W76A 5HR7A 1KLYA 2XN0A 1XXXA 1MEIA 5HULA 3KVJA 2CLEA 1EP3A 4DBEA 3QMTA 2WOQA 3W86A 5EBUA 2NUXA 2J6XA 2ZZ4A 3D0CA 2B4GA 1WYIA 3EX4A 2ZCGA 3TSMA 4I7WA 2X1SA 3TSDA 3G0SA 4AWSA 5D09A 4GUGA 1OFPA 1XUZA 3W1QA 4Y90A 2RDUA 1T0OA 2GQ8A 4DBDA 1WOAA 3LDVA 4K37A 3IV3A 1TPEA 3EX2A 1L6SA 3A24A 2B7OA 5C6MA 4WJEA 1WV2A 5HUPA 4CNNA 5F2MA 3WK0A 1LORA 3HGOA 3QPYA 2Y7EA 3W2KA 3O16A 1GZGA 4O28A 3HQ1A 3VKJA 1TRDA 3TAOA 2P1FA 4OV9A 2VFGA 2C18A 1LRTA 3STCA 4ZQNA 5K9DA 3W1MA 1PV8A 3NYZA 3NVTA 3GXNA 4MUZA 1KFBA 3YPIA 2NV1A 1OK6A 3USBA 1GVSA 2RKXA 4BI5A 5MHBA 3S5OA 4CCDA 2YR1A 5AN7A 3KAOA 2TYSA 5AYZA 5LGZA 3OHIA 4K6AA 2X16A 4FHAA 4UTKA 3F4NA 2NWSA 3P82A 2NWRA 4WY0F 4XBSA 2C1HA 2Q3RA 2E09A 3GDMA 4K8EA 4OV4A 5EL1A 1FXPA 1EA0A 1OFBA 3SW6A 3IGUA 4HSOA 4ONVA 1SZEA 4S2BA 4JTSA 3FYOA 4JICA 3W7IA 3TMQA 1XL9A 4TU1A 5F4XA 3PS7A 4IMEA 2OJPA 2V5LA 1W5PA 2XN2A 1DQXA 4RV8A 4Q4KA 3HF3A 3GDRA 3H55A 1UJPA 4M5PA 4R34A 1VCFA 1P4CA 4YCOA 1PVNA 3LCGA 1P5BA 2D73A 5DBUA 4E2DA 3GDKA 2A85A 3DI0A 5HWJA 4IMCA 1LDCA 3GXPA 2V2HA 1Y0EA 2ATSA 3NZ1A 4M19A 1W5OA 1OJXA 2VELA 1OK4A 3DFNA 3NL5A 5K4XA 1LBLA 4QAIA 3G3MA 3G1FA 2EGZA 5GVJA 3M47A 1DVJA 1MZHA 2NX9A 2GJLA 5AHNA 3C3NA 3GKAA 3GLCA 1XI3A 2VOMA 4K39A 3G1DA 1WXJA 4IOTA 1JUEA 4NJHA 1K8YA 3ANYA 3B0PA 1FWSA 1VHCA 4RX0A 5A5WA 5KZEA 3MJYA 4M7SA 3W7CA 1OX4A 2J27A 4I7UA 4CQ8A 1MEWA 3HPSA 1H7RA 1RQHA 2VFFA 2CZFA 2GQ9A 4JTLA 5I3KA 3MP4A 4XQ6A 4PA8A 1W5NA 4Z08A 4Y9AA 4NXSA 1CW2A 3IVTA 1QDSA 3CM4A 2WPBA 3THQA 4CLMA 4C1KA 1DHPA 1K8XA 1VHNA 1ZAHA 2G97A 4UTMA 1I8JA 2X1RA 2V2DA 1DL3A 3PSVA 3W71A 3BVJA 5HNRA 1SO4A 3DU0A 1QMLA 3O8AA 3QQ1A 4JS3A 4YWIA 3SJ3A 2HS6A 5HMSA 1W31A 4E2BA 3BG9A 5I3JA 4WZHA 2VFDA 5A8GA 1JRCA 3TDFA 3G8EA 3M7WA 2VXNA 1LZOA 1KV5A 4O0ZA 1PS9A 3SSJA 3NOEA 1GWJA 3B04A 3LTSA 3UQNA 1PIIA 1TPH1 2W79A 4JDYA 2X30A 2C0AA 4PODA 4HKPA 3IRDA 3C8FA 3NQCA 1K7EA 1OYAA 2NLIA 3B0UX 3LXBA 1F6PA 3IGXA 3IIVA 3C2RA 3DFTA 3W70A 1AK5A 5HWMA 3G1XA 3OG3A 1MSSA 3LRMA 3QF0A 3KVKA 2JKPA 5KMYA 1G67A 2OT1A 4UFHA 1H63A 2ZZ2A 4XKYA 1LLWA 1PHQA 3C4UA 4GWEA 2J24A 1E51A 5DCEA 2RFGA 3T78A 3W1XA 3R8RA 4AAJA 4JYFA 2ZA3A 3EWWA 2AAMA 5DY3A 4AF0B 2ZA2A 4NNBA 3UZJA 4FF7A 3THAA 2ZBTA 3FJLA 2A4AA 4O50A 1G4PA 3W1UA 3MI2A 4FX6M 3PY2A 3HO8A 3HG4A 2H8XA 3F1QA 4H3DA 1A5AA 3ABOA 4JXCA 2R8WA 1G6CA 3OIXA 1HTIA 3W22A 5G1TA 4E38A 2ISVA 5BNKA 2WKJA 3S1WA 2CLLA 2QCGA 3WFAA 3P74A 3TA6A 1D3HA 3W1AA 2EAWA 4CNOA 3W7MA 1SO3A 2H3DA 5E1QA 4WX2A 4FX7A 4ICNA 3JR2A 5CG7A 3LERA 3SFKA 4FX8A 3HG2A 4LNYA 2Z0IA 3BPWA 2J88A 5F2GA 2QEZA 3NO5A 1KFLA 4QITA 2O7QA 3W88A 3STEA 3G22A 1H7WA 4X2RA 1IIGA 3HJZA 3NGJA 3GR8A 1SW3A 4GBUA 1S5WA 1A5CA 1SFJA 4IPJA 1J2WA 2GOUA 4UTTC 2ABAA 1OG0A 3G24A 1G69A 4JDBA 1FDYA 4DXVA 3KX6A 3LHZA 2ATMA 3DFSA 2WO5A 4BK9A 1T8XA 3CWOX 4N2YA 1OYBA 2B0MA 3DKJA 4PEKA 4FXRA 3W2UA 1GYLA 4O17A 1GVRA 4RZ5A 1JUKA 1AW2A 1SPQA 4O4WA 3NPVA 3LOTA 2NUYA 3PF3A 1H62A 1W54A 4XUGA 3S42A 3N14A 1XKYA 4MZYA 2Y89A 5D2YA 1YPFA 1TB3A 2QCMA 1KM4A 4HNUA 1QOQA 4LUIA 3T4CA 1VH7A 2QUTA 5K9XA 1EUNA 1ZNNA 1XBXA 5EA9A 1G7VA 1MO0A 4YMZA 2QDHA 1JCXA 1FWWA 1OX5A 1LROA 2C15A 5CPLA 4JTIA 5LNWA 4IMGA 3EWZA 2G95A 4DF1A 3C2EA 4I7VA 5FEPA 2H90A 4O12A 1I2PA 1O4UA 5F2IA 2NXHA 2TPSA 4U4MA 3TXZA 1ME9A 2WQPA 2RDTA 2X1UA 3BLEA 2RDWA 2C6QA 4JR5A 3NQ2A 2QJIA 3QFEA 1FCBA 4DELA 4LY8A 3DH7A 2GVLA 4JYDA 4JD4A 1H7OA 4WOQA 4ZQCA 3O63A 2E5BA 1O60A 1QWGA 3B05A 3PG9A 1H5YA 3U2OA 5D2TA 3W7HA 4IMDA 2Y85A 1SW0A 1VYRA 1ZAJA 3T7VA 4NNAA 4O10A 4UTHA 3PWAA 1FCQA 3R2GA 4QNEA 3W2LA 3W23A 2WNZA 4LU0A 1WBHA 4BI7A 3QSTA 4CQ9A 2NXIA 3V1PA 1YXDA 4XBKA 3IVSA 3QYQA 3L65A 1MXSA 3N9RA 2QCDB 4M7TA 1SZGA 1OF6A 1TTPA 3KRZA 3EWBX 3FKKA 2IQTA 1ME8A 1GVFA 1TPB1 5C55A 1QPRA 2JKEA 3TNOA 5H2ZA 1SO6A 5BW6A 1JCNA 1WBJA 4FEZA 2E6YA 1F2JA 1OFAA 4MJZA 1Q45A 4O1AA 3TC6A 2B7NA 4N9DA 4JX5A 1CX9A 3NQVA 3ZWTA 4FNUA 2DJXA 1XCFA 3EXSA 4MZ1A 3MI3A 2FDSA 2E6FA 5KZMA 2ZTKA 1YLVA 5DY2A 4LT9A 4FNRA 1JCMP 2Q8LA 1LOLA 3TU9A 4WY0A 4OT7A 3LCIA 4HN4A 5L9FA 1K03A 3OVRA 4UC5A 2JBMA 1FCUA 1TQJA 4MY1A 2QR6A 2V0TA 1QCWA 4GXMA 2FPTA 4QM1A 4O13A 1SUXA 5DN1A 1Q6OA 2YFNA 4A2SA 5EPDA 3NQEA 2C16A 5D2VA 5FF3A 3NM3A 3FLUA 1G4SA 3C2FA 1RR2A 1A53A 2E68A 4N02A 1BEUA 3WK3A 3W2NA 3HPZA 4JNMA 2FTPA 5LKYA 3CU2A 2V81A 4JY9A 3TV8A 4U28A 1XBYA 2ZZ1A 4NX0A 1R2TA 1VPXA 1TYGA 4E0CA 5HJLA 3S1VA 3M0ZA 3NNTA 3SECA 2KZHA 3KXQA 4ORIA 5FEWA 1NAL1 3A21A 3BW3A 3GX9A 1FX6A 1Z41A 1W37A 2BSLA 4MLRA 3S1XA 3UD6A 1HFBA 3O6YX 1H60A 2HS8A 2F84A 4MLJA 4N4PA 4CQAA 4DO5A 1F7BA 3MUXA 5C2XA 3P80A 1KM3A 1I45A 