5G3LF

Escherichia coli heat labile enterotoxin type iib b-pentamer complexed with sialylated sugar
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
98
structure length
98
Chain Sequence
GASQFFKDNCNRTTASLVEGVELTKYISDINNNTDGMYVVSSTGGVWRISRAKDYPDNVMTAEMRKIAMAAVLSGMRVNMCASPASSPNVIWAIELEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN IIB, B CHAIN
publication title Biochemical and Structural Characterization of the Novel Sialic Acid-Binding Site of Escherichia Coli Heat-Labile Enterotoxin Lt-Iib.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 23
structure length 98
sequence length 98
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.50 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5g3lF00
5G3LF 1TIID 4FNFA 1QCBD 5G3LD 4FP5D 1QB5D 4FO2A
chains in the Genus database with same CATH superfamily
3F1ZA 4K5WA 5C44B 2OXPA 4M1UB 3URYA 1PV4A 4JV5L 3MWYW 3WOFA 4DR6Q 2WB1E 4JI4L 4LF4L 3CRKC 3AFQA 5IWAL 1HXYD 2R3ZA 3UI2A 1YJNA 3EBEA 3G4SA 1SEBD 3K7UC 3QWNA 1KIXA 1CM9A 4UY8C 1U4PA 4JV5Q 3FEWX 3ER0A 3PUXA 1K28A 3KF6B 3M7GA 4KY6A 5IGDA 4A3MG 3BVZA 5C0XG 4HTHA 2I5HA 4JI4Q 5IWAQ 4LF4Q 1AFPA 2BE5C 3W5OA 2JJQA 2K5DA 1E1OA 3D6CA 1XYIA 2F0SA 1KNAA 2DNEA 2F1MA 3I7FA 2P5ZX 5D14A 4POFA 1AE2A 4A93H 2R7ZG 4Y7NB 3E0JA 1EIGA 3DLLA 4IURA 4X6AH 1Q1EA 1EOVA 4OWWB 3IKJA 4DK6C 4A3JG 3FPPA 3S17B 1HHVA 5BR8L 3J7ZC 3NUCA 3J80L 3GTGH 3D4RA 3JAML 2I07B 3K81C 2X6GA 4UPAA 4DK0A 1PA6A 2Q8TA 1Z7TA 3NE5B 4PMBA 3KFUA 4EX5A 1K3BC 4UDUC 4B3SL 3HKZB 2EYLA 3MFGA 1UEAB 1D7QA 1EIYB 2K5HA 1TWCH 4S3SA 1TWAH 5EPKA 5I2YA 1B8AA 5IGFA 2UXDL 1H9JA 3GTJB 1S5BD 4DV4L 1LT5D 4OO1H 1JT8A 2G9HD 1W6KA 1SE2A 1VF5C 1IKMA 4B3SQ 1ILPA 3RR5A 1YZ6A 1GD7A 2Z1CA 2CKZB 3GTOH 2UXDQ 5IT9E 4CKCA 2KBNA 3J81E 3EVQA 4DV4Q 2BE5D 1V8QA 1STHA 5FOBB 4FYDA 2NVQH 1MSGA 1VQFA 3BDOA 5M9OA 5JPMC 3TRZA 4A3EB 3OHXC 1PRTD 2E75C 2NVTB 1EOTA 4HJ8A 5I4DA 3CD6A 2EY6A 1B50A 1GXDC 1O7ZA 2XWJB 4A3DG 2PI2A 3CCJA 2HD3A 4IOCA 1CKMA 2MO1A 1N9WA 1E7ZA 2L11A 1EEID 1STGA 1PYSB 3EJIA 1WJJA 2JK8A 3Q23A 4I7AA 4DNTB 4JI5L 1SYGA 3Q6SA 3T51B 1XMQL 5C44G 1BO0A 3SEBA 2NUCA 2WP8J 1ZXTA 4C2MH 2CHBD 2IT1A 4ZYSA 1EZ6A 1PXUA 1QZHA 5A35A 2OQKA 2D0PA 1CQVA 2K5NA 5IP7G 1XMQQ 1GM5A 3DM1A 3I4MB 4C3IH 1WTXA 1E1TA 1O7YA 5IE8A 1KHIA 5ELDA 4KTAA 2F0IA 1EYCA 5FO9B 3T1HL 1I50B 3S15B 4TRDA 4IFDG 3S16H 1OTCA 2KUMA 3CCVA 1SYCA 1D8LA 2K7VA 4DR2L 1PFMA 1EQVA 5D3DA 2DGYA 3PUVA 4DN4M 2H1EA 4L5QA 1BDOA 3NELA 3T1HQ 3HOUB 5JEAH 5I6WA 1YVCA 1PHJA 2N49A 3GTMB 4DR2Q 1YNNC 3H3VH 2FFKB 1DOKA 1JMCA 1UEBA 3ICEA 3I72A 1A63A 1VQPA 3UE0A 1BBXC 1HQMC 1BXTA 4FP5D 1WTQA 1KAAA 1SFOB 4KHPL 4ZAIA 2D0OA 3BDCA 3SE0A 2K32A 4X65L 4ZUIA 1EY5A 1GKHA 1AZPA 1LT6D 3HG9A 1DYQA 4Q5VA 5EKLA 4C56C 2JEAI 3HKZG 5C6AA 3K7AB 2JP1A 1UE7A 2UUAL 2RVLA 2B2YA 4KHPQ 3H3VC 4G57A 4X65Q 3C2PA 2L9HA 4KY7A 2F3WA 1Y14B 1NTGA 2Z9HA 4YCVA 4AH6A 2E8GA 3GTPB 1B1ZA 2UUAQ 1G91A 4U68A 4HCSA 2WAQE 5F2DA 2L15A 2K04A 2K4KA 5M3FB 4P71A 2ZTDA 1WTOA 2DJGC 4RWSC 1NAPA 2M2LA 1IYVA 4YWKA 1UAPA 1HUMA 2IY5B 2B39A 5K5PA 4A3EG 2GN5A 5EKIA 1CHQD 1A15A 5CV7A 1GOZA 3NTKA 1QJOA 2QA4A 1PZID 5COYA 1KABA 2Y0SE 2L5TA 4QJFA 1BNZA 1TY0A 4I65A 1P16A 4DR4L 1DD2A 4WJ3M 1VQ7A 3KBXA 1I3QB 1YNND 5IT9L 4R4OA 4ME3A 4OO1I 4OL7A 2L4NA 1JOOA 4LF7Q 4Z9CB 2YYZA 3VA5A 4LF8L 2N8NA 4NPSA 5FJ8H 4DR4Q 2B8FA 2PW5A 1N32L 2Z6BA 1T5EA 4R4QA 3SXHA 1V1PB 2SNSA 3MC0B 4DGZA 1Q1BA 1E22A 1I4QA 2O5JC 3NWSA 2JQOA 4YCUA 3R8BA 1ENAA 3I4NH 2J4XA 4QMGA 2HIXA 1I4PA 2RSNA 3HOZB 4LF8Q 1N32Q 3UE1A 2RSOA 3FKIH 4LUOA 3I4MG 1F77A 3J80i 3GTKB 1P8LA 3JAMi 3KLSA 2CCZA 1X3PA 1PFBA 1I6VC 1VQGA 3CPFA 3U58A 3C1FA 5AFWA 4TKOB 4BWGB 4C2MB 2VY3A 3KLSX 4OIKA 4DNRB 2DN8A 1GUNA 4HJ7A 4CDFC 1FL0A 3HOUG 2A68C 3QOJA 1FR3A 3QG1A 4A3MH 5C0XH 1QUQB 3HOVB 5C4ZA 1K9MC 4BXXG 3OMGA 4EQOA 3OWFA 1LACA 4DR3L 1KRSA 3S16B 1LTSD 1ZEQX 4V0BA 4NDXA 4ILWA 4A4IA 5T1GA 2AWNA 4IUUA 2XSCA 4KD4A 3HOWB 2KQ3A 4G4KA 4DR3Q 4LJZC 4BS9A 1R9TB 1UE1A 3WDNA 5ELCA 2OF1A 1W6JA 4A3JH 3MXNA 3OTOL 1S4ZA 3L3OC 5CV8A 1B9MA 4ZQ3A 5FLMG 3VYTA 2F03A 2OQ0A 3E3XA 4DV5L 1Q81C 1BUVT 1M4VA 1MHWC 2K5WA 3KDFA 3T4AC 4J6HA 3Q0AA 1RODA 1PRTF 1F9SA 3H3VI 1NMGA 4IN3A 3OTOQ 5EPJA 4HAEA 1BBWA 5M3FG 2MHVA 3D8GA 2DJFC 2EDGA 5JEAJ 4U673 4DV5Q 4K2LA 1CTMA 4EVOA 5C3XA 1BCPC 4H02A 3FDTA 5ELEA 1A3UA 3PF4A 1EYDA 1U0LA 3TP8A 4AQYQ 2ENBA 1ASYA 1ZYRC 5C4JH 1YNXA 3J80c 1B2TA 1HFNA 3JAMc 1VQLA 2A68D 4LMQD 1I4GA 2BH8A 4M8AA 3QOLA 2EZVA 4DV7L 1CUKA 4PZ6A 1HRJA 1STEA 4HIKA 4CKEA 1K8GA 4P73A 4K0KL 2IWHA 4DV6Q 1QCBD 4H7BA 1EY9A 3MAQA 4DV7Q 3AYHB 4OEMB 2CH4W 1Q7YC 4A3DH 4JPBW 1IHZA 3W2DA 2A74C 4K0KQ 3HOZG 5KYLA 1IBML 5IGBA 3U50C 1F9RA 2KECA 3S1MH 4R4CA 4XT3B 4KKTA 4NMZA 4R8IA 3C46A 3KK7A 3RLFA 4DNIA 1WTRA 3S2DB 1V1OA 4LUZA 4JI1L 1SYDA 1O78A 2PQAB 5C44H 1IBMQ 3CAMA 5CV5A 1TS4A 4XQQA 3VR5A 1Y8NB 2KEEA 4BBRB 2YU9B 3M4OB 3E9IA 1BCPD 1EU4A 4JI1Q 2F0TA 5IP7H 4DU9A 3X3MA 3STBC 4RGMA 1LTRD 3FKIB 2XRSD 4A3KB 2A1AA 1ZYRD 4X64L 3HP3A 3L9AX 5E3FA 1HR0W 2CVRA 3HOVG 2AKWB 3MXNB 1LLRD 1LABA 4IUTA 4BBSB 1IYJB 1GUTA 4IFDH 3DWQA 4K6LA 5KGUA 1O80A 4X64Q 1NMFA 2EYMA 4K8JA 5IGGA 4KD3A 1Y1WG 2E2DC 4A75A 4DXGA 4MZ9A 3HOWG 4Y7NH 1K8OA 5HGQA 4CDCC 1QOHA 2RCNA 3HZXA 3QB3A 4X62L 4AYBE 1VQDA 5IP9G 1A8VA 3S17H 1NR2A 4YY3Q 3MHBA 3PIP3 2NTTA 2R92B 4RKBA 2LXJA 2IX1A 1DJRD 1C4QA 1RCVD 5C0XI 2NZOA 1WCMB 4NXNL 4BA2I 4X62Q 5LMNL 5GQOA 1VQJA 4L8JA 3C1EA 3MVVA 3W3AA 1GHJA 5C0XJ 3M7NA 4CDEC 3P1HA 3GTJH 1K0RA 4NXNQ 1NJIC 4A3JB 2F0LA 3V96A 5LMNQ 3GD7A 5KIXA 4JK1C 1X9NA 3STBD 1MJEA 4RGTA 4A3BB 2K6AA 3ULPA 3MA2B 3DWAA 3ZJYC 5ELNA 2LXKA 4CJ0B 5JPNC 1JC7A 1ICFB 2XVSA 2A6HC 3RUZA 4R1JA 2NN6G 5JJLA 2ICEC 1OXXK 4X66L 5FLXL 5EQ0A 1SXTA 4A3EH 2EVBA 4OHJA 1F2YA 1TWGH 1JJCB 4JW0A 2NVTH 1CHPD 4GKJL 2BCOA 2DUDA 1S5DD 3OWEB 4QIWB 1X3EA 3OMCA 4RCNA 4LF6L 2D9UA 2EXZA 2MP1A 1PH8A 1U9RA 2JE6I 3NQTA 4RGOS 1ASZA 3M4YA 3VR4A 1Z9FA 5J39A 3L2PA 1M90C 3J81j 1UE6A 1UE5A 4K2KA 1BVSA 1WTVA 3U4ZA 1B4OA 2ICIA 4QGUA 4HJ5A 4LF6Q 3TS2A 4GKJQ 1HR0L 1GJXA 2PYKA 2B29A 4WRDA 3O13A 1Q8KA 1RF2D 3RZDB 3SGIA 1IL8A 2MFIA 2NWGA 3I90A 1GUOA 3F2UA 4EQ5A 3ONAB 4JCVE 3DHQA 2R6GA 5M5WB 4BBRG 2K5QA 4XXEA 2Q2HA 4P74A 4NKLA 4PZ8A 3I70A 3HRZC 3I4MH 1ESFA 5IT9c 5EAYA 1A2TA 1H9SA 4N9PA 1U4MA 1NSNS 1F2MA 1PTOC 3G48A 4A3KG 1V1QA 3F8TA 1LTGD 4J8QA 1X3FA 1KC8C 4DAMA 1DGSA 4BBSG 1MBYA 1I50H 3S15H 3GDEA 4PV1C 1G6PA 4JI3L 2A6HD 3PGZA 3CC4A 2K05A 3NPPA 3S1QH 1SYEA 4LF9L 4X3KA 1AP0A 1QNKA 2FINB 3WOEA 3F2DA 2AQ3B 2B2WC 3VR6A 5M5XB 4RCOA 3HOUH 3W1BA 4UAIA 3EN2A 4JI3Q 3GTMH 1SJHD 5CMDA 2FHTA 1V9PA 5CORA 2FMMA 2RCFA 2F4IA 4OWTB 4BXXH 2JA7B 5M5YB 4HIOA 1SYBA 1SMXA 3F2BA 2D2CC 3NTIA 1EFID 3T56B 3U9SA 2R92G 5KNDA 1DOMA 1SFOH 1TQOA 1Q12A 3KOJA 5CBEE 3CU7A 1WCMG 2N88A 2JXMB 3LWUA 3TQYA 3H15A 3BS1A 3MXPA 5HGTA 2LFNA 5LL6S 4IFDI 1RTOA 2B2WA 1SNDA 3K7AH 2E2IB 1CZWA 1F2ZA 3M9BA 3PO2B 5IGEA 4HIDA 1M8AA 2N3SA 5FLMH 3HOXB 5GADC 4IFDJ 1HZAA 4A3BG 3GTPH 4HR7B 4KHVA 2XIWA 1PTOD 1PH2A 3I55A 2OEOA 4DR7L 2K75A 5M3FH 4CGYB 1D2BA 5BR8Q 2WB1B 2IL8A 1WTWA 1N8RC 3GTQB 2K01A 2F0PA 1L0WA 4LWCA 5CV9A 1TVXA 4DR7Q 1Q86C 2SEBD 4GN5A 1AEXA 2A5HA 1JORA 2BA0A 4A3CG 1I3QH 2UXBL 3HOYB 4LUVA 3VR3A 1TXYA 1K73C 1B70B 1H9SB 2GVAA 3GO5A 1WOCA 2MPMA 1BCPF 3MXUA 3T53B 1F2LA 3PO3B 1X3QA 3D4DA 2JYOA 4QUCA 1G2TA 3DEOA 1TWGB 2F0MA 2HCIA 3C3LA 2WV6D 2UXBQ 3NBHB 1AN8A 5IYBH 4FDBA 1RKNA 5EKKA 3PIOA 1IBKL 2XGTA 1QE6A 2Z4HA 3HOZH 1PMRA 4ZK9B 2HQEA 2RHQB 3TZUA 1ENCA 3GTKH 4LK1C 1PTOB 1IBKQ 2ZTCA 1EY6A 5G3LD 2QW7A 4A76A 1TS3A 1PH6A 5GAGC 4XQJA 1KDCA 2F0KA 2A19A 2VZAA 3K5OA 2CFMA 2L55A 3BZKA 4IUNA 2LY7A 4DXFA 1N33L 3NWTA 4OIJA 3AU7A 5DEHA 4JI5Q 1PZKD 4B9WA 2M9VA 2QKIC 4QQBX 1WFQA 3JC66 1VDZA 4KLKA 3V2TA 3HOVH 4YCWA 4DAVA 4GNXB 4RKLA 1Y8OB 2JA7G 2VW9A 5DM63 5E1FA 1DZ1A 1N33Q 1K3RA 4DKAC 3FPUB 3E6ZX 2Z8LA 4ULLA 1V1PA 1YI2A 4F7XA 1WVLA 1KLUD 4X3UA 3CCUA 2IJ0A 5LMUL 1V43A 4JBJA 4JYAL 4DR5L 2RKSA 1Y1WH 3S1QB 3NBIA 2K14A 3FHWA 3HOWH 3TZDA 1CA6A 5JOBA 1G8ZD 5FKAC 3SK4A 2PI2E 2ZT9C 