5G3AA

Psbo subunit of photosystem ii, beta barrel domain at 100k, ph 10
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
172
structure length
172
Chain Sequence
b'CPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKENGEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVNGTKGQISLNVAKVDGRTGEIAGTFESEQLSNGHEVKIQGVFYASIEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM II MANGANESE-STABILIZING POLYPEPTIDE
publication title Crystallographic and Computational Analysis of the Barrel Part of the Psbo Protein of Photosystem II -Carboxylate-Water Clusters as Putative Proton Transfer Relays and Structural Switches
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Photosynthesis
total genus 34
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2016-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5g3aA00
3KZIO 5GTIO 5B5EO 5G3AA 5GTHO 5H2FO 1S5LO 3WU2O 4UB8O 5G38A 5KAFO 4UB6O 5TISO 3JCUO 3A0HO 5G39A 2AXTO 5B66O 4IL6O 4PJ0O 3A0BO 5KAIO 5E79O
chains in the Genus database with same CATH superfamily
4FSOA 2M06A 2F1TA 1T1LA 1HXXA 4FZLA 4XNKA 3SZVA 3UAQA 2Y0HA 3VY8X 3VZUX 4GCQA 4BUMX 3UPGA 1THQA 3PQSA 4AYDC 3NJTA 2KZ7B 4O3WA 3SY9A 5AFUL 2R89A 5GV0A 5JDPA 1OPFA 1MM4A 3AA1A 3BS0A 1T16A 4FOZA 3SY7A 4D64A 2K4TA 1OSMA 1MM5A 4K3BA 2J1NA 3GP6A 4AYEC 3T0SA 2Y2XA 2XE3A 2YNKA 2ZFGA 3DA4A 4RLCA 2LFUA 4O3ZA 4AYID 4N59A 3RBHA 8PRNA 3LK3B 3JCUO 4RL9A 3PGUA 4E1TA 4GHBA 2X27X 2KZ7A 2LHFA 3QRAA 2KC0A 4JFBA 4O3YA 3T24A 4IL6O 4PJ0O 4AKRB 4C00A 4C4VA 3A0BO 4GCPA 3TZGA 2R88A 3KVDD 3AA6A 4FUVA 3HOEA 1MPFA 3POXA 1BXWA 3PORA 2R4PA 5GTIO 5B5EO 5T5FA 4JCHA 4D65A 4PUXA 2W80C 6PRNA 3HOLA 4RJXA 2R8AA 5G3AA 4KR4A 5GTHO 1QJ8A 2Y0LA 5DL8A 2KXPB 2XTRA 4RLBA 2PORA 3EMNX 4XNLA 2IWVA 4CTDA 5EE2A 4E1SA 1HXUA 1PRNA 2W81C 3LK2A 5G38A 3AAEB 3C5OA 3PGSA 4KRAA 3HWBA 1BH3A 4UB6O 3AA7B 3JTYA 2XE2A 5G26A 1E54A 2R4NA 2R4OA 3A0HO 4FZNA 3G7GA 5PRNA 5G39A 3SYBA 1ZHWA 2AXTO 5DL7A 1GFQA 3VE2A 4G76A 4AUIA 5KAIO 2F1CX 1GFPA 4FT6A 1ZHZA 5ADXK 2WJQA 4N74A 2J4UP 3AAEA 4FQEA 3VY9X 1YS5A 3AA0B 4LSHA 2K0LA 4FMSA 3QRCA 4C69X 4U9CA 1BT9A 5ADXL 3AAAB 3LK3A 5FVNA 5IYUA 2XTQA 5H2FO 3PF1A 4LSIA 2XE5A 2FGQX 2YPVA 3LK42 4G75A 3SZDA 3PQUA 4AKRA 4FRTA 2MNHA 4AKMA 