5G38A

Psbo subunit of photosystem ii, beta barrel domain at 100k, ph 6
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
172
structure length
172
Chain Sequence
b'CPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKENGEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVNGTKGQISLNVAKVDGRTGEIAGTFESEQLSNGHEVKIQGVFYASIEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM II MANGANESE-STABILIZING POLYPEPTIDE
publication title Crystallographic and Computational Analysis of the Barrel Part of the Psbo Protein of Photosystem II -Carboxylate-Water Clusters as Putative Proton Transfer Relays and Structural Switches
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Photosynthesis
total genus 32
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2016-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5g38A00
5GTHO 4UB8O 4IL6O 5TISO 5H2FO 5G38A 5E79O 3KZIO 5KAIO 3JCUO 5G39A 5B66O 1S5LO 5B5EO 3A0BO 3A0HO 4PJ0O 5KAFO 2AXTO 5GTIO 3WU2O 5G3AA 4UB6O
chains in the Genus database with same CATH superfamily
3AAAA 5TISO 2OMFA 1ZHYA 3PF1A 5G38A 2MNHA 4LSEA 5H2FO 4CTDA 3AA0B 3LK42 3KZIO 4O3XB 2Y0LA 3UPGA 4O3ZA 3AA1A 5KAIO 2F1VA 2JMMA 3POXA 4KRAA 5EE2A 4AKMA 4C00A 4O4UA 2FGRA 3DA3A 4RL9A 4AYDC 3PQUA 5JDPA 4D5UA 3SZDA 3V8UA 1Q9FA 2J1NA 3QRCA 2Y7SA 3HOEA 4LSFA 3O0EA 3AAEB 2K0LA 4PUXA 4RJWA 2XG6A 4GCPA 3AAAB 3VZWX 3WI5A 4C4VB 4C4VA 4K3BA 2XE3A 2R89A 3BS0A 3PGRA 4FRXA 3T24A 1BXWA 1ZHWA 2XMXA 2O4VA 2AXTO 4LSIA 2N2LA 3AA1B 4FZNA 1GFOA 5KAFO 3VE1A 1YS5A 4RJXA 3TZGA 2XE1A 1OPFA 4G76A 4GCQA 4FOZA 3G7GA 4N74A 1PRNA 3A2SX 2LHFA 3BRZA 1GFQA 1MM4A 4N59A 4IL6O 4UB8O 5IYUA 2Y2XA 3C5OA 2FGQX 1GFNA 2XTQA 4O4XA 2K4TA 3VE2A 4U9CA 2KXPB 3POUA 4FRTA 4F4BA 5AFUL 8PRNA 3VZTX 4GHBA 3VY9X 4JFBA 1G90A 3JCUO 4O49A 4GCSA 5G39A 4FT6A 4RLBA 2R88A 2F1TA 4AZLA 4FZMA 4C69X 4FMSA 3LK2A 2R4NA 4N58A 4BUMX 5B5EO 2XE2A 7PRNA 4AYMC 5DL8A 2KXPA 5AFUK 3NJTA 1ZHZA 4AKRA 3T20A 1GFPA 1MPFA 5G26A 3LK3A 1GFMA 5G3AA 1Q9GA 3LK2B 3K19A 4O3YA 4LSHA 2W80C 3RBHA 5FVNA 2N2MA 1PHOA 2LFUA 4K3CA 4FESA 3SYBA 1T1LA 1HXXA 2F1CX 4AUIA 1HXTA 3VY8X 4AYID 2Y0HA 1THQA 3SYSA 3UAQA 3UU2A 2XTRA 2R4PA 3LK3B 1HXUA 5PRNA 1ZHXA 3HW9A 4JCHA 4RLCA 3JTYA 1QJ8A 2IWVA 1OSMA 2XE5A 