5G3LF

Escherichia coli heat labile enterotoxin type iib b-pentamer complexed with sialylated sugar
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
98
structure length
98
Chain Sequence
GASQFFKDNCNRTTASLVEGVELTKYISDINNNTDGMYVVSSTGGVWRISRAKDYPDNVMTAEMRKIAMAAVLSGMRVNMCASPASSPNVIWAIELEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN IIB, B CHAIN
publication title Biochemical and Structural Characterization of the Novel Sialic Acid-Binding Site of Escherichia Coli Heat-Labile Enterotoxin Lt-Iib.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 23
structure length 98
sequence length 98
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.50 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5g3lF00
1QCBD 4FNFA 5G3LF 4FP5D 5G3LD 4FO2A 1TIID 1QB5D
chains in the Genus database with same CATH superfamily
1XPOA 4JI5L 1SYEA 3PO3B 2NVYB 1VQBA 1D6EC 3ZJYC 4RWSC 5C4XB 4QF4A 4PV1C 4EQOA 1F2LA 3Q6SA 2Y0SB 4DV6L 2QEXA 2B2WC 4IUVA 4IOCA 3D0FA 5JVH3 4POFA 1VQIA 1LTSD 3H91A 1IL8A 4A3KH 4LFBL 1MKHA 4XQJA 2B2VC 3AU7A 5IT9L 4V0BA 4DV3L 3HOYH 3Q23A 2KQ3A 3GTKB 1TWAH 4GOPA 1S5FD 1XNQQ 2JA9A 3HOZG 3ICEA 1F9QA 3NUCA 1QZGA 2XNAC 1H9SB 2B2YA 4A3EH 2R93H 1SJHD 1STNA 2FMMA 3BVGA 3TRZA 1LYLA 1YBYA 5DAUA 5ELNA 2PPBC 4QGUA 1ML0D 4A93G 5CC4A 1IL2A 2EYFA 1EWCA 2ICEC 1B9NA 2EOTA 3BZCA 3KLSA 3FPUB 2VB3X 1HUMA 2UUCL 1PZKD 5I6YA 4FF4A 1PH1A 5JJKA 3AMUA 3CF5A 4XDXA 3GTJB 5EKLA 2G9DA 3I70A 2B2UA 3H3VC 3CCRA 3S1RB 4RA8A 4LF8Q 3BG3A 3GO5A 4K0KL 1BKBA 1TU2B 4BY1H 1C48A 1OXSC 1BCPD 2KJXA 4MN3A 2R7ZB 3F1ZA 4KJOA 5K36G 3PO3H 2NVYH 4XQQA 2XSCA 2HDMA 2A73B 2WIIB 4UP9A 3MVVA 5C4XH 5I4DA 2VQFL 5IWAL 2EY5A 2RCFA 3J7YW 1E2VA 4APVA 4JBMA 4RHRA 3SGIA 3QG1A 3ER0A 1ICFB 1NJIC 1JJ2A 3M7NA 3F2CA 1MGSA 5JEAG 3JAME 1VMPA 1YIJA 4LF4L 4IJHA 1HQRD 1JE4A 1Q8IA 4C3IB 1HHVA 4X65L 5E1FA 1D1IA 1TWGH 3J81L 1H9JA 1V1PA 3GTKH 3T56B 2L5TA 1HA5A 3S24A 3IFTA 4CHTB 5LMUQ 4IPDA 5IY0A 3OMGA 1VQ9A 1QILA 1LTAD 3VYSA 4PMCA 2BE5C 2E76C 1B70B 2I5HA 1L2FA 4JV5Q 5D14A 4Y52H 3JC66 1CK1A 5IYDH 1K3RA 3HG9A 4NPSA 2F0FA 3QB3A 4QMGA 4X3KA 2X69A 3H6MA 4O2DA 2PNHA 1QVGA 1K8OA 2XRSD 4AYBG 3GTJH 3I55A 4JVZA 2LKVA 4LF6Q 1LABA 3HP3A 2K03A 2K6AA 4XT3B 3N6RA 4HJAA 3S1RH 4IOAA 4N8FA 3UDIA 2UXBQ 1A6XA 4RH6A 3J80E 1Z6HA 2KCMA 4DV5Q 5IT9c 4MZ9A 4ID6A 1KAWA 1CQVA 2Q8RE 4UP7A 2JA8G 1Q12A 4ABNA 4L5SA 3GTGH 3KK7A 3EROA 2B63B 1A3TA 1QVCA 3CMEA 1PYWD 5K5PA 1JOQA 2KOLA 1STEA 2KHJA 1BR9A 5I6WA 2ZM6L 1BVSA 3M85A 3DM3A 4HSVA 4G7HC 4KY7A 3CCVA 4PZ6A 5KNDA 3U9SA 1I4PA 3A5UA 3LWEA 1LTBD 2PMZE 3GD7A 2NN6I 3AQQA 2BE5D 1T5XD 3RLOA 2Z9HA 