3DHFA 3M5ZA 1TPDA 1THFD 2WNNA 4NVTA 1LOQA 3UXAA 3LRLA 3TKFA 3IIPA 2P0OA 3GIYA 1XDLA 1I2RA 3WJZA 1YPIA 1K02A 1KFCA 1FWTA 1LBFA 3L21A 5G2HA 1O95A 3MP5A 5AC7A 3CLMA 3CTLA 4LS1A 4EWND 3EWUA 3L68A 3BLIA 2I14A 3O15A 4MVAA 1AG1O 4LWWA 5IBXA 1KM5A 2VEMA 1NF7A 4HT3A 4ZVJA 4YXGA 1KM1A 3WJXA 2ZTJA 3HOJA 3MI6A 1GEQA 3NQAA 3G0XA 4UTJA 2PC4A 1L6YA 1TSIA 5KINA 4POCA 4RXFA 2PCQA 3LHTA 1YDNA 1GPWA 4RXGA 4L4MA 3TR2A 3ABSA 3SIZA 4UUIA 1DJNA 4NT0A 4ALDA 2RHGA 2G96A 1F74A 3TXVA 4TR9A 1T99A 2C3ZA 2ZRWA 3C56A 3M44A 1LP6A 3W7KA 4ORMA 1GJPA 5LSMA 2DU2A 5AHEA 4LOCA 1HO4A 1R30A 1GQNA 3LHVA 4LVDA 4FNQA 3L5AA 1SQ7A 4O16A 3W2MA 3W83A 3PG8A 1VZWA 4KFNA 4W9TA 2YW3A 2ZZ7A 4RKAA 3B8DA 4KWVA 1JULA 1H1ZA 4B5NA 3RF9A 4DO4A 1AW1A 5LNRA 1R2SA 1JVNA 3TUUA 3M5YA 4OQVA 3TW6A 3HMJG 1KFKA 1SU5A 1VJIA 1UUMA 3CIXA 1O94A 2WJZA 3BW4A 3PUDA 2AGKA 1X7FA 4GC4A 5I3IA 4NJGA 2ZZ6A 4QJ1A 4HNVA 1L2UA 3G8RA 3LHYA 3CB8A 4GUHA 1H7XA 3M16A 4LS2A 1A5BA 1UB3A 5HWNA 2DORA 1ZFJA 3N3MA 3UWZA 1J4EA 1BWLA 4FB7A 3IVUA 3N2MA 1HO1A 1FQ0A 4CCEA 3P61A 4EIVA 1H51A 1Q3NA 4ML9A 2VEPA 1ALDA 2PRLA 1KBJA 3LLFA 1K3UA 2PE4A 5CZTA 2FIQA 2FB2A 5D38A 1IF2A 2ZRYA 3W7DA 3GNDA 1EWDA 3CPRA 4IQLA 1AL8A 3QQ0A 2CZEA 4LC8A 1QFEA 4N9BA 1EEPA 1G4EA 3TFCA 3BV4A 3MHGA 1S5VA 1RZMA 2J9ZA 4IJBA 4UCGA 2QCEA 2VFHA 1ONRA 2WV8A 3BGGA 2FLIA 1Q6LA 4YL2A 1GT8A 1WAUA 2OT0A 4JTEA 2ZYFA 3EX6A 1VYPX 3KRSA 1ZAIA 1UASA 4JTUA 3W7EA 4IUOA 4AXKA 4Z1BA 5D33A 2BXVA 3LXAA 4ZQOA 4NU7A 5KSWA 1W8SA 3VFLA 4ADUA 4AHPA 1SW7A 1Z44A 1LRNA 2H3BA 2QCLA 3TSBA 1YADA 3A5VA 3LGEA 5KTLA 3IGSA 3CC1A 1LRQA 5CZJA 1B4KA 3LBMA 2VKZG 3VE9A 1Q6QA 1W1ZA 5F4SA 1TPWA 4O0KA 3S9YA 4MYAA 1OFRA 3L0GA 1RVGA 2GQAA 5TBOA 3W85A 1VS1A 4MFEA 4NXKA 3QEZA 3LHWA 1OX6A 3CIWA 3QZEA 1R2RA 5TIMA 3UWUA 2CLOA 1SZNA 2R91A 4MFDA 1VRDA 2Q8ZA 4UR7A 2Y6ZA 3TIMA 3UWYA 1C29A 2B7QA 2BTMA 5DBTA 3EKLA 3STFA 5KZDA 4GFSA 4UXDA 4UFLA 2QCNA 4JTJA 4MZ8A 1QOPA 4PL2A 4TMBA 3ZWSA 4UTWC 2RH9A 3G1YA 5FEXA 3P5ZA 3IEBA 4BF9A 3R89A 5AOUA 4WXZA 4O18A 4ZZ9A 1O5KA 3ELFA 5BRBA 1I2OA 4LW7A 3PB0A 3PUOA 5U7SA 3OA3A 4UFJA 4QQ3A 1DKWA 1JR1A 3L2IA 3M5VA 1ZCOA 3W1LA 3S8HA 4O15A 3MYPA 3QPZA 1TJRA 2YYUA 3OVQA 5LGXA 4GUIA 5G5IA 3A23A 3G1VA 3L0NA 5AFDA 5K4ZA 4MYXA 3FS2A 3G1HA 5AC8A 4IXXA 1W3IA 2X1TA 3HGJA 4DO6A 1LBMA 1OX4B 3E02A 1KTBA 2TSYA 5CPMA 1FBAA 4FIRA 2DZVA 2Z6JA 4Z1CA 3S6DA 1EP2A 2Y7GA 4KFPA 5LNVA 3CQ0A 4UNKA 2QAPA 4NJIA 1OYCA 1IXQA 4LVGA 1PHWA 2OZ0A 3W7NA 4IWWA 3TCEA 3UZ5A 4AWUA 4PCFA 3CHVA 3R13A 1TPVA 1CI1A 1VQTA 1VGAA 3TROA 3B06A 3QC3A 2YFOA 4XWUA 5D03A 2PRMA 1SO5A 2EKCA 5EKYA 3FOKA 4DF2A 3MYOA 3E12A 3LM7A 3TQVA 1J5TA 1SZFA 4MJMA 5EYWA 4A29A 3NL2A 1M5WA 3DI1A 2YSWA 3GYEA 3QW4B 3P81A 1I2QA 4Q33A 2JK2A 1TPUA 5F2LA 1AL7A 1TV5A 3GR7A 1B4EA 1PCWA 1GOXA 4WQ6A 1I4NA 1VCVA 4JX4A 3AJXA 3TMLA 4DEFA 3TX9A 4A21A 2G5WA 5G1YA 3JS3A 5AYYA 4OWGA 2BWGA 1DQWA 3LCLA 1IXOA 5I3GA 5CKSA 1C8VA 4EOUA 5FEZA 3I68A 2CZ5A 1UCWA 3PM6A 2CLFA 3QMRA 3EX3A 2C19A 2BZNA 4N6FA 4NNCA 1JQVA 4O14A 4UFKA 4LRSA 1F6KA 4XKYB 3M6YA 4UIOA 4A22A 2QJHA 3L5MA 3F03K 3SGZA 1TPC1 1NFBA 3EB2A 5BOOA 3DHDA 3DBPA 3AO0A 3T44A 5CPOA 5T26A 4ZMGA 4DPPA 3C52A 3W1NA 3PSWA 1UUOA 3LLDA 3EWXA 4G1KA 4NQ1A 1KTCA 4ZQMA 4RZ6A 3TH6A 4BFAA 3NPWA 1EP1A 2FPYA 3QRHA 1SSDA 3W7OA 3TE9A 1MEHA 1F73A 2OX1A 2V9DA 4O1DA 4OU1A 3GKFA 3VNDA 2ZRUA 3UNDA 4Y6GA 4HIBA 3W87A 3OVPA 1BKSA 3OBKA 3G0UA 4HPJA 3S5NA 4IMFA 5CPNA 3GNNA 1N7KA 4LVFA 3GAYA 1LOSA 4AHOA 4QSHA 2TMDA 5D05A 4LRTA 1TQXA 4K8HA 3U6WA 2J9YA 4HNTA 3O1NA 3U8GA 3HBLA 1T96A 4H4IA 1KM0A 3GAKA 3W7QA 4AVFA 3RU6A 1GVOA 2A5HA 4EF8A 3UYCA 2O7SA 3LX9A 4BWLA 1FY6A 1JCLA 4N9EA 3DFOA 4UTLA 4CCCA 4IX2A 3QW3A 1N55A 1ZHAA 1OFDA 1KLZA 2CFFA 2E1DA 4JN6A 1BTMA 4QNWA 5D37A 3LB0A 1VLIA 4AHQA 1KW1A 4XTDA 1FWNA 5H91A 1P1XA 3NM1A 1U83A 4UTTA 1X8FA 1G4TA 2EF9A 1U5JA 2CW6A 3CEUA 1KFJA 2XFWA 1SR9A 1WOBA 3JRKA 2ISWA 4LS0A 3KVLA 3FIGA 3W3OA 1TO3A 1PL9A 3B4UA 2NZLA 4K7YA 2VENA 3W7LA 3N19B 1ML1A 2CZDA 1LTDA 1G7UA 1V7YA 4A3UA 4K7VA 4JTFA 1QPNA 1TIMA 3RLUA 3LTPA 2PURA 2A21A 4Z1AA 4EVZA 3RFAA 2QCHA 4Y8FA 3MO7A 5HR6A 3NEVA 3WJSA 3FA5A 1W3TA 3PBUA 4JTKA 2V30A 1WX0A 2Q3OA 5AYXA 3C2VA 1A50A 3LHUA 1HG3A 5G2WA 7TIMA 3NQ7A 2BLEA 3DXIA 1JCJA 5D2WA 1RQBA 3BGJA 3ABQA 4UR8A 3M9YA 3TK7A 3Q94A 4LTSA 4JTGA 4MIMA 3T40A 2YPIA 3H54A 3S5ZA 5K9CA 1P0NA 1DV7A 2OMAA 1EIXA 2NX3A 4M6PA 1TTIA 5K7JA 1S3HA 4X3ZA 1JJKA 1TCDA 3SGUA 3LRKA 5CZSA 4HHPA 2Y88A 1EB3A 3O05A 3C2OA 4AMAA 1B9BA 1GVQA 3TAKA 4JEQA 4M6QA 5IM51 3W7PA 3GZ3A 3P60A 2PRHA 1QPQA 3M1ZA 2V82A 5HQEA 1KM2A 2HTMA 3ZR4A 1OFEA 4RR4A 3N34A 4JYEA 3L67A 3Q58A 1GYNA 3TJXA 3OEXA 3TJLA 3O07A 2A7NA 4S2CA 4PFMA 1UBSA 1YDVA 3FKRA 4KKXA 3LTYA 5K3VA 1LYXA 2FQIA 5DCBA 1Z48A 3G18A 1H7NA 4GRSA 4CNPA 4O19A 4WOZA 2V2CA 4AWTA 3HGSA 3UY8A 1D3GA 4WY0B 2A6LA 1FUYA 3WJWA 1PE1A 5ABTA 2YXGA 2QCCA 1R47A 3F4WA 3MHUA 5C54A 4ADTA 1ZJIA 4MPQA 1OFQA 4KWWA 2NV2A 1B57A 3TC7A 2Y7FA 3GDLA 2E5CA 2Y63A 2DZWA 3N73A 4J9JA
