5G38A

Psbo subunit of photosystem ii, beta barrel domain at 100k, ph 6
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
172
structure length
172
Chain Sequence
CPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKENGEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVNGTKGQISLNVAKVDGRTGEIAGTFESEQLSNGHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM II MANGANESE-STABILIZING POLYPEPTIDE
publication title Crystallographic and Computational Analysis of the Barrel Part of the Psbo Protein of Photosystem II -Carboxylate-Water Clusters as Putative Proton Transfer Relays and Structural Switches
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Photosynthesis
total genus 32
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2016-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5g38A00
5GTHO 3KZIO 5KAFO 1S5LO 5B66O 4PJ0O 5G3AA 5GTIO 5KAIO 5G39A 4IL6O 5H2FO 2AXTO 5B5EO 3A0HO 3JCUO 4UB6O 3WU2O 5TISO 5G38A 5E79O 4UB8O 3A0BO
chains in the Genus database with same CATH superfamily
2PORA 4AYDC 4Z3TA 3UAQA 2LFUA 3BRYA 3AAEB 4FZNA 4G75A 2LHFA 3AA7B 3G7GA 4RL9A 5KAFO 4K3BA 1PRNA 2ZFGA 2JQYA 3DWNA 2J4UP 4PR7A 4FSOA 5G3AA 1GFOA 1ZHXA 2F1CX 2R4NA 3AA0B 2W80C 5G39A 1E54A 3EMNX 3TZGA 4D65A 3HW9A 1GFMA 3LK3B 7PRNA 2X9KA 1OPFA 1Q9GA 1ZHWA 1ZHYA 3AAAB 2XE5A 4AYEC 2FGRA 1T16A 4LSEA 4XNLA 2ODJA 4FMSA 4E1SA 1IZNB 3LK2B 4FSPA 4FOZA 2ERVA 4FZMA 4B61A 2KC0A 2XG6A 3WI4A 3C5OA 4FUVA 4N75A 5JDPA 5T5FA 3UPGA 1G90A 2Y0LA 2IWVA 1HXUA 4KR8A 3PORA 4FESA 1OSMA 1P4TA 3VY8X 3NSGA 3HOLA 2PRNA 1MM5A 3VY9X 4C00A 5ADXL 5DL7A 4BUMX 3NJTA 1GFQA 2MHLA 2R88A 4O3XB 3A2SX 3GP6A 4D5UA 2WVPA 3SYSA 3O0EA 5EE2A 3QRCA 4G76A 3WI5A 4PJ0O 1H6S1 3JTYA 2KXPB 3AA1A 2K4TA 2R4OA 4FT6A 4KR4A 4RLBA 5GTIO 5KAIO 2R4PA 5AFUL 3T20A 3POXA 4N58A 4O49A 4LSFA 4E1TA 2KDYA 2KZ7A 3HOEA 2WJRA 2Y2XA 5D5DA 2MNHA 4AKRA 4F4BA 2R8AA 4N74A 3PGUA 1BT9A 3POUA 4C4VA 2K0LA 4UB6O 5PRNA 4FZLA 4RJXA 3WU2O 3AA6A 5FVNA 5ADXK 2N2LA 2YPVA 2Y0HA 5E79O 1QJ9A 4O4XA 2Y7SA 3SY7A 2JMMA 2R89A 3DA3A 4GCSA 1BXWA 5GTHO 1MPFA 2XE1A 3T0SA 1HXTA 4GHBA 1MM4A 3PGSA 2XMXA 4GCQA 1S5LO 3V8UA 5B66O 4JFBA 1Q9FA 2OMFA 3RBHA 5IYUA 3AAEA 2N2MA 3VE1A 3AA7A 2XTQA 4RJWA 4AYMC 2Y0KA 1QJ8A 2XTRA 