1R9TH 1NE3A 2AQ1B 2HIVA 2QDLA 2XNAC 4CJ1B 3PIPA 5LMUQ 2F0QA 5C4HA 3PO2G 4DR5Q 3UDXA 4JYAQ 5IP9H 1HZ9A 3I4OA 1KL9A 3GV3A 3HOXG 4OWXB 5GAEC 1SNCA 2PZTA 2V1CC 1EZ8A 1UUPA 2JA6B 3HGBA 4A3FB 4GLXA 3A7LA 4FXKC 4R9WA 1A2UA 4ID6A 3QJYA 2ZXPA 4XTCS 4JI2L 2WB1G 3J7A5 1ESRA 1S3OA 4JBMA 1ML0D 2K52A 1B7YB 1QUQA 4YIJA 2B2TC 1KLGD 5ELFA 3I56A 4XIGS 1FD7D 4JI8L 2KENA 5JVG3 4JI2Q 1S40A 3QR8A 1I5FA 4PMCA 3SDZA 1JCKB 3HOYG 1Q90A 4ALPA 2R93B 2NN6H 3J7YW 1S5CD 4H44C 4B3TL 5TSSA 2HCCA 3K59A 1VQ6A 4JI8Q 1C0AA 3QIAA 2IW3A 1JE4A 1JOKA 3PO3G 3UDGA 2NVXB 4BY1B 2K50A 2E2JB 1ET9A 2BOSA 3M4PA 4DK3C 2QDBA 2HUGA 1EIHA 5FK9C 4B3TQ 2OTJA 2F4VL 4NXML 2HQLA 3PQIA 4O42A 5KNBA 3S2DH 4PZ7A 4IPGA 1XNQL 3ULJA 2VQEL 1L1OC 2QEJC 5FLXc 4LNQA 2F4VQ 4APVA 2R61A 4NXMQ 5JAVA 1PFNA 4ME5A 4OONA 2MJ8A 3E9HA 2RBMA 2ID0A 2C35B 4BBRH 3BYYB 2YU9H 3M4OH 2HDMA 4P2CB 1XNQQ 1E0BA 2VQEQ 2DY8A 3G6JB 4LFCL 2PZWA 4IALA 2UXCL 4A3KH 3TBIB 4C1NK 1VQMA 4PNYA 4LF5L 2VUMB 2GVBA 1Q3LA 2CH4A 3LX0A 4DA2A 4BBSH 2WAQB 2SNMA 1L1OA 4J15A 1RTNA 3RD4A 3CC7A 1RJTA 4GLAC 5IIFA 3DWPA 1CKNB 3NTHA 4LFCQ 3BU2A 3HEJA 2UXCQ 3AEVA 2BH2A 2EYHA 3G71A 4JI7L 2IHEA 2H4OA 4LF5Q 2NB0A 5ISRA 4GKKL 1WD0A 1EYAA 2BDOA 1AW7A 4RAUC 3K5NA 1VQ4A 3K6OA 4ZUJA 4DUZL 3K80C 5E4XA 1Y1VB 4JI7Q 3BZDB 2G5DA 3BVMA 1QG7A 1TKWB 1TU2B 4FNFA 1HTLD 4QL5A 2PQAA 4GKKQ 2KVMA 3PCOB 2R92H 1ET6A 4IQZA 4MN3A 3K5LA 2I5MX 3D6WA 4HMIA 4P75A 2EYOA 1XNRL 2JA6G 2AWOA 4O2DA 1WCMH 5AJ3L 4DUZQ 1RDPD 4A3FG 1Y1WB 2NVYB 3DM3A 1KD1C 1HZBA 3P75A 1E24A 1M1KC 3DMUA 2F0UA 3MEFA 2CWPA 3VA7A 1XNRQ 3S14B 1D1IA 1OXVA 1TWFB 2Z4IA 2JA8B 4B08A 4Q0FA 5AJ3Q 1I94L 3AFPA 4L5RC 5C3EG 1TY2A 2CW0C 4A3BH 4CJ2C 1LT4D 2K5VA 2KCNA 4MTKA 4XDXA 2M00A 4KKSA 4I7ZC 4WFN3 1BKBA 2R93G 1I94Q 2Q8RE 1PH5A 4CKBA 1BOSA 2MUYA 5GROA 3MTSA 5FLXE 5LHY1 1SNPA 1RL2A 2EYFA 4BY1G 3RLNA 1X65A 3OSOA 2LSSA 4P72A 1XPUA 1MGSA 3VYRA 4FF1A 2K33A 5G3LF 4A3CH 3V05A 3QO2A 4X3SA 1C48A 1NUCA 2VNUD 2HT1A 5IODA 2LS01 1EEFD 2L12A 4POGA 4G7HC 4BY7B 2WACA 1S5FD 1QVGA 2TSSA 3A74A 1G6ZA 1EWCA 1L1OB 5C3WA 3RZDH 2CWAA 3Q22A 1J8IA 1HNZL 2C5CA 2NN6I 5IYBG 2PO4A 5M5WH 4PG3A 2IHFA 4MNOA 1MIUA 2JSOA 2SOBA 3P7JA 3S24A 3D0FA 2ZJPA 5BN5A 3PIO3 4GN3B 3ND9A 1A3VA 2F0FA 1ILQA 3D31A 5KNCA 1HNZQ 4IPHA 2VUMG 2CW0D 1A6XA 4QF4A 5I6YA 4A3IB 1CQFA 2RDFA 1T9HA 2WAQG 2A73B 5ELOA 2PMZB 3TSSA 1JICA 3EQLC 1CA5A 2EIFA 3CPWA 2A69C 1H95A 1IKLA 2E2HB 1FVIA 4F88A 1RIPA 1DXMA 1X56A 5M5XH 3S1RB 2XRQD 2ZXRA 4CHTB 4IPCA 1WD1A 4YWLA 1Y1VG 4IUQA 2JA7H 2NZHA 2PQEA 5M5YH 3ERSX 4KJOA 1IYUA 2JEBI 5BN4A 1YITA 1C8CA 3CP0A 1X55A 3A8IE 1NBWA 1BBUA 4Y52H 2EYJA 2AQ2B 1LO5D 2LMCB 2CQAA 5DLQE 4GOPB 1D5XC 3I73A 4DR1L 2F0EA 4K5XA 2E2IH 4K14A 1ZKOA 4F8MA 1PVOA 2JA8G 3PO2H 1PH7A 5IYDG 1OXUA 5E4WC 3HOXH 4IUVA 2K28A 3E0EA 5CR3A 1PH9A 1VQHA 2QILA 3TP6A 4DR1Q 3KJPA 4K6DA 2ZTEA 3CF5A 4EQPA 3DEPA 2J7ZA 3BZCA 4QIWE 2EE1A 3T13A 1MSHA 3BJUA 1SYFA 3GTQH 2A69D 3SVMA 3RZOB 2I0QA 4MTNA 1PH3A 1XPOA 1TWHB 4G7ZC 2RA4A 3H0GB 1JR0D 3MEHA 3HOYH 1SDFA 4NB3A 4DV2L 1HTPA 5JJKA 4BY7G 4UP8A 4JG2A 2VQFL 2IX3A 2UU9L 4GLVB 3A0JA 3PO3H 3LWEA 4BA1I 1OXSC 3G6EA 3DXJC 2WKCA 2NYZD 2H5XA 2VQFQ 2UU9Q 1JWSD 1LV9A 4IJLA 2RF4A 4X66Q 3A8KE 4AYBB 1CK1A 3IRBA 2Q2IA 1K83B 2KCTA 3IFDA 4LFBL 1MKHA 1KRTA 1A0IA 5IGCA 1PTOH 4G7OC 3LGJA 4A3IG 4DPGA 5L37A 2MGSA 2PNHA 1YNJC 4RFBA 3EA6A 3RMHA 4LFBQ 3H91A 1LTBD 4FO2A 4JBWA 1E2VA 4LFAL 1HR0Q 2PPBC 2KA7A 2MO0A 2B2UC 1I4HA 5M3MB 3PUWA 1GUGA 1SMYC 1U4RA 1D5ZC 3D3RA 2KHSA 1QZGA 2JA5B 2WKDA 3WWVA 3CCLA 3I2ZA 1YIJA 3HS0C 1O7LA 4LFAQ 4L63B 1ENFA 1GO3E 3SK5A 3CCQA 3J7AV 3NBHA 1F9PA 3N6RA 5J3BA 2K03A 1LUZA 3PUZA 3GP7A 2ZJRA 2KEDA 4HJAA 1JE5A 3KYHC 2SDFA 2XTIA 4ZRZA 3VR2A 4KMUC 5C5MA 3CHBD 2B2UA 2YTYA 2F0HA 4LAAA 4GNXC 3TS0A 3OIPA 4KY5A 3NP8A 1MD2D 2PNRC 4LF9Q 3RN2A 3I8ZA 1SE3A 4A3GB 5J1ZA 5KRUA 4RHRA 3HKZE 2JA6H 2O5IC 4A3FH 1LT3D 1VQCA 1SROA 2PCFB 3ITPA 3HKSA 1VF7A 1FNVA 5CV4A 2FMCA 1D1KA 1YNJD 4GZYC 1STYA 4FF3A 1IL2A 1AH9A 5KEEA 4GNXA 5CBAE 5C3EH 1VQ9A 4IZ8A 2TMPA 1STAA 4JBKA 2B2VC 4FF4A 1SMYD 1VQEA 1HPCA 1FYCA 3T16A 3PSIA 3H0GG 3OIQA 4DV0L 1PRTC 1L2FA 3OW2A 4B3RL 1II3A 5EBCA 3S2HB 2R93H 1S72A 2B63B 2PZUA 2WINB 4C3HB 3BYTB 2F0WA 2F3IA 3MFYA 2D62A 1XTDA 4UP7A 1JB3A 1D6EC 1HA5A 3CCSA 2B3GA 2NVXH 4DV0Q 4BY1H 2E2JH 1VQ8A 1WTPA 5K36G 4DAPA 3A5ZB 3KF8A 4B3RQ 1YHQA 3RLOA 5BN3A 1VQIA 1E3PA 1S5ED 1X54A 2EY1A 2B2VA 2CQOA 1UNSA 3AB9A 4HSVA 5C4XB 3G7LA 1SNQA 2Q2TA 5JJIA 4AYBG 5JVH3 1SSOA 4DV3L 5A2QL 1CSPA 1STBA 3OPOA 2VS1A 1IZ6A 2RDGA 2EY5A 4ABNA 1GHKA 2HHHL 3RNUA 1KNEA 3EFXD 3CW2C 1Q8IA 2EXDA 2HDLA 2O2LD 5KYIA 4MIUA 4DV3Q 3L0OA 4B3ML 4KI0A 1Z47A 2R7DA 5IOCA 1EY0A 1E2ZA 3UDIA 4PQXA 1DCZA 4QY7A 2HHHQ 5M3MG 2VUMH 3N52A 4RA8A 1YJWA 2JA5G 3ZYYX 4KN4C 1VQNA 3KLWA 4GN4B 4B3MQ 1I6HB 4OELB 4H13C 3T1YL 4RG1A 1DONA 1HCZA 1QB5D 2YTVA 1LTTD 3NHHA 3CCRA 3K0XA 1W3SA 3CC2A 1FGUA 3CQZB 1HNWL 4JOIC 4KV6A 1Q82C 1VMCA 3T1YQ 3S1NB 2RDHA 4WORA 1JWUD 3J7AF 3H6MA 4HN7A 1Y1VH 3R2TA 1K8AC 1SE4A 4KN7C 4JI0L 1HNWQ 5EBDA 2A8VA 4XQNA 1XPRA 4KKUA 4A3GG 1QNUA 4IPDA 5I2XA 3BVGA 3CRLC 1FNWA 5LL6X 4JOIA 4JI0Q 2NVYH 4DK1A 3PF5A 3HFZB 2EJGC 2F0DA 3K58A 3GTLB 4R4IA 1SNOA 2KCCA 4C3JB 1H9KA 3S14H 2OWOA 1TWFH 2JA8H 1LYLA 5IYDH 1HNXL 2EPBA 3KF8B 4DV1L 3A7AB 1H9RA 1JB7A 2ATWA 3KJOA 3CCMA 4JVZA 1CKNA 2VL6A 2EJFC 3BG3A 4A3LG 2J0TD 3H09A 4NW2A 4XT1B 1PRTB 4QCLA 2JN4A 1KAWA 1HNXQ 2B63G 4DV1Q 4C3HG 3CMAA 2R7FA 2B2YC 1Q46A 2VB3X 3Q24A 4C1NI 5HY6A 1CSQA 1SNMA 2MQHA 2F0NA 5C3EB 1A62A 1LTLA 3GV6A 4YHHL 1JJGA 2QEXA 5C4XG 3PV0A 5D3IB 1QVFA 1EIFA 1TIID 1NCVA 3EIVA 3IL8A 5CGKA 2BDNA 4UHVA 4JC0A 5I9PA 1BF4A 4N8X1 4BY7H 4A93B 1HQRD 4YHHQ 2F0OA 1VCIA 4AIMA 4ZKCB 5NUCA 1H9MA 3GTGB 1QVCA 2B2TA 1PLFA 3SK6A 2VB2X 1XTCD 3I3CA 4N9TA 4N8FA 4ODGA 5GAHC 1EU3A 1YJ9A 4RH6A 1T5XD 2F0JA 2AHOB 3R3OA 4L6TB 4FVMA 4OX9L 1TS2A 4A3IH 1EY8A 2QCPX 2UUCL 1TWCB 4RMFA 1TWAB 2EYPA 2OTLA 3ULLA 1B3AA 4KHZA 4LF7L 1EQTA 2E74C 4O1NA 5CYUA 2E2HH 2KHJA 3LNNA 4OX9Q 4RGNA 1CI3M 2UUCQ 4WJWA 1L0YB 3S1RH 3GTOB 2ZJQA 2AUKA 3J81L 2WFWA 3SK8A 5JJZA 1TS5A 1ICWA 1TR5A 1KDAA 4R8NA 2NVQB 3KBGA 4L5SA 3ERQA 3B6YA 2XWBB 1CFMA 1GUSA 2OCEA 3PUYA 2Z0SA 5IYCG 2KCMA 3F2CA 4FXGC 3TEHB 2BA1A 1R4QB 1HZCA 2G9DA 2I46A 4J1MA 1U4LA 4OGQC 1WTHA 1NNXA 4V190 1C9OA 3A5UA 3M4QA 1JWMD 3FMCA 5EGTA 1PTOF 2VXWA 4C3JG 2Y0SB 2K1BA 3E5SA 4OXPA 1QILA 1EL0A 2DNCA 5H1SE 3CXCA 2QGQA 2ES2A 1STNA 2ZXOA 4NP5A 1LTAD 3NENA 3X3NA 1YEZA 3CKIB 4TQUS 4TSSA 4QUFA 1K0SA 2XN9C 3CCEA 4GOPC 1KXLA 3KLRA 1VQKA 1EFWA 5DAUA 3FVQA 4C3IB 1GVPA 1JOQA 3TDQA 1XMOL 1IXRA 3RZOH 1KDBA 3P20A 4IO9A 1VMPA 2IX0A 3H94A 4CDDC 4GS3A 1ONLA 1TWHH 1KQSA 4DUYL 1J9OA 4FXDA 2L1BA 3H0GH 1CZGA 1XMOQ 3IFTA 3A8JE 1NR4A 3A56A 4EGVA 2UUBL 2R7ZH 2YTXA 4A93G 4GOPA 4IJHA 5ELBA 4DUYQ 1AE3A 4KK7A 2F0VA 1X3GA 1GUWA 3A55A 1E2WA 3TP7A 1PH1A 3MZ5A 2N55A 5K36H 1JQYD 1AZQA 2ASBA 1OXTA 1JJ2A 4MHEA 4RHSA 2UUBQ 3ND8A 1SR3A 3BDLA 3IAYA 5DM73 3M3YH 2NZ1D 4DAYA 2N78A 1X6OA 1LTID 2PMZE 5FO8B 2ALYB 4AQYL 1K83H 3A54A 1I4RA 1VS0A 4HSPA 4K8IA 3K57A 1DOLA 1WI5A 5IY0A 4IUPA 3NQIA 4R4TA 1SAPA 1FJGL 1HH2P 3M85A 5T1IA 3TN2A 1CKOA 3K5MA 1EUJA 1MJCA 3NK9A 1SE8A 1VQ5A 4OO1G 2I5LX 4DV6L 1DM0B 2NBFA 2V4DA 3NXWA 1XJVA 2MNAA 1G2SA 1FJGQ 5LMNW 1VQAA 1L0XB 1XX8A 1YHAA 5M3MH 2LKVA 1EQQA 2E5LL 4KJNA 2JA5H 1A3TA 4UP9A 1IBLL 2EOTA 4ZKBB 2KHIA 4HJ9A 1SRUA 2QF7A 2FXQA 3EROA 2E5LQ 1OO9B 1SN8A 1IBLQ 1XXGA 4B9XA 1PH4A 1W2BA 1FNUA 4EQNA 1QWYA 5D65A 3S9WA 5E7NA 2Y0SG 3OW7A 3RN5A 2RQXA 1U5KA 2Z6KC 1K8MA 2X69A 1EYGA 4A3GH 4K5VA 2D5DA 1PDQA 3NEMA 2FJ2A 5EJWA 1B44D 3I4NB 3K8AA 3SR1A 5EPLA 4CBVA 2Q2UA 5CV6A 2O4XA 4HEDA 1BR9A 5CC4A 2EQSA 1YHBA 4DF7A 2EY2A 4C3IG 4F87A 2Q8IB 1CT1D 4QB4A 1PFSA 4DFAA 2Z6KA 1J6QA 2RHSB 1EWIA 4JI6L 3KDFB 3OYYA 3Q8DA 3I91A 3I4LA 1EY4A 4DAYB 2ZM6L 3OOCA 4A3LH 2PW7A 4YY3L 3S2HH 1PZJD 1G51A 1KTKA 1J5EL 1B3QA 2B63H 4C3HH 2A6EC 2F52A 4YWMA 4JI6Q 5JEAG 3MXGA 2NTSA 4X3TA 1G291 4A3MB 1N34L 4O0AA 2ZM6Q 2GA4B 5C5LA 3TP5A 3KUPA 1J5EQ 1O7IA 1SJED 1HFGA 5J22A 3J80E 3J81i 4FF2A 5HURA 5C4XH 3VYUA 1F9QA 1B53A 1SLJA 3FRPB 4ZCKA 3JAME 3TMEA 3CMEA 1BQQT 1WYDA 1N34Q 1B9NA 3W1GA 1UWVA 4ZLTF 2C9OA 2R7ZB 1RD9D 2F3VA 5A2QE 4TVAB 1IW7C 2B8GA 2JA9A 1BCPB 3KF6A 1EQRA 1PYBA 1Y8PB 4XYOA 1VQBA 3PMFA 3VYSA 4DV2Q 1YBYA 1VQOA 4E6IA 3VDYA 3TREA 2L0CA 2EJMA 3M3YB 2YV5A 3D4WA 2KOLA 1HJPA 4IOAA 4XYQA 4PMWA 4LW1A 3GQBA 1XWEA 1PYWD 2X6LA 4HCEA 1I6HH 2E76C 1X32A 1D5MC 4L5TA 5DNFA 1SBBB 1EWHA 5I9OA 2A6ED 1Z6HA 3CQZH 5C4JB 3AMUA 3K0YA 3U4VA 3SHLA 3U9OA 2KJXA 1R4PB 4WJ4A 1I4XA 3UDFA 3S1NH 1TT2A 3R2IA 4HIMA 1HA6A 1C7YA 1Y69U 2OT2A 3AQQA 1N36L 3FP9A 1RHPA 3R93A 5FJ8G 2IPKD 2WIIB 5IYCH 2F0GA 2AMCB 2AUJD 1LM0A 4A3DB 3I4NG 1NY4A 1IW7D 1EY7A 4H0LC 1N36Q 4HMJA 3DUZA 3S1MB 1MI2A 3J81c 4DR6L 3GTLH 3FKIG 4C3JH 5FO7B 3NSWA 3L7ZC 1HUNA 2DY7A 1FGBD