chains in the Genus database with same CATH superfamily
5I3FA 1C8QA 5AB3A 1L6WA 1XSJA 2VR4A 2OLAA 4JTQA 4LB4A 5HINA 4QISA 1JRBA 1QJWA 1CXIA 1WPCA 1FCVA 4Y96A 2EKGA 1K7FA 5EMUA 1TE6A 5LIUX 9XIAA 4B92A 4RE4A 5DELA 1DJXA 3O06A 5IFPA 3HQOA 3CAVA 1F3XA 5A2BA 5D2XA 3I6RA 4I6VA 3B03A 4EF9A 4ZQPA 3EXTA 1T41A 4D1JA 4MKNA 4LVAA 5D4YA 5DXYA 5CJ5A 2E9BA 2PS2A 4AZIA 3HPXA 1F3WA 4B9YA 5F1VA 2YGYA 3TOPA 2F7FA 3WKZA 3VPLA 2DP3A 1TKKA 3HN3A 2AGTA 2Q01A 4YTUA 2E6AA 3OIHA 3K46A 2QMJA 1NWUA 1ADOA 3M7SA 5KITA 4RV3A 5LHFA 4ADSA 4O4VA 3ZFHA 1UA3A 1U1UA 2FMNA 3HV8A 5JBFA 2OB3A 4Q8PA 4LBUA 3SI9A 4ERIA 1SSGA 1GEHA 4HPXA 2EG6A 1EJ7L 2QCFA 2JGQA 4GVFA 1ZY9A 3CO4A 4UOZA 1JPDX 4DPQA 1QNQA 1RAKA 2O4QA 3EA1A 2GSEA 2V5DA 2DZXA 5EMKA 2TODA 4X22A 3TN4A 1V03A 3W73A 1EDTA 4J3SA 4GZIA 3EDJA 4MTVA 2CLHA 4LF1A 4AG0A 3PVFA 2YW4A 3CHDA 4AB4A 1VYSX 3MB9A 3NXFA 2PGWA 1TRIA 1M7PA 1UPPA 4I9JA 4M1BA 4JTHA 4G7EA 3P8IA 3BO9A 3N2CA 2WBGA 3P93A 3GC2A 2PFHA 1A3XA 3GVGA 3W82A 2QUUA 3VOGA 2PA6A 4GK8A 1MW3A 4J2PA 3V16A 4M1RA 3O2LA 3MKVA 1OHLA 3NQ8A 2GWGA 3PBVA 1NARA 2GJNA 4D6CA 1V0MA 5ABFB 1XM3A 4EXAA 3PPHA 1WKFA 4IL2A 5FJOA 3K4AA 3P84A 2LLEA 3AMKA 3HZ3A 3M0HA 4O57A 1RY0A 2VX6A 4OIFA 1H7PA 4NZJA 1QATA 5JH2A 5DXXA 4GI8A 2HISA 3PNZA 3SUUA 1VR6A 4HQVA 3WQOA 2VVNA 1ZJBA 5BOFA 2J7GA 2CIPA 2PBGA 4LBSA 2WSQA 1H61A 1MDLA 2TRSA 3WNMA 2Y7DA 1QK2A 3AXIA 4ML4A 2EPMX 3N2TA 1PCKA 3W6YA 3M5XA 3FK4A 3OVGA 4R7JA 2QKFA 3FCPA 1VKFA 2X40A 4UFMA 2YA2A 1IV8A 3BW2A 5J04A 1S46A 4LUTA 3OGVA 4A2RA 2V8ZA 4NZ1A 3NIYA 2OGJA 1I6NA 5HMFA 2XFYA 4HU4A 4I5RA 3LCHA 1KM6A 4BWLC 1J6OA 3BK0A 3DENA 1TUXA 1BRLB 1WZLA 3PBWA 3B9DA 1DBTA 1MDRA 4Z1DA 1TG7A 4JTTA 1VRXA 1R46A 4C91A 2W5FA 3AHXA 4QLKA 3WNKA 1TWDA 5CC7A 5DCDA 1WE5A 4P61A 4XZNX 6ALDA 2VFEA 3CWNA 3W4RA 1HP4A 4GJ1A 4EAYA 5B7ZA 4PN2A 1JQXA 2GVJA 4HP5A 4Q6JA 5DMNA 1V5XA 2DJLA 4ZSUA 3N1AA 4D6FA 3O9NA 4R53A 4FNTA 2OX4A 2QPUA 5I0DA 3HIJA 3VKBA 3CNYA 1BLIA 1JCYA 4B3KA 1NH6A 2HXTA 1KFEA 3P2VA 4QGCA 4UTWA 4TIMA 3RRAA 3AMDA 4R33A 1HP5A 3PBGA 4GX8A 4JQ1A 4LC6A 4H01A 3CYVA 4FAMA 2BHUA 2JQXA 4QR6A 2ZQ0A 8XIAA 3FVMA 2R82A 4FALA 2V63A 4IFKA 4XO7A 3BG3A 3NQ6A 3BAWA 4W5ZA 2PWVA 4JGDA 1YYAA 3I65A 1IIHA 4EXQA 3LPOA 2IPFA 3L12A 2C13A 5I7GA 3LMYA 4KGLA 1FFQA 3EYPA 2KX9A 1M7OA 4K38A 1E0TA 5H8PA 3W07A 3PC0A 1QK0A 3GVVA 3HG3A 4HMNA 1QO5A 1E4MM 3ZJ8A 4EWJA 1NFPA 5FI8A 3CUGA 1LLZA 1GUVA 1Z7AA 1W56A 4C6EA 1XG4A 1C9DA 1DXFA 3M07A 4FI4A 4RL3A 3KZSA 4WK9A 3NWRA 3S5YA 3QM3A 2FZ9A 5LZLA 2BMBA 5BMXA 4F0LA 3ES8A 3NCOA 3FFSA 3FSUA 3PZMA 1UIOA 2W62A 3IWPA 3HG5A 1Q6FA 2C71A 4JIQA 3ZVHB 1JZ5A 3NDYA 1B31A 1ZGDA 3SCWA 5TQLA 3LV6A 1L9WA 4FIQA 5G1MA 4PUNA 1S2VA 3QBUA 1WB0A 4S3CA 5EFDA 4UWMA 1R3YA 4CCZA 1P0KA 1KA9F 1BFNA 3H4XA 1L8PA 2AQWA 3EB4A 3EMQA 5A95A 2J8FA 5HR7A 5I02A 3WBYA 4EACA 2XN0A 1EPVA 2CLEA 3VX1A 2QW5A 1EGMA 2WOQA 3EDEA 4M56A 2VDIA 3W86A 3VMOA 3F4VA 4U2ZA 3HURA 5FAGA 5ECUA 2QNEA 3WF0A 1V79A 4WJXA 4B5SA 1ODUA 1GZJA 5KZ6A 1XYBA 3R10A 4MB1A 2B4GA 5A2CA 3EX4A 4HU0A 3TCSA 1FWJC 3TSDA 1AH3A 4AWSA 5D09A 2P8BA 3DFHA 1OFPA 3T09A 4J3XA 4DBDA 3S2CA 1XIJA 5A3HA 4B4FA 3PUGA 5F2MA 2WKGA 1VFTA 4S3DA 4GC3A 3PK7A 3WELA 2Y7EA 4FPSA 4O28A 3VKJA 1BQGA 3C0SA 2VGBA 2Z1VA 3T81A 4IISA 4NZ4A 4OV9A 3W1MA 1PV8A 3NYZA 5EMYA 1B1YA 3VIIA 5EMLA 1V3JA 3IUHA 3B9OA 4GNKB 3ARTA 1HQTA 1OK6A 2GGEA 1SVDA 3USBA 5H6HA 4BI5A 1K4HA 3W01A 4CCDA 5CLWA 2BGQA 3H2OA 4QP0A 1RY8A 2ZVIA 1KXTA 3OHIA 3V35A 2NWSA 4NRRA 2NWRA 2Q3RA 4J1OA 3GDMA 2ZWYA 4M8UA 2RGLA 3W29A 4JTSA 3FYOA 4Q4QA 1IEWA 4NZCA 4G1NA 2ZXDA 3AI0A 2DT1A 2OJPA 3URAA 2G3JA 1W5PA 2XN2A 4RV8A 2XZ7A 1GGOA 4EANA 3HF3A 2X1IA 1E6ZA 3DCPA 4E4FA 3KW3A 1R87A 1ISXA 5HWJA 1AZ2A 1LDCA 4WKFA 2WC3A 1R3VA 3AXHA 1H1NA 1Y0EA 4HOZA 1IT8A 3TTQA 1RSCA 2R24A 1OJXA 2VELA 3GXMA 3CJPA 3NL5A 4LAMA 3BSGA 4AVNA 5K4XA 2GVEA 2BODX 1LBLA 3OB8A 4QAIA 3G1FA 3M47A 4O0QA 3VXGA 3ARVA 4FZIA 3CLWA 4ZCWA 2NX9A 2GJLA 3GKAA 3IJQA 3UW6A 2VOMA 2R1KA 1LL6A 4IOTA 3RGTA 1JUEA 4NJHA 4B3ZA 3ANYA 3B0PA 4RX0A 1R38A 3C5QA 1VFFA 4MWAC 1H4PA 3MJYA 1Q7ZA 1OX4A 1HIZA 3HPSA 1FH8A 3F7JA 3CQJA 2VWSA 3EZ4A 1RQHA 2Z24A 3IJ6A 2VFFA 2WHLA 5JIPA 