5G3AA

Psbo subunit of photosystem ii, beta barrel domain at 100k, ph 10
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
172
structure length
172
Chain Sequence
CPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKENGEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVNGTKGQISLNVAKVDGRTGEIAGTFESEQLSNGHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and Computational Analysis of the Barrel Part of the Psbo Protein of Photosystem II -Carboxylate-Water Clusters as Putative Proton Transfer Relays and Structural Switches
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Photosynthesis
molecule keywords PHOTOSYSTEM II MANGANESE-STABILIZING POLYPEPTIDE
total genus 34
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2016-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5g3aA00
4PJ0O 1S5LO 5G3AA 4UB6O 5GTHO 2AXTO 5E79O 3KZIO 3A0BO 5H2FO 5GTIO 4UB8O 5TISO 5B66O 5KAFO 3A0HO 4IL6O 5KAIO 5G39A 3WU2O 5B5EO 5G38A 3JCUO
chains in the Genus database with same CATH superfamily
4RLCA 3AA7B 2W80C 2ZFGA 2O4VA 3SYBA 4C69X 3FYXA 2J4UP 2F1CX 3HWBA 4FT6A 1G90A 2MNHA 5AFUL 3EMNX 5DL8A 1H6S1 3SZDA 5GTHO 5T5FA 2AXTO 2J1NA 4AYNA 4GF4A 4FESA 3HW9A 2R89A 4KR4A 2Y0HA 3LK41 1MPFA 1Q9GA 3POXA 1ZHYA 3VZWX 4D65A 2Y0KA 3VY8X 3JTYA 5D5DA 4C4VA 4O3WA 3DWNA 5GV0A 3DWOX 3LK42 4O49A 5FVNA 4LSEA 4BUMX 3T24A 1ZHTA 1ZHXA 1P4TA 3AA6B 2Y0LA 4K3BA 4AYMC 2XTRA 3VE1A 4D64A 4FRXA 3SY7A 5G38A 4RL9A 3NJTA 3PF1A 2KZ7A 1QJPA 3WI5A 2XTQA 4K3CA 4PJ0O 3PGRA 1T16A 1OSMA 1E54A 2ZLDA 3POQA 5PRNA 5ADXK 3UAQA 1HXTA 2M07A 2F1TA 4LSIA 4O3YA 4G75A 3DA3A 4RLBA 4AZLA 3LK2A 1GFNA 3VZTX 3HOLA 2ODJA 3HOEA 4FZLA 4GCPA 4XNKA 4RJXA 3LK3B 5E79O 1OPFA 2R4NA 2YPVA 4XNLA 5G26A 3G7GA 4LSFA 2KXPA 1PHOA 2IWVA 4AFKA 1IZNA 4AKRB 3AAAB 3AA7A 4GCQA 4E1SA 1GFOA 3GP6A 4PR7A 4RJWA 3T20A 2Y2XA 2R8AA 4O4UA 3UU2A 3WI4A 1GFQA 3A0HO 4AYID 1ZHZA 3PGSA 4AYEC 3LK3A 5DL7A 1Q9FA 5G39A 1BH3A 5EE2A 1QJ8A 4KRAA 2WJRA 2N2LA 3TZGA 3C5OA 3PQUA 2LHFA 2R4OA 3AAEA 4KR8A 4N59A 2X27X 3PGUA 4B61A 2YNKA 3DZMA 3K19A 5G3AA 3AA1A 3JCUO 3POUA 3SYSA 4AUIA 3BRYA 1BT9A 2XE3A 4FOZA 3SZVA 4AYDC 3QRCA 3KZIO 4FSOA 4C00A 3A0BO 4N74A 4E1TA 4LSHA 5GTIO 3VY9X 2KXPB 1ZHWA 4UB8O 5JDPA 3DA4A 