chains in the Genus database with same CATH topology
4K5WA 5C44B 2OXPA 4M1UB 3URYA 3MWYW 3WOFA 3CRKC 1HXYD 2R3ZA 3UI2A 1SEBD 3QWNA 1CM9A 1U4PA 3FEWX 3PUXA 3M7GA 4KY6A 5IGDA 3BVZA 5C0XG 4HTHA 1AFPA 2BE5C 2K5DA 3D6CA 1XYIA 2F0SA 1KNAA 2DNEA 2F1MA 5D14A 4Y7NB 3E0JA 1EIGA 4IURA 1Q1EA 3IKJA 3FPPA 3S17B 1HHVA 3NUCA 3J80L 3D4RA 3JAML 2I07B 2X6GA 4DK0A 2Q8TA 1Z7TA 3NE5B 4PMBA 4UDUC 3HKZB 2EYLA 3MFGA 1UEAB 4S3SA 5I2YA 5EPKA 5IGFA 1H9JA 3GTJB 1S5BD 1LT5D 4OO1H 2G9HD 1W6KA 1SE2A 1VF5C 1IKMA 1ILPA 2Z1CA 5IT9E 4CKCA 3J81E 3EVQA 2BE5D 1V8QA 1STHA 5FOBB 4FYDA 1MSGA 5M9OA 3BDOA 5JPMC 4A3EB 3OHXC 1PRTD 2E75C 2NVTB 1EOTA 5I4DA 1B50A 2EY6A 1GXDC 1O7ZA 2XWJB 2L11A 1EEID 1STGA 3EJIA 3Q23A 4DNTB 1SYGA 3Q6SA 3T51B 1BO0A 3SEBA 2NUCA 2WP8J 1ZXTA 2CHBD 2IT1A 4ZYSA 1EZ6A 1PXUA 5A35A 1CQVA 3DM1A 3I4MB 1WTXA 1O7YA 5ELDA 4KTAA 2F0IA 1EYCA 5FO9B 1I50B 3S15B 4TRDA 4IFDG 2KUMA 1SYCA 2K7VA 1PFMA 1EQVA 5D3DA 3PUVA 4DN4M 2H1EA 1BDOA 3HOUB 5JEAH 5I6WA 3GTMB 1YNNC 2FFKB 1DOKA 3I72A 1BBXC 1HQMC 1BXTA 4FP5D 1WTQA 1KAAA 1SFOB 4ZAIA 3BDCA 3SE0A 2K32A 4ZUIA 1EY5A 1AZPA 1LT6D 3HG9A 1DYQA 4Q5VA 5EKLA 4C56C 2JEAI 5C6AA 3K7AB 2JP1A 2RVLA 2B2YA 3H3VC 4G57A 3C2PA 2L9HA 4KY7A 2F3WA 3GTPB 1B1ZA 1G91A 4U68A 4HCSA 5F2DA 2K04A 5M3FB 1WTOA 4RWSC 1NAPA 2M2LA 1IYVA 1UAPA 1HUMA 2B39A 5K5PA 5EKIA 1CHQD 1A15A 5CV7A 1GOZA 3NTKA 1QJOA 1PZID 5COYA 1KABA 2L5TA 1BNZA 1TY0A 4I65A 1DD2A 3KBXA 1I3QB 1YNND 5IT9L 4OO1I 4OL7A 2L4NA 1JOOA 4Z9CB 2YYZA 3VA5A 2B8FA 2PW5A 1T5EA 3SXHA 1V1PB 2SNSA 4DGZA 3MC0B 1Q1BA 1I4QA 2O5JC 3NWSA 3R8BA 1ENAA 2J4XA 4QMGA 1I4PA 2RSNA 3HOZB 2RSOA 1F77A 3GTKB 3KLSA 1X3PA 1PFBA 1I6VC 3C1FA 5AFWA 4TKOB 4BWGB 4C2MB 3KLSX 4OIKA 4DNRB 2DN8A 1GUNA 2A68C 3QOJA 1FR3A 3QG1A 5C0XH 3HOVB 5C4ZA 3OMGA 4EQOA 3OWFA 1LACA 3S16B 1LTSD 1ZEQX 4V0BA 4NDXA 4ILWA 5T1GA 2AWNA 4IUUA 2XSCA 4KD4A 3HOWB 2KQ3A 4G4KA 4LJZC 4BS9A 1R9TB 3WDNA 5ELCA 2OF1A 1W6JA 3MXNA 1S4ZA 3L3OC 5CV8A 1B9MA 4ZQ3A 3VYTA 2F03A 1BUVT 1M4VA 2K5WA 3T4AC 3Q0AA 4J6HA 1RODA 1PRTF 1F9SA 4IN3A 5EPJA 4HAEA 2MHVA 2EDGA 3D8GA 5JEAJ 4U673 4K2LA 1CTMA 4EVOA 5C3XA 1BCPC 3FDTA 5ELEA 1A3UA 1EYDA 3TP8A 2ENBA 1ZYRC 1B2TA 1HFNA 2A68D 4LMQD 1I4GA 4M8AA 3QOLA 2EZVA 1HRJA 1STEA 4CKEA 2IWHA 1QCBD 4H7BA 1EY9A 3MAQA 1IHZA 3W2DA 2A74C 5KYLA 5IGBA 1F9RA 2KECA 4XT3B 4KKTA 4NMZA 4R8IA 3C46A 3KK7A 3RLFA 1WTRA 3S2DB 1V1OA 1SYDA 1O78A 5CV5A 1TS4A 4XQQA 3VR5A 1Y8NB 2KEEA 4BBRB 2YU9B 3M4OB 1BCPD 1EU4A 2F0TA 4DU9A 3X3MA 4RGMA 1LTRD 3FKIB 2XRSD 4A3KB 1ZYRD 3HP3A 3L9AX 5E3FA 2CVRA 1LLRD 1LABA 4IUTA 4BBSB 1GUTA 4IFDH 3DWQA 4K6LA 5KGUA 1O80A 2EYMA 4K8JA 5IGGA 4KD3A 2E2DC 4DXGA 1K8OA 1QOHA 3HZXA 3QB3A 1NR2A 3MHBA 3PIP3 2NTTA 2R92B 4RKBA 2IX1A 1DJRD 1C4QA 1RCVD 5C0XI 1WCMB 4BA2I 4L8JA 3C1EA 3MVVA 3W3AA 1GHJA 5C0XJ 3M7NA 3P1HA 4A3JB 2F0LA 3V96A 3GD7A 5KIXA 4JK1C 4A3BB 4RGTA 2K6AA 3MA2B 3DWAA 4CJ0B 5JPNC 1JC7A 2XVSA 2A6HC 3RUZA 2NN6G 2ICEC 1OXXK 5FLXL 5EQ0A 1SXTA 2EVBA 4OHJA 1F2YA 1CHPD 2BCOA 4QIWB 1S5DD 3OWEB 4RCNA 3OMCA 2D9UA 2EXZA 2MP1A 1U9RA 2JE6I 3NQTA 4RGOS 3M4YA 3VR4A 5J39A 4K2KA 1WTVA 1B4OA 2ICIA 1GJXA 2PYKA 4WRDA 3O13A 1RF2D 3RZDB 1IL8A 3I90A 2NWGA 1GUOA 3F2UA 3ONAB 3DHQA 2R6GA 5M5WB 2K5QA 4XXEA 4NKLA 3I70A 3HRZC 1ESFA 1A2TA 1H9SA 4N9PA 1U4MA 1NSNS 1F2MA 1PTOC 1LTGD 4J8QA 1MBYA 4PV1C 2A6HD 2K05A 3NPPA 1SYEA 4X3KA 1AP0A 1QNKA 2FINB 3WOEA 2AQ3B 2B2WC 3VR6A 5M5XB 4RCOA 4UAIA 1SJHD 5CMDA 2FHTA 5CORA 2FMMA 2F4IA 2JA7B 5M5YB 1SYBA 2D2CC 3NTIA 1EFID 3T56B 3U9SA 5KNDA 1DOMA 1TQOA 1Q12A 5CBEE 3CU7A 2N88A 2JXMB 3LWUA 3BS1A 3MXPA 5HGTA 2LFNA 5LL6S 4IFDI 1RTOA 2B2WA 1SNDA 2E2IB 1CZWA 1F2ZA 3PO2B 5IGEA 1M8AA 3HOXB 4IFDJ 4HR7B 4KHVA 2XIWA 1PTOD 2OEOA 4CGYB 1D2BA 2WB1B 2IL8A 1WTWA 3GTQB 2K01A 2F0PA 5CV9A 1TVXA 2SEBD 1AEXA 2A5HA 1JORA 2BA0A 3HOYB 3VR3A 1H9SB 3GO5A 2MPMA 1BCPF 3MXUA 3T53B 1F2LA 3PO3B 1X3QA 3D4DA 2JYOA 4QUCA 1G2TA 3DEOA 1TWGB 2F0MA 2HCIA 3C3LA 2WV6D 1AN8A 1RKNA 5EKKA 1QE6A 2Z4HA 1PMRA 4ZK9B 2HQEA 3TZUA 1ENCA 4LK1C 1PTOB 1EY6A 5G3LD 1TS3A 4XQJA 1KDCA 2F0KA 3K5OA 2L55A 4IUNA 2LY7A 4DXFA 3NWTA 4OIJA 3AU7A 5DEHA 1PZKD 4B9WA 2M9VA 2QKIC 1VDZA 3V2TA 4DAVA 4RKLA 1Y8OB 1DZ1A 5DM63 5E1FA 3FPUB 3E6ZX 2Z8LA 4ULLA 1V1PA 4F7XA 1WVLA 4X3UA 1KLUD 2IJ0A 1V43A 2RKSA 3S1QB 3NBIA 3TZDA 1CA6A 5JOBA 1G8ZD 5FKAC 3SK4A 2ZT9C 2AQ1B 2XNAC 4CJ1B 2F0QA 5C4HA 3GV3A 1SNCA 2PZTA 1EZ8A 1UUPA 2JA6B 3HGBA 4A3FB 3A7LA 4FXKC 4R9WA 1A2UA 4ID6A 3QJYA 2ZXPA 4XTCS 1ESRA 1ML0D 4YIJA 2B2TC 1KLGD 5ELFA 4XIGS 1FD7D 5JVG3 4PMCA 3SDZA 1JCKB 1Q90A 2R93B 2NN6H 3J7YW 1S5CD 4H44C 5TSSA 2HCCA 3K59A 3QIAA 2IW3A 1JE4A 1JOKA 2NVXB 4BY1B 2E2JB 1ET9A 2BOSA 2QDBA 2HUGA 1EIHA 5FK9C 4O42A 5KNBA 2QEJC 2R61A 5JAVA 1PFNA 4ME5A 2MJ8A 2RBMA 2ID0A 3BYYB 2HDMA 4P2CB 1E0BA 2DY8A 3G6JB 2PZWA 4IALA 3TBIB 4C1NK 2VUMB 4PNYA 1Q3LA 3LX0A 4DA2A 2WAQB 2SNMA 1RTNA 3RD4A 1RJTA 5IIFA 3DWPA 3NTHA 3HEJA 2EYHA 2H4OA 2NB0A 5ISRA 1WD0A 1EYAA 2BDOA 1AW7A 4RAUC 3K5NA 3K6OA 4ZUJA 5E4XA 1Y1VB 3BZDB 3BVMA 1QG7A 1TKWB 1TU2B 4FNFA 1HTLD 2KVMA 1ET6A 4IQZA 4MN3A 3K5LA 3D6WA 4HMIA 2EYOA 2AWOA 1RDPD 1Y1WB 2NVYB 3P75A 3DMUA 2F0UA 3VA7A 3S14B 1D1IA 1OXVA 1TWFB 2Z4IA 2JA8B 4B08A 4Q0FA 1TY2A 2CW0C 4CJ2C 1LT4D 2KCNA 4XDXA 2M00A 4KKSA 4I7ZC 4WFN3 2Q8RE 4CKBA 1BOSA 2MUYA 3MTSA 5FLXE 5LHY1 1SNPA 2EYFA 3OSOA 1MGSA 3VYRA 4FF1A 2K33A 5G3LF 3V05A 3QO2A 4X3SA 1C48A 1NUCA 2VNUD 5IODA 2LS01 1EEFD 2L12A 4G7HC 4BY7B 2WACA 1S5FD 2TSSA 1G6ZA 1EWCA 5C3WA 3Q22A 1J8IA 2C5CA 2NN6I 2PO4A 2JSOA 2SOBA 3P7JA 5BN5A 3PIO3 3ND9A 1A3VA 2F0FA 1ILQA 3D31A 5KNCA 2CW0D 1A6XA 4QF4A 5I6YA 4A3IB 1CQFA 2RDFA 2A73B 3TSSA 2PMZB 1JICA 3EQLC 1CA5A 2A69C 1IKLA 2E2HB 4F88A 1DXMA 3S1RB 2XRQD 2ZXRA 4CHTB 1WD1A 4IUQA 2PQEA 4KJOA 1IYUA 2JEBI 5BN4A 1C8CA 3A8IE 2EYJA 2AQ2B 1LO5D 2LMCB 2CQAA 1D5XC 3I73A 2F0EA 4K5XA 4K14A 1ZKOA 4F8MA 1OXUA 5E4WC 4IUVA 2K28A 5CR3A 2QILA 3TP6A 4K6DA 4EQPA 3DEPA 2J7ZA 2EE1A 3T13A 1MSHA 1SYFA 2A69D 3SVMA 3RZOB 1TWHB 4G7ZC 2RA4A 3H0GB 1JR0D 3MEHA 1SDFA 1HTPA 2IX3A 3LWEA 4BA1I 1OXSC 3DXJC 2WKCA 2NYZD 1JWSD 1LV9A 3A8KE 4AYBB 1CK1A 1K83B 3IFDA 5IGCA 1PTOH 4G7OC 2MGSA 1YNJC 4RFBA 3EA6A 3RMHA 3H91A 1LTBD 4FO2A 4JBWA 1E2VA 2PPBC 2KA7A 2B2UC 1I4HA 5M3MB 3PUWA 1GUGA 1SMYC 1U4RA 1D5ZC 3D3RA 2KHSA 2JA5B 2WKDA 3HS0C 1O7LA 4L63B 1ENFA 3SK5A 3J7AV 3NBHA 1F9PA 3N6RA 2K03A 3PUZA 3GP7A 2KEDA 2SDFA 3VR2A 4ZRZA 4KMUC 5C5MA 3CHBD 2B2UA 2F0HA 4LAAA 3OIPA 4KY5A 3NP8A 1MD2D 2PNRC 3I8ZA 1SE3A 4A3GB 5J1ZA 5KRUA 4RHRA 2O5IC 1LT3D 2PCFB 3ITPA 1VF7A 1FNVA 5CV4A 2FMCA 1D1KA 1YNJD 4GZYC 1STYA 4FF3A 5KEEA 5CBAE 4IZ8A 2TMPA 1STAA 2B2VC 4FF4A 1SMYD 1HPCA 1FYCA 3T16A 3OIQA 1PRTC 3S2HB 1II3A 5EBCA 2B63B 2PZUA 2WINB 4C3HB 3BYTB 2F0WA 3MFYA 2D62A 1JB3A 1D6EC 1HA5A 1WTPA 5K36G 4DAPA 3KF8A 5BN3A 1S5ED 2EY1A 3AB9A 2B2VA 4HSVA 1UNSA 5C4XB 3G7LA 1SNQA 5JVH3 1SSOA 5A2QL 1STBA 3OPOA 2RDGA 2EY5A 4ABNA 1GHKA 1KNEA 3EFXD 1Q8IA 2HDLA 2O2LD 5KYIA 4MIUA 4KI0A 1Z47A 5IOCA 1EY0A 1E2ZA 4PQXA 1DCZA 3N52A 4RA8A 3ZYYX 4KN4C 1I6HB 4H13C 1DONA 1HCZA 1QB5D 1LTTD 3NHHA 3CQZB 4KV6A 1VMCA 3S1NB 2RDHA 4WORA 1JWUD 3J7AF 3H6MA 4HN7A 3R2TA 1SE4A 4KN7C 5EBDA 4XQNA 4KKUA 1QNUA 5I2XA 3BVGA 3CRLC 1FNWA 5LL6X 4DK1A 2EJGC 2F0DA 3K58A 3GTLB 1SNOA 2KCCA 4C3JB 1H9KA 2EPBA 3A7AB 1H9RA 2EJFC 