3KOXA 3B97A 3MP4A 4QDPA 4B5TA 2PDFA 4AY7A 3MUCA 2PLJA 3IVTA 2IXUA 4Y8EA 3CM4A 4CLMA 4KEUA 3M0LA 2BVWA 1NDWA 2GGJA 1I8JA 3W71A 1J0HA 3P3BA 5C71A 1UOKA 1HKKA 2PGRA 4MAVA 1QMLA 1EBHA 3VZZA 1IGWA 2HS6A 3KCOA 1C7SA 3LYEA 3C0QA 3KHDA 3E74A 1JRCA 3G8EA 5DT5A 3MU7A 1KV5A 2FDMA 4W8AA 4YVVA 1PS9A 4C7GA 1B0IA 1SJDA 1TPH1 2W79A 1AQMA 4AD2A 2C0AA 2DVXA 3GFYA 1UOZA 1EQPA 1UZDA 3IS4A 2NVDA 3IRDA 5LA0A 1OYAA 3B0UX 3LXBA 1BWVA 2OSWA 3DFTA 3G1XA 3OG3A 1MSSA 3LRMA 2XM1A 1UW9A 3TOYA 4GQBA 2FZMA 5KMYA 2OT1A 3WLPA 1H63A 1BXCA 4XKYA 4ZTXA 1LLWA 4PMOA 3C4UA 1E51A 2I9UA 3ORWA 5HPCA 3MZNA 4FS9A 2ZA3A 3MSGA 3GVRA 4XD5A 1HJVA 2O9TA 3UZJA 3V3WA 4JFWA 1H09A 3THAA 1WZMA 1V93A 3FJLA 3WDHA 1XLLA 5FOOA 3TTSA 4L6HA 3WDPP 3MI2A 1YHTA 3HO8A 3VNKA 1GVEA 2H8XA 4HK6A 4H3DA 2XJ7A 1LWIA 3R79A 4E8CA 4HN8A 3R94A 3R25A 1L0PA 4HNLA 1A0CA 1VPQA 1NDZA 3W22A 3D5HA 5BNKA 2GSHA 1CGUA 3VIJA 2WKJA 2CLLA 5A6MA 2OSXA 2EQDA 4KWOA 1SO3A 4J3VA 3TEVA 5E1QA 4AU0A 3LERA 4J35A 3GNRA 3Q65A 4LNYA 2Z0IA 1GOQA 4AFYA 3ABZA 4CGTA 3PPGA 3G22A 4L7ZA 3GR8A 3CZJA 3F5LA 3CMGA 4IPJA 1POJA 4OOUA 2ZC1A 1RJPA 1FDYA 1AD1A 3KX6A 3LHZA 1CZ1A 2ATMA 5GNZA 2WO5A 4BK9A 3BWWA 3CWOX 3I3BA 2B0MA 4G7EB 2OXNA 1GHRA 4FXRA 3TLLA 1OQFA 4GI9A 1AW2A 4O4WA 2XSXA 3UZWA 1H62A 1GW9A 5H8UA 1MZRA 1Q8JA 1SJBA 2C91A 1YPFA 2QCMA 2FTYA 3JU2A 1PAMA 1G9HA 3WLIA 1KRBC 1VH7A 3CAWA 2QUTA 3VK5A 2J7HA 2DSWA 2AL1A 3EOEA 1XBXA 3WNNA 4NSBA 4YMZA 1VJZA 4KIRA 2CETA 1JCXA 2QDHA 1LROA 2C15A 5CPLA 4JTIA 4W4QA 4TQTA 1XDJA 4I7VA 2DUAA 4O12A 3T2PA 2Q09A 4QROA 3RO8A 3KM8A 5ECVA 2NQ9A 2C6QA 2CERA 1XRVA 1S2TA 4DELA 4JYDA 4H8UA 1H7OA 1KNWA 4FR1A 4ZR8A 4ZQCA 2OKTA 4YVXA 1JFHA 2E5BA 1QWGA 1H5YA 1SW0A 4JFUA 2WNZA 4ZODA 1CYGA 4QSFA 1LQ0A 4LUTB 4XBKA 3GO2A 1WP6A 3OLEA 2Y1HA 3N9RA 1H0GA 1BYDA 1P48A 2EJAA 3OQEA 4WKAA 1ESWA 3OGSA 1JF5A 1PKLA 3TNOA 2IMRA 1B3YA 3EPNA 3RU8X 4BHYA 4Z2JA 1YEYA 1EL3A 3R7MA 4TTUA 1Q45A 4H9ZA 4N9DA 4AIUA 2WJEA 4H8NA 1P0EA 3KBSA 1I1XA 3ZWTA 2DJXA 3RAOA 4AD5A 3EXSA 3ISIX 1UA7A 5KZMA 2QIIA 4Q8QA 5DY2A 5AZ0A 3VDGA 1JCMP 2Q8LA 1LOLA 4ACZA 2W63A 1B54A 2DFAA 3E1F1 4ROQA 1PJ9A 3H22A 2JBMA 3UVAA 3H7RA 2EO7A 5FJTA 2WWCA 4MG4A 4MY1A 4G5DA 3O0KA 3VKCA 4CEUC 3QZAA 4E4PA 4QM1A 5DN1A 1PDYA 2IQ0A 3NQEA 4CD5A 3IJLA 5D2VA 1LF1A 3FLUA 1PEZA 7ODCA 4QDWA 2CEQA 4N02A 3HPZA 4TVUA 3OA5A 3UZXA 2Z1SA 4GMEA 4CN6A 5CXPA 3BCJA 3GTIA 4FA3A 4M29A 3IV8A 4CD8A 1BVZA 4ZEPA 3TV8A 2O9PA 2XH2A 4NX0A 1A3WA 3MCMA 2DY3A 4P8XA 1TYGA 8A3HA 3SBFA 1GVIA 3S2LA 5HJLA 3IGHX 3R8GA 2KZHA 2OQHA 2HNHA 3UGRA 1ELSA 3KXQA 4FOJA 3GG0A 4IFKB 2GDVA 3E6EA 4MLRA 4ZA0A 4OECA 3M0MA 4FLSA 4CQAA 3MUXA 4W7VA 4RE0A 2G3IA 3M5ZA 1TPDA 2WNNA 2OO0A 4NVTA 3LRLA 3IIPA 2VDGA 2P53A 3GIYA 2F8QA 1FWTA 1LBFA 5G2HA 5IHSA 1BGGA 4RUBA 1T7LA 3CLMA 4IIGA 3O15A 4J3TA 2I17A 4LWWA 1KM5A 2VEMA 3MKKA 4G8TA 4J3WA 2FHBA 2GDQA 3PHAA 3HOJA 3MI6A 2F9RA 2XDFA 4IMAA 2PC4A 2PD5A 3E5BA 2PCQA 4C6IA 3PZVA 4RXGA 2JIEA 1M9HA 3N15A 1OCNA 3VKAA 2IKIA 2ZRWA 3F4CA 1HGYA 3A4WA 1UROA 5LSMA 1GKRA 1YMYA 2DU2A 4LOCA 1HO4A 4C1NA 5TAOA 4LVDA 3DHPA 4O16A 5FIPA 7TAAA 3T6CA 8RUCA 2ZZ7A 3B8DA 4AW7A 4B5NA 3OLGA 3RF9A 1WO2A 2QPSA 3SCSA 3EB3A 5LNRA 2A79A 1Y5VA 1ENUA 4E8GA 1E0WA 2A3BA 2WJZA 3LPFA 2ASHA 5FJRA 4XBJA 2ZZ6A 3Q45A 4HNVA 1L2UA 4OUIA 4WDWA 4S23A 2XPKA 3LY0A 1A5BA 1UB3A 3GTNA 1MXGA 3UWZA 2XWDA 3STPA 3TVAA 4AQLA 4FB7A 3IVUA 2Z1XA 4I6KA 4A3QA 2XVKA 3UNTA 2B81A 3OBAA 1DIDA 3VOFA 2FB2A 4C6NA 3CPUA 3CPRA 3SUSA 1AL8A 4H7ZA 4LC8A 3AYTA 1E5JA 4QE4A 2PZ0A 1G4EA 3TFCA 1XSIA 1OZQA 5ABGA 5HQLA 4UCGA 4XG1A 1IT7A 2BFGA 1QNRA 1ONRA 2WV8A 3BGGA 3U5YA 1UMLA 3KOWA 2OT0A 3NYDA 1VYPX 5A1AA 4JKKA 3W7EA 4IUOA 2PDHA 2WZTA 4AXKA 1Q7QA 4Z1BA 3VGBA 5KSWA 1M1BA 1GKQA 3A12A 1WKDA 1DJYA 3VFLA 2QDDA 3R1ZA 1MFVA 2VD9A 4Z17A 2PDLA 2QCLA 4LANA 1V6UA 1JF6A 3XINA 2J79A 3VE9A 1P0DA 5EMMA 1UD8A 3S9YA 1NP0A 1OFRA 2Y8KA 1CB2A 5JQ9A 1RVGA 3AC0A 4MFEA 3LHWA 3CIWA 3QZEA 1PWLA 5TIMA 3KBMA 1XISA 2PF0A 2R91A 4MFDA 2Y6ZA 2BTMA 3V0UA 4B3LA 5DBTA 3STFA 3VM7A 2QCNA 4LFYA 3BQ6A 1GQIA 1QOPA 3GIPA 2F38A 4TMBA 2VEGA 4I5UA 3G1YA 2RGMA 3P5ZA 3IEBA 1JIBA 4JHMA 4ZZ9A 1UR9A 1VEPA 1I2OA 3W6LA 4LW7A 5U7SA 4UFJA 3MUZ1 4AXNA 4O15A 2NQHA 5HOSA 3WQVA 3A47A 1BYBA 3BLKA 4H04A 4Z42C 4PB3A 3A23A 3G1VA 3ITXA 3VABA 2W91A 3U57A 2FYMA 4MYXA 3WUEA 3FS2A 8XIMA 3JZEA 1LBMA 1X96A 1OX4B 4S3KA 3E02A 1FBAA 4D6DA 2Z6JA 4JQAA 2Z2AA 4Z1CA 3S6DA 4M0XA 4P8UA 5LNVA 4MWAA 3I4EA 2XH0A 3M46A 3IK2A 3UZ5A 4AWUA 4PCFA 2ZE3A 4PGLA 3F5KA 3QYSA 2J7DA 3S2JA 2ZX8A 4TX6A 4DUXA 3QC3A 2YFOA 3KWXA 2WVTA 3ALFA 1H41A 