4F4BA 4AFKA 1Q9GA 2JQYA 3BRZA 4Z3TA 3T20A 1GFNA 1ZHYA 3PRNA 3SYSA 4LSEA 4AYNA 3AA0A 1GFMA 1GFOA 2ODJA 5TISO 2IWWA 3A2SX 2KDYA 3UU2A 1IZNB 1QJ9A 3NSGA 2X9KA 1QJPA 2GE4A 5DL6A 2N2LA 2XG6A 3DWNA 5B66O 1ZHXA 1ORMA 7PRNA 2QTKA 3WI4A 1ZHTA 2KXPA 3O0EA 4O49A 5DL5A 4AYMC 4D5UA 5E79O 2M07A 2N2MA 4K3CA 4PR7A 1H6S1 2F1VA 2MHLA 2O4VA 3KZIO 4N58A 2FGRA 2Y7SA 3VZTX 2OMFA 4GCSA 4KR8A 2PRNA 4N75A 3WI5A 3K19A 3DZMA 4O4UA 2ERVA 4LSFA 3AA7A 4C4VB 3FYXA 1IZNA 2WJRA 1PHOA 3PGRA 3POUA 1S5LO 4FSPA 3WU2O 3VZWX 2ZLDA 3DA3A 4FESA 2XE1A 3AA6B 4FRXA 4UB8O 4RJWA 4B61A 5KAFO 3V8UA 4GF4A 4O4XA 1Q9FA 3VE1A 5D5DA 3DWOX 2WVPA 1P4TA 3HW9A 1HXTA 4AZLA 3POQA 2XMXA 2Y0KA 1G90A 3AA1B 3AAAA 2JMMA 2R4LA 4FZMA 4QQ1A 3LK2B 3LK41 4O3XB 3BRYA 5AFUK
chains in the Genus database with same CATH topology
3KZIO 5GTIO 5B5EO 5G3AA 5GTHO 5H2FO 1S5LO 3WU2O 4UB8O 5G38A 5KAFO 4UB6O 5TISO 3JCUO 3A0HO 5G39A 2AXTO 5B66O 4IL6O 4PJ0O 3A0BO 5KAIO 5E79O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZI O;  5GTI O;  5B5E O;  5G3A A;  5GTH O;  5H2F O;  1S5L O;  3WU2 O;  4UB8 O;  5G38 A;  5KAF O;  4UB6 O;  5TIS O;  3JCU O;  3A0H O;  5G39 A;  2AXT O;  5B66 O;  4IL6 O;  4PJ0 O;  3A0B O;  5KAI O;  5E79 O; 
#chains in the Genus database with same CATH topology
 4FSO A;  2M06 A;  2F1T A;  1T1L A;  1HXX A;  4FZL A;  4XNK A;  3SZV A;  3UAQ A;  2Y0H A;  3VY8 X;  3VZU X;  4GCQ A;  4BUM X;  3UPG A;  1THQ A;  3PQS A;  4AYD C;  3NJT A;  2KZ7 B;  4O3W A;  3SY9 A;  5AFU L;  2R89 A;  5GV0 A;  5JDP A;  1OPF A;  1MM4 A;  3AA1 A;  3BS0 A;  1T16 A;  4FOZ A;  3SY7 A;  4D64 A;  2K4T A;  1OSM A;  1MM5 A;  4K3B A;  2J1N A;  3GP6 A;  4AYE C;  3T0S A;  2Y2X A;  2XE3 A;  2YNK A;  2ZFG A;  3DA4 A;  4RLC A;  2LFU A;  4O3Z A;  4AYI D;  4N59 A;  3RBH A;  8PRN A;  3LK3 B;  3JCU O;  4RL9 A;  3PGU A;  4E1T A;  4GHB A;  2X27 X;  2KZ7 A;  2LHF A;  3QRA A;  2KC0 A;  4JFB A;  4O3Y A;  3T24 A;  4IL6 O;  4PJ0 O;  4AKR B;  4C00 A;  4C4V A;  3A0B O;  4GCP A;  3TZG A;  2R88 A;  3KVD D;  3AA6 A;  4FUV A;  3HOE A;  1MPF A;  3POX A;  1BXW A;  3POR A;  2R4P A;  5GTI O;  5B5E O;  5T5F A;  4JCH A;  4D65 A;  4PUX A;  2W80 C;  6PRN A;  3HOL A;  4RJX A;  2R8A A;  5G3A A;  4KR4 A;  5GTH O;  1QJ8 A;  2Y0L A;  