3BG3A 2J0TD 3H09A 4NW2A 4XT1B 1PRTB 4QCLA 4C3HG 2B2YC 2VB3X 3Q24A 4C1NI 1SNMA 2F0NA 5C3EB 3GV6A 3PV0A 5D3IB 1TIID 3IL8A 1NCVA 5CGKA 2BDNA 5I9PA 1BF4A 4A93B 1HQRD 2F0OA 1VCIA 4ZKCB 5NUCA 1H9MA 3GTGB 2B2TA 1PLFA 3SK6A 2VB2X 1XTCD 3I3CA 4N9TA 4ODGA 1EU3A 4RH6A 1T5XD 2F0JA 3R3OA 4L6TB 4FVMA 1TS2A 1EY8A 2QCPX 1TWCB 1TWAB 2EYPA 1B3AA 4KHZA 1EQTA 2E74C 4O1NA 5CYUA 3LNNA 4RGNA 1CI3M 4WJWA 1L0YB 3GTOB 2AUKA 3J81L 3SK8A 5JJZA 1TS5A 1ICWA 1TR5A 1KDAA 4R8NA 2NVQB 3KBGA 3ERQA 2XWBB 1CFMA 1GUSA 3PUYA 4FXGC 2BA1A 1R4QB 2G9DA 2I46A 4J1MA 1U4LA 4OGQC 4V190 1JWMD 3FMCA 5EGTA 1PTOF 2VXWA 4C3JG 2Y0SB 2K1BA 3E5SA 1QILA 1EL0A 2DNCA 1STNA 2ZXOA 4NP5A 1LTAD 3X3NA 3CKIB 4TQUS 4TSSA 4QUFA 2XN9C 3KLRA 5DAUA 3FVQA 4C3IB 1JOQA 3TDQA 1KDBA 3P20A 1VMPA 2IX0A 3H94A 1ONLA 1J9OA 4FXDA 2L1BA 1CZGA 3IFTA 3A8JE 1NR4A 3A56A 4EGVA 5ELBA 4KK7A 2F0VA 1GUWA 3A55A 1E2WA 3TP7A 3MZ5A 2N55A 5K36H 1JQYD 1AZQA 1OXTA 4MHEA 4RHSA 3ND8A 3BDLA 3IAYA 5DM73 2NZ1D 4DAYA 1LTID 5FO8B 3A54A 1I4RA 4HSPA 4K8IA 3K57A 1DOLA 4IUPA 3NQIA 1SAPA 3M85A 5T1IA 3TN2A 3K5MA 3NK9A 4OO1G 1DM0B 2NBFA 2V4DA 3NXWA 1G2SA 1L0XB 1XX8A 2LKVA 4KJNA 1A3TA 2EOTA 4ZKBB 2QF7A 3EROA 1OO9B 1XXGA 4B9XA 1FNUA 4EQNA 1QWYA 5D65A 3S9WA 3OW7A 2RQXA 1K8MA 2X69A 4K5VA 2D5DA 1PDQA 2FJ2A 5EJWA 1B44D 3I4NB 3SR1A 5EPLA 4CBVA 5CV6A 2O4XA 4HEDA 5CC4A 1BR9A 4DF7A 2EY2A 4C3IG 4F87A 2Q8IB 1CT1D 4QB4A 4DFAA 3I91A 3I4LA 1EY4A 3OOCA 2PW7A 1PZJD 1KTKA 2A6EC 5JEAG 3MXGA 2NTSA 4X3TA 1G291 4A3MB 2GA4B 5C5LA 3TP5A 3KUPA 1SJED 1HFGA 5J22A 3J80E 4FF2A 5HURA 3VYUA 1F9QA 1B53A 3FRPB 3JAME 3TMEA 1BQQT 1B9NA 4ZLTF 2C9OA 2R7ZB 1RD9D 2F3VA 5A2QE 1IW7C 2B8GA 1BCPB 1Y8PB 4XYOA 3PMFA 3VYSA 4E6IA 2L0CA 2EJMA 3M3YB 3D4WA 2KOLA 4XYQA 4PMWA 3GQBA 1XWEA 1PYWD 2X6LA 4HCEA 2E76C 1X32A 1D5MC 5DNFA 1SBBB 1EWHA 5I9OA 2A6ED 1Z6HA 5C4JB 3AMUA 3K0YA 3SHLA 3U9OA 2KJXA 1R4PB 1I4XA 1TT2A 3R2IA 1HA6A 1Y69U 2OT2A 1RHPA 3R93A 2IPKD 2WIIB 2F0GA 2AUJD 4A3DB 1IW7D 1EY7A 4H0LC 4HMJA 3DUZA 3S1MB 1MI2A 5FO7B 3NSWA 3L7ZC 1HUNA 2DY7A 1FGBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G3L F;  1TII D;  4FNF A;  1QCB D;  5G3L D;  4FP5 D;  1QB5 D;  4FO2 A; 
#chains in the Genus database with same CATH topology
 3F1Z A;  4K5W A;  5C44 B;  2OXP A;  4M1U B;  3URY A;  1PV4 A;  4JV5 L;  3MWY W;  3WOF A;  4DR6 Q;  2WB1 E;  4JI4 L;  4LF4 L;  3CRK C;  3AFQ A;  5IWA L;  1HXY D;  2R3Z A;  3UI2 A;  1YJN A;  3EBE A;  3G4S A;  1SEB D;  3K7U C;  3QWN A;  1KIX A;  1CM9 A;  4UY8 C;  1U4P A;  4JV5 Q;  3FEW X;  3ER0 A;  3PUX A;  1K28 A;  3KF6 B;  3M7G A;  4KY6 A;  5IGD A;  4A3M G;  3BVZ A;  5C0X G;  4HTH A;  2I5H A;  4JI4 Q;  5IWA Q;  4LF4 Q;  1AFP A;  2BE5 C;  3W5O A;  2JJQ A;  2K5D A;  1E1O A;  3D6C A;  1XYI A;  2F0S A;  1KNA A;  2DNE A;  2F1M A;  3I7F A;  2P5Z X;  5D14 A;  4POF A;  1AE2 A;  4A93 H;  2R7Z G;  4Y7N B;  3E0J A;  1EIG A;  3DLL A;  4IUR A;  4X6A H;  1Q1E A;  1EOV A;  4OWW B;  3IKJ A;  4DK6 C;  4A3J G;  3FPP A;  3S17 B;  1HHV A;  5BR8 L;  3J7Z C;  3NUC A;  3J80 L;  3GTG H;  3D4R A;  3JAM L;  2I07 B;  3K81 C;  2X6G A;  4UPA A;  4DK0 A;  1PA6 A;  2Q8T A;  1Z7T A;  3NE5 B;  4PMB A;  3KFU A;  4EX5 A;  1K3B C;  4UDU C;  4B3S L;  3HKZ B;  2EYL A;  3MFG A;  1UEA B;  1D7Q A;  1EIY B;  2K5H A;  1TWC H;  4S3S A;  1TWA H;  5EPK A;  5I2Y A;  1B8A A;  5IGF A;  2UXD L;  1H9J A;  3GTJ B;  1S5B D;  4DV4 L;  1LT5 D;  4OO1 H;  1JT8 A;  2G9H D;  1W6K A;  1SE2 A;  1VF5 C;  1IKM A;  4B3S Q;  1ILP A;  3RR5 A;  1YZ6 A;  1GD7 A;  2Z1C A;  2CKZ B;  3GTO H;  2UXD Q;  5IT9 E;  4CKC A;  2KBN A;  3J81 E;  3EVQ A;  4DV4 Q;  2BE5 D;  1V8Q A;  1STH A;  5FOB B;  4FYD A;  2NVQ H;  1MSG A;  1VQF A;  3BDO A;  5M9O A;  5JPM C;  3TRZ A;  4A3E B;  3OHX C;  1PRT D;  2E75 C;  2NVT B;  1EOT A;  4HJ8 A;  5I4D A;  3CD6 A;  2EY6 A;  1B50 A;  1GXD C;  1O7Z A;  2XWJ B;  4A3D G;  2PI2 A;  3CCJ A;  2HD3 A;  4IOC A;  1CKM A;  2MO1 A;  1N9W A;  1E7Z A;  2L11 A;  1EEI D;  1STG A;  1PYS B;  3EJI A;  1WJJ A;  2JK8 A;  3Q23 A;  4I7A A;  4DNT B;  4JI5 L;  1SYG A;  3Q6S A;  3T51 B;  1XMQ L;  5C44 G;  1BO0 A;  3SEB A;  2NUC A;  2WP8 J;  1ZXT A;  4C2M H;  2CHB D;  2IT1 A;  4ZYS A;  1EZ6 A;  1PXU A;  1QZH A;  5A35 A;  2OQK A;  2D0P A;  1CQV A;  2K5N A;  5IP7 G;  1XMQ Q;  1GM5 A;  3DM1 A;  3I4M B;  4C3I H;  1WTX A;  1E1T A;  1O7Y A;  5IE8 A;  1KHI A;  5ELD A;  4KTA A;  2F0I A;  1EYC A;  5FO9 B;  3T1H L;  1I50 B;  3S15 B;  4TRD A;  4IFD G;  3S16 H;  1OTC A;  2KUM A;  3CCV A;  1SYC A;  1D8L A;  2K7V A;  4DR2 L;  1PFM A;  1EQV A;  5D3D A;  2DGY A;  3PUV A;  4DN4 M;  2H1E A;  4L5Q A;  1BDO A;  3NEL A;  3T1H Q;  3HOU B;  5JEA H;  5I6W A;  1YVC A;  1PHJ A;  2N49 A;  3GTM B;  4DR2 Q;  1YNN C;  3H3V H;  2FFK B;  1DOK A;  1JMC A;  1UEB A;  3ICE A;  3I72 A;  1A63 A;  1VQP A;  3UE0 A;  1BBX C;  1HQM C;  1BXT A;  4FP5 D;  1WTQ A;  1KAA A;  1SFO B;  4KHP L;  4ZAI A;  2D0O A;  3BDC A;  3SE0 A;  2K32 A;  4X65 L;  4ZUI A;  1EY5 A;  1GKH A;  1AZP A;  1LT6 D;  3HG9 A;  1DYQ A;  4Q5V A;  5EKL A;  4C56 C;  2JEA I;  3HKZ G;  5C6A A;  3K7A B;  2JP1 A;  1UE7 A;  2UUA L;  2RVL A;  2B2Y A;  4KHP Q;  3H3V C;  4G57 A;  4X65 Q;  3C2P A;  2L9H A;  4KY7 A;  2F3W A;  1Y14 B;  1NTG A;  2Z9H A;  4YCV A;  4AH6 A;  2E8G A;  3GTP B;  1B1Z A;  2UUA Q;  1G91 A;  4U68 A;  4HCS A;  2WAQ E;  5F2D A;  2L15 A;  2K04 A;  2K4K A;  5M3F B;  4P71 A;  2ZTD A;  1WTO A;  2DJG C;  4RWS C;  1NAP A;  2M2L A;  1IYV A;  4YWK A;  1UAP A;  1HUM A;  2IY5 B;  2B39 A;  5K5P A;  4A3E G;  2GN5 A;  5EKI A;  1CHQ D;  1A15 A;  5CV7 A;  1GOZ A;  3NTK A;  1QJO A;  2QA4 A;  1PZI D;  5COY A;  1KAB A;  2Y0S E;  2L5T A;  4QJF A;  1BNZ A;  1TY0 A;  4I65 A;  1P16 A;  4DR4 L;  1DD2 A;  4WJ3 M;  1VQ7 A;  3KBX A;  1I3Q B;  1YNN D;  5IT9 L;  4R4O A;  4ME3 A;  4OO1 I;  4OL7 A;  2L4N A;  1JOO A;  4LF7 Q;  4Z9C B;  2YYZ A;  3VA5 A;  4LF8 L;  2N8N A;  4NPS A;  5FJ8 H;  4DR4 Q;  2B8F A;  2PW5 A;  1N32 L;  2Z6B A;  1T5E A;  4R4Q A;  3SXH A;  1V1P B;  2SNS A;  3MC0 B;  4DGZ A;  1Q1B A;  1E22 A;  1I4Q A;  2O5J C;  3NWS A;  2JQO A;  4YCU A;  3R8B A;  1ENA A;  3I4N H;  2J4X A;  4QMG A;  2HIX A;  1I4P A;  2RSN A;  3HOZ B;  4LF8 Q;  1N32 Q;  3UE1 A;  2RSO A;  3FKI H;  4LUO A;  3I4M G;  1F77 A;  3J80 i;  3GTK B;  1P8L A;  3JAM i;  3KLS A;  2CCZ A;  1X3P A;  1PFB A;  1I6V C;  1VQG A;  3CPF A;  3U58 A;  3C1F A;  5AFW A;  4TKO B;  4BWG B;  4C2M B;  2VY3 A;  3KLS X;  4OIK A;  4DNR B;  2DN8 A;  1GUN A;  4HJ7 A;  4CDF C;  1FL0 A;  3HOU G;  2A68 C;  3QOJ A;  1FR3 A;  3QG1 A;  4A3M H;  5C0X H;  1QUQ B;  3HOV B;  5C4Z A;  1K9M C;  4BXX G;  3OMG A;  4EQO A;  3OWF A;  1LAC A;  4DR3 L;  1KRS A;  3S16 B;  1LTS D;  1ZEQ X;  4V0B A;  4NDX A;  4ILW A;  4A4I A;  5T1G A;  2AWN A;  4IUU A;  2XSC A;  4KD4 A;  3HOW B;  2KQ3 A;  4G4K A;  4DR3 Q;  4LJZ C;  4BS9 A;  1R9T B;  1UE1 A;  3WDN A;  5ELC A;  2OF1 A;  1W6J A;  4A3J H;  3MXN A;  3OTO L;  1S4Z A;  3L3O C;  5CV8 A;  1B9M A;  4ZQ3 A;  5FLM G;  3VYT A;  2F03 A;  2OQ0 A;  3E3X A;  4DV5 L;  1Q81 C;  1BUV T;  1M4V A;  1MHW C;  2K5W A;  3KDF A;  3T4A C;  4J6H A;  3Q0A A;  1ROD A;  1PRT F;  1F9S A;  3H3V I;  1NMG A;  4IN3 A;  3OTO Q;  5EPJ A;  4HAE A;  1BBW A;  5M3F G;  2MHV A;  3D8G A;  2DJF C;  2EDG A;  5JEA J;  4U67 3;  4DV5 Q;  4K2L A;  1CTM A;  4EVO A;  5C3X A;  1BCP C;  4H02 A;  3FDT A;  5ELE A;  1A3U A;  3PF4 A;  1EYD A;  1U0L A;  3TP8 A;  4AQY Q;  2ENB A;  1ASY A;  1ZYR C;  5C4J H;  1YNX A;  3J80 c;  1B2T A;  1HFN A;  3JAM c;  1VQL A;  2A68 D;  4LMQ D;  1I4G A;  2BH8 A;  4M8A A;  3QOL A;  2EZV A;  4DV7 L;  1CUK A;  4PZ6 A;  1HRJ A;  1STE A;  4HIK A;  4CKE A;  1K8G A;  4P73 A;  4K0K L;  2IWH A;  4DV6 Q;  1QCB D;  4H7B A;  1EY9 A;  3MAQ A;  4DV7 Q;  3AYH B;  4OEM B;  2CH4 W;  1Q7Y C;  4A3D H;  4JPB W;  1IHZ A;  3W2D A;  2A74 C;  4K0K Q;  3HOZ G;  5KYL A;  1IBM L;  5IGB A;  3U50 C;  1F9R A;  2KEC A;  3S1M H;  4R4C A;  4XT3 B;  4KKT A;  4NMZ A;  4R8I A;  3C46 A;  3KK7 A;  