1UZHA 4F3HA 3MYOA 3E12A 4MJMA 4GLEA 3NL2A 1M5WA 3CK5A 1OC7A 3L4YA 1XFCA 3VMPA 4UCFA 1B4EA 1GOXA 2F2KA 3B0YA 4FXJA 1EYWA 1VFMA 4ZB5A 3H26A 4A21A 3QKEA 2WAGA 3T05A 2VX7A 2DSVA 3SUVA 5I23A 1VFUA 1NM9A 5C2CA 3LCLA 5DMLA 1IXOA 2Z1KA 5CKSA 5FEZA 4OBSA 4J40A 2CZ5A 1OD8A 1S2AA 2RUSA 3KS5A 3QKZA 2C19A 5LXEA 3PTQA 2BP1A 3DBNA 4NNCA 1F6KA 4XKYB 4GBDA 3WMSA 4QG6A 1SJAA 4DWSD 4DJFD 2BVDA 3DBPA 3AO0A 3SRKA 3WDIA 1QI4A 1E6PA 3CO8A 4PCPA 3T44A 2HJPA 1OB0A 4ZMGA 3C52A 3TZFA 2PDNA 3EWXA 3B9EA 1BXNA 1EP1A 3NUKA 4LYPA 3W7OA 3TE9A 3LPPA 2V9DA 4WDXA 4Q4PA 1BSLA 7CGTA 4D6JA 4XAYA 1R3TA 3S9ZA 4C6JA 3OVPA 4MB4A 3G0UA 3S5NA 4IMFA 4LVFA 1LOSA 3ONBA 1UKOA 3GYCA 4QSHA 4AHOA 5JMUA 1K8CA 3U6WA 4IP4A 4H8HA 3NURA 3EOLA 1T96A 1I75A 3G6LA 5FSEC 3GAKA 2P88A 1Y5XA 1RLDA 1W3JA 3URNA 3L4WA 4PULA 3CH0A 2VQTA 2PU1A 3W26A 3CQIA 4MWAE 4CCCA 1CXKA 1ZHAA 3FAXA 4JN6A 1HVXA 2D69A 4H00A 5T9BG 1B2YA 4OUEA 2HVNA 4E3TA 1P1XA 3NM1A 2NQJA 4H9VA 4PCTA 5HJYA 1U5JA 2CW6A 5TNVA 1KFJA 1M3UA 1WOBA 1K9FA 2ICSA 4PMYA 3N29A 2ISWA 2DSZA 3MWCA 1PYFA 3KVLA 3RJXA 1YNQA 1XICA 4ZBCA 1QW7A 3B4UA 3ITYA 4F66A 3WDRA 2VENA 1LTDA 1G7UA 2WHKA 3COTA 3LS9A 1T5AA 1QPNA 1BXBA 2XVLA 5JH1A 3LTPA 3BMVA 1UH4A 4Z1AA 1KWGA 1KRAC 1BVWA 4O1EA 2FTWA 1J0JA 1ZB5A 3WJSA 3FA5A 4GXWA 4ES4A 1EZ2A 1XG3A 1IWPA 3C2VA 3LHUA 7TIMA 4Y9PA 2BLEA 3QV8A 3OOQA 1E40A 5D2WA 3ABQA 1BF2A 4LTSA 4MIMA 3H54A 2W4XA 1DV7A 2OMAA 4TTGA 1EIXA 2NX3A 5K7JA 1WDDA 1JJKA 4WHBA 1TCDA 3OBEA 1C91A 2H9AA 3SGUA 3LRKA 1SR0A 2PLKA 3OP2A 4IPLA 4XIAA 4AMAA 1GVQA 2ZUTA 5IRPA 1EC8A 4IF2A 4KH2A 1O66A 3UCCA 1J8VA 3KUMA 4QCFA 4DLMA 3CHCA 1PKMA 1IZKA 5IM51 4JKMA 2HXUA 5G4HC 1QPQA 3M1ZA 4D1IA 2PI6A 1KC7A 2HTMA 3OO2A 1QHPA 5C7VA 3JW7A 2HK0A 2VWTA 4KBXA 3TJXA 4W8LA 3TJLA 3K4WA 4PFMA 3WO8A 1LWJA 1YDVA 1MI3A 4KKXA 5K3VA 1HNYA 4S3EA 4GRSA 4CNPA 3WLSA 1FUYA 4K2SA 2BBFA 4L9ZA 4LGXA 1WDQA 3C0LA 1WCGA 2ZUNA 2VP8A 3CMFA 4KWWA 3CUZA 4QEHA 1B9ZA 3FXGA 3CL8A 4C6DA 3PZNA 2E5CA 2Y63A 1XH2A 1XRFA 4KCVA 2ZXBA 4P5UA 4O8RA 4N4QA 2J77A 3WQWA 3BJSA 3H8AA 5EY5A 3S3GA 5A6LA 1BYCA 4KIEA 3DGRA 3VIOA 1D7KA 5FF2A 2DQWA 1E71M 1NF0A 3MW7A 1FHLA 5AYBA 2WC7A 3RNDA 1ZL1A 4AEEA 3VI2A 3SAZA 4HJWA 1ZSXA 4KW2A 4D6GA 3O3RA 1FHDA 3S0CA 4J4KA 5FJJA 1KRCC 4F0RA 1A47A 1GTHA 3TNBA 4MNMA 1UZ1A 3PUEA 2DZPA 4MAZA 3RG6A 3TJ4A 2J47A 3DZ1A 1HKMA 3MBDA 1PYMA 4NHVA 4WJ8A 1XIEA 1XH0A 3AIWA 1HKVA 3RM8A 3WH8A 4BQ3A 4F0KA 1ZUAX 4JHOA 1NVMA 2P5NA 3NG3A 3OG2A 1E55A 1K8ZA 3GW0A 3QGVA 3WBEA 2C7FA 2VEFA 1MVYA 1TV2A 1Q6RA 2GQ3A 3H53A 3A22A 1XLGA 4LUJA 1AODA 1X1NA 5PTDA 2XFFA 3MC5A 5CSUA 3LCWA 1YTEA 4ATWA 1A80A 4YLWA 3FXYA 5IDIA 3NZPA 2E6DA 1ONWA 1XCXA 2OZ3A 1YTKA 2A7PA 3Q2DA 5C8BB 1W9BM 4UFIA 5AY7A 3VFCA 3KBWA 3VOJA 4MKSA 4LH8A 3UA3A 4DXXA 4HYWA 1EJRC 3DFPA 4UNLA 4NZFA 1KD0A 5EGRA 1L8NA 3W84A 4BEQA 4C1NB 2KAUC 4IXHA 3VDAA 1CGYA 1JDEA 4DB7A 2IUZA 3EWYA 1DWJM 4AZ6A 6TIMA 3CHFA 1H1YA 3NQMA 1X1OA 1R6WA 3FEMA 3R0KA 1XDMA 4DRSA 4M24A 1S5TA 3NSMA 4LALA 4PTNA 4MSSA 2HE5A 4ATLA 5SWUA 2I9EA 4B15A 3UZZA 2NW0A 3V75A 2V38A 3PFRA 3XIMA 2PF8A 4JQ2A 2JF6A 2WQDA 1CT5A 4IPIA 1EJWC 3M41A 4GUFA 1FWRA 3MY9A 1TJPA 2QDGA 4MF4A 1NWSA 2VEKA 1XBVA 2PPGA 4GUJA 1CIUA 2WPGA 1BPLB 4AZHA 3LD5A 3QVQA 1R8LA 3KOZA 3WLMA 1FWCC 2O0TA 1IGSA 1TPFA 1UHVA 2WZEA 4Y7EA 3ZZ1A 2J9XA 3L9CA 3QJAA 3MMUA 2GGGA 3DN5A 3UG4A 1PIFA 2E40A 2CU0A 4JQ3A 1Q2SA 1SFLA 3UPBA 5CBJA 3UXLA 4OBTA 2VC6A 4U2YA 4O53A 5E0KA 2FGBA 3E96A 1MUCA 3VD5A 3LXCA 1RH9A 1IQ8A 4JOMA 5I3HA 4H2CA 4ZO9A 3P7YA 2XVPA 2ZFAA 1NDYA 2B7PA 3ABRA 1EXBA 3MVIA 4V15A 1KXVA 4MY8A 2WW5A 5D02A 1W5QA 1XLCA 2XIOA 3TQ0A 3QHNA 1OF8A 1S38A 5HATA 4QHRA 1S1RA 1JFXA 1R3WA 4Q32A 3ZJ6A 4D6IA 2DV0A 5DMYA 1QNVA 1F8IA 1TV4A 3I3EA 3V18A 2FFCA 1KTNA 2Q02A 4OE7A 4YCPA 5LNSA 2F6KA 1JAEA 4WEVX 2AMGA 4XD4A 1Q5MA 3M0IA 1DIOA 1W2VA 1SJCA 5BXPA 1HF6A 2A0NA 2HRWA 3WL0A 5C9WA 3EEZA 4LUSB 5FF0A 1QOXA 2PC8A 3EKZA 2HWGA 3VIGA 4CU8A 2RDXA 3HGRA 3SR7A 3E9AA 4NJKA 4CEXC 4TMCA 4UZSA 4AWEA 3GK0A 3B8VA 2NX1A 1QT1A 4H41A 3CZEA 5MKGA 3AS3A 5LHEA 2DGAA 1QAPA 4PMVA 2CLIA 3RPMA 9XIMA 1NY1A 3N2XA 2ZZ3A 1XRSA 3MUAA 1VPYA 1W9VA 4AEOA 3VE7A 4OOZA 2DSUA 5G2IA 4R27A 3SDOA 1D2KA 2ZDRA 1S2WA 1DYSA 3P0XA 3PZ9A 3WMCA 5DX7A 1YDOA 1KBLA 1FKXA 4FLRA 3II1A 3O7UA 4XUYA 3UPWA 4MJ4A 4BI6A 3KEHA 1KBKA 3NDOA 1QNPA 2CESA 2G0WA 1CXLA 1Z42A 2CLMA 4BR1A 4H9MA 1ZENA 2OEJA 2QAFA 1UD4A 1OSEA 3LCFA 2A1YA 3B0VC 1XS2A 4MWAB 4PZVA 4L4LA 3W24A 3USZA 5CEWA 1VIZA 5DFAA 1A5LC 4YWSA 1H3GA 3UZYA 3WK1A 1E9YB 2VFIA 2NXGA 2QVHA 1IZJA 4H6KA 5D04C 5I3DA 3TC3A 1Q6CA 3BAIA 