1AP0A 2QILA 4UP8A 1Y1WB 1PRTD 1IBKQ 1JR0D 3I4OA 1PH6A 2RDFA 1EY8A 4EX5A 1GHKA 3F8TA 4XYQA 3C3LA 3A0JA 3JAML 3B6YA 2F0MA 1NAPA 5IP9H 5IGDA 1VQOA 2IX0A 4DAMA 4DR1Q 4BA1I 2R6GA 4AQYQ 5FOBB 3TQYA 1VQNA 1SAPA 2CWPA 1FVIA 4IUNA 3M4OB 2GVAA 1V8QA 4O1NA 4JV5L 1R9TB 3NXWA 5ISRA 3HOXB 1FD7D 2WAQG 4UAIA 1I50B 2BA0A 4LFCL 3M7GA 1Y8NB 3S17B 4FDBA 4DF7A 2L1BA 4B3SL 1F77A 1EIHA 4GN5A 1XMOQ 4NXNQ 4DXFA 4RKBA 1B44D 1EYAA 4A3IB 1X32A 1TVXA 3I90A 3J81c 4B3ML 4DU9A 2ZJRA 2B63H 2G9HD 2KHIA 1JT8A 4DV1Q 2UXBL 1R4QB 3FKIG 2JEAI 1J5EL 3UDFA 1N34Q 2CW0C 1CKMA 4M8AA 3KF8B 1ICWA 1CSQA 1KNEA 3NWTA 1PFMA 2CVRA 2I5LX 2NN6H 5IP7G 5T1GA 3PF5A 2B39A 4ODGA 3BYYB 4OONA 3A55A 2E5LL 2I5MX 1DOMA 5LHY1 4A3DB 1JOOA 1Y69U 1Y1WH 2L11A 1RODA 1AFPA 4FNFA 3E6ZX 1TWCB 3A8JE 4GOPC 1TT2A 4JBWA 4NKLA 1E1OA 5ELBA 4KKSA 3PIOA 1IBKL 4HSPA 4B3TQ 4HJ7A 3FP9A 1E3PA 4JC0A 3M4OH 4A3CG 1BXTA 1R9TH 1KHIA 2F0JA 4OX9L 5L37A 1QOHA 1I50H 2KBNA 3PV0A 3K58A 3PUVA 2MPMA 1CZGA 1VQHA 3SEBA 2QF7A 3F2BA 2B2WA 3MTSA 3S17H 1PZJD 1AEXA 4BY7B 3CCEA 4A3GG 3FRPB 2LY7A 2NZOA 2ENBA 2MNAA 4QQBX 4FVMA 4ZUIA 2SOBA 4JCVE 4AYBE 1KLGD 1KRTA 2RHSB 5KGUA 5CYUA 1C7YA 2WFWA 3VYRA 1MJEA 2QCPX 3GTOB 4A3JG 3NEMA 5JPNC 4NXNL 1TS4A 2K05A 5ELDA 4F8MA 2HCIA 4B3RQ 1PYSB 1AH9A 1KDBA 4LWCA 2N55A 3ULPA 1CKOA 4C3JG 1HH2P 4FXGC 3JAMc 2R92G 1HZAA 1A2TA 1CHPD 3CRLC 4YCWA 2AQ1B 2SNMA 3RNUA 1SROA 3SK4A 4M1UB 4DV1L 4NXML 1WTHA 2JA6B 2GN5A 1DZ1A 4ZYSA 1N34L 2B2TA 1F2ZA 4QJFA 4DK3C 4A3DH 5CBAE 1WTRA 3S9WA 1CKNB 5D3IB 1NBWA 1QWYA 1STYA 2RKSA 3NQIA 3NBHB 4A3MG 1J9OA 2F0WA 1TWCH 3ULJA 1PHJA 4K5XA 1LACA 3I4MG 4H7BA 3EFXD 3EA6A 3MFGA 4GKJQ 1X3EA 1UE6A 1WFQA 5IYBG 2O4XA 4C3HB 4IPCA 4ZQ3A 3P20A 3I2ZA 2A19A 3I3CA 3SXHA 3K0XA 2NZ1D 4XIGS 1SYCA 2JA7B 2SDFA 4K8IA 1E24A 2EY1A 1H9KA 2UU9Q 1JC7A 2Y0SG 3EQLC 2F0TA 5JJIA 1U4LA 1O7IA 2D0PA 1R4PB 4KN7C 4B3TL 4BY7H 1B3QA 2AWNA 2Q2UA 2EDGA 2LXKA 5C3EG 3GTQB 1Q46A 3M9BA 4KKTA 2NUCA 1HTPA 2WAQE 2ASBA 1CSPA 2F0PA 2YYZA 1I4XA 1S72A 2DGYA 2A8VA 4IURA 3PO2G 2OCEA 1Q81C 3HOWG 1XWEA 4HIOA 1HZCA 4C1NI 2NVTB 3Q8DA 3DHQA 1TWFB 1EIGA 5FKAC 2IHFA 4BXXH 4JYAL 3S1QH 4X3SA 3HOUB 5M3MB 1PH3A 3G6JB 4XXEA 5J22A 1PVOA 3K7UC 3R93A 4B3RL 1QCBD 2F0DA 1UUPA 1VQEA 3R2IA 4DK0A 2H4OA 3K5MA 1IZ6A 4XYOA 4C1NK 1PTOC 4KHZA 1PLFA 5IGEA 3KBXA 1WCMG 3T51B 3CRKC 2K32A 3E3XA 4CDEC 3PIO3 4ALPA 3CPWA 4CGYB 3J7ZC 1FNWA 5BR8Q 2QGQA 1RF2D 1M8AA 4KY6A 1G2SA 1QNUA 4C3HH 2R7ZG 1LT6D 2F0IA 5I9PA 3NENA 4CDCC 3UDXA 3BDCA 3K81C 2OT2A 1WD1A 2O2LD 4A3LH 2N49A 4MNOA 2P5ZX 1X9NA 2IW3A 2DJFC 4K8JA 2K04A 2VXWA 3D4WA 5EBDA 3NQTA 1PH2A 4JI8L 3H94A 3BVMA 1YJ9A 1VQGA 3GTQH 