5DL8 A;  2KXP B;  2XTR A;  4RLB A;  2POR A;  3EMN X;  4XNL A;  2IWV A;  4CTD A;  5EE2 A;  4E1S A;  1HXU A;  1PRN A;  2W81 C;  3LK2 A;  5G38 A;  3AAE B;  3C5O A;  3PGS A;  4KRA A;  3HWB A;  1BH3 A;  4UB6 O;  3AA7 B;  3JTY A;  2XE2 A;  5G26 A;  1E54 A;  2R4N A;  2R4O A;  3A0H O;  4FZN A;  3G7G A;  5PRN A;  5G39 A;  3SYB A;  1ZHW A;  2AXT O;  5DL7 A;  1GFQ A;  3VE2 A;  4G76 A;  4AUI A;  5KAI O;  2F1C X;  1GFP A;  4FT6 A;  1ZHZ A;  5ADX K;  2WJQ A;  4N74 A;  2J4U P;  3AAE A;  4FQE A;  3VY9 X;  1YS5 A;  3AA0 B;  4LSH A;  2K0L A;  4FMS A;  3QRC A;  4C69 X;  4U9C A;  1BT9 A;  5ADX L;  3AAA B;  3LK3 A;  5FVN A;  5IYU A;  2XTQ A;  5H2F O;  3PF1 A;  4LSI A;  2XE5 A;  2FGQ X;  2YPV A;  3LK4 2;  4G75 A;  3SZD A;  3PQU A;  4AKR A;  4FRT A;  2MNH A;  4AKM A;  4F4B A;  4AFK A;  1Q9G A;  2JQY A;  3BRZ A;  4Z3T A;  3T20 A;  1GFN A;  1ZHY A;  3PRN A;  3SYS A;  4LSE A;  4AYN A;  3AA0 A;  1GFM A;  1GFO A;  2ODJ A;  5TIS O;  2IWW A;  3A2S X;  2KDY A;  3UU2 A;  1IZN B;  1QJ9 A;  3NSG A;  2X9K A;  1QJP A;  2GE4 A;  5DL6 A;  2N2L A;  2XG6 A;  3DWN A;  5B66 O;  1ZHX A;  1ORM A;  7PRN A;  2QTK A;  3WI4 A;  1ZHT A;  2KXP A;  3O0E A;  4O49 A;  5DL5 A;  4AYM C;  4D5U A;  5E79 O;  2M07 A;  2N2M A;  4K3C A;  4PR7 A;  1H6S 1;  2F1V A;  2MHL A;  2O4V A;  3KZI O;  4N58 A;  2FGR A;  2Y7S A;  3VZT X;  2OMF A;  4GCS A;  4KR8 A;  2PRN A;  4N75 A;  3WI5 A;  3K19 A;  3DZM A;  4O4U A;  2ERV A;  4LSF A;  3AA7 A;  4C4V B;  3FYX A;  1IZN A;  2WJR A;  1PHO A;  3PGR A;  3POU A;  1S5L O;  4FSP A;  3WU2 O;  3VZW X;  2ZLD A;  3DA3 A;  4FES A;  2XE1 A;  3AA6 B;  4FRX A;  4UB8 O;  4RJW A;  4B61 A;  5KAF O;  3V8U A;  4GF4 A;  4O4X A;  1Q9F A;  3VE1 A;  5D5D A;  3DWO X;  2WVP A;  1P4T A;  3HW9 A;  1HXT A;  4AZL A;  3POQ A;  2XMX A;  2Y0K A;  1G90 A;  3AA1 B;  3AAA A;  2JMM A;  2R4L A;  4FZM A;  4QQ1 A;  3LK2 B;  3LK4 1;  4O3X B;  3BRY A;  5AFU K; 
#chains in the Genus database with same CATH homology
 3KZI O;  5GTI O;  5B5E O;  5G3A A;  5GTH O;  5H2F O;  1S5L O;  3WU2 O;  4UB8 O;  5G38 A;  5KAF O;  4UB6 O;  5TIS O;  3JCU O;  3A0H O;  5G39 A;  2AXT O;  5B66 O;  4IL6 O;  4PJ0 O;  3A0B O;  5KAI O;  5E79 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...