6PRNA 1GFNA 5GV0A 3POQA 1T1LA 4LSIA 1HXXA 5H2FO 4AYID 2M06A 4RLCA 5DL5A 2WJQA 4N59A 3DZMA 4LSHA 2F1VA 3AA0A 3PRNA 3BRZA 3FYXA 2O4VA 5DL6A 3LK3A 8PRNA 1PHOA 3AAAA 3PGRA 5G38A 2W81C 3VZUX 4K3CA 4AUIA 4UB8O 4QQ1A 2IWWA 1ZHZA 5B5EO 3DA4A 1IZNA 3LK2A 3HWBA 3LK41 2GE4A 5G26A 1THQA 3SZDA 3KVDD 3KZIO 3DWOX 3SZVA 3AA1B 4C69X 1GFPA 4GF4A 3VZTX 4FRXA 4U9CA 2M07A 3SY9A 2XE3A 2F1TA 4O3WA 2FGQX 5DL8A 4AZLA 2KZ7B 5AFUK 3T24A 4AKMA 2QTKA 4AKRB 3LK42 1ORMA 4JCHA 4FRTA 4C4VB 3K19A 4CTDA 4O4UA 4IL6O 4FQEA 3PQUA 3QRAA 3AA6B 1ZHTA 3PQSA 2AXTO 4PUXA 2ZLDA 4KRAA 3BS0A 2KXPA 1QJPA 3A0HO 4D64A 3JCUO 3VE2A 1BH3A 3VZWX 4O3YA 3UU2A 3PF1A 4AYNA 4XNKA 5TISO 2R4LA 1YS5A 2X27X 2XE2A 2YNKA 4GCPA 3SYBA 4O3ZA 4AFKA 2J1NA 3A0BO
chains in the Genus database with same CATH topology
5GTHO 3KZIO 5KAFO 1S5LO 5B66O 4PJ0O 5G3AA 5GTIO 5KAIO 5G39A 4IL6O 5H2FO 2AXTO 5B5EO 3A0HO 3JCUO 4UB6O 3WU2O 5TISO 5G38A 5E79O 4UB8O 3A0BO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTH O;  3KZI O;  5KAF O;  1S5L O;  5B66 O;  4PJ0 O;  5G3A A;  5GTI O;  5KAI O;  5G39 A;  4IL6 O;  5H2F O;  2AXT O;  5B5E O;  3A0H O;  3JCU O;  4UB6 O;  3WU2 O;  5TIS O;  5G38 A;  5E79 O;  4UB8 O;  3A0B O; 
#chains in the Genus database with same CATH topology
 2POR A;  4AYD C;  4Z3T A;  3UAQ A;  2LFU A;  3BRY A;  3AAE B;  4FZN A;  4G75 A;  2LHF A;  3AA7 B;  3G7G A;  4RL9 A;  5KAF O;  4K3B A;  1PRN A;  2ZFG A;  2JQY A;  3DWN A;  2J4U P;  4PR7 A;  4FSO A;  5G3A A;  1GFO A;  1ZHX A;  2F1C X;  2R4N A;  3AA0 B;  2W80 C;  5G39 A;  1E54 A;  3EMN X;  3TZG A;  4D65 A;  3HW9 A;  1GFM A;  3LK3 B;  7PRN A;  2X9K A;  1OPF A;  1Q9G A;  1ZHW A;  1ZHY A;  3AAA B;  2XE5 A;  4AYE C;  2FGR A;  1T16 A;  4LSE A;  4XNL A;  2ODJ A;  4FMS A;  4E1S A;  1IZN B;  3LK2 B;  4FSP A;  4FOZ A;  2ERV A;  4FZM A;  4B61 A;  2KC0 A;  2XG6 A;  3WI4 A;  3C5O A;  4FUV A;  4N75 A;  5JDP A;  5T5F A;  3UPG A;  1G90 A;  2Y0L A;  2IWV A;  1HXU A;  4KR8 A;  3POR A;  4FES A;  1OSM A;  1P4T A;  3VY8 X;  3NSG A;  3HOL A;  2PRN A;  1MM5 A;  3VY9 X;  4C00 A;  5ADX L;  5DL7 A;  4BUM X;  3NJT A;  1GFQ A;  2MHL A;  2R88 A;  4O3X B;  3A2S X;  3GP6 A;  4D5U A;  2WVP A;  3SYS A;  3O0E A;  5EE2 A;  3QRC A;  4G76 A;  3WI5 A;  