2MO1A 1HNWQ 1VQKA 4H0LC 2N88A 4C3IG 2KCCA 4ILWA 3FDTA 4LF9L 2E8GA 2Q2IA 3SK5A 2OTJA 2IT1A 4DV7L 2NVTH 2L12A 2RA4A 4TVAB 1HCZA 1TWFH 2Z6KA 4CDDC 1XXGA 3MXUA 4CKEA 5AJ3Q 3KJOA 2JA5B 1PTOD 4KV6A 1VQDA 3FVQA 4ZAIA 5C3XA 3HOUH 3HRZC 4J6HA 5M3MH 4A3EB 5E4WC 3TP8A 2NTTA 2FFKB 2IJ0A 4JG2A 3LGJA 4KY5A 4LW1A 5EQ0A 2RF4A 4DXGA 1OXTA 4LF7Q 4R8IA 1O80A 1BNZA 1IBLQ 3BU2A 3CCSA 3KF6A 2J7ZA 3RLFA 3U9OA 1FR3A 2TMPA 2KEEA 4KD3A 1TKWB 3MEHA 1JJCB 1A15A 4K0KQ 1P8LA 2EY2A 2RSOA 1PFBA 3DEPA 2L15A 4IPGA 3U4VA 2IPKD 1DGSA 3P7JA 3G4SA 5M3FB 1A0IA 4L8JA 2F0UA 4CJ2C 4OO1I 3EVQA 3OW7A 2VQFQ 1T5EA 2RDGA 3SDZA 1U4MA 5CV8A 2F4VQ 5EJWA 3H09A 3MC0B 1BBWA 3C1EA 5BR8L 2KECA 4LUVA 4BBSG 4LFAL 4R8NA 4OHJA 2ZJQA 1SXTA 4HEDA 4LF4Q 4DNRB 1STBA 3I72A 4X65Q 3W1BA 3OIQA 2F03A 2XWBB 1C8CA 4PQXA 4DAYA 3CC2A 2VZAA 2UXDQ 2F0NA 3PIP3 3E9IA 4NB3A 4EGVA 5HGTA 1SNPA 1XX8A 3D4DA 5CV4A 1E2ZA 1CT1D 1GO3E 4GLAC 2HT1A 1O78A 3IKJA 3WWVA 5C4JB 1TWGB 1HNWL 4YCVA 4QUFA 3ERSX 4RAUC 4BA2I 3PQIA 4GLVB 4O42A 2JA5H 3TEHB 4CDFC 2IHEA 2NWGA 3TP5A 4A3FB 4DGZA 3MXNB 1I4GA 1CI3M 3MEFA 2AHOB 4IUPA 1WTXA 2VUMH 5C44G 3L2PA 4DNTB 1LTID 1F9RA 4PMBA 1IW7C 1HUNA 4DAPA 4L5TA 5AJ3L 3HOXG 5IGFA 3I56A 1GUTA 4LNQA 4I65A 2B2TC 2LXJA 4KD4A 4XQNA 3DEOA 4PZ7A 4LF7L 1GUGA 1WTOA 3MXPA 2EJGC 3MHBA 4OO1H 2NZHA 1IBLL 1JE5A 4UY8C 1P16A 4A3IG 1A3VA 3R3OA 1DM0B 5M3FH 1HNXQ 2V4DA 5EPLA 3D4RA 4QL5A 2BH8A 3RN5A 1EZ8A 2DY8A 2HD3A 5IYCH 1K8GA 4U673 2Z4HA 3ERQA 2ZM6Q 2F0QA 1Y1VB 4JI4Q 1GM5A 3QOJA 1BCPF 3Q22A 3FHWA 3CQZB 1Y8OB 3GTGB 1NSNS 4DR3L 2AUJD 1O7YA 3KUPA 3NELA 5C5MA 2QKIC 4K2LA 1F2YA 1SEBD 5LMNL 4H02A 1STAA 4EQ5A 2ZXRA 2Z1CA 2F4VL 1TS2A 4FXKC 2FXQA 4DPGA 2ATWA 2OWOA 2ES2A 4A3BG 1Y8PB 2DJGC 2F0SA 3BZDB 1SE3A 5IGBA 3W2DA 5A2QL 4RG1A 5C4JH 2PCFB 1F2MA 3U50C 2C9OA 5LL6X 4KK7A 2A6EC 1K8AC 1QJOA 1RJTA 1YNNC 2UXDL 4IFDG 2Z8LA 2NB0A 4CJ1B 4OWWB 4X62Q 3HOVB 2EJFC 4A3FH 2PZUA 2F0VA 4P72A 1A2UA 1JWSD 2EYJA 4XT1B 1JWUD 3BJUA 2O5IC 1XPRA 1AZPA 2KVMA 3AEVA 1UE5A 1JMCA 4LFCQ 4F87A 4X64L 3J7AF 5EAYA 4JI0L 4B3SQ 2JE6I 3F2UA 1HXYD 3CP0A 3K59A 1JOKA 3R8BA 3VR2A 1BCPB 3HS0C 1I6VC 3KLRA 4L5RC 2PQEA 4H44C 5C3WA 1JICA 3F2DA 5G3LD 3TREA 3NP8A 5C0XG 4B3MQ 3S2HB 2R3ZA 1SNCA 1LUZA 1KNAA 3EBEA 1FJGL 4F88A 1OXXK 3A56A 4P75A 1J5EQ 1E22A 2B3GA 3UE0A 2RSNA 3I4NG 2IX3A 1QB5D 1Y1VH 5E4XA 2L4NA 3M4PA 2L0CA 5CGKA 3KLSX 5FO9B 5FLMH 3CQZH 3U4ZA 5TSSA 4MTNA 3S15H 4B08A 1HNXL 1HRJA 4FP5D 4YWMA 2Q8TA 2A5HA 2E5LQ 3H0GG 2WB1G 2H5XA 4BWGB 4YWKA 5KYIA 4JI4L 2JA6G 1G291 2EXZA 2A6ED 4O0AA 5I2XA 4NMZA 1JORA 3BDOA 3BS1A 1TS5A 2OF1A 2EYOA 1KAAA 5JJZA 2RBMA 3CCLA 3CAMA 4R1JA 1OTCA 2HHHL 