5G39A

Psbo subunit of photosystem ii, beta barrel domain at 297k, ph 6
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
172
structure length
172
Chain Sequence
CPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKENGEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVNGTKGQISLNVAKVDGRTGEIAGTFESEQLSNGHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and Computational Analysis of the Barrel Part of the Psbo Protein of Photosystem II -Carboxylate-Water Clusters as Putative Proton Transfer Relays and Structural Switches
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Photosynthesis
molecule keywords PHOTOSYSTEM II MANGANESE-STABILIZING POLYPEPTIDE
total genus 35
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2016-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5g39A00
5G38A 5KAIO 3KZIO 5G39A 3A0BO 2AXTO 5H2FO 5GTHO 4PJ0O 4UB6O 5B66O 5KAFO 5B5EO 5G3AA 3WU2O 3A0HO 3JCUO 5GTIO 5E79O 1S5LO 5TISO 4UB8O 4IL6O
chains in the Genus database with same CATH superfamily
2KZ7B 4KRAA 2R88A 3A2SX 3DWOX 4FQEA 5G38A 5GV0A 2F1CX 2W81C 4LSEA 4G76A 3VY8X 2MHLA 3A0BO 3PQSA 1MM5A 5PRNA 2FGQX 2XE5A 4FZLA 1BXWA 1E54A 1QJ9A 3VZUX 3PGUA 4PUXA 1ZHWA 4BUMX 5JDPA 1IZNA 1BH3A 1MM4A 1ZHZA 1YS5A 2J1NA 2KXPB 2XTRA 2OMFA 4PJ0O 4RL9A 2W80C 7PRNA 4RJXA 5KAFO 1Q9GA 3V8UA 5G3AA 1PRNA 1ZHTA 2XE2A 2XMXA 2Y0KA 3QRAA 3POQA 4O3XB 2MNHA 4RLBA 4AKRA 6PRNA 1THQA 3JCUO 3LK42 2KXPA 3HWBA 1IZNB 2O4VA 2QTKA 3EMNX 3QRCA 5ADXK 3PF1A 4RLCA 2M06A 2PORA 3AAAB 1S5LO 3BS0A 3SY9A 2M07A 5TISO 1GFMA 5G26A 4N75A 3PQUA 2WJQA 5KAIO 4PR7A 4U9CA 2XG6A 2R4OA 4Z3TA 1ZHYA 2K0LA 3HW9A 3PRNA 1T16A 3POXA 4FRTA 1HXTA 2ODJA 4GCSA 4LSIA 5G39A 4AKMA 4AYEC 3JTYA 2XTQA 4KR4A 3AAEA 3VZTX 1Q9FA 2GE4A 1T1LA 2WVPA 1QJPA 4O4UA 3DA4A 3LK41 2XE1A 4UB6O 5ADXL 3GP6A 3BRZA 3LK3B 3K19A 5T5FA 3AA6B 2F1TA 4C4VA 3PGRA 2JQYA 4RJWA 4E1SA 5EE2A 1GFQA 4D5UA 2IWWA 5DL5A 4AYNA 1ORMA 4FZNA 2R89A 2FGRA 4C69X 3DWNA 4FUVA 5DL8A 3PGSA 4GF4A 2J4UP 4QQ1A 4FSPA 2Y0HA 4IL6O 2R8AA 2N2LA 3NJTA 4XNKA 1QJ8A 3HOEA 4LSHA 4D65A 1PHOA 5DL7A 3KZIO 3LK2A 1MPFA 4JFBA 3WI4A 4AFKA 3AA7A 4K3BA 4E1TA 1G90A 2AXTO 3O0EA 1ZHXA 3FYXA 5AFUL 3UPGA 4FRXA 3AA0B 3SYBA 3SZDA 3UU2A 4AYDC 4AYMC 