3RLF A;  4DNI A;  1WTR A;  3S2D B;  1V1O A;  4LUZ A;  4JI1 L;  1SYD A;  1O78 A;  2PQA B;  5C44 H;  1IBM Q;  3CAM A;  5CV5 A;  1TS4 A;  4XQQ A;  3VR5 A;  1Y8N B;  2KEE A;  4BBR B;  2YU9 B;  3M4O B;  3E9I A;  1BCP D;  1EU4 A;  4JI1 Q;  2F0T A;  5IP7 H;  4DU9 A;  3X3M A;  3STB C;  4RGM A;  1LTR D;  3FKI B;  2XRS D;  4A3K B;  2A1A A;  1ZYR D;  4X64 L;  3HP3 A;  3L9A X;  5E3F A;  1HR0 W;  2CVR A;  3HOV G;  2AKW B;  3MXN B;  1LLR D;  1LAB A;  4IUT A;  4BBS B;  1IYJ B;  1GUT A;  4IFD H;  3DWQ A;  4K6L A;  5KGU A;  1O80 A;  4X64 Q;  1NMF A;  2EYM A;  4K8J A;  5IGG A;  4KD3 A;  1Y1W G;  2E2D C;  4A75 A;  4DXG A;  4MZ9 A;  3HOW G;  4Y7N H;  1K8O A;  5HGQ A;  4CDC C;  1QOH A;  2RCN A;  3HZX A;  3QB3 A;  4X62 L;  4AYB E;  1VQD A;  5IP9 G;  1A8V A;  3S17 H;  1NR2 A;  4YY3 Q;  3MHB A;  3PIP 3;  2NTT A;  2R92 B;  4RKB A;  2LXJ A;  2IX1 A;  1DJR D;  1C4Q A;  1RCV D;  5C0X I;  2NZO A;  1WCM B;  4NXN L;  4BA2 I;  4X62 Q;  5LMN L;  5GQO A;  1VQJ A;  4L8J A;  3C1E A;  3MVV A;  3W3A A;  1GHJ A;  5C0X J;  3M7N A;  4CDE C;  3P1H A;  3GTJ H;  1K0R A;  4NXN Q;  1NJI C;  4A3J B;  2F0L A;  3V96 A;  5LMN Q;  3GD7 A;  5KIX A;  4JK1 C;  1X9N A;  3STB D;  1MJE A;  4RGT A;  4A3B B;  2K6A A;  3ULP A;  3MA2 B;  3DWA A;  3ZJY C;  5ELN A;  2LXK A;  4CJ0 B;  5JPN C;  1JC7 A;  1ICF B;  2XVS A;  2A6H C;  3RUZ A;  4R1J A;  2NN6 G;  5JJL A;  2ICE C;  1OXX K;  4X66 L;  5FLX L;  5EQ0 A;  1SXT A;  4A3E H;  2EVB A;  4OHJ A;  1F2Y A;  1TWG H;  1JJC B;  4JW0 A;  2NVT H;  1CHP D;  4GKJ L;  2BCO A;  2DUD A;  1S5D D;  3OWE B;  4QIW B;  1X3E A;  3OMC A;  4RCN A;  4LF6 L;  2D9U A;  2EXZ A;  2MP1 A;  1PH8 A;  1U9R A;  2JE6 I;  3NQT A;  4RGO S;  1ASZ A;  3M4Y A;  3VR4 A;  1Z9F A;  5J39 A;  3L2P A;  1M90 C;  3J81 j;  1UE6 A;  1UE5 A;  4K2K A;  1BVS A;  1WTV A;  3U4Z A;  1B4O A;  2ICI A;  4QGU A;  4HJ5 A;  4LF6 Q;  3TS2 A;  4GKJ Q;  1HR0 L;  1GJX A;  2PYK A;  2B29 A;  4WRD A;  3O13 A;  1Q8K A;  1RF2 D;  3RZD B;  3SGI A;  1IL8 A;  2MFI A;  2NWG A;  3I90 A;  1GUO A;  3F2U A;  4EQ5 A;  3ONA B;  4JCV E;  3DHQ A;  2R6G A;  5M5W B;  4BBR G;  2K5Q A;  4XXE A;  2Q2H A;  4P74 A;  4NKL A;  4PZ8 A;  3I70 A;  3HRZ C;  3I4M H;  1ESF A;  5IT9 c;  5EAY A;  1A2T A;  1H9S A;  4N9P A;  1U4M A;  1NSN S;  1F2M A;  1PTO C;  3G48 A;  4A3K G;  1V1Q A;  3F8T A;  1LTG D;  4J8Q A;  1X3F A;  1KC8 C;  4DAM A;  1DGS A;  4BBS G;  1MBY A;  1I50 H;  3S15 H;  3GDE A;  4PV1 C;  1G6P A;  4JI3 L;  2A6H D;  3PGZ A;  3CC4 A;  2K05 A;  3NPP A;  3S1Q H;  1SYE A;  4LF9 L;  4X3K A;  1AP0 A;  1QNK A;  2FIN B;  3WOE A;  3F2D A;  2AQ3 B;  2B2W C;  3VR6 A;  5M5X B;  4RCO A;  3HOU H;  3W1B A;  4UAI A;  3EN2 A;  4JI3 Q;  3GTM H;  1SJH D;  5CMD A;  2FHT A;  1V9P A;  5COR A;  2FMM A;  2RCF A;  2F4I A;  4OWT B;  4BXX H;  2JA7 B;  5M5Y B;  4HIO A;  1SYB A;  1SMX A;  3F2B A;  2D2C C;  3NTI A;  1EFI D;  3T56 B;  3U9S A;  2R92 G;  5KND A;  1DOM A;  1SFO H;  1TQO A;  1Q12 A;  3KOJ A;  5CBE E;  3CU7 A;  1WCM G;  2N88 A;  2JXM B;  3LWU A;  3TQY A;  3H15 A;  3BS1 A;  3MXP A;  5HGT A;  2LFN A;  5LL6 S;  4IFD I;  1RTO A;  2B2W A;  1SND A;  3K7A H;  2E2I B;  1CZW A;  1F2Z A;  3M9B A;  3PO2 B;  5IGE A;  4HID A;  1M8A A;  2N3S A;  5FLM H;  3HOX B;  5GAD C;  4IFD J;  1HZA A;  4A3B G;  3GTP H;  4HR7 B;  4KHV A;  2XIW A;  1PTO D;  1PH2 A;  3I55 A;  2OEO A;  4DR7 L;  2K75 A;  5M3F H;  4CGY B;  1D2B A;  5BR8 Q;  2WB1 B;  2IL8 A;  1WTW A;  1N8R C;  3GTQ B;  2K01 A;  2F0P A;  1L0W A;  4LWC A;  5CV9 A;  1TVX A;  4DR7 Q;  1Q86 C;  2SEB D;  4GN5 A;  1AEX A;  2A5H A;  1JOR A;  2BA0 A;  4A3C G;  1I3Q H;  2UXB L;  3HOY B;  4LUV A;  3VR3 A;  1TXY A;  1K73 C;  1B70 B;  1H9S B;  2GVA A;  3GO5 A;  1WOC A;  2MPM A;  1BCP F;  3MXU A;  3T53 B;  1F2L A;  3PO3 B;  1X3Q A;  3D4D A;  2JYO A;  4QUC A;  1G2T A;  3DEO A;  1TWG B;  2F0M A;  2HCI A;  3C3L A;  2WV6 D;  2UXB Q;  3NBH B;  1AN8 A;  5IYB H;  4FDB A;  1RKN A;  5EKK A;  3PIO A;  1IBK L;  2XGT A;  1QE6 A;  2Z4H A;  3HOZ H;  1PMR A;  4ZK9 B;  2HQE A;  2RHQ B;  3TZU A;  1ENC A;  3GTK H;  4LK1 C;  1PTO B;  1IBK Q;  2ZTC A;  1EY6 A;  5G3L D;  2QW7 A;  4A76 A;  1TS3 A;  1PH6 A;  5GAG C;  4XQJ A;  1KDC A;  2F0K A;  2A19 A;  2VZA A;  3K5O A;  2CFM A;  2L55 A;  3BZK A;  4IUN A;  2LY7 A;  4DXF A;  1N33 L;  3NWT A;  4OIJ A;  3AU7 A;  5DEH A;  4JI5 Q;  1PZK D;  4B9W A;  2M9V A;  2QKI C;  4QQB X;  1WFQ A;  3JC6 6;  1VDZ A;  4KLK A;  3V2T A;  3HOV H;  4YCW A;  4DAV A;  4GNX B;  4RKL A;  1Y8O B;  2JA7 G;  2VW9 A;  5DM6 3;  5E1F A;  1DZ1 A;  1N33 Q;  1K3R A;  4DKA C;  3FPU B;  3E6Z X;  2Z8L A;  4ULL A;  1V1P A;  1YI2 A;  4F7X A;  1WVL A;  1KLU D;  4X3U A;  3CCU A;  2IJ0 A;  5LMU L;  1V43 A;  4JBJ A;  4JYA L;  4DR5 L;  2RKS A;  1Y1W H;  3S1Q B;  3NBI A;  2K14 A;  3FHW A;  3HOW H;  3TZD A;  1CA6 A;  5JOB A;  1G8Z D;  5FKA C;  3SK4 A;  2PI2 E;  2ZT9 C;  1R9T H;  1NE3 A;  2AQ1 B;  2HIV A;  2QDL A;  2XNA C;  4CJ1 B;  3PIP A;  5LMU Q;  2F0Q A;  5C4H A;  3PO2 G;  4DR5 Q;  3UDX A;  4JYA Q;  5IP9 H;  1HZ9 A;  3I4O A;  1KL9 A;  3GV3 A;  3HOX G;  4OWX B;  5GAE C;  1SNC A;  2PZT A;  2V1C C;  1EZ8 A;  1UUP A;  2JA6 B;  3HGB A;  4A3F B;  4GLX A;  3A7L A;  4FXK C;  4R9W A;  1A2U A;  4ID6 A;  3QJY A;  2ZXP A;  4XTC S;  4JI2 L;  2WB1 G;  3J7A 5;  1ESR A;  1S3O A;  4JBM A;  1ML0 D;  2K52 A;  1B7Y B;  1QUQ A;  4YIJ A;  2B2T C;  1KLG D;  5ELF A;  3I56 A;  4XIG S;  1FD7 D;  4JI8 L;  2KEN A;  5JVG 3;  4JI2 Q;  1S40 A;  3QR8 A;  1I5F A;  4PMC A;  3SDZ A;  1JCK B;  3HOY G;  1Q90 A;  4ALP A;  2R93 B;  2NN6 H;  3J7Y W;  1S5C D;  4H44 C;  4B3T L;  5TSS A;  2HCC A;  3K59 A;  1VQ6 A;  4JI8 Q;  1C0A A;  3QIA A;  2IW3 A;  1JE4 A;  1JOK A;  3PO3 G;  3UDG A;  2NVX B;  4BY1 B;  2K50 A;  2E2J B;  1ET9 A;  2BOS A;  3M4P A;  4DK3 C;  2QDB A;  2HUG A;  1EIH A;  5FK9 C;  4B3T Q;  2OTJ A;  2F4V L;  4NXM L;  2HQL A;  3PQI A;  4O42 A;  5KNB A;  3S2D H;  4PZ7 A;  4IPG A;  1XNQ L;  3ULJ A;  2VQE L;  1L1O C;  2QEJ C;  5FLX c;  4LNQ A;  2F4V Q;  4APV A;  2R61 A;  4NXM Q;  5JAV A;  1PFN A;  4ME5 A;  4OON A;  2MJ8 A;  3E9H A;  2RBM A;  2ID0 A;  2C35 B;  4BBR H;  3BYY B;  2YU9 H;  3M4O H;  2HDM A;  4P2C B;  1XNQ Q;  1E0B A;  2VQE Q;  2DY8 A;  3G6J B;  4LFC L;  2PZW A;  4IAL A;  2UXC L;  4A3K H;  3TBI B;  4C1N K;  1VQM A;  4PNY A;  4LF5 L;  2VUM B;  2GVB A;  1Q3L A;  2CH4 A;  3LX0 A;  4DA2 A;  4BBS H;  2WAQ B;  2SNM A;  1L1O A;  4J15 A;  1RTN A;  3RD4 A;  3CC7 A;  1RJT A;  4GLA C;  5IIF A;  3DWP A;  1CKN B;  3NTH A;  4LFC Q;  3BU2 A;  3HEJ A;  2UXC Q;  3AEV A;  2BH2 A;  2EYH A;  3G71 A;  4JI7 L;  2IHE A;  2H4O A;  4LF5 Q;  2NB0 A;  5ISR A;  4GKK L;  1WD0 A;  1EYA A;  2BDO A;  1AW7 A;  4RAU C;  3K5N A;  1VQ4 A;  3K6O A;  4ZUJ A;  4DUZ L;  3K80 C;  5E4X A;  1Y1V B;  4JI7 Q;  3BZD B;  2G5D A;  3BVM A;  1QG7 A;  1TKW B;  1TU2 B;  4FNF A;  1HTL D;  4QL5 A;  2PQA A;  4GKK Q;  2KVM A;  3PCO B;  2R92 H;  1ET6 A;  4IQZ A;  4MN3 A;  3K5L A;  2I5M X;  3D6W A;  4HMI A;  4P75 A;  2EYO A;  1XNR L;  2JA6 G;  2AWO A;  4O2D A;  1WCM H;  5AJ3 L;  4DUZ Q;  1RDP D;  4A3F G;  1Y1W B;  2NVY B;  3DM3 A;  1KD1 C;  1HZB A;  3P75 A;  1E24 A;  1M1K C;  3DMU A;  2F0U A;  3MEF A;  2CWP A;  3VA7 A;  1XNR Q;  3S14 B;  1D1I A;  1OXV A;  1TWF B;  2Z4I A;  2JA8 B;  4B08 A;  4Q0F A;  5AJ3 Q;  1I94 L;  3AFP A;  4L5R C;  5C3E G;  1TY2 A;  2CW0 C;  4A3B H;  4CJ2 C;  1LT4 D;  2K5V A;  2KCN A;  4MTK A;  4XDX A;  2M00 A;  4KKS A;  4I7Z C;  4WFN 3;  1BKB A;  2R93 G;  1I94 Q;  2Q8R E;  1PH5 A;  4CKB A;  1BOS A;  2MUY A;  5GRO A;  3MTS A;  5FLX E;  5LHY 1;  1SNP A;  1RL2 A;  2EYF A;  4BY1 G;  3RLN A;  1X65 A;  3OSO A;  2LSS A;  4P72 A;  1XPU A;  1MGS A;  3VYR A;  4FF1 A;  2K33 A;  5G3L F;  4A3C H;  3V05 A;  3QO2 A;  4X3S A;  1C48 A;  1NUC A;  2VNU D;  2HT1 A;  5IOD A;  2LS0 1;  1EEF D;  2L12 A;  4POG A;  4G7H C;  4BY7 B;  2WAC A;  1S5F D;  1QVG A;  2TSS A;  3A74 A;  1G6Z A;  1EWC A;  1L1O B;  5C3W