3H24A 3GTFA 1TTJA 2VUNA 3BMXA 3L7RA 3NAVA 2R1NA 1Q4WA 4ZE5A 1GOOA 2ZZ5A 4DWDA 2HMCA 4M6VA 3VIPA 2GJXB 2PP0A 3DERA 5C70A 5A69A 4WUIA 3QOMA 1GTEA 2QLYA 3EA3A 1Y7VA 4IQEA 3CEPA 4C1LA 1TMHA 5HNNA 2FJKA 5FF4A 2VTFA 3AS1A 2YZRA 1R9YA 3BLFA 5LIYX 2Z6IA 3EDDA 1K9TA 1RPXA 1XUUA 5AHFA 1S5MA 2CHNA 4JFVA 4NAEA 3S5SA 1EDGA 3OZMA 2ALDA 4AH7A 3LBCA 2DZSA 3KOFA 6XIMA 3FHAA 4EPKA 3NR0A 3MHFA 1CECA 3SUTA 1JGIA 4KWUA 1OINA 4QS6A 4RPPA 3PULA 3DUGA 3PR2A 1BF6A 4GQQA 1AFSA 4DF0A 4TOQA 3ARPA 2WMJA 1IXNA 1XBZA 3IIXA 2XH4A 5L6UA 2YX0A 3DFQA 4PTVA 3AOFA 2HV5A 3N18A 1OGGA 2QYGA 3LI0A 2VX4A 3NZRA 3AISA 4F2TA 8TIMA 2NSOA 3WBWA 2ZOXA 4F9DA 2E5DA 3TWAA 3ZLFA 1QPKA 4BA0A 1H5VA 1SFSA 5D32A 2VEIA 3CUJA 4NUWA 1RQEA 1UWIA 4DBUA 4TV6A 1XPGA 4IFOA 1GG1A 4TX9A 3SJNA 2WNQA 2CLKA 1VENA 3Q37A 4OFCA 4L1GA 1WKYA 3HM7A 1LJYA 5EBAA 4B2DA 3KVJA 5IOBA 2WCSA 1MXDA 1YPXA 5EBUA 3GG1A 4Z2LA 2J6XA 4QG8A 3PZIA 1UQYA 3GFXA 4I7WA 2VCAA 4FK9A 4YS1A 1EHNA 2Y2WA 3OODA 4Y90A 2CBIA 5LXXA 1HL8A 3LDVA 4K37A 1J6PA 1V7AA 3IV3A 2BOGX 2B7OA 2PLCA 4CNNA 3GHSA 2FJUB 2PAJA 1AA1B 2I7GA 1JDAA 3WLNA 4H9XA 1GJWA 1J10A 2P1FA 3B3DA 2VFGA 2OKOA 1DJIA 4INFA 1V4YA 3STCA 1QRQA 2ACSA 3LUTA 3ZOAA 1VEMA 2BNJA 2YB4A 4MUZA 3RCMA 1V02A 4IIBA 2GOKA 2GSJA 5BWFA 3B8UA 3FGCB 1IWAA 4KETA 1OT1A 5EB8A 1Q7MA 2GJRA 1UG6A 5AN7A 5FSDC 1J11A 3EDFA 2QVNA 5AYZA 5LGZA 4K6AA 2X16A 4UTKA 5JUVA 1V6VA 2OVLA 3P82A 3VINA 4HNOA 3PTMA 4WY0F 4XBSA 3CZLA 4PSRA 1QXLA 3G2GA 1NFGA 2E09A 3H6OA 5EL1A 6TAAA 1EA0A 4ONVA 2ISFA 4S2BA 2CITA 4JICA 3W7IA 1W9UA 4F48A 5F4XA 4ICCX 1TA3A 2I5QA 2VM8A 3M6DA 4Q8UA 3GDRA 3H55A 1UJPA 4M5PA 3G77A 4MADA 4YCOA 3NXLA 1PVNA 3LCGA 4E2DA 3G1RA 1GCYA 3GDKA 3DI0A 1YNYA 4XIMA 1ITCA 4ZO8A 4M19A 1B3VA 4DY1A 2YL6A 5FJPA 3AU2A 3AHZA 2ZADA 1E6NA 1R0MA 3LM3A 1TVNA 6ENLA 5I79A 2V3DA 2D0GA 3MCOA 1XLFA 1K8YA 5KZEA 3CYJA 4V1XA 4US5D 1UJQA 4DHGA 4RNFA 3RM4A 2C8NA 2ZX6A 1H7RA 1QW9A 3NGFA 2AOSA 3R43A 1QWKA 2OYLA 2C79A 3ZYZA 1UIPA 3ZJ7A 1LT7A 1W5NA 4Z08A 4MB5A 5D8ZA 1NELA 1CW2A 2CNCA 3FHQA 2WPBA 3CQKA 1K8XA 3WFZA 5CC5A 4JNZA 3QV7A 3PSVA 3BVJA 1UD2A 5DO8A 1SO4A 4JCMA 3SJ3A 3EMCA 3GY1A 5HMSA 3VD3A 4AD1A 3BG9A 5FCZA 3RX4A 4HK7A 5A8GA 3IACA 3PJXA 4DZHA 4GXPA 1ZJAA 1PZ1A 1V02E 3GNPA 4NIRA 3V0SA 1GWJA 3B04A 2BVYA 4H2HA 3LTSA 3UQNA 4R7OA 3N4FA 4X60A 1DE6A 4PODA 3NQCA 1K7EA 3VNMA 3UYIA 3W6MA 1JPMA 3W0KA 1E72M 2PDXA 1TWWA 3C2RA 3W70A 5HWMA 3KVKA 4I3GA 4UB9A 2JKPA 1G67A 4XAGA 2ZZ2A 4JTAA 1PHQA 2NVCA 4GWEA 1PTDA 4A35A 4HHLA 2RFGA 4AAJA 3ID7A 1B5TA 1XYFA 2ZA2A 1X38A 3P14A 4GISA 3VVGA 2Z28A 1DTUA 1OGSA 1DWIM 1LL4A 4JIIX 1UR1A 4FX6M 1EXPA 4DAIA 1UH3A 3DECA 4LUYA 1F61A 3F1QA 1R85A 1K9EA 5DF0A 2YL5A 2R8WA 7ENLA 3TN5A 3QV9A 1HTIA 3FW6A 3SQMA 1E70M 3WMLA 3K13A 4WX2A 3TTOA 4ECLA 1E1EA 2MANA 3JR2A 5I03A 4D6HA 3T2OA 3RXZA 4Z2GA 2QEZA 3NO5A 1RK5A 3GH7A 1IIGA 3NGJA 1SW3A 4PUEA 2FHCA 2JE8A 3FDGA 2OQLA 4RPQA 1SFJA 3AJ7A 1XLMA 4UTTC 2Y8VA 1G69A 1TFVA 1EX1A 1RUSA 2Y5SA 4AX7A 3DFSA 3AXMA 5JVLA 5CZKA 3DKJA 4PEKA 3W2UA 4GA8A 1M01A 4O17A 1GVRA 1VFSA 1SPQA 3LOTA 3VX0A 1CLVA 4HA1A 1V0NA 2BG5A 4MZYA 5EMJA 1UWUA 5D2YA 1TB3A 4HU8A 4LUIA 1JL8A 3K4DA 2CKSA 1RD6A 5ABEA 4HB7A 5K9XA 2IKHA 4Q4MA 3HTWA 2FMOA 1FWWA 1OX5A 2GJPA 5BYWA 2GWNA 4IMGA 2G95A 3R0UA 2NT0A 5FEPA 1A0DA 1O4UA 2TPSA 2WQPA 4PUWA 2X1UA 3BLEA 2RDWA 3PZQA 4JQ4A 2OFJA 3WFLA 2ZIDA 4QFUA 3DH7A 2GVLA 2UY2A 3T8QA 4WOQA 2CC0A 1OY0A 3H2FA 1W1YA 3EOUA 3B05A 4GIRA 7REQA 1L2QA 5HPOA 1XIFA 4C5ZA 3E2VA 2DIKA 1ZAJA 2YB1A 4UTHA 4PRRA 1FCQA 4HPNA 2RJHA 2EPNA 3ARSA 3KLLA 5BRPA 2QULA 3QSTA 4BI7A 4AD4A 1YXDA 3IVSA 3A64A 3IJ9A 3CTTA 4DJDA 3VIFA 2QUMA 3EWBX 1QPRA 2JKEA 2AL2A 4YVPA 1PX3A 5BW6A 1JCNA 2XUCA 4PEEA 2Z29A 4Q3MA 3H21A 2WSKA 2PB1A 2BGSA 1QI2A 3ITTA 3IAQA 3QY8A 3TC6A 2SFPA 4WR3A 4JX5A 3PJTA 3RLGA 2IPGA 5AVNA 1CX9A 1AD4A 3GTHA 1XCFA 3MCNA 4MZ1A 2FDSA 2QUNA 1YLVA 3U2CA 4BF5A 5L9FA 1K03A 3OVRA 2F61A 2WM0A 4GVGA 1VAHA 1XX1A 2XIMA 5MKGB 4QXIA 1TQJA 3NSXA 4AISA 1QCWA 4O13A 4PUDA 1JYXA 1Q6OA 2YFNA 4A2SA 3ARXA 1OCQA 5FF3A 4BZYA 1JYWA 1RR2A 7PTDA 4GVIA 5A94A 2FFIA 2ODOA 3LGGA 4JNMA 1V6TA 2FTPA 1FA2A 3URBA 4YTTA 5JXQA 3CU2A 3LNMA 3KZPA 4DIAA 1E43A 1XBYA 1DPMA 1LQAA 3QC0A 1CNVA 3EOSA 1IZCA 1VEOA 2V3EA 5GNXA 5FEWA 2PWFA 4UR9A 3SM0A 1Z41A 2BS9A 1W1IE 1W37A 2PDJA 1QNOA 1SM9A 2WVVA 1WZAA 3ONCA 3CH9A 2F84A 1KKOA 4BKNA 3ZO9A 3QY7A 1DJHA 4A8RA 1XRTA 4Z1YA 4MDOA 1E9LA 1Q13A 3SN4A 5C2XA 1V77A 3LGDA 4CVUA 3OZPA 1S39A 3UCDA 4DXKA 1LOQA 4L5ZA 4L9XA 3BZJA 3TKFA 5CG0A 5BROA 2BVTA 2A3EA 1XDLA 1BVNP 1K02A 3D6NA 4K68A 