3NSGA 2YPVA 4CTDA 3PORA 5GTHO 3DA3A 4O4XA 2Y2XA 2LFUA 3BRYA 5B66O 4GCQA 1BT9A 2F1VA 4G75A 3WU2O 4FOZA 5AFUK 2KC0A 2N2MA 4FESA 4KR8A 4FSOA 1P4TA 3SZVA 4O49A 2Y7SA 4FT6A 4GCPA 1OSMA 2KDYA 4K3CA 3AAAA 2X27X 1GFNA 2R4LA 3AA0A 3AA1B 3G7GA 4FZMA 3AA6A 3SYSA 4AYID 4B61A 3HOLA 2YNKA 4N59A 3KVDD 3AA7B 3RBHA 4O3YA 4F4BA 3VY9X 2X9KA 3T20A 2ZFGA 4UB8O 3T0SA 3WI5A 2XE3A 3C5OA 3AA1A 2R4NA 3T24A 4AKRB 3DZMA 2JMMA 3TZGA 1GFPA 5FVNA 2Y0LA 1HXUA 2ERVA 1GFOA 1OPFA 5H2FO 4O3ZA 4N58A 4AUIA 3VE2A 4LSFA 4XNLA 4C00A 1HXXA 2R4PA 2WJRA 4GHBA 4AZLA 5B5EO 4C4VB 4JCHA 2KZ7A 3LK3A 3A0HO 8PRNA 3UAQA 3SY7A 5GTIO 4FMSA 2IWVA 3POUA 3LK2B 3VE1A 3AAEB 3VZWX 5DL6A 5E79O 2PRNA 4N74A 5D5DA 5IYUA 4D64A 2LHFA 4O3WA 1H6S1 2ZLDA 2K4TA
chains in the Genus database with same CATH topology
5G38A 5KAIO 3KZIO 5G39A 3A0BO 2AXTO 5H2FO 5GTHO 4PJ0O 4UB6O 5B66O 5KAFO 5B5EO 5G3AA 3WU2O 3A0HO 3JCUO 5GTIO 5E79O 1S5LO 5TISO 4UB8O 4IL6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G38 A;  5KAI O;  3KZI O;  5G39 A;  3A0B O;  2AXT O;  5H2F O;  5GTH O;  4PJ0 O;  4UB6 O;  5B66 O;  5KAF O;  5B5E O;  5G3A A;  3WU2 O;  3A0H O;  3JCU O;  5GTI O;  5E79 O;  1S5L O;  5TIS O;  4UB8 O;  4IL6 O; 
#chains in the Genus database with same CATH topology
 2KZ7 B;  4KRA A;  2R88 A;  3A2S X;  3DWO X;  4FQE A;  5G38 A;  5GV0 A;  2F1C X;  2W81 C;  4LSE A;  4G76 A;  3VY8 X;  2MHL A;  3A0B O;  3PQS A;  1MM5 A;  5PRN A;  2FGQ X;  2XE5 A;  4FZL A;  1BXW A;  1E54 A;  1QJ9 A;  3VZU X;  3PGU A;  4PUX A;  1ZHW A;  4BUM X;  5JDP A;  1IZN A;  1BH3 A;  1MM4 A;  1ZHZ A;  1YS5 A;  2J1N A;  2KXP B;  2XTR A;  2OMF A;  4PJ0 O;  4RL9 A;  2W80 C;  7PRN A;  4RJX A;  5KAF O;  1Q9G A;  3V8U A;  5G3A A;  1PRN A;  1ZHT A;  2XE2 A;  2XMX A;  2Y0K A;  3QRA A;  3POQ A;  4O3X B;  2MNH A;  4RLB A;  4AKR A;  6PRN A;  1THQ A;  3JCU O;  3LK4 2;  2KXP A;  3HWB A;  1IZN B;  2O4V A;  2QTK A;  3EMN X;  3QRC A;  5ADX K;  3PF1 A;  4RLC A;  2M06 A;  2POR A;  3AAA B;  1S5L O;  3BS0 A;  3SY9 A;  2M07 A;  5TIS O;  1GFM A;  5G26 A;  4N75 A;  3PQU A;  2WJQ A;  5KAI O;  4PR7 A;  4U9C A;  2XG6 A;  2R4O A;  4Z3T A;  1ZHY A;  2K0L A;  3HW9 A;  3PRN A;  1T16 A;  3POX A;  4FRT A;  1HXT A;  2ODJ A;  4GCS A;  4LSI A;  