A;  3RZD H;  2CWA A;  3Q22 A;  1J8I A;  1HNZ L;  2C5C A;  2NN6 I;  5IYB G;  2PO4 A;  5M5W H;  4PG3 A;  2IHF A;  4MNO A;  1MIU A;  2JSO A;  2SOB A;  3P7J A;  3S24 A;  3D0F A;  2ZJP A;  5BN5 A;  3PIO 3;  4GN3 B;  3ND9 A;  1A3V A;  2F0F A;  1ILQ A;  3D31 A;  5KNC A;  1HNZ Q;  4IPH A;  2VUM G;  2CW0 D;  1A6X A;  4QF4 A;  5I6Y A;  4A3I B;  1CQF A;  2RDF A;  1T9H A;  2WAQ G;  2A73 B;  5ELO A;  2PMZ B;  3TSS A;  1JIC A;  3EQL C;  1CA5 A;  2EIF A;  3CPW A;  2A69 C;  1H95 A;  1IKL A;  2E2H B;  1FVI A;  4F88 A;  1RIP A;  1DXM A;  1X56 A;  5M5X H;  3S1R B;  2XRQ D;  2ZXR A;  4CHT B;  4IPC A;  1WD1 A;  4YWL A;  1Y1V G;  4IUQ A;  2JA7 H;  2NZH A;  2PQE A;  5M5Y H;  3ERS X;  4KJO A;  1IYU A;  2JEB I;  5BN4 A;  1YIT A;  1C8C A;  3CP0 A;  1X55 A;  3A8I E;  1NBW A;  1BBU A;  4Y52 H;  2EYJ A;  2AQ2 B;  1LO5 D;  2LMC B;  2CQA A;  5DLQ E;  4GOP B;  1D5X C;  3I73 A;  4DR1 L;  2F0E A;  4K5X A;  2E2I H;  4K14 A;  1ZKO A;  4F8M A;  1PVO A;  2JA8 G;  3PO2 H;  1PH7 A;  5IYD G;  1OXU A;  5E4W C;  3HOX H;  4IUV A;  2K28 A;  3E0E A;  5CR3 A;  1PH9 A;  1VQH A;  2QIL A;  3TP6 A;  4DR1 Q;  3KJP A;  4K6D A;  2ZTE A;  3CF5 A;  4EQP A;  3DEP A;  2J7Z A;  3BZC A;  4QIW E;  2EE1 A;  3T13 A;  1MSH A;  3BJU A;  1SYF A;  3GTQ H;  2A69 D;  3SVM A;  3RZO B;  2I0Q A;  4MTN A;  1PH3 A;  1XPO A;  1TWH B;  4G7Z C;  2RA4 A;  3H0G B;  1JR0 D;  3MEH A;  3HOY H;  1SDF A;  4NB3 A;  4DV2 L;  1HTP A;  5JJK A;  4BY7 G;  4UP8 A;  4JG2 A;  2VQF L;  2IX3 A;  2UU9 L;  4GLV B;  3A0J A;  3PO3 H;  3LWE A;  4BA1 I;  1OXS C;  3G6E A;  3DXJ C;  2WKC A;  2NYZ D;  2H5X A;  2VQF Q;  2UU9 Q;  1JWS D;  1LV9 A;  4IJL A;  2RF4 A;  4X66 Q;  3A8K E;  4AYB B;  1CK1 A;  3IRB A;  2Q2I A;  1K83 B;  2KCT A;  3IFD A;  4LFB L;  1MKH A;  1KRT A;  1A0I A;  5IGC A;  1PTO H;  4G7O C;  3LGJ A;  4A3I G;  4DPG A;  5L37 A;  2MGS A;  2PNH A;  1YNJ C;  4RFB A;  3EA6 A;  3RMH A;  4LFB Q;  3H91 A;  1LTB D;  4FO2 A;  4JBW A;  1E2V A;  4LFA L;  1HR0 Q;  2PPB C;  2KA7 A;  2MO0 A;  2B2U C;  1I4H A;  5M3M B;  3PUW A;  1GUG A;  1SMY C;  1U4R A;  1D5Z C;  3D3R A;  2KHS A;  1QZG A;  2JA5 B;  2WKD A;  3WWV A;  3CCL A;  3I2Z A;  1YIJ A;  3HS0 C;  1O7L A;  4LFA Q;  4L63 B;  1ENF A;  1GO3 E;  3SK5 A;  3CCQ A;  3J7A V;  3NBH A;  1F9P A;  3N6R A;  5J3B A;  2K03 A;  1LUZ A;  3PUZ A;  3GP7 A;  2ZJR A;  2KED A;  4HJA A;  1JE5 A;  3KYH C;  2SDF A;  2XTI A;  4ZRZ A;  3VR2 A;  4KMU C;  5C5M A;  3CHB D;  2B2U A;  2YTY A;  2F0H A;  4LAA A;  4GNX C;  3TS0 A;  3OIP A;  4KY5 A;  3NP8 A;  1MD2 D;  2PNR C;  4LF9 Q;  3RN2 A;  3I8Z A;  1SE3 A;  4A3G B;  5J1Z A;  5KRU A;  4RHR A;  3HKZ E;  2JA6 H;  2O5I C;  4A3F H;  1LT3 D;  1VQC A;  1SRO A;  2PCF B;  3ITP A;  3HKS A;  1VF7 A;  1FNV A;  5CV4 A;  2FMC A;  1D1K A;  1YNJ D;  4GZY C;  1STY A;  4FF3 A;  1IL2 A;  1AH9 A;  5KEE A;  4GNX A;  5CBA E;  5C3E H;  1VQ9 A;  4IZ8 A;  2TMP A;  1STA A;  4JBK A;  2B2V C;  4FF4 A;  1SMY D;  1VQE A;  1HPC A;  1FYC A;  3T16 A;  3PSI A;  3H0G G;  3OIQ A;  4DV0 L;  1PRT C;  1L2F A;  3OW2 A;  4B3R L;  1II3 A;  5EBC A;  3S2H B;  2R93 H;  1S72 A;  2B63 B;  2PZU A;  2WIN B;  4C3H B;  3BYT B;  2F0W A;  2F3I A;  3MFY A;  2D62 A;  1XTD A;  4UP7 A;  1JB3 A;  1D6E C;  1HA5 A;  3CCS A;  2B3G A;  2NVX H;  4DV0 Q;  4BY1 H;  2E2J H;  1VQ8 A;  1WTP A;  5K36 G;  4DAP A;  3A5Z B;  3KF8 A;  4B3R Q;  1YHQ A;  3RLO A;  5BN3 A;  1VQI A;  1E3P A;  1S5E D;  1X54 A;  2EY1 A;  2B2V A;  2CQO A;  1UNS A;  3AB9 A;  4HSV A;  5C4X B;  3G7L A;  1SNQ A;  2Q2T A;  5JJI A;  4AYB G;  5JVH 3;  1SSO A;  4DV3 L;  5A2Q L;  1CSP A;  1STB A;  3OPO A;  2VS1 A;  1IZ6 A;  2RDG A;  2EY5 A;  4ABN A;  1GHK A;  2HHH L;  3RNU A;  1KNE A;  3EFX D;  3CW2 C;  1Q8I A;  2EXD A;  2HDL A;  2O2L D;  5KYI A;  4MIU A;  4DV3 Q;  3L0O A;  4B3M L;  4KI0 A;  1Z47 A;  2R7D A;  5IOC A;  1EY0 A;  1E2Z A;  3UDI A;  4PQX A;  1DCZ A;  4QY7 A;  2HHH Q;  5M3M G;  2VUM H;  3N52 A;  4RA8 A;  1YJW A;  2JA5 G;  3ZYY X;  4KN4 C;  1VQN A;  3KLW A;  4GN4 B;  4B3M Q;  1I6H B;  4OEL B;  4H13 C;  3T1Y L;  4RG1 A;  1DON A;  1HCZ A;  1QB5 D;  2YTV A;  1LTT D;  3NHH A;  3CCR A;  3K0X A;  1W3S A;  3CC2 A;  1FGU A;  3CQZ B;  1HNW L;  4JOI C;  4KV6 A;  1Q82 C;  1VMC A;  3T1Y Q;  3S1N B;  2RDH A;  4WOR A;  1JWU D;  3J7A F;  3H6M A;  4HN7 A;  1Y1V H;  3R2T A;  1K8A C;  1SE4 A;  4KN7 C;  4JI0 L;  1HNW Q;  5EBD A;  2A8V A;  4XQN A;  1XPR A;  4KKU A;  4A3G G;  1QNU A;  4IPD A;  5I2X A;  3BVG A;  3CRL C;  1FNW A;  5LL6 X;  4JOI A;  4JI0 Q;  2NVY H;  4DK1 A;  3PF5 A;  3HFZ B;  2EJG C;  2F0D A;  3K58 A;  3GTL B;  4R4I A;  1SNO A;  2KCC A;  4C3J B;  1H9K A;  3S14 H;  2OWO A;  1TWF H;  2JA8 H;  1LYL A;  5IYD H;  1HNX L;  2EPB A;  3KF8 B;  4DV1 L;  3A7A B;  1H9R A;  1JB7 A;  2ATW A;  3KJO A;  3CCM A;  4JVZ A;  1CKN A;  2VL6 A;  2EJF C;  3BG3 A;  4A3L G;  2J0T D;  3H09 A;  4NW2 A;  4XT1 B;  1PRT B;  4QCL A;  2JN4 A;  1KAW A;  1HNX Q;  2B63 G;  4DV1 Q;  4C3H G;  3CMA A;  2R7F A;  2B2Y C;  1Q46 A;  2VB3 X;  3Q24 A;  4C1N I;  5HY6 A;  1CSQ A;  1SNM A;  2MQH A;  2F0N A;  5C3E B;  1A62 A;  1LTL A;  3GV6 A;  4YHH L;  1JJG A;  2QEX A;  5C4X G;  3PV0 A;  5D3I B;  1QVF A;  1EIF A;  1TII D;  1NCV A;  3EIV A;  3IL8 A;  5CGK A;  2BDN A;  4UHV A;  4JC0 A;  5I9P A;  1BF4 A;  4N8X 1;  4BY7 H;  4A93 B;  1HQR D;  4YHH Q;  2F0O A;  1VCI A;  4AIM A;  4ZKC B;  5NUC A;  1H9M A;  3GTG B;  1QVC A;  2B2T A;  1PLF A;  3SK6 A;  2VB2 X;  1XTC D;  3I3C A;  4N9T A;  4N8F A;  4ODG A;  5GAH C;  1EU3 A;  1YJ9 A;  4RH6 A;  1T5X D;  2F0J A;  2AHO B;  3R3O A;  4L6T B;  4FVM A;  4OX9 L;  1TS2 A;  4A3I H;  1EY8 A;  2QCP X;  2UUC L;  1TWC B;  4RMF A;  1TWA B;  2EYP A;  2OTL A;  3ULL A;  1B3A A;  4KHZ A;  4LF7 L;  1EQT A;  2E74 C;  4O1N A;  5CYU A;  2E2H H;  2KHJ A;  3LNN A;  4OX9 Q;  4RGN A;  1CI3 M;  2UUC Q;  4WJW A;  1L0Y B;  3S1R H;  3GTO B;  2ZJQ A;  2AUK A;  3J81 L;  2WFW A;  3SK8 A;  5JJZ A;  1TS5 A;  1ICW A;  1TR5 A;  1KDA A;  4R8N A;  2NVQ B;  3KBG A;  4L5S A;  3ERQ A;  3B6Y A;  2XWB B;  1CFM A;  1GUS A;  2OCE A;  3PUY A;  2Z0S A;  5IYC G;  2KCM A;  3F2C A;  4FXG C;  3TEH B;  2BA1 A;  1R4Q B;  1HZC A;  2G9D A;  2I46 A;  4J1M A;  1U4L A;  4OGQ C;  1WTH A;  1NNX A;  4V19 0;  1C9O A;  3A5U A;  3M4Q A;  1JWM D;  3FMC A;  5EGT A;  1PTO F;  2VXW A;  4C3J G;  2Y0S B;  2K1B A;  3E5S A;  4OXP A;  1QIL A;  1EL0 A;  2DNC A;  5H1S E;  3CXC A;  2QGQ A;  2ES2 A;  1STN A;  2ZXO A;  4NP5 A;  1LTA D;  3NEN A;  3X3N A;  1YEZ A;  3CKI B;  4TQU S;  4TSS A;  4QUF A;  1K0S A;  2XN9 C;  3CCE A;  4GOP C;  1KXL A;  3KLR A;  1VQK A;  1EFW A;  5DAU A;  3FVQ A;  4C3I B;  1GVP A;  1JOQ A;  3TDQ A;  1XMO L;  1IXR A;  3RZO H;  1KDB A;  3P20 A;  4IO9 A;  1VMP A;  2IX0 A;  3H94 A;  4CDD C;  4GS3 A;  1ONL A;  1TWH H;  1KQS A;  4DUY L;  1J9O A;  4FXD A;  2L1B A;  3H0G H;  1CZG A;  1XMO Q;  3IFT A;  3A8J E;  1NR4 A;  3A56 A;  4EGV A;  2UUB L;  2R7Z H;  2YTX A;  4A93 G;  4GOP A;  4IJH A;  5ELB A;  4DUY Q;  1AE3 A;  4KK7 A;  2F0V A;  1X3G A;  1GUW A;  3A55 A;  1E2W A;  3TP7 A;  1PH1 A;  3MZ5 A;  2N55 A;  5K36 H;  1JQY D;  1AZQ A;  2ASB A;  1OXT A;  1JJ2 A;  4MHE A;  4RHS A;  2UUB Q;  3ND8 A;  1SR3 A;  3BDL A;  3IAY A;  5DM7 3;  3M3Y H;  2NZ1 D;  4DAY A;  2N78 A;  1X6O A;  1LTI D;  2PMZ E;  5FO8 B;  2ALY B;  4AQY L;  1K83 H;  3A54 A;  1I4R A;  1VS0 A;  4HSP A;  4K8I A;  3K57 A;  1DOL A;  1WI5 A;  5IY0 A;  4IUP A;  3NQI A;  4R4T A;  1SAP A;  1FJG L;  1HH2 P;  3M85 A;  5T1I A;  3TN2 A;  1CKO A;  3K5M A;  1EUJ A;  1MJC A;  3NK9 A;  1SE8 A;  1VQ5 A;  4OO1 G;  2I5L X;  4DV6 L;  1DM0 B;  2NBF A;  2V4D A;  3NXW A;  1XJV A;  2MNA A;  1G2S A;  1FJG Q;  5LMN W;  1VQA A;  1L0X B;  1XX8 A;  1YHA A;  5M3M H;  2LKV A;  1EQQ A;  2E5L L;  4KJN A;  2JA5 H;  1A3T A;  4UP9 A;  1IBL L;  2EOT A;  4ZKB B;  2KHI A;  4HJ9 A;  1SRU A;  2QF7 A;  2FXQ A;  3ERO A;  2E5L Q;  1OO9 B;  1SN8 A;  1IBL Q;  1XXG A;  4B9X A;  1PH4 A;  1W2B A;  