1MM4A 2PORA 2W81C 4O3XB 2Y7SA 4AKMA 4C4VB 3LK2B 2XE1A 2R4LA 2WVPA 3PORA 5KAFO 5DL5A 3VE2A 1MM5A 1BXWA 1HXXA 3AA6A 4IL6O 4O3ZA 2JQYA 2N2MA 3AAAA 5KAIO 1IZNB 2XG6A 2QTKA 3BRZA 2GE4A 3AA0B 3VZUX 4AKRA 2ERVA 4Z3TA 5B5EO 3KVDD 2R4PA 4FRTA 3T0SA 5ADXL 2WJQA 4GHBA 2OMFA 3AA0A 4GCSA 3A2SX 3AAEB 1QJ9A 1S5LO 1T1LA 3UPGA 5DL6A 4N58A 3PRNA 4UB6O 4U9CA 4JFBA 3AA1B 1GFMA 2KZ7B 2XE5A 4F4BA 3RBHA 5AFUK 4JCHA 2K0LA 4D5UA 5H2FO 3QRAA 2FGQX 2K4TA 2F1VA 4FZMA 7PRNA 3PQSA 2M06A 5TISO 1THQA 4FMSA 4FZNA 4FQEA 3O0EA 4O4XA 2MHLA 1YS5A 2X9KA 5B66O 2FGRA 6PRNA 2R88A 2IWWA 2XMXA 1PRNA 4QQ1A 4CTDA 2JMMA 3V8UA 4FUVA 8PRNA 4PUXA 3NSGA 4N75A 2KC0A 2LFUA 4G76A 3SY9A 1ORMA 3WU2O 5IYUA 1GFPA 2PRNA 2XE2A 2KDYA 4FSPA 1HXUA 3BS0A
chains in the Genus database with same CATH topology
4PJ0O 1S5LO 5G3AA 4UB6O 5GTHO 2AXTO 5E79O 3KZIO 3A0BO 5H2FO 5GTIO 4UB8O 5TISO 5B66O 5KAFO 3A0HO 4IL6O 5KAIO 5G39A 3WU2O 5B5EO 5G38A 3JCUO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJ0 O;  1S5L O;  5G3A A;  4UB6 O;  5GTH O;  2AXT O;  5E79 O;  3KZI O;  3A0B O;  5H2F O;  5GTI O;  4UB8 O;  5TIS O;  5B66 O;  5KAF O;  3A0H O;  4IL6 O;  5KAI O;  5G39 A;  3WU2 O;  5B5E O;  5G38 A;  3JCU O; 
#chains in the Genus database with same CATH topology
 4RLC A;  3AA7 B;  2W80 C;  2ZFG A;  2O4V A;  3SYB A;  4C69 X;  3FYX A;  2J4U P;  2F1C X;  3HWB A;  4FT6 A;  1G90 A;  2MNH A;  5AFU L;  3EMN X;  5DL8 A;  1H6S 1;  3SZD A;  5GTH O;  5T5F A;  2AXT O;  2J1N A;  4AYN A;  4GF4 A;  4FES A;  3HW9 A;  2R89 A;  4KR4 A;  2Y0H A;  3LK4 1;  1MPF A;  1Q9G A;  3POX A;  1ZHY A;  3VZW X;  4D65 A;  2Y0K A;  3VY8 X;  3JTY A;  5D5D A;  4C4V A;  4O3W A;  3DWN A;  5GV0 A;  3DWO X;  3LK4 2;  4O49 A;  5FVN A;  4LSE A;  4BUM X;  3T24 A;  1ZHT A;  1ZHX A;  1P4T A;  3AA6 B;  2Y0L A;  4K3B A;  4AYM C;  2XTR A;  3VE1 A;  4D64 A;  4FRX A;  3SY7 A;  5G38 A;  4RL9 A;  3NJT A;  3PF1 A;  2KZ7 A;  1QJP A;  3WI5 A;  2XTQ A;  4K3C A;  4PJ0 O;  3PGR A;  1T16 A;  1OSM A;  1E54 A;  2ZLD A;  3POQ A;  5PRN A;  5ADX K;  3UAQ A;  1HXT A;  2M07 A;  2F1T A;  4LSI A;  4O3Y A;  4G75 A;  3DA3 A;  4RLB A;  4AZL A;  3LK2 A;  1GFN A;  3VZT X;  3HOL A;  2ODJ A;  3HOE A;  4FZL A;  4GCP A;  4XNK A;  4RJX A;  3LK3 B;  