3SHLA 2R7FA 1EIFA 1S5BD 2B8GA 1CA5A 2EVBA 1LT3D 3J81i 1PRTF 5JVG3 4OIJA 5ELFA 1FNUA 2FINB 3MA2B 5CMDA 3T13A 3HOVH 5DM73 4BBRG 1VQ4A 1RDPD 2VQEL 3H3VI 2VL6A 2Z6KC 2PMZB 5COYA 1PDQA 3OWEB 4IPHA 2EQSA 4OX9Q 2JA7G 1N32Q 4YIJA 1EL0A 2IL8A 2ALYB 4X62L 4DR5L 4QCLA 3QWNA 3PSIA 2D0OA 2DN8A 4EQNA 4I7ZC 1O7ZA 5M5YB 1TXYA 1IKLA 5J39A 3C1FA 4TQUS 3S2DB 3M4QA 3M3YB 1JWMD 3CU7A 3KLWA 3TS0A 3URYA 2WINB 3S2HH 4FXDA 1H9SA 4LK1C 1V1QA 3MXNA 3NHHA 4J1MA 2RDHA 4CBVA 4OEMB 3G6EA 5HGQA 1PXUA 3RD4A 2KCTA 3UDGA 1KL9A 2F4IA 4JBKA 2KUMA 2OQ0A 4TKOB 4JI3Q 4A93B 3L7ZC 1WJJA 5KRUA 3DXJC 2UUBQ 4WORA 2Z6BA 1SRUA 4NXMQ 5IIFA 1IHZA 1PRTB 1SNOA 1BDOA 5ELCA 4DKAC 1TIID 4KI0A 1EWHA 5JEAJ 1IBML 3J80L 2HDLA 3NPPA 5FJ8H 2BCOA 2FJ2A 1QNKA 1PA6A 1XNRQ 1HPCA 2EYMA 4R4IA 1BBXC 5BN4A 1YZ6A 4HCSA 5KEEA 3CCQA 4RCOA 2BA1A 3KDFB 2CFMA 3BYTB 5IODA 2I0QA 3GV6A 4YWLA 1KC8C 2ZXOA 2DUDA 3HKZG 1L1OB 2YU9B 1ENCA 4DK6C 3NWSA 4HN7A 2CCZA 4Y7NB 3GV3A 3JAMi 2D9UA 2JQOA 1DOKA 5F2DA 1D7QA 2AUKA 5J1ZA 1FYCA 4LJZC 1EYCA 5M5YH 2F0EA 1G2TA 5FLXE 3S2DH 4DFAA 3M3YH 1N32L 1RD9D 4RGMA 3HOZH 5EPJA 4HMJA 2JK8A 1G6PA 5I9OA 4A3KG 1SFOB 4K2KA 1HZ9A 3DWPA 3HOYG 2WKCA 1IYVA 2MQHA 2CW0D 4P73A 4JYAQ 4A93H 1NMGA 2K5WA 3D3RA 4MHEA 5CBEE 3C46A 1GD7A 3GP7A 1E7ZA 1VQFA 1OXUA 3T1HQ 3TS2A 1C9OA 5EBCA 2I07B 2PI2E 3IAYA 4A3EG 1HTLD 1ASYA 2R61A 1YI2A 2R93G 3OSOA 4L5QA 4JW0A 5JAVA 3PMFA 4AYBB 3P1HA 4JI3L 3S1QB 1B7YB 1RTOA 3WOEA 2UUBL 5C0XI 4DR4Q 1LM0A 2WB1E 4UDUC 4GLXA 3NTKA 1MSGA 4OWXB 4E6IA 1VQPA 3PGZA 3X3MA 2RCNA 1B3AA 3EIVA 4PMWA 1A63A 3ONAB 4IALA 4KHPQ 2JA8B 1I5FA 5K36H 1WVLA 3AB9A 2JJQA 3FPPA 2E2HB 1QUQB 2QA4A 1LV9A 4DR7Q 1T9HA 1XNRL 4KTAA 2I46A 2J0TD 2YU9H 1DD2A 1X6OA 3QOLA 3PF4A 4BY1G 1FNVA 3MXGA 4Y7NH 5JEAH 4HJ5A 3CKIB 3CXCA 4JI8Q 3MWYW 3PO3G 1U4RA 1J8IA 1ILQA 1JJGA 5C4XG 3QR8A 1PFSA 2A1AA 1OXVA 1I94Q 3W1GA 4RMFA 3WOFA 2YTYA 4LF9Q 1TY0A 2UUAQ 1I4HA 2NVXB 1A62A 2LS01 1SNMA 1SN8A 4LF5L 3J80c 4PZ8A 1O7LA 3G48A 3QJYA 3A54A 1BF4A 4DV7Q 1SFOH 3VR6A 1CTMA 1BBUA 5JPMC 1X56A 2JXMB 3G7LA 3I8ZA 1EY0A 4A4IA 1G51A 2MUYA 3GTPH 2YTXA 2KHSA 4GOPB 1VQ8A 2ICIA 4Z9CB 2E2JB 1EFID 2A69C 2EYLA 1NMFA 1EFWA 2K75A 1YNXA 1RHPA 2WAQB 2HIXA 1WD0A 2QW7A 2OQKA 4Q0FA 3IRBA 4R4TA 5IYDG 5M5WB 1VQLA 3STBC 3T1HL 4GZYC 1PV4A 3S1MB 1KRSA 1CHQD 1K73C 1EYDA 2JA8H 1S5DD 1SJED 1QZHA 2E2HH 1EUJA 1ZYRC 4DR4L 3OHXC 1U9RA 3CCMA 2N78A 3FKIB 3KF8A 2MHVA 1ESFA 1Q1BA 1M4VA 5C4ZA 3TZUA 1ONLA 3ND8A 3OMCA 3IFDA 2CQOA 4KHPL 2YTVA 3NSWA 1KDCA 1MJCA 4LFAQ 2GA4B 3K5LA 1JCKB 4UHVA 1VDZA 4HJ9A 3HKZE 4DR7L 3BDLA 1WOCA 3LX0A 4KLKA 3OTOL 1GKHA 1S5ED 1SR3A 2A74C 1HQMC 3KDFA 1YVCA 