4PJ0 O;  1H6S 1;  3JTY A;  2KXP B;  3AA1 A;  2K4T A;  2R4O A;  4FT6 A;  4KR4 A;  4RLB A;  5GTI O;  5KAI O;  2R4P A;  5AFU L;  3T20 A;  3POX A;  4N58 A;  4O49 A;  4LSF A;  4E1T A;  2KDY A;  2KZ7 A;  3HOE A;  2WJR A;  2Y2X A;  5D5D A;  2MNH A;  4AKR A;  4F4B A;  2R8A A;  4N74 A;  3PGU A;  1BT9 A;  3POU A;  4C4V A;  2K0L A;  4UB6 O;  5PRN A;  4FZL A;  4RJX A;  3WU2 O;  3AA6 A;  5FVN A;  5ADX K;  2N2L A;  2YPV A;  2Y0H A;  5E79 O;  1QJ9 A;  4O4X A;  2Y7S A;  3SY7 A;  2JMM A;  2R89 A;  3DA3 A;  4GCS A;  1BXW A;  5GTH O;  1MPF A;  2XE1 A;  3T0S A;  1HXT A;  4GHB A;  1MM4 A;  3PGS A;  2XMX A;  4GCQ A;  1S5L O;  3V8U A;  5B66 O;  4JFB A;  1Q9F A;  2OMF A;  3RBH A;  5IYU A;  3AAE A;  2N2M A;  3VE1 A;  3AA7 A;  2XTQ A;  4RJW A;  4AYM C;  2Y0K A;  1QJ8 A;  2XTR A;  6PRN A;  1GFN A;  5GV0 A;  3POQ A;  1T1L A;  4LSI A;  1HXX A;  5H2F O;  4AYI D;  2M06 A;  4RLC A;  5DL5 A;  2WJQ A;  4N59 A;  3DZM A;  4LSH A;  2F1V A;  3AA0 A;  3PRN A;  3BRZ A;  3FYX A;  2O4V A;  5DL6 A;  3LK3 A;  8PRN A;  1PHO A;  3AAA A;  3PGR A;  5G38 A;  2W81 C;  3VZU X;  4K3C A;  4AUI A;  4UB8 O;  4QQ1 A;  2IWW A;  1ZHZ A;  5B5E O;  3DA4 A;  1IZN A;  3LK2 A;  3HWB A;  3LK4 1;  2GE4 A;  5G26 A;  1THQ A;  3SZD A;  3KVD D;  3KZI O;  3DWO X;  3SZV A;  3AA1 B;  4C69 X;  1GFP A;  4GF4 A;  3VZT X;  4FRX A;  4U9C A;  2M07 A;  3SY9 A;  2XE3 A;  2F1T A;  4O3W A;  2FGQ X;  5DL8 A;  4AZL A;  2KZ7 B;  5AFU K;  3T24 A;  4AKM A;  2QTK A;  4AKR B;  3LK4 2;  1ORM A;  4JCH A;  4FRT A;  4C4V B;  3K19 A;  4CTD A;  4O4U A;  4IL6 O;  4FQE A;  3PQU A;  3QRA A;  3AA6 B;  1ZHT A;  3PQS A;  2AXT O;  4PUX A;  2ZLD A;  4KRA A;  3BS0 A;  2KXP A;  1QJP A;  3A0H O;  4D64 A;  3JCU O;  3VE2 A;  1BH3 A;  3VZW X;  4O3Y A;  3UU2 A;  3PF1 A;  4AYN A;  4XNK A;  5TIS O;  2R4L A;  1YS5 A;  2X27 X;  2XE2 A;  2YNK A;  4GCP A;  3SYB A;  4O3Z A;  4AFK A;  2J1N A;  3A0B O; 
#chains in the Genus database with same CATH homology
 5GTH O;  3KZI O;  5KAF O;  1S5L O;  5B66 O;  4PJ0 O;  5G3A A;  5GTI O;  5KAI O;  5G39 A;  4IL6 O;  5H2F O;  2AXT O;  5B5E O;  3A0H O;  3JCU O;  4UB6 O;  3WU2 O;  5TIS O;  5G38 A;  5E79 O;  4UB8 O;  3A0B O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...