5E79 O;  1OPF A;  2R4N A;  2YPV A;  4XNL A;  5G26 A;  3G7G A;  4LSF A;  2KXP A;  1PHO A;  2IWV A;  4AFK A;  1IZN A;  4AKR B;  3AAA B;  3AA7 A;  4GCQ A;  4E1S A;  1GFO A;  3GP6 A;  4PR7 A;  4RJW A;  3T20 A;  2Y2X A;  2R8A A;  4O4U A;  3UU2 A;  3WI4 A;  1GFQ A;  3A0H O;  4AYI D;  1ZHZ A;  3PGS A;  4AYE C;  3LK3 A;  5DL7 A;  1Q9F A;  5G39 A;  1BH3 A;  5EE2 A;  1QJ8 A;  4KRA A;  2WJR A;  2N2L A;  3TZG A;  3C5O A;  3PQU A;  2LHF A;  2R4O A;  3AAE A;  4KR8 A;  4N59 A;  2X27 X;  3PGU A;  4B61 A;  2YNK A;  3DZM A;  3K19 A;  5G3A A;  3AA1 A;  3JCU O;  3POU A;  3SYS A;  4AUI A;  3BRY A;  1BT9 A;  2XE3 A;  4FOZ A;  3SZV A;  4AYD C;  3QRC A;  3KZI O;  4FSO A;  4C00 A;  3A0B O;  4N74 A;  4E1T A;  4LSH A;  5GTI O;  3VY9 X;  2KXP B;  1ZHW A;  4UB8 O;  5JDP A;  3DA4 A;  1MM4 A;  2POR A;  2W81 C;  4O3X B;  2Y7S A;  4AKM A;  4C4V B;  3LK2 B;  2XE1 A;  2R4L A;  2WVP A;  3POR A;  5KAF O;  5DL5 A;  3VE2 A;  1MM5 A;  1BXW A;  1HXX A;  3AA6 A;  4IL6 O;  4O3Z A;  2JQY A;  2N2M A;  3AAA A;  5KAI O;  1IZN B;  2XG6 A;  2QTK A;  3BRZ A;  2GE4 A;  3AA0 B;  3VZU X;  4AKR A;  2ERV A;  4Z3T A;  5B5E O;  3KVD D;  2R4P A;  4FRT A;  3T0S A;  5ADX L;  2WJQ A;  4GHB A;  2OMF A;  3AA0 A;  4GCS A;  3A2S X;  3AAE B;  1QJ9 A;  1S5L O;  1T1L A;  3UPG A;  5DL6 A;  4N58 A;  3PRN A;  4UB6 O;  4U9C A;  4JFB A;  3AA1 B;  1GFM A;  2KZ7 B;  2XE5 A;  4F4B A;  3RBH A;  5AFU K;  4JCH A;  2K0L A;  4D5U A;  5H2F O;  3QRA A;  2FGQ X;  2K4T A;  2F1V A;  4FZM A;  7PRN A;  3PQS A;  2M06 A;  5TIS O;  1THQ A;  4FMS A;  4FZN A;  4FQE A;  3O0E A;  4O4X A;  2MHL A;  1YS5 A;  2X9K A;  5B66 O;  2FGR A;  6PRN A;  2R88 A;  2IWW A;  2XMX A;  1PRN A;  4QQ1 A;  4CTD A;  2JMM A;  3V8U A;  4FUV A;  8PRN A;  4PUX A;  3NSG A;  4N75 A;  2KC0 A;  2LFU A;  4G76 A;  3SY9 A;  1ORM A;  3WU2 O;  5IYU A;  1GFP A;  2PRN A;  2XE2 A;  2KDY A;  4FSP A;  1HXU A;  3BS0 A; 
#chains in the Genus database with same CATH homology
 4PJ0 O;  1S5L O;  5G3A A;  4UB6 O;  5GTH O;  2AXT O;  5E79 O;  3KZI O;  3A0B O;  5H2F O;  5GTI O;  4UB8 O;  5TIS O;  5B66 O;  5KAF O;  3A0H O;  4IL6 O;  5KAI O;  5G39 A;  3WU2 O;  5B5E O;  5G38 A;  3JCU O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...