2F0HA 4OGQC 1L0YB 2NVXH 1LTGD 4GNXB 1EOTA 3E9HA 1ENFA 2L9HA 1L1OA 3V05A 3VYTA 4X66Q 3S1NH 4QY7A 3I7FA 4AIMA 3S14B 2A69D 1VQAA 4IUQA 2BH2A 1I94L 2HQLA 4K14A 4K5VA 3D6CA 1VF5C 2G5DA 3QIAA 3GTMB 2UUAL 1Z47A 1V1PB 1ESRA 1M1KC 2OXPA 5GQOA 1CM9A 1PZID 2DNEA 1JB3A 2ZXPA 2E2JH 3BVZA 3V2TA 4G7OC 1S4ZA 3PCOB 4DUYQ 1X3QA 2BOSA 1ZXTA 1PTOF 1KQSA 1XJVA 3RMHA 3K6OA 1EQRA 5IP9G 1GXDC 5M5WH 3V96A 1EY6A 1CZWA 2J4XA 1VQ6A 3S1MH 2K28A 2VUMB 3TZDA 1PH5A 2K5NA 1QE6A 5D65A 1SBBB 2VS1A 1CQFA 4R9WA 4A3JB 2EZVA 2ZTEA 3EN2A 5FO7B 3H15A 2UXCQ 3T1YQ 4L63B 4HIDA 3KYHC 3FKIH 4JOIC 4ME3A 1B8AA 3R2TA 3ULLA 4IJLA 1QVFA 4YY3Q 3AFQA 2ZTDA 1VQMA 1HR0L 4DR3Q 4QIWE 5IP7H 4IZ8A 5J3BA 3P75A 5LMNQ 2B63G 5LMNW 1N33L 1TY2A 3D8GA 1CFMA 1CKNA 2XRQD 3D6WA 3GQBA 5GROA 1XTCD 4X3TA 2K01A 2SEBD 3NBHA 4HAEA 1BOSA 2D2CC 3AYHB 4A3MB 2F0OA 4PNYA 2NN6G 5D3DA 1WTWA 5CV7A 2E2DC 1K0SA 2F0GA 4B9WA 4DK1A 1PTOB 5A35A 1JB7A 2Y0SE 1CA6A 4WRDA 1EQVA 3S14H 5H1SE 4YCUA 1X54A 3GTMH 2N8NA 5HY6A 2L55A 1Y1WG 1K83B 3J81E 1I6HB 1D2BA 2XTIA 4X66L 4JI2L 4JBJA 5EKIA 1NR2A 4A3CH 1EZ6A 1Y14B 2B29A 2M9VA 2QEJC 2NBFA 1BCPC 1HFGA 4FO2A 4X64Q 3OWFA 4DAVA 3RZOH 4JI0Q 1D1KA 4A3GH 4KN4C 1EIYB 5E7NA 1NUCA 3OW2A 1KTKA 4LUOA 5C3EB 4DR2L 3BZKA 4DUYL 4JI7L 4K6LA 4ZK9B 1K9MC 3W3AA 4P71A 1AZQA 1V43A 1U5KA 3SR1A 4POGA 3PO2B 4KHVA 4A3JH 5M9OA 3HOWB 1FJGQ 4C2MH 1YHQA 2K5QA 1B50A 1DYQA 4AH6A 3NK9A 2PW7A 4C3JH 2XGTA 5IOCA 1DXMA 2R92H 1E1TA 5ELOA 4DV4Q 4IQZA 2UXCL 1LT5D 3T1YL 1YHAA 2PQAB 4RGTA 3CPFA 2F52A 3VDYA 1B9MA 4YY3L 3OPOA 3CHBD 4IUUA 1N9WA 5KNCA 1WCMB 2VB2X 3HFZB 3S15B 4A3MH 1KDAA 4ZLTF 1NY4A 2B8FA 2EYHA 3HZXA 4ME5A 2DY7A 1PTOH 2XN9C 5E3FA 1S40A 3I4MH 2HHHQ 3RUZA 1W6KA 5IYBH 1LTRD 2K52A 3CMAA 3SK6A 4RGOS 4BS9A 4A3DG 2XWJB 1AE2A 1KXLA 2C35B 1K83H 5CV6A 3KOJA 4MIUA 1NTGA 1K0RA 2VQEQ 1I6HH 2O5JC 4F7XA 1F9SA 2D62A 4CJ0B 4RCNA 5C6AA 1IW7D 2PW5A 1H9MA 2JP1A 2KENA 4GNXA 4DR5Q 3GTLB 1H95A 1CUKA 1LTTD 2AQ2B 2IY5B 1YNJC 3TP7A 4KKUA 4X6AH 1SNDA 5C3EH 3VR3A 1UE7A 3CW2C 1XMQQ 2NTSA 4JI6Q 3PO2H 2EXDA 4HCEA 5BN3A 3HOWH 2TSSA 5IE8A 2XIWA 5IGCA 1M90C 5T1IA 3KFUA 4BY7G 4P74A 3A5ZB 5DEHA 3PUXA 1V1OA 4HMIA 4HTHA 3AFPA 5GADC 3K57A 5G3LF 4OIKA 3DWAA 3RLNA 1VQ5A 1PRTC 3RN2A 1XNQL 3DM1A 1STGA 1SYGA 4K6DA 4LAAA 4N9TA 1UEBA 1YITA 2CHBD 3I91A 2YV5A 2F3VA 3M4YA 1DOLA 3L9AX 1GOZA 1IBMQ 1WCMH 3DLLA 4BXXG 3HGBA 1MIUA 4R4QA 4DV4L 3CC4A 1XPUA 1D5MC 2FMCA 4DR6Q 1Q3LA 2D5DA 2N3SA 4DNIA 3L3OC 3IL8A 2F1MA 2A68C 4G7ZC 1W2BA 4ZKCB 1EOVA 1YNND 2Q8IB 2LMCB 2R7ZH 1L1OC 1SYBA 4QB4A 1NE3A 1X65A 3VA5A 1B1ZA 4ZRZA 1YNJD 5KIXA 2M00A 5C4HA 1SE2A 4LF8L 1JQYD 5FK9C 3U58A 2SNSA 