2WJQA 2YPVA 3AA7B 3PGSA 4FZLA 2KZ7A 2WVPA 3GP6A 2GE4A 1P4TA 3PQSA 5DL7A 2X27X 2KC0A 4XNLA 2ODJA 1MM5A 5DL5A 2M07A 4D65A 2W81C 5GV0A 4D64A 1QJ9A 1ORMA 3WI4A 5ADXL 3SY7A 2X9KA 3AA6A 4AYEC 3QRAA 4KR8A 1ZHTA 4XNKA 3SZVA 3DWOX 5GTHO 3VZUX 2R8AA 2JQYA 1BT9A 4KR4A 5DL6A 6PRNA 5E79O 3DWNA 3PGUA 4AYNA 2IWWA 4FQEA 3HOLA 2PORA 3AA7A 4E1SA 4AKRB 3KVDD 2J4UP 2KZ7B 2MHLA 4E1TA 3EMNX 3POQA 4AFKA 2ZFGA 4GF4A 2ZLDA 3NSGA 5T5FA 5ADXK 1T16A 2PRNA 1IZNA 3AA6B 3PRNA 1S5LO 5B66O 2KDYA 2ERVA 3FYXA 4FSPA 1H6S1 4FSOA 4PR7A 3SY9A 2M06A 3A0BO 3AA0A 3A0HO 3BRYA 4FUVA 4Z3TA 1BH3A 4PJ0O 2R4LA 2QTKA 2WJRA 2YNKA 4N75A 3LK41 5D5DA 3HWBA 3T0SA 4G75A 2Y0KA 3PORA 3DA4A 3DZMA 1QJPA 4O3WA 1E54A 5GTIO 4B61A 3WU2O 4UB6O 3AAEA 2R4OA 1IZNB 4QQ1A
chains in the Genus database with same CATH topology
5GTHO 4UB8O 4IL6O 5TISO 5H2FO 5G38A 5E79O 3KZIO 5KAIO 3JCUO 5G39A 5B66O 1S5LO 5B5EO 3A0BO 3A0HO 4PJ0O 5KAFO 2AXTO 5GTIO 3WU2O 5G3AA 4UB6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTH O;  4UB8 O;  4IL6 O;  5TIS O;  5H2F O;  5G38 A;  5E79 O;  3KZI O;  5KAI O;  3JCU O;  5G39 A;  5B66 O;  1S5L O;  5B5E O;  3A0B O;  3A0H O;  4PJ0 O;  5KAF O;  2AXT O;  5GTI O;  3WU2 O;  5G3A A;  4UB6 O; 
#chains in the Genus database with same CATH topology
 3AAA A;  5TIS O;  2OMF A;  1ZHY A;  3PF1 A;  5G38 A;  2MNH A;  4LSE A;  5H2F O;  4CTD A;  3AA0 B;  3LK4 2;  3KZI O;  4O3X B;  2Y0L A;  3UPG A;  4O3Z A;  3AA1 A;  5KAI O;  2F1V A;  2JMM A;  3POX A;  4KRA A;  5EE2 A;  4AKM A;  4C00 A;  4O4U A;  2FGR A;  3DA3 A;  4RL9 A;  4AYD C;  3PQU A;  5JDP A;  4D5U A;  3SZD A;  3V8U A;  1Q9F A;  2J1N A;  3QRC A;  2Y7S A;  3HOE A;  4LSF A;  3O0E A;  3AAE B;  2K0L A;  4PUX A;  4RJW A;  2XG6 A;  4GCP A;  3AAA B;  3VZW X;  3WI5 A;  4C4V B;  4C4V A;  4K3B A;  2XE3 A;  2R89 A;  3BS0 A;  3PGR A;  4FRX A;  3T24 A;  1BXW A;  1ZHW A;  2XMX A;  2O4V A;  2AXT O;  4LSI A;  2N2L A;  3AA1 B;  4FZN A;  1GFO A;  5KAF O;  3VE1 A;  1YS5 A;  4RJX A;  3TZG A;  2XE1 A;  1OPF A;  4G76 A;  4GCQ A;  4FOZ A;  3G7G A;  4N74 A;  1PRN A;  3A2S X;  2LHF A;  3BRZ A;  1GFQ A;  1MM4 A;  4N59 A;  4IL6 O;  4UB8 O;  5IYU A;  2Y2X A;  3C5O A;  2FGQ X;  1GFN A;  2XTQ A;  4O4X A;  2K4T A;  3VE2 A;  4U9C A;  