1FNU A;  4EQN A;  1QWY A;  5D65 A;  3S9W A;  5E7N A;  2Y0S G;  3OW7 A;  3RN5 A;  2RQX A;  1U5K A;  2Z6K C;  1K8M A;  2X69 A;  1EYG A;  4A3G H;  4K5V A;  2D5D A;  1PDQ A;  3NEM A;  2FJ2 A;  5EJW A;  1B44 D;  3I4N B;  3K8A A;  3SR1 A;  5EPL A;  4CBV A;  2Q2U A;  5CV6 A;  2O4X A;  4HED A;  1BR9 A;  5CC4 A;  2EQS A;  1YHB A;  4DF7 A;  2EY2 A;  4C3I G;  4F87 A;  2Q8I B;  1CT1 D;  4QB4 A;  1PFS A;  4DFA A;  2Z6K A;  1J6Q A;  2RHS B;  1EWI A;  4JI6 L;  3KDF B;  3OYY A;  3Q8D A;  3I91 A;  3I4L A;  1EY4 A;  4DAY B;  2ZM6 L;  3OOC A;  4A3L H;  2PW7 A;  4YY3 L;  3S2H H;  1PZJ D;  1G51 A;  1KTK A;  1J5E L;  1B3Q A;  2B63 H;  4C3H H;  2A6E C;  2F52 A;  4YWM A;  4JI6 Q;  5JEA G;  3MXG A;  2NTS A;  4X3T A;  1G29 1;  4A3M B;  1N34 L;  4O0A A;  2ZM6 Q;  2GA4 B;  5C5L A;  3TP5 A;  3KUP A;  1J5E Q;  1O7I A;  1SJE D;  1HFG A;  5J22 A;  3J80 E;  3J81 i;  4FF2 A;  5HUR A;  5C4X H;  3VYU A;  1F9Q A;  1B53 A;  1SLJ A;  3FRP B;  4ZCK A;  3JAM E;  3TME A;  3CME A;  1BQQ T;  1WYD A;  1N34 Q;  1B9N A;  3W1G A;  1UWV A;  4ZLT F;  2C9O A;  2R7Z B;  1RD9 D;  2F3V A;  5A2Q E;  4TVA B;  1IW7 C;  2B8G A;  2JA9 A;  1BCP B;  3KF6 A;  1EQR A;  1PYB A;  1Y8P B;  4XYO A;  1VQB A;  3PMF A;  3VYS A;  4DV2 Q;  1YBY A;  1VQO A;  4E6I A;  3VDY A;  3TRE A;  2L0C A;  2EJM A;  3M3Y B;  2YV5 A;  3D4W A;  2KOL A;  1HJP A;  4IOA A;  4XYQ A;  4PMW A;  4LW1 A;  3GQB A;  1XWE A;  1PYW D;  2X6L A;  4HCE A;  1I6H H;  2E76 C;  1X32 A;  1D5M C;  4L5T A;  5DNF A;  1SBB B;  1EWH A;  5I9O A;  2A6E D;  1Z6H A;  3CQZ H;  5C4J B;  3AMU A;  3K0Y A;  3U4V A;  3SHL A;  3U9O A;  2KJX A;  1R4P B;  4WJ4 A;  1I4X A;  3UDF A;  3S1N H;  1TT2 A;  3R2I A;  4HIM A;  1HA6 A;  1C7Y A;  1Y69 U;  2OT2 A;  3AQQ A;  1N36 L;  3FP9 A;  1RHP A;  3R93 A;  5FJ8 G;  2IPK D;  2WII B;  5IYC H;  2F0G A;  2AMC B;  2AUJ D;  1LM0 A;  4A3D B;  3I4N G;  1NY4 A;  1IW7 D;  1EY7 A;  4H0L C;  1N36 Q;  4HMJ A;  3DUZ A;  3S1M B;  1MI2 A;  3J81 c;  4DR6 L;  3GTL H;  3FKI G;  4C3J H;  5FO7 B;  3NSW A;  3L7Z C;  1HUN A;  2DY7 A;  1FGB D; 
#chains in the Genus database with same CATH homology
 4K5W A;  5C44 B;  2OXP A;  4M1U B;  3URY A;  3MWY W;  3WOF A;  3CRK C;  1HXY D;  2R3Z A;  3UI2 A;  1SEB D;  3QWN A;  1CM9 A;  1U4P A;  3FEW X;  3PUX A;  3M7G A;  4KY6 A;  5IGD A;  3BVZ A;  5C0X G;  4HTH A;  1AFP A;  2BE5 C;  2K5D A;  3D6C A;  1XYI A;  2F0S A;  1KNA A;  2DNE A;  2F1M A;  5D14 A;  4Y7N B;  3E0J A;  1EIG A;  4IUR A;  1Q1E A;  3IKJ A;  3FPP A;  3S17 B;  1HHV A;  3NUC A;  3J80 L;  3D4R A;  3JAM L;  2I07 B;  2X6G A;  4DK0 A;  2Q8T A;  1Z7T A;  3NE5 B;  4PMB A;  4UDU C;  3HKZ B;  2EYL A;  3MFG A;  1UEA B;  4S3S A;  5I2Y A;  5EPK A;  5IGF A;  1H9J A;  3GTJ B;  1S5B D;  1LT5 D;  4OO1 H;  2G9H D;  1W6K A;  1SE2 A;  1VF5 C;  1IKM A;  1ILP A;  2Z1C A;  5IT9 E;  4CKC A;  3J81 E;  3EVQ A;  2BE5 D;  1V8Q A;  1STH A;  5FOB B;  4FYD A;  1MSG A;  5M9O A;  3BDO A;  5JPM C;  4A3E B;  3OHX C;  1PRT D;  2E75 C;  2NVT B;  1EOT A;  5I4D A;  1B50 A;  2EY6 A;  1GXD C;  1O7Z A;  2XWJ B;  2L11 A;  1EEI D;  1STG A;  3EJI A;  3Q23 A;  4DNT B;  1SYG A;  3Q6S A;  3T51 B;  1BO0 A;  3SEB A;  2NUC A;  2WP8 J;  1ZXT A;  2CHB D;  2IT1 A;  4ZYS A;  1EZ6 A;  1PXU A;  5A35 A;  1CQV A;  3DM1 A;  3I4M B;  1WTX A;  1O7Y A;  5ELD A;  4KTA A;  2F0I A;  1EYC A;  5FO9 B;  1I50 B;  3S15 B;  4TRD A;  4IFD G;  2KUM A;  1SYC A;  2K7V A;  1PFM A;  1EQV A;  5D3D A;  3PUV A;  4DN4 M;  2H1E A;  1BDO A;  3HOU B;  5JEA H;  5I6W A;  3GTM B;  1YNN C;  2FFK B;  1DOK A;  3I72 A;  1BBX C;  1HQM C;  1BXT A;  4FP5 D;  1WTQ A;  1KAA A;  1SFO B;  4ZAI A;  3BDC A;  3SE0 A;  2K32 A;  4ZUI A;  1EY5 A;  1AZP A;  1LT6 D;  3HG9 A;  1DYQ A;  4Q5V A;  5EKL A;  4C56 C;  2JEA I;  5C6A A;  3K7A B;  2JP1 A;  2RVL A;  2B2Y A;  3H3V C;  4G57 A;  3C2P A;  2L9H A;  4KY7 A;  2F3W A;  3GTP B;  1B1Z A;  1G91 A;  4U68 A;  4HCS A;  5F2D A;  2K04 A;  5M3F B;  1WTO A;  4RWS C;  1NAP A;  2M2L A;  1IYV A;  1UAP A;  1HUM A;  2B39 A;  5K5P A;  5EKI A;  1CHQ D;  1A15 A;  5CV7 A;  1GOZ A;  3NTK A;  1QJO A;  1PZI D;  5COY A;  1KAB A;  2L5T A;  1BNZ A;  1TY0 A;  4I65 A;  1DD2 A;  3KBX A;  1I3Q B;  1YNN D;  5IT9 L;  4OO1 I;  4OL7 A;  2L4N A;  1JOO A;  4Z9C B;  2YYZ A;  3VA5 A;  2B8F A;  2PW5 A;  1T5E A;  3SXH A;  1V1P B;  2SNS A;  4DGZ A;  3MC0 B;  1Q1B A;  1I4Q A;  2O5J C;  3NWS A;  3R8B A;  1ENA A;  2J4X A;  4QMG A;  1I4P A;  2RSN A;  3HOZ B;  2RSO A;  1F77 A;  3GTK B;  3KLS A;  1X3P A;  1PFB A;  1I6V C;  3C1F A;  5AFW A;  4TKO B;  4BWG B;  4C2M B;  3KLS X;  4OIK A;  4DNR B;  2DN8 A;  1GUN A;  2A68 C;  3QOJ A;  1FR3 A;  3QG1 A;  5C0X H;  3HOV B;  5C4Z A;  3OMG A;  4EQO A;  3OWF A;  1LAC A;  3S16 B;  1LTS D;  1ZEQ X;  4V0B A;  4NDX A;  4ILW A;  5T1G A;  2AWN A;  4IUU A;  2XSC A;  4KD4 A;  3HOW B;  2KQ3 A;  4G4K A;  4LJZ C;  4BS9 A;  1R9T B;  3WDN A;  5ELC A;  2OF1 A;  1W6J A;  3MXN A;  1S4Z A;  3L3O C;  5CV8 A;  1B9M A;  4ZQ3 A;  3VYT A;  2F03 A;  1BUV T;  1M4V A;  2K5W A;  3T4A C;  3Q0A A;  4J6H A;  1ROD A;  1PRT F;  1F9S A;  4IN3 A;  5EPJ A;  4HAE A;  2MHV A;  2EDG A;  3D8G A;  5JEA J;  4U67 3;  4K2L A;  1CTM A;  4EVO A;  5C3X A;  1BCP C;  3FDT A;  5ELE A;  1A3U A;  1EYD A;  3TP8 A;  2ENB A;  1ZYR C;  1B2T A;  1HFN A;  2A68 D;  4LMQ D;  1I4G A;  4M8A A;  3QOL A;  2EZV A;  1HRJ A;  1STE A;  4CKE A;  2IWH A;  1QCB D;  4H7B A;  1EY9 A;  3MAQ A;  1IHZ A;  3W2D A;  2A74 C;  5KYL A;  5IGB A;  1F9R A;  2KEC A;  4XT3 B;  4KKT A;  4NMZ A;  4R8I A;  3C46 A;  3KK7 A;  3RLF A;  1WTR A;  3S2D B;  1V1O A;  1SYD A;  1O78 A;  5CV5 A;  1TS4 A;  4XQQ A;  3VR5 A;  1Y8N B;  2KEE A;  4BBR B;  2YU9 B;  3M4O B;  1BCP D;  1EU4 A;  2F0T A;  4DU9 A;  3X3M A;  4RGM A;  1LTR D;  3FKI B;  2XRS D;  4A3K B;  1ZYR D;  3HP3 A;  3L9A X;  5E3F A;  2CVR A;  1LLR D;  1LAB A;  4IUT A;  4BBS B;  1GUT A;  4IFD H;  3DWQ A;  4K6L A;  5KGU A;  1O80 A;  2EYM A;  4K8J A;  5IGG A;  4KD3 A;  2E2D C;  4DXG A;  1K8O A;  1QOH A;  3HZX A;  3QB3 A;  1NR2 A;  3MHB A;  3PIP 3;  2NTT A;  2R92 B;  4RKB A;  2IX1 A;  1DJR D;  1C4Q A;  1RCV D;  5C0X I;  1WCM B;  4BA2 I;  4L8J A;  3C1E A;  3MVV A;  3W3A A;  1GHJ A;  5C0X J;  3M7N A;  3P1H A;  4A3J B;  2F0L A;  3V96 A;  3GD7 A;  5KIX A;  4JK1 C;  4A3B B;  4RGT A;  2K6A A;  3MA2 B;  3DWA A;  4CJ0 B;  5JPN C;  1JC7 A;  2XVS A;  2A6H C;  3RUZ A;  2NN6 G;  2ICE C;  1OXX K;  5FLX L;  5EQ0 A;  1SXT A;  2EVB A;  4OHJ A;  1F2Y A;  1CHP D;  2BCO A;  4QIW B;  1S5D D;  3OWE B;  4RCN A;  3OMC A;  2D9U A;  2EXZ A;  2MP1 A;  1U9R A;  2JE6 I;  3NQT A;  4RGO S;  3M4Y A;  3VR4 A;  5J39 A;  4K2K A;  1WTV A;  1B4O A;  2ICI A;  1GJX A;  2PYK A;  4WRD A;  3O13 A;  1RF2 D;  3RZD B;  1IL8 A;  3I90 A;  2NWG A;  1GUO A;  3F2U A;  3ONA B;  3DHQ A;  2R6G A;  5M5W B;  2K5Q A;  4XXE A;  4NKL A;  3I70 A;  3HRZ C;  1ESF A;  1A2T A;  1H9S A;  4N9P A;  1U4M A;  1NSN S;  1F2M A;  1PTO C;  1LTG D;  4J8Q A;  1MBY A;  4PV1 C;  2A6H D;  2K05 A;  3NPP A;  1SYE A;  4X3K A;  1AP0 A;  1QNK A;  2FIN B;  3WOE A;  2AQ3 B;  2B2W C;  3VR6 A;  5M5X B;  4RCO A;  4UAI A;  1SJH D;  5CMD A;  2FHT A;  5COR A;  2FMM A;  2F4I A;  2JA7 B;  5M5Y B;  1SYB A;  2D2C C;  3NTI A;  1EFI D;  3T56 B;  3U9S A;  5KND A;  1DOM A;  1TQO A;  1Q12 A;  5CBE E;  3CU7 A;  2N88 A;  2JXM B;  3LWU A;  3BS1 A;  3MXP A;  5HGT A;  2LFN A;  5LL6 S;  4IFD I;  1RTO A;  2B2W A;  1SND A;  2E2I B;  1CZW A;  1F2Z A;  3PO2 B;  5IGE A;  1M8A A;  3HOX B;  4IFD J;  4HR7 B;  4KHV A;  2XIW A;  1PTO D;  2OEO A;  4CGY B;  1D2B A;  2WB1 B;  2IL8 A;  1WTW A;  3GTQ B;  2K01 A;  2F0P A;  5CV9 A;  1TVX A;  2SEB D;  1AEX A;  2A5H A;  1JOR A;  2BA0 A;  3HOY B;  3VR3 A;  1H9S B;  3GO5 A;  2MPM A;  1BCP F;  3MXU A;  3T53 B;  1F2L A;  3PO3 B;  1X3Q A;  3D4D A;  2JYO A;  4QUC A;  1G2T A;  3DEO A;  1TWG B;  2F0M A;  2HCI A;  3C3L A;  2WV6 D;  1AN8 A;  1RKN A;  5EKK A;  1QE6 A;  2Z4H A;  1PMR A;  4ZK9 B;  