4HR7B 4BBSB 2C5CA 1A8VA 3VYUA 1YHBA 4FF3A 3GTLH 2HUGA 3HKSA 4NW2A 4C3HG 1E0BA 2X6GA 3KBGA 1UWVA 5GAGC 2WP8J 3I73A 1ENAA 1S5CD 4C3IH 2A6HC 1BUVT 3OOCA 1NR4A 4A3LG 1G91A 3N52A 5JOBA 4FYDA 1GUOA 3VA7A 2HCCA 3RZDB 1G6ZA 1GJXA 1MBYA 1XMQL 3HOZB 4EQPA 1U0LA 4JI6L 3SE0A 3NE5B 4GN4B 5LMUL 2Q2TA 2HIVA 3VR4A 5C44B 4KMUC 3E5SA 1STHA 2PYKA 4G4KA 5CR3A 1LO5D 2A68D 4V190 3A7AB 4MTKA 1PMRA 4WJWA 3HOUG 3TBIB 1FL0A 5M3MG 1ILPA 3TP6A 3UI2A 4CKBA 5KNBA 5KYLA 1W3SA 2ZTCA 1GVPA 4L6TB 5CV5A 2K4KA 1VS0A 1LTLA 2AQ3B 2PQAA 1SNQA 3D31A 3KJPA 5NUCA 4LF6L 4DR6L 2OTLA 1IYUA 1PH9A 2VW9A 3T16A 4IN3A 1B2TA 4JOIA 1IYJB 4DV5L 4IFDJ 1EY4A 2A6HD 1PFNA 3H3VH 2F0LA 4BBSH 2QDLA 1SMYC 2KCNA 4G57A 3Q24A 4UPAA 2QDBA 1K8MA 1W6JA 2F0KA 2GVBA 1VCIA 4A75A 1ET9A 4K5WA 3CCJA 1E2WA 1H9RA 1X3PA 2E74C 3PUYA 4RFBA 4A3BB 2V1CC 3DMUA 2VY3A 4R4OA 2Z0SA 4JK1C 4LF5Q 3K8AA 5AFWA 3HEJA 3J7AV 3LWUA 1UAPA 4RGNA 3RZDH 5CORA 3ND9A 2H1EA 2MP1A 3NTHA 3X3NA 5C0XJ 5M5XB 1EQTA 1SYDA 5CV9A 1B4OA 4ULLA 1ET6A 1Q8KA 3VR5A 1D5ZC 2B2YC 1MHWC 3G71A 2NYZD 2EY6A 1K28A 4J8QA 4IFDI 1K3BC 5BN5A 4IO9A 4P2CB 5C44H 1EU3A 4KJNA 4TRDA 5DNFA 3HOXH 3GTPB 3S16B 1J6QA 2WKDA 2JA5G 2CQAA 3T4AC 3K80C 1NCVA 4DR1L 4AQYL 4GKKQ 5IGGA 2R7DA 2EE1A 4B9XA 4FF2A 5LL6S 2VUMG 4ZCKA 1Q1EA 2EYPA 2B2VA 4A3IH 3MAQA 2PNRC 2CH4W 3OIPA 3OYYA 1SMYD 2B2UC 2RQXA 2VNUD 4EVOA 1D5XC 1XTDA 2JEBI 3KF6B 3J80i 3I4NB 1XMOL 3ZYYX 2CKZB 4HJ8A 2E75C 1SDFA 3LNNA 1I4QA 1C4QA 3A8IE 4DV0Q 3QO2A 4OO1G 1HZBA 1VQCA 1N36Q 1X55A 1DCZA 5M3FG 2PZWA 5DM63 3Q0AA 1GUSA 3J81j 3H0GB 2WB1B 3OTOQ 1MI2A 2FHTA 4Q5VA 4GNXC 1Z9FA 5IYCG 2IWHA 2DNCA 3K7AB 3CD6A 4WJ4A 4A3BH 2MJ8A 1Q7YC 2KA7A 5C5LA 1SE4A 2AWOA 4FF1A 2K1BA 1I3QB 1Z7TA 4HIKA 1U4PA 3I4LA 4X3UA 2E2IB 1HFNA 1YEZA 3A74A 1QG7A 4CKCA 1MD2D 2EPBA 5M5XH 1TWHB 2LSSA 5DLQE 3SK8A 1BO0A 1AN8A 3GDEA 4IFDH 4DUZQ 2AMCB 3TMEA 4BBRB 3K5OA 4XTCS 4OL7A 4DAYB 3S1NB 2K5VA 5I2YA 1HNZQ 5EKKA 1LLRD 1LT4D 2NVQB 3L0OA 1DONA 4GS3A 1II3A 1D8LA 2EIFA 2K7VA 3E0EA 1RTNA 3S16H 5FLXL 1S3OA 4OWTB 4A3FG 2PZTA 2JYOA 1DJRD 3SVMA 3PUWA 4ZKBB 1HA6A 5C0XH 3J7A5 4H13C 2Q2HA 1RCVD 2K14A 1AE3A 1IXRA 1B53A 1OO9B 5FO8B 4NP5A 4LUZA 3GTOH 4S3SA 3FMCA 4GKKL 2BDNA 1EY9A 4I7AA 3TDQA 1VMCA 4DA2A 3I4NH 4PG3A 2KEDA 3W5OA 1WI5A 1X3GA 4TSSA 3E0JA 3PIPA 1ZEQX 1HR0Q 1GUWA 1HR0W 2AKWB 4N8X1 1KABA 1GHJA 1SMXA 3A8KE 3H0GH 1TR5A 1PYBA 1N33Q 1PH4A 5GAHC 2ZJPA 3DWQA 2JA6H 1AW7A 2PO4A 3K7AH 1EY5A 1PH7A 1BQQT 4WJ3M 3WDNA 1Y1VG 4DV0L 4J15A 4QUCA 1N36L 4RHSA 3TN2A 2F3WA 1VQ7A 5FLMG 1I3QH 2JSOA 4R4CA 4DN4M 4OELB 4HIMA 1WTPA 2MFIA 2E2IH 1UEAB 4YHHQ 1RIPA 1YJNA 4JI1Q 1TWHH 1WYDA 4DV2Q 2M2LA 