2KXP B;  3POU A;  4FRT A;  4F4B A;  5AFU L;  8PRN A;  3VZT X;  4GHB A;  3VY9 X;  4JFB A;  1G90 A;  3JCU O;  4O49 A;  4GCS A;  5G39 A;  4FT6 A;  4RLB A;  2R88 A;  2F1T A;  4AZL A;  4FZM A;  4C69 X;  4FMS A;  3LK2 A;  2R4N A;  4N58 A;  4BUM X;  5B5E O;  2XE2 A;  7PRN A;  4AYM C;  5DL8 A;  2KXP A;  5AFU K;  3NJT A;  1ZHZ A;  4AKR A;  3T20 A;  1GFP A;  1MPF A;  5G26 A;  3LK3 A;  1GFM A;  5G3A A;  1Q9G A;  3LK2 B;  3K19 A;  4O3Y A;  4LSH A;  2W80 C;  3RBH A;  5FVN A;  2N2M A;  1PHO A;  2LFU A;  4K3C A;  4FES A;  3SYB A;  1T1L A;  1HXX A;  2F1C X;  4AUI A;  1HXT A;  3VY8 X;  4AYI D;  2Y0H A;  1THQ A;  3SYS A;  3UAQ A;  3UU2 A;  2XTR A;  2R4P A;  3LK3 B;  1HXU A;  5PRN A;  1ZHX A;  3HW9 A;  4JCH A;  4RLC A;  3JTY A;  1QJ8 A;  2IWV A;  1OSM A;  2XE5 A;  2WJQ A;  2YPV A;  3AA7 B;  3PGS A;  4FZL A;  2KZ7 A;  2WVP A;  3GP6 A;  2GE4 A;  1P4T A;  3PQS A;  5DL7 A;  2X27 X;  2KC0 A;  4XNL A;  2ODJ A;  1MM5 A;  5DL5 A;  2M07 A;  4D65 A;  2W81 C;  5GV0 A;  4D64 A;  1QJ9 A;  1ORM A;  3WI4 A;  5ADX L;  3SY7 A;  2X9K A;  3AA6 A;  4AYE C;  3QRA A;  4KR8 A;  1ZHT A;  4XNK A;  3SZV A;  3DWO X;  5GTH O;  3VZU X;  2R8A A;  2JQY A;  1BT9 A;  4KR4 A;  5DL6 A;  6PRN A;  5E79 O;  3DWN A;  3PGU A;  4AYN A;  2IWW A;  4FQE A;  3HOL A;  2POR A;  3AA7 A;  4E1S A;  4AKR B;  3KVD D;  2J4U P;  2KZ7 B;  2MHL A;  4E1T A;  3EMN X;  3POQ A;  4AFK A;  2ZFG A;  4GF4 A;  2ZLD A;  3NSG A;  5T5F A;  5ADX K;  1T16 A;  2PRN A;  1IZN A;  3AA6 B;  3PRN A;  1S5L O;  5B66 O;  2KDY A;  2ERV A;  3FYX A;  4FSP A;  1H6S 1;  4FSO A;  4PR7 A;  3SY9 A;  2M06 A;  3A0B O;  3AA0 A;  3A0H O;  3BRY A;  4FUV A;  4Z3T A;  1BH3 A;  4PJ0 O;  2R4L A;  2QTK A;  2WJR A;  2YNK A;  4N75 A;  3LK4 1;  5D5D A;  3HWB A;  3T0S A;  4G75 A;  2Y0K A;  3POR A;  3DA4 A;  3DZM A;  1QJP A;  4O3W A;  1E54 A;  5GTI O;  4B61 A;  3WU2 O;  4UB6 O;  3AAE A;  2R4O A;  1IZN B;  4QQ1 A; 
#chains in the Genus database with same CATH homology
 5GTH O;  4UB8 O;  4IL6 O;  5TIS O;  5H2F O;  5G38 A;  5E79 O;  3KZI O;  5KAI O;  3JCU O;  5G39 A;  5B66 O;  1S5L O;  5B5E O;  3A0B O;  3A0H O;  4PJ0 O;  5KAF O;  2AXT O;  5GTI O;  3WU2 O;  5G3A A;  4UB6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...