2PP3A 2P3ZA 3VA8A 4HMCA 1O1ZA 3AAMA 2UY5A 3BLIA 2I14A 2QT3A 4L4PA 4NAEB 4YXGA 2ZUUA 4AZGA 3VGEA 2DVUA 2X42A 1K4GA 3NQAA 1X7IA 7A3HA 1L6YA 3VZYA 2D24A 4POCA 1F3TA 4RXFA 5E09A 4B90A 3LHTA 4CNSA 1GPWA 4C6BA 2HZGA 2I57A 4I9TA 3SIZA 4ALDA 5FJUA 4NF7A 1D8WA 3NJ3A 4C6OA 3TXVA 3H2NA 1JPHA 3EOOA 4E4UA 3WQ8A 1LP6A 3HQNA 3MANA 1GJPA 2PDGA 5AHEA 1VFHA 3K2GA 4FNQA 5XIMA 3W83A 3W2MA 1Z32X 1TJ0A 4W9TA 4KFNA 2P50A 4RKAA 2WCAA 4S39A 3U0HA 1TVPA 4DO4A 4R3UA 1GPFA 3ZLGA 3TUUA 3WLLA 1GNXA 3HMJG 1PKNA 4IIHA 3CIXA 5BZAA 1P6WA 3PUDA 4G2DA 2AGKA 1X7FA 1B3ZA 2EXOA 3VCNA 2WMIA 1YNPA 3FA3A 3SO7A 1REQA 1ZFJA 3N3MA 1J4EA 1TR1A 1C3FA 4I5XA 5LIWX 4CCEA 4EIVA 4QS5A 3CXOA 3U3HA 3LLFA 1ALDA 2PRLA 3S2NA 2PE4A 3PZUA 1JNEA 4GVHA 1WAWA 5D38A 1IF2A 5CC3A 4QLLA 1JXJA 4IFRA 3AXXA 3LU2A 4JEJA 2GDUA 3VM5A 1S5VA 2E9LA 1RZMA 1UMYA 2CXEA 3ITCA 4CU7A 3KWSA 3B8TA 4JTEA 2ZYFA 3EX6A 1ZAIA 4GABA 1KB3A 1XLDA 4PBFA 4ZQOA 2D20A 4NU7A 1W8SA 1MWOA 3WENA 2XSAA 1WDRA 1MYRA 3LZ5A 4UQEA 3VNLA 1YADA 4JTDA 3LGEA 4XAFA 2OLHA 2D3NA 1OGBA 3TTYA 3CC1A 4DJFC 1W1ZA 1TPWA 1N82A 4PUJA 1UWSA 3L0GA 4ZO6A 1H2JA 1G1YA 1X98A 4KEVA 3W85A 1FWIC 3GSMA 1TA3B 1VD6A 4B91A 1OX6A 3UWUA 3FAWA 1BKHA 4H6RA 2EPKX 1KFWA 3UR5A 1CEOA 2Q8ZA 3UWYA 1C29A 1UR3M 2B7QA 1JG9A 3S4TA 1GONA 3GS6A 4JTJA 5GJMA 4PMUA 3W28A 2GK1A 2OO6A 1FH7A 2BASA 4PL2A 1S2CA 1UKTA 1OCBA 3ZWSA 3E2RA 1GOKA 2C1IA 1J0KA 2RH9A 4HMEA 5FEXA 4BF9A 3R89A 5AOUA 4WXZA 5BRBA 4J28A 1H49A 1DKWA 3L2IA 4AYGA 3W1LA 1LUCB 3S8HA 3MYPA 2YYUA 3OVQA 4GUIA 2DT0A 5G5IA 3F5JA 1UZ4A 1XSKA 3L0NA 2PU0A 1H11A 4S3AA 5AC8A 1W3IA 2X1TA 3ZXWA 3F2BA 4DO6A 1WXYA 5M1TA 3N4EA 3PZTA 5BOEA 1XYMA 4FIRA 3K5XA 2MNRA 1EP2A 4KFPA 4JNYA 2EJ1A 1OYCA 3WEMA 1IXQA 2OWXA 1PHWA 4PRTA 4IWWA 3UXKA 2YCJA 5CJNA 1W3HA 4HU3A 3CHVA 4L61A 1CI1A 3GXFA 1U22A 1VGAA 4LQ1A 1RLCL 3UG3A 5CGMA 3RITA 1TUFA 4LF2A 2IPJA 2YDQA 3WQ4A 2PRMA 1OT2A 5D9OA 1KQZA 2XM2A 2EKCA 5EKYA 3NOYA 2VR5A 5LA2A 1J5TA 3KTSA 5GJNA 1XYAA 1OIMA 3DI1A 2HBXA 3QW4B 3P81A 3T42A 1I2QA 4Q33A 3LENA 2QS8A 1TPUA 2XG9A 3GR7A 1PCWA 1Q65A 2X0SA 3RYSA 1RBLA 4IG2A 3SN0A 4JX4A 3WH9A 3NTYA 4CVWA 3IRSA 3JS3A 2PTZA 4OWGA 4W88A 4YHEA 4EPDC 1DQWA 3FEQA 1TR9A 3LG3A 1CXHA 1XINA 1C8VA 3I68A 3PM6A 2PDWA 3A4AA 3R11A 3EX3A 3H70A 2BZNA 2GGIA 3N4AA 4O14A 4UFKA 3FNDA 4A22A 2QJHA 3NVDA 3L5MA 3WLKX 4JIHA 3SGZA 2AKMA 5F7UA 1NFBA 3CUFA 3EB2A 4LXFA 5BOOA 3UA4A 3C3UA 1ZRQA 2PODA 4HZ8A 3MV01 4RNJA 1U30A 2AMXA 3TQPA 1O7AA 4I8YA 2OOFA 1KTCA 1Q6DA 3ZQ9A 2X0YA 4BFAA 2FPYA 4GYJA 5JIWA 1MEHA 4OKDA 3SFWA 3NEHA 2WSPA 3GKFA 2YBTA 4RDVA 1SZRA 3AROA 4XKMA 3CAKA 2EG8A 3UNDA 3VDCA 4JCLA 3W87A 2BY3A 5ENLA 1AH0A 1N7KA 2ACRA 3T4WA 2PTDA 2YA0A 4C6CA 2NQZA 3UETA 4S3FA 3I4KA 3QLDA 4B4HA 1DJWA 3PWGA 4H4IA 1BHGA 3CUXA 4KT2A 1KM0A 1E4NA 3W7QA 4AVFA 2DSKA 2PCEA 3QTPA 3RU6A 4EF8A 4F0SA 3LX9A 4ZFMA 5I00A 1FY6A 3MVTA 4QLJA 1GZ1A 1N55A 3AALA 1KLZA 1V3HA 1WUFA 1BTMA 3AYSA 1A0EA 1KW1A 4XTDA 3TYZA 1FWNA 2ON3A 5H91A 4F2BA 1U83A 4UTTA 1X8FA 1W17A 3UJEA 2XFWA 1SR9A 2J8GA 1Z3NA 3ZSTA 4D6EA 2W27A 3S46A 1V6WA 4DJDD 4K8GA 3DOPA 4HZ6A 1O1HA 3SRFA 2Y5JA 1E73M 1XGDA 3N19B 2CBUA 4Q8VA 3BXWA 5T91A 4A3UA 1ZTVA 4K7VA 3SCOA 1PPIA 5HANA 3N12A 3GR4A 2A21A 4IIDA 3RFAA 4XAZA 1DXEA 3H2EA 4XSLA 3ARRA 3ALGA 1WX0A 1E1FA 3BAJA 5D9MA 2ZX5A 3GE7A 5G2WA 2VCBA 1JCJA 3WNLA 4LAZA 7REQB 3M9YA 2Z7KA 4DN1A 4JTGA 2D2JA 3WDJA 2VGIA 1QASA 4MNJA 3S5ZA 4M6PA 1TTIA 2J74A 1S3HA 4X3ZA 4CKQA 3P6LA 1U5VA 4HVXA 3O05A 1KXHA 3DC0A 3TAKA 2PP1A 4AZCA 3ANUA 4M6QA 3W7PA 1EOKA 1Q6EA 2AL2B 3AWNA 3P60A 2PRHA 4ZB2A 4IPPA 1KM2A 1OFEA 1PTAA 4JYEA 2ONEA 3T0TA 3OEXA 2VNCA 1NWTA 4S2CA 3VNYA 2J7CA 4AZ7A 3GC4A 3SSZA 5DCBA 3WBXA 1V3MA 2GZXA 3H2AA 5GPRA 4AWTA 3BCDA 3UY8A 5I6SA 1HW6A 3WEZA 2J6VA 3F4WA 3MHUA 1R86A 3DG6A 4MPQA 3GUWA 3UG5A 1UD5A 4HYRA 2WZHA 1B57A 1J79A 3TC7A 2Y7FA 3BGAA 3GDLA 3KP0A 1RPKA 1OZMA 2DZWA 3N73A 4IM4A 4J9JA 4WIWA 1KO0A 5AKQA 1XLBA 2GUUA 2J7BA 3RMJA 4HNNA 3AIEA 1ISZA 3PPCA 1Z6KA 4WCJA 4HMDA 2INFA 4UMCA 3ZM8A 3FYPA 4DQWA 4KRTA 1C8YA 3W1RA 4YIWA 4I9AA 1R9ZA 1E3ZA 4PMXA 1IXPA 4JBRA 1GQJA 4AEFA 1QUMA 5FF7A 4N7QA 4GCAA 2VT0A 3K30A 4B5VA 1ITXA 3CUIA 5A8MA 4RLIA 5CAHA 3NQDA 4XTIA 3AIVA 4FNSA 1P6BA 4GO8A 2WVVB 4F8XA 4RCXA 2EPLX 3UVIA 3QR0A 1N8FA 2VD8A 4HPGA 3T55A 2A6NA 4V2XA 4D2JA 1W1PA 2UV8G 4PTXA 4JTRA 3A9IA 3N13A 1EYEA 3H2CA 3HQPA 5HMEA 4TO8A 1W3NA 1JXKA 2ZUSA 4GH1A 3MP3A 5LYRA 3UR2A 1Z89A 4XZ9A 3IIZA 3ITOA 1V8EA 1XWYA 4L65A 4DNMA 1EC7A 2J4GA 1POKA 3RK8A 3LBOA 3QH2A 4DAFA 3UFYA 3UWQA 1ICPA 3CV2A 4GG9A 2ZRVA 1I2NA 2P76A 3GNOA 