5G39 A;  4AKM A;  4AYE C;  3JTY A;  2XTQ A;  4KR4 A;  3AAE A;  3VZT X;  1Q9F A;  2GE4 A;  1T1L A;  2WVP A;  1QJP A;  4O4U A;  3DA4 A;  3LK4 1;  2XE1 A;  4UB6 O;  5ADX L;  3GP6 A;  3BRZ A;  3LK3 B;  3K19 A;  5T5F A;  3AA6 B;  2F1T A;  4C4V A;  3PGR A;  2JQY A;  4RJW A;  4E1S A;  5EE2 A;  1GFQ A;  4D5U A;  2IWW A;  5DL5 A;  4AYN A;  1ORM A;  4FZN A;  2R89 A;  2FGR A;  4C69 X;  3DWN A;  4FUV A;  5DL8 A;  3PGS A;  4GF4 A;  2J4U P;  4QQ1 A;  4FSP A;  2Y0H A;  4IL6 O;  2R8A A;  2N2L A;  3NJT A;  4XNK A;  1QJ8 A;  3HOE A;  4LSH A;  4D65 A;  1PHO A;  5DL7 A;  3KZI O;  3LK2 A;  1MPF A;  4JFB A;  3WI4 A;  4AFK A;  3AA7 A;  4K3B A;  4E1T A;  1G90 A;  2AXT O;  3O0E A;  1ZHX A;  3FYX A;  5AFU L;  3UPG A;  4FRX A;  3AA0 B;  3SYB A;  3SZD A;  3UU2 A;  4AYD C;  4AYM C;  3NSG A;  2YPV A;  4CTD A;  3POR A;  5GTH O;  3DA3 A;  4O4X A;  2Y2X A;  2LFU A;  3BRY A;  5B66 O;  4GCQ A;  1BT9 A;  2F1V A;  4G75 A;  3WU2 O;  4FOZ A;  5AFU K;  2KC0 A;  2N2M A;  4FES A;  4KR8 A;  4FSO A;  1P4T A;  3SZV A;  4O49 A;  2Y7S A;  4FT6 A;  4GCP A;  1OSM A;  2KDY A;  4K3C A;  3AAA A;  2X27 X;  1GFN A;  2R4L A;  3AA0 A;  3AA1 B;  3G7G A;  4FZM A;  3AA6 A;  3SYS A;  4AYI D;  4B61 A;  3HOL A;  2YNK A;  4N59 A;  3KVD D;  3AA7 B;  3RBH A;  4O3Y A;  4F4B A;  3VY9 X;  2X9K A;  3T20 A;  2ZFG A;  4UB8 O;  3T0S A;  3WI5 A;  2XE3 A;  3C5O A;  3AA1 A;  2R4N A;  3T24 A;  4AKR B;  3DZM A;  2JMM A;  3TZG A;  1GFP A;  5FVN A;  2Y0L A;  1HXU A;  2ERV A;  1GFO A;  1OPF A;  5H2F O;  4O3Z A;  4N58 A;  4AUI A;  3VE2 A;  4LSF A;  4XNL A;  4C00 A;  1HXX A;  2R4P A;  2WJR A;  4GHB A;  4AZL A;  5B5E O;  4C4V B;  4JCH A;  2KZ7 A;  3LK3 A;  3A0H O;  8PRN A;  3UAQ A;  3SY7 A;  5GTI O;  4FMS A;  2IWV A;  3POU A;  3LK2 B;  3VE1 A;  3AAE B;  3VZW X;  5DL6 A;  5E79 O;  2PRN A;  4N74 A;  5D5D A;  5IYU A;  4D64 A;  2LHF A;  4O3W A;  1H6S 1;  2ZLD A;  2K4T A; 
#chains in the Genus database with same CATH homology
 5G38 A;  5KAI O;  3KZI O;  5G39 A;  3A0B O;  2AXT O;  5H2F O;  5GTH O;  4PJ0 O;  4UB6 O;  5B66 O;  5KAF O;  5B5E O;  5G3A A;  3WU2 O;  3A0H O;  3JCU O;  5GTI O;  5E79 O;  1S5L O;  5TIS O;  4UB8 O;  4IL6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...