3K5NA 1VF7A 3PUZA 4C56C 1SYFA 4JI5Q 4BBRH 1VQJA 4N9PA 2MGSA 2CWAA 4LMQD 4JI2Q 3HKZB 5EGTA 2NVQH 2K5DA 1N8RC 2JA7H 3ITPA 1Q82C 1PH8A 1EYGA 1TS3A 5IT9E 4DV6Q 4DUZL 4GKJL 1EWIA 1FGBD 1MSHA 1F9PA 3MZ5A 1G8ZD 1EEFD 3STBD 1RL2A 3HOVG 4DR2Q 3MFYA 3NBIA 4JPBW 1HNZL 2XVSA 4LFBQ 3A7LA 1EEID 4DV3Q 1KIXA 4JI7Q 1HJPA 2BDOA 2ZT9C 3TSSA 3O13A 3RZOB 4RKLA 2UU9L 2IX1A 4A3GB 4OXPA 1ZYRD 4A3KB 1UNSA 5EPKA 1YJWA 4U68A 3HOYB 4A76A 2EJMA 1L0WA 4ZUJA 1L0XB 1TWAB 1X3FA 5ELEA 1GUNA 4GN3B 3CC7A 2ID0A 1SSOA 3EJIA 1SE8A 3NTIA 1FGUA 4C2MB 2LFNA 1A3UA 2UUCQ 2K33A 2R93B 1XYIA 3FEWX 2Z4IA 1SLJA 4C3JB 1IKMA 4NDXA 1C0AA 2R92B 2K5HA 2MO0A 5HURA 1EQQA 1ASZA 3UE1A 3DUZA 1Q90A 1EY7A 2CH4A 2WV6D 5FLXc 1KLUD 2PI2A 5JJLA 1NNXA 5GAEC 2F3IA 1UE1A 2X6LA 1TQOA 1QUQA 4WFN3 2WACA 1ZKOA 1WTVA 1RKNA 1WTQA 2RVLA 4QIWB 1Q86C 2K50A 2HQEA 4IUTA 1I4RA 3T53B 5FJ8G 2RHQB 3C2PA 3CCUA 3I4MB 5IWAQ 2OEOA 2JN4A 4YHHL 1KD1C 1V9PA 4BY1B 1EU4A 4JI1L 4DV2L 3K0YA 5A2QE 3RR5A
chains in the Genus database with same CATH topology
1SYEA 3PO3B 2NVYB 1D6EC 4RWSC 5C4XB 4QF4A 4PV1C 4EQOA 1F2LA 3Q6SA 2Y0SB 2B2WC 4IUVA 5JVH3 1LTSD 3H91A 1IL8A 4XQJA 2B2VC 3AU7A 5IT9L 4V0BA 3Q23A 2KQ3A 3GTKB 1S5FD 1F9QA 3NUCA 2XNAC 1H9SB 2B2YA 1SJHD 1STNA 2FMMA 3BVGA 5DAUA 2PPBC 1ML0D 5CC4A 2EYFA 1EWCA 2ICEC 1B9NA 2EOTA 3KLSA 3FPUB 2VB3X 1HUMA 1PZKD 5I6YA 4FF4A 3AMUA 4XDXA 3GTJB 5EKLA 2G9DA 3I70A 2B2UA 3H3VC 3S1RB 4RA8A 3BG3A 3GO5A 1TU2B 1C48A 1OXSC 1BCPD 2KJXA 4MN3A 2R7ZB 4KJOA 5K36G 4XQQA 2XSCA 2HDMA 2A73B 2WIIB 3MVVA 5I4DA 2EY5A 3J7YW 1E2VA 4RHRA 3QG1A 3M7NA 1MGSA 5JEAG 3JAME 1VMPA 1HQRD 1JE4A 1Q8IA 4C3IB 1HHVA 5E1FA 1D1IA 3J81L 1H9JA 1V1PA 3T56B 2L5TA 1HA5A 3IFTA 4CHTB 3OMGA 1QILA 1LTAD 3VYSA 4PMCA 2BE5C 2E76C 5D14A 1CK1A 3HG9A 2F0FA 3QB3A 4QMGA 4X3KA 2X69A 3H6MA 1K8OA 2XRSD 2LKVA 1LABA 3HP3A 2K03A 2K6AA 4XT3B 3N6RA 1A6XA 4RH6A 3J80E 1Z6HA 4ID6A 1CQVA 2Q8RE 1Q12A 4ABNA 3KK7A 3EROA 2B63B 1A3TA 1PYWD 5K5PA 1JOQA 2KOLA 1STEA 1BR9A 5I6WA 3M85A 4HSVA 4G7HC 4KY7A 5KNDA 3U9SA 1I4PA 3LWEA 1LTBD 3GD7A 2NN6I 2BE5D 1T5XD 1AP0A 2QILA 1Y1WB 1PRTD 1JR0D 2RDFA 1EY8A 1GHKA 4XYQA 3C3LA 3JAML 2F0MA 1NAPA 5IGDA 2IX0A 4BA1I 2R6GA 5FOBB 1SAPA 4IUNA 3M4OB 1V8QA 4O1NA 1R9TB 3NXWA 5ISRA 3HOXB 1FD7D 4UAIA 1I50B 2BA0A 3M7GA 1Y8NB 3S17B 4DF7A 2L1BA 1F77A 1EIHA 4DXFA 4RKBA 1B44D 1EYAA 4A3IB 1X32A 1TVXA 3I90A 4DU9A 2G9HD 1R4QB 2JEAI 2CW0C 4M8AA 1ICWA 1KNEA 3NWTA 1PFMA 2CVRA 2NN6H 5T1GA 2B39A 4ODGA 3BYYB 3A55A 1DOMA 5LHY1 4A3DB 1JOOA 1Y69U 2L11A 1RODA 1AFPA 4FNFA 3E6ZX 1TWCB 3A8JE 1TT2A 4JBWA 4NKLA 5ELBA 4KKSA 4HSPA 1BXTA 2F0JA 1QOHA 3PV0A 3K58A 3PUVA 2MPMA 