2HQE A;  3TZU A;  1ENC A;  4LK1 C;  1PTO B;  1EY6 A;  5G3L D;  1TS3 A;  4XQJ A;  1KDC A;  2F0K A;  3K5O A;  2L55 A;  4IUN A;  2LY7 A;  4DXF A;  3NWT A;  4OIJ A;  3AU7 A;  5DEH A;  1PZK D;  4B9W A;  2M9V A;  2QKI C;  1VDZ A;  3V2T A;  4DAV A;  4RKL A;  1Y8O B;  1DZ1 A;  5DM6 3;  5E1F A;  3FPU B;  3E6Z X;  2Z8L A;  4ULL A;  1V1P A;  4F7X A;  1WVL A;  4X3U A;  1KLU D;  2IJ0 A;  1V43 A;  2RKS A;  3S1Q B;  3NBI A;  3TZD A;  1CA6 A;  5JOB A;  1G8Z D;  5FKA C;  3SK4 A;  2ZT9 C;  2AQ1 B;  2XNA C;  4CJ1 B;  2F0Q A;  5C4H A;  3GV3 A;  1SNC A;  2PZT A;  1EZ8 A;  1UUP A;  2JA6 B;  3HGB A;  4A3F B;  3A7L A;  4FXK C;  4R9W A;  1A2U A;  4ID6 A;  3QJY A;  2ZXP A;  4XTC S;  1ESR A;  1ML0 D;  4YIJ A;  2B2T C;  1KLG D;  5ELF A;  4XIG S;  1FD7 D;  5JVG 3;  4PMC A;  3SDZ A;  1JCK B;  1Q90 A;  2R93 B;  2NN6 H;  3J7Y W;  1S5C D;  4H44 C;  5TSS A;  2HCC A;  3K59 A;  3QIA A;  2IW3 A;  1JE4 A;  1JOK A;  2NVX B;  4BY1 B;  2E2J B;  1ET9 A;  2BOS A;  2QDB A;  2HUG A;  1EIH A;  5FK9 C;  4O42 A;  5KNB A;  2QEJ C;  2R61 A;  5JAV A;  1PFN A;  4ME5 A;  2MJ8 A;  2RBM A;  2ID0 A;  3BYY B;  2HDM A;  4P2C B;  1E0B A;  2DY8 A;  3G6J B;  2PZW A;  4IAL A;  3TBI B;  4C1N K;  2VUM B;  4PNY A;  1Q3L A;  3LX0 A;  4DA2 A;  2WAQ B;  2SNM A;  1RTN A;  3RD4 A;  1RJT A;  5IIF A;  3DWP A;  3NTH A;  3HEJ A;  2EYH A;  2H4O A;  2NB0 A;  5ISR A;  1WD0 A;  1EYA A;  2BDO A;  1AW7 A;  4RAU C;  3K5N A;  3K6O A;  4ZUJ A;  5E4X A;  1Y1V B;  3BZD B;  3BVM A;  1QG7 A;  1TKW B;  1TU2 B;  4FNF A;  1HTL D;  2KVM A;  1ET6 A;  4IQZ A;  4MN3 A;  3K5L A;  3D6W A;  4HMI A;  2EYO A;  2AWO A;  1RDP D;  1Y1W B;  2NVY B;  3P75 A;  3DMU A;  2F0U A;  3VA7 A;  3S14 B;  1D1I A;  1OXV A;  1TWF B;  2Z4I A;  2JA8 B;  4B08 A;  4Q0F A;  1TY2 A;  2CW0 C;  4CJ2 C;  1LT4 D;  2KCN A;  4XDX A;  2M00 A;  4KKS A;  4I7Z C;  4WFN 3;  2Q8R E;  4CKB A;  1BOS A;  2MUY A;  3MTS A;  5FLX E;  5LHY 1;  1SNP A;  2EYF A;  3OSO A;  1MGS A;  3VYR A;  4FF1 A;  2K33 A;  5G3L F;  3V05 A;  3QO2 A;  4X3S A;  1C48 A;  1NUC A;  2VNU D;  5IOD A;  2LS0 1;  1EEF D;  2L12 A;  4G7H C;  4BY7 B;  2WAC A;  1S5F D;  2TSS A;  1G6Z A;  1EWC A;  5C3W A;  3Q22 A;  1J8I A;  2C5C A;  2NN6 I;  2PO4 A;  2JSO A;  2SOB A;  3P7J A;  5BN5 A;  3PIO 3;  3ND9 A;  1A3V A;  2F0F A;  1ILQ A;  3D31 A;  5KNC A;  2CW0 D;  1A6X A;  4QF4 A;  5I6Y A;  4A3I B;  1CQF A;  2RDF A;  2A73 B;  3TSS A;  2PMZ B;  1JIC A;  3EQL C;  1CA5 A;  2A69 C;  1IKL A;  2E2H B;  4F88 A;  1DXM A;  3S1R B;  2XRQ D;  2ZXR A;  4CHT B;  1WD1 A;  4IUQ A;  2PQE A;  4KJO A;  1IYU A;  2JEB I;  5BN4 A;  1C8C A;  3A8I E;  2EYJ A;  2AQ2 B;  1LO5 D;  2LMC B;  2CQA A;  1D5X C;  3I73 A;  2F0E A;  4K5X A;  4K14 A;  1ZKO A;  4F8M A;  1OXU A;  5E4W C;  4IUV A;  2K28 A;  5CR3 A;  2QIL A;  3TP6 A;  4K6D A;  4EQP A;  3DEP A;  2J7Z A;  2EE1 A;  3T13 A;  1MSH A;  1SYF A;  2A69 D;  3SVM A;  3RZO B;  1TWH B;  4G7Z C;  2RA4 A;  3H0G B;  1JR0 D;  3MEH A;  1SDF A;  1HTP A;  2IX3 A;  3LWE A;  4BA1 I;  1OXS C;  3DXJ C;  2WKC A;  2NYZ D;  1JWS D;  1LV9 A;  3A8K E;  4AYB B;  1CK1 A;  1K83 B;  3IFD A;  5IGC A;  1PTO H;  4G7O C;  2MGS A;  1YNJ C;  4RFB A;  3EA6 A;  3RMH A;  3H91 A;  1LTB D;  4FO2 A;  4JBW A;  1E2V A;  2PPB C;  2KA7 A;  2B2U C;  1I4H A;  5M3M B;  3PUW A;  1GUG A;  1SMY C;  1U4R A;  1D5Z C;  3D3R A;  2KHS A;  2JA5 B;  2WKD A;  3HS0 C;  1O7L A;  4L63 B;  1ENF A;  3SK5 A;  3J7A V;  3NBH A;  1F9P A;  3N6R A;  2K03 A;  3PUZ A;  3GP7 A;  2KED A;  2SDF A;  3VR2 A;  4ZRZ A;  4KMU C;  5C5M A;  3CHB D;  2B2U A;  2F0H A;  4LAA A;  3OIP A;  4KY5 A;  3NP8 A;  1MD2 D;  2PNR C;  3I8Z A;  1SE3 A;  4A3G B;  5J1Z A;  5KRU A;  4RHR A;  2O5I C;  1LT3 D;  2PCF B;  3ITP A;  1VF7 A;  1FNV A;  5CV4 A;  2FMC A;  1D1K A;  1YNJ D;  4GZY C;  1STY A;  4FF3 A;  5KEE A;  5CBA E;  4IZ8 A;  2TMP A;  1STA A;  2B2V C;  4FF4 A;  1SMY D;  1HPC A;  1FYC A;  3T16 A;  3OIQ A;  1PRT C;  3S2H B;  1II3 A;  5EBC A;  2B63 B;  2PZU A;  2WIN B;  4C3H B;  3BYT B;  2F0W A;  3MFY A;  2D62 A;  1JB3 A;  1D6E C;  1HA5 A;  1WTP A;  5K36 G;  4DAP A;  3KF8 A;  5BN3 A;  1S5E D;  2EY1 A;  3AB9 A;  2B2V A;  4HSV A;  1UNS A;  5C4X B;  3G7L A;  1SNQ A;  5JVH 3;  1SSO A;  5A2Q L;  1STB A;  3OPO A;  2RDG A;  2EY5 A;  4ABN A;  1GHK A;  1KNE A;  3EFX D;  1Q8I A;  2HDL A;  2O2L D;  5KYI A;  4MIU A;  4KI0 A;  1Z47 A;  5IOC A;  1EY0 A;  1E2Z A;  4PQX A;  1DCZ A;  3N52 A;  4RA8 A;  3ZYY X;  4KN4 C;  1I6H B;  4H13 C;  1DON A;  1HCZ A;  1QB5 D;  1LTT D;  3NHH A;  3CQZ B;  4KV6 A;  1VMC A;  3S1N B;  2RDH A;  4WOR A;  1JWU D;  3J7A F;  3H6M A;  4HN7 A;  3R2T A;  1SE4 A;  4KN7 C;  5EBD A;  4XQN A;  4KKU A;  1QNU A;  5I2X A;  3BVG A;  3CRL C;  1FNW A;  5LL6 X;  4DK1 A;  2EJG C;  2F0D A;  3K58 A;  3GTL B;  1SNO A;  2KCC A;  4C3J B;  1H9K A;  2EPB A;  3A7A B;  1H9R A;  2EJF C;  3BG3 A;  2J0T D;  3H09 A;  4NW2 A;  4XT1 B;  1PRT B;  4QCL A;  4C3H G;  2B2Y C;  2VB3 X;  3Q24 A;  4C1N I;  1SNM A;  2F0N A;  5C3E B;  3GV6 A;  3PV0 A;  5D3I B;  1TII D;  3IL8 A;  1NCV A;  5CGK A;  2BDN A;  5I9P A;  1BF4 A;  4A93 B;  1HQR D;  2F0O A;  1VCI A;  4ZKC B;  5NUC A;  1H9M A;  3GTG B;  2B2T A;  1PLF A;  3SK6 A;  2VB2 X;  1XTC D;  3I3C A;  4N9T A;  4ODG A;  1EU3 A;  4RH6 A;  1T5X D;  2F0J A;  3R3O A;  4L6T B;  4FVM A;  1TS2 A;  1EY8 A;  2QCP X;  1TWC B;  1TWA B;  2EYP A;  1B3A A;  4KHZ A;  1EQT A;  2E74 C;  4O1N A;  5CYU A;  3LNN A;  4RGN A;  1CI3 M;  4WJW A;  1L0Y B;  3GTO B;  2AUK A;  3J81 L;  3SK8 A;  5JJZ A;  1TS5 A;  1ICW A;  1TR5 A;  1KDA A;  4R8N A;  2NVQ B;  3KBG A;  3ERQ A;  2XWB B;  1CFM A;  1GUS A;  3PUY A;  4FXG C;  2BA1 A;  1R4Q B;  2G9D A;  2I46 A;  4J1M A;  1U4L A;  4OGQ C;  4V19 0;  1JWM D;  3FMC A;  5EGT A;  1PTO F;  2VXW A;  4C3J G;  2Y0S B;  2K1B A;  3E5S A;  1QIL A;  1EL0 A;  2DNC A;  1STN A;  2ZXO A;  4NP5 A;  1LTA D;  3X3N A;  3CKI B;  4TQU S;  4TSS A;  4QUF A;  2XN9 C;  3KLR A;  5DAU A;  3FVQ A;  4C3I B;  1JOQ A;  3TDQ A;  1KDB A;  3P20 A;  1VMP A;  2IX0 A;  3H94 A;  1ONL A;  1J9O A;  4FXD A;  2L1B A;  1CZG A;  3IFT A;  3A8J E;  1NR4 A;  3A56 A;  4EGV A;  5ELB A;  4KK7 A;  2F0V A;  1GUW A;  3A55 A;  1E2W A;  3TP7 A;  3MZ5 A;  2N55 A;  5K36 H;  1JQY D;  1AZQ A;  1OXT A;  4MHE A;  4RHS A;  3ND8 A;  3BDL A;  3IAY A;  5DM7 3;  2NZ1 D;  4DAY A;  1LTI D;  5FO8 B;  3A54 A;  1I4R A;  4HSP A;  4K8I A;  3K57 A;  1DOL A;  4IUP A;  3NQI A;  1SAP A;  3M85 A;  5T1I A;  3TN2 A;  3K5M A;  3NK9 A;  4OO1 G;  1DM0 B;  2NBF A;  2V4D A;  3NXW A;  1G2S A;  1L0X B;  1XX8 A;  2LKV A;  4KJN A;  1A3T A;  2EOT A;  4ZKB B;  2QF7 A;  3ERO A;  1OO9 B;  1XXG A;  4B9X A;  1FNU A;  4EQN A;  1QWY A;  5D65 A;  3S9W A;  3OW7 A;  2RQX A;  1K8M A;  2X69 A;  4K5V A;  2D5D A;  1PDQ A;  2FJ2 A;  5EJW A;  1B44 D;  3I4N B;  3SR1 A;  5EPL A;  4CBV A;  5CV6 A;  2O4X A;  4HED A;  5CC4 A;  1BR9 A;  4DF7 A;  2EY2 A;  4C3I G;  4F87 A;  2Q8I B;  1CT1 D;  4QB4 A;  4DFA A;  3I91 A;  3I4L A;  1EY4 A;  3OOC A;  2PW7 A;  1PZJ D;  1KTK A;  2A6E C;  5JEA G;  3MXG A;  2NTS A;  4X3T A;  1G29 1;  4A3M B;  2GA4 B;  5C5L A;  3TP5 A;  3KUP A;  1SJE D;  1HFG A;  5J22 A;  3J80 E;  4FF2 A;  5HUR A;  3VYU A;  1F9Q A;  1B53 A;  3FRP B;  3JAM E;  3TME A;  1BQQ T;  1B9N A;  4ZLT F;  2C9O A;  2R7Z B;  1RD9 D;  2F3V A;  5A2Q E;  1IW7 C;  2B8G A;  1BCP B;  1Y8P B;  4XYO A;  3PMF A;  3VYS A;  4E6I A;  2L0C A;  2EJM A;  3M3Y B;  3D4W A;  2KOL A;  4XYQ A;  4PMW A;  3GQB A;  1XWE A;  1PYW D;  2X6L A;  4HCE A;  2E76 C;  1X32 A;  1D5M C;  5DNF A;  1SBB B;  1EWH A;  5I9O A;  2A6E D;  1Z6H A;  5C4J B;  3AMU A;  3K0Y A;  3SHL A;  3U9O A;  2KJX A;  1R4P B;  1I4X A;  1TT2 A;  3R2I A;  1HA6 A;  1Y69 U;  2OT2 A;  1RHP A;  3R93 A;  2IPK D;  2WII B;  2F0G A;  2AUJ D;  4A3D B;  1IW7 D;  1EY7 A;  4H0L C;  4HMJ A;  3DUZ A;  3S1M B;  1MI2 A;  5FO7 B;  3NSW A;  3L7Z C;  1HUN A;  2DY7 A;  1FGB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...