2OG9A 1D9EA 1UKPA 4Q7BA 4KFOA 1J12A 3NQFA 1JPIA 4N9CA 2UY3A 3MMDA 1JZ2A 1NOUA 1JYVA 3UXDA 2W6RA 2BHZA 4GINA 1ME7A 4H9YA 3RLVA 4IQDA 4LBRA 1EF2A 3MTWA 5U4NA 1EA9C 2VHLA 2ISDA 2D23A 2RJGA 5FD0A 4RDZA 2VZOA 3CT2A 3WLRA 2Y62A 3VC6A 1FDZA 3U7VA 4FNPA 1E56A 3O6DA 1Q2RA 1ZALA 4YJ5A 2ISSA 3T08A 3R4IA 2VZTA 4XX6A 2WMFA 1VBGA 2TAAA 4ILSA 1NWRA 2CHOA 5LNUA 2EPHA 1VBHA 3LI1A 3C0JA 5B7YA 3VNIA 2R14A 2BX7A 4OJYA 1RD5A 2OEMA 3I7QA 4GKTA 3P62A 3O6CA 3MWAA 2YCEA 3P8JA 1M6JA 1PXGA 2ZC8A 2ZE0A 3WLQA 2XIJA 4CQDA 3DAQA 4PSPA 2IQDA 1UWAA 3IAPA 1UBPC 2WMIB 3NO3A 3SURA 1B3OA 2E0PA 4PTMA 1REQB 1W9DM 1PKYA 1BWKA 3NL6A 4O1BA 4Q6XA 2F2HA 3OYXA 4XZHA 3GU9A 1AZ1A 4OHQA 2JEQA 1GG0A 2DZAA 2FPVA 2FVMA 4FLQA 3QPEA 4ZOEA 1Q66A 2Y0FA 5CSRA 3N6JA 1KCXA 2YCLA 3SZ8A 1NJJA 1NQ6A 1DWGM 3VNZA 3PZGA 3ZS4A 3GC5A 1E0VA 1BQCA 2DPEA 4PH6A 1LCOA 1F5ZA 1M04A 4LYRA 3A4JA 1FDJA 4OGZA 3W7JA 4AZBA 1R3QA 4UMAA 3UWVA 4PCSA 4Z0JA 4Q4SA 3W1PA 2DZTA 1NEYA 3NQGA 4O52A 1NSJA 3BOFA 3TYAA 2P0IA 2W66A 4JN7A 3UY7A 2VC5A 1XLIA 2DIJA 4UTIA 3H7VA 4IGHA 1D7FA 3EWCA 2OR2A 1PUDA 1VCGA 1MW0A 2J25A 1EJXC 4LYQA 3WQEA 4DWSA 1HL9A 4DJFA 1GVYA 3TN6A 1XQLA 1RBAA 4WD0A 3UGVA 5M2FX 3WN6A 3VKKA 3TW7A 2XN1A 2ZUMA 2OELA 3WLJA 3ERPA 1XFBA 4M51A 2GK1B 2ZRZA 3KHJA 4GPNA 5A6AA 3A5FA 4TXEA 4F40A 2BOEX 1JI2A 2X05A 5GQBA 1H50A 3DG3A 1JUBA 2WXDM 4UTUA 1ICSA 2A3HA 4PL1A 2DH2A 3QOKA 3MO4A 4LV4A 3GXTA 3RR1A 1EPXA 3TFXA 1QI5A 1QBAA 3KVMA 4ATDA 3HB9A 3WD1A 1Q85A 3VIKA 4AIEA 3BG5A 1GK8A 5A8OA 4FOUA 3EWDA 1OFOA 5LIKX 2D2OA 4L56A 3MUIA 3WEOA 2HROA 1IEQA 2XU2A 3POCA 1WA3A 1EUAA 4N6EA 3U2ZA 5G4EA 2CCRA 4DUOA 5F1UA 3UG8A 1GOWA 3BURA 4REQA 5J5DA 2C14A 1MRAA 3PWIA 2WSYA 1YKWA 2Y61A 2E7FA 2OLSA 3WQ6A 1XC6A 2POZA 3I6EA 1XGEA 2XVGA 1PX8A 1K7XA 2QV5A 4XZMX 2ZRXA 3I7SA 3IIOA 3L66A 2FZNA 5E93A 3GG7A 4V33A 3M43A 5E6ZA 3QHMA 2PDBA 6CGTA 1RALA 4H7VA 3NL3A 3HV9A 2E8ZA 3UWWA 3FJ6A 4IG2B 3E38A 1FH9A 2WSRA 4BQ2A 4EP8C 3ATZA 4D8ZA 3NPXA 4ZENA 3BLPX 1XYZA 1QO2A 2JKAA 1TWSA 2A7RA 3SY5A 3N9SA 3GHUA 2DVTA 3H12A 1C90A 3MBFA 4AY8A 3L4XA 2NUWA 1F9CA 2HE8A 3OU8A 1MMFA 3P5YA 3VIMA 3L4VA 2PMQA 2WKLA 2VRKA 1V51A 4LVBA 3N25A 4F2UA 2WHJA 3KL5A 3SB0A 1UPMB 1OVDA 4H6EA 2DZUA 4MGGA 1ONXA 3OQ8A 4LV9A 4C90A 1E4IA 4AY1A 4EAMA 3BAXA 4NJJA 2X09A 4LEQA 2PDQA 5XINA 3C61A 4HZMA 1Z8AA 5CBIA 1CGVA 1OABA 5AHMA 3W76A 1OIFA 3EPMA 3A13A 4TX8A 1MEIA 3QMTA 3URQA 2ZX7A 1HZYA 1UD6A 2NUXA 5DEZA 3BL3A 2ZZ4A 1X39A 4Z2KA 1EQCA 1WYIA 1ZPTA 1E3XA 2ZCGA 3VMNA 1FTXA 3PJUA 3AZRA 3KCLA 3W1QA 2RDUA 1T0OA 2X0HA 1WOAA 3TZNA 1S5NA 1L6SA 3A24A 4WJEA 1WV2A 5HUPA 5M3WA 3KP1A 2ZVRA 3WNPA 1JI1A 3W2KA 3BDKA 3MPGA 3V5FA 1W1TA 3O16A 1GZGA 4R85A 1TRDA 3PANA 2GL5A 5DT7A 2C18A 3NVTA 3GXNA 4HA0A 1NP2A 4I8DA 3WLOA 3W53A 1KFBA 5HQMA 2NV1A 2PWUA 1GVSA 1Y8BA 2RKXA 2W92A 5MHBA 2XGBA 3S5OA 5XIAA 4IL0A 3WQPA 4ASTA 2YZ5A 1RXOB 3KAOA 2TYSA 1FKWA 1GHSA 1OWQA 4FHAA 2HPIA 2C1HA 2Z25A 4K8EA 4KCUA 3SW6A 4HSOA 2WJDA 4DZIA 1XKJA 1D8CA 4IMEA 1DQXA 4WRHA 4Q4KA 1VBUA 4R34A 3WH6A 4Q8MA 1VCFA 3MMWA 1P5BA 5DBUA 3T8LA 4IMCA 4NYYA 2OEKA 3WBAA 1EKOA 2O56A 4DX3A 3GVWA 1W5OA 3MZ2A 2HNEA 3APGA 2QZRA 3WY1A 2YL8A 4X0NA 2EGZA 3OGRA 5CH9A 5GVJA 2OWCA 3RIKA 1Z69A 3QN3A 4JAWA 2BOFX 4K39A 4AZCB 1DWHM 1G01A 1A5OC 1AMYA 1FWSA 2VQUA 5A5WA 4XVEA 1W9PA 2OOGA 4M7SA 2UZ9A 2ANUA 2J27A 4I7UA 4CQ8A 1U2YA 4W87A 4TUFA 3I6TA 2G41A 4ENLA 4WLCA 1OCJA 4D72A 4HJFA 1W3LA 4PA8A 4NXSA 1SYTA 1QDSA 1RP9A 2VZSA 3THQA 5DRCA 2CHRA 4C1KA 1DHPA 1VHNA 1ZAHA 2Y5EA 3ZR6A 3RPTA 1IEIA 3DFYA 1TMQA 2X1RA 2V2DA 4J3ZA 1DL3A 4HYVA 2INEA 2BDQA 4V1YA 5HNRA 1XJBA 2C1GA 3DDMA 3DU0A 3QY6A 3QQ1A 3O8AA 4JS3A 4YWIA 3VUSA 1Q6GA 1DWAM 1WUEA 4W89A 5I3JA 2VFDA 3TDFA 3U4FA 2WNWA 4DYEA 3M7WA 4DJED 3OLIA 3CB3A 4RE3A 4O0ZA 1EGVA 4GQ0A 1PIIA 3RN6A 1OC6A 2XHYA 4LUSA 2X30A 4KPLA 4IQJA 3WF1A 4PUUA 3T0CA 1HJSA 1PO9A 4JFTA 1PTGA 5CPSA 2NLIA 3S2MA 4CN1A 3ZJKA 3VGDA 3OPSA 1AK5A 1JDDA 4B5XA 4KRZA 3QF0A 3VD7A 3AFBA 3UJRA 4CQBA 4UFHA 2O4MA 1JAKA 4IHCA 1TWIA 4GNVA 4H9UA 4U5IA 1P7TB 5IDZA 2J24A 3PPFA 3O0FA 1XLHA 5DCEA 4MNKA 2JF7A 1IE7C 1JZ6A 2AQVA 3W1XA 4MKVA 1BAGA 3EWWA 2AAMA 2YLAA 2HK1A 3WF3A 4NNBA 4TV5A 4FF7A 1ITQA 2OQYA 2A4AA 4ZOAA 3W1UA 1YQ2A 2FGLA 4DBWA 4NI3A 4XISA 3ABOA 4JXCA 3WH7A 4CD6A 5G1TA 3MKCA 3JVAA 1KGWA 4Y2WA 2QCGA 3WFAA 1XIMA 1D3HA 2OODA 3W1AA 2EAWA 3W7MA 2H3DA 1DXIA 4FX7A 3CUHA 3MSDA 3LMZA 5E0CA 1AVAA 2YCKX 1J5SA 3HG2A 4AC1X 1PDZA 4Q8OA 1N8IA 3BPWA 2J88A 1KFLA 4QITA 2DW6A 4K1GA 4X2RA 3HJZA 4W7WA 1G5AA 2GJXA 3TYCA 1A5CA 4P7OA 3UBPC 1J2WA 1FHVA 3E0WA 3M64A 4C6MA