1CZGA 3SEBA 2QF7A 2B2WA 3MTSA 1PZJD 1AEXA 4BY7B 3FRPB 2LY7A 2ENBA 4FVMA 4ZUIA 2SOBA 1KLGD 5KGUA 5CYUA 3VYRA 2QCPX 3GTOB 5JPNC 1TS4A 2K05A 5ELDA 4F8MA 2HCIA 1KDBA 2N55A 4C3JG 4FXGC 3CRLC 1A2TA 1CHPD 2AQ1B 2SNMA 3SK4A 4M1UB 2JA6B 1DZ1A 4ZYSA 2B2TA 1F2ZA 5CBAE 1WTRA 3S9WA 5D3IB 1QWYA 1STYA 2RKSA 3NQIA 1J9OA 2F0WA 4K5XA 1LACA 4H7BA 3EFXD 3EA6A 3MFGA 2O4XA 4C3HB 4ZQ3A 3P20A 3I3CA 3SXHA 2NZ1D 4XIGS 1SYCA 2JA7B 2SDFA 4K8IA 2EY1A 1H9KA 1JC7A 3EQLC 2F0TA 1U4LA 1R4PB 4KN7C 2AWNA 2EDGA 3GTQB 4KKTA 2NUCA 1HTPA 2F0PA 2YYZA 1I4XA 4IURA 1XWEA 4C1NI 2NVTB 3DHQA 1TWFB 1EIGA 5FKAC 4X3SA 3HOUB 5M3MB 3G6JB 4XXEA 5J22A 3R93A 1QCBD 2F0DA 1UUPA 3R2IA 4DK0A 2H4OA 3K5MA 4XYOA 4C1NK 1PTOC 4KHZA 1PLFA 5IGEA 3KBXA 3T51B 3CRKC 2K32A 3PIO3 4CGYB 1FNWA 1RF2D 1M8AA 4KY6A 1G2SA 1QNUA 1LT6D 2F0IA 5I9PA 3BDCA 2OT2A 1WD1A 2O2LD 2IW3A 4K8JA 2K04A 2VXWA 3D4WA 5EBDA 3NQTA 3H94A 3BVMA 4H0LC 2N88A 4C3IG 2KCCA 4ILWA 3FDTA 3SK5A 2IT1A 2L12A 2RA4A 1HCZA 1XXGA 3MXUA 4CKEA 2JA5B 1PTOD 4KV6A 5C3XA 3FVQA 4ZAIA 3HRZC 4J6HA 4A3EB 5E4WC 3TP8A 2NTTA 2FFKB 2IJ0A 4KY5A 5EQ0A 4DXGA 1OXTA 4R8IA 1O80A 1BNZA 2J7ZA 3RLFA 3U9OA 1FR3A 2TMPA 2KEEA 4KD3A 1TKWB 3MEHA 1A15A 2EY2A 2RSOA 1PFBA 3DEPA 2IPKD 3P7JA 5M3FB 4L8JA 2F0UA 4CJ2C 4OO1I 3EVQA 3OW7A 1T5EA 2RDGA 3SDZA 1U4MA 5CV8A 5EJWA 3H09A 3MC0B 3C1EA 2KECA 4R8NA 4OHJA 1SXTA 4HEDA 4DNRB 1STBA 3I72A 3OIQA 2F03A 2XWBB 1C8CA 4PQXA 4DAYA 2F0NA 3PIP3 4EGVA 5HGTA 1SNPA 1XX8A 3D4DA 5CV4A 1E2ZA 1CT1D 1O78A 3IKJA 5C4JB 1TWGB 4QUFA 4RAUC 4BA2I 4O42A 2NWGA 3TP5A 4A3FB 4DGZA 1I4GA 1CI3M 4IUPA 1WTXA 4DNTB 1LTID 1F9RA 4PMBA 1IW7C 1HUNA 4DAPA 5IGFA 1GUTA 4I65A 2B2TC 4KD4A 4XQNA 3DEOA 1GUGA 1WTOA 3MXPA 2EJGC 3MHBA 4OO1H 1A3VA 3R3OA 1DM0B 2V4DA 5EPLA 3D4RA 1EZ8A 2DY8A 4U673 2Z4HA 3ERQA 2F0QA 1Y1VB 3QOJA 1BCPF 3Q22A 3CQZB 1Y8OB 3GTGB 1NSNS 2AUJD 1O7YA 3KUPA 5C5MA 2QKIC 4K2LA 1F2YA 1SEBD 1STAA 2ZXRA 2Z1CA 1TS2A 4FXKC 1Y8PB 2F0SA 3BZDB 1SE3A 5IGBA 3W2DA 5A2QL 2PCFB 1F2MA 2C9OA 5LL6X 4KK7A 2A6EC 1QJOA 1RJTA 1YNNC 4IFDG 2Z8LA 2NB0A 4CJ1B 3HOVB 2EJFC 2PZUA 2F0VA 1A2UA 1JWSD 2EYJA 4XT1B 1JWUD 2O5IC 1AZPA 2KVMA 4F87A 3J7AF 2JE6I 3F2UA 1HXYD 3K59A 1JOKA 3R8BA 3VR2A 1BCPB 3HS0C 1I6VC 3KLRA 2PQEA 4H44C 5C3WA 1JICA 5G3LD 5C0XG 3NP8A 3S2HB 2R3ZA 1SNCA 1KNAA 4F88A 1OXXK 3A56A 2RSNA 2IX3A 1QB5D 5E4XA 2L4NA 2L0CA 5CGKA 3KLSX 5FO9B 5TSSA 4B08A 1HRJA 4FP5D 2Q8TA 2A5HA 4BWGB 5KYIA 1G291 2EXZA 2A6ED 5I2XA 4NMZA 1JORA 3BDOA 3BS1A 1TS5A 2OF1A 2EYOA 1KAAA 5JJZA 2RBMA 3SHLA 1S5BD 2B8GA 1CA5A 2EVBA 1LT3D 5JVG3 1PRTF 4OIJA 5ELFA 1FNUA 5CMDA 2FINB 3MA2B 3T13A 5DM73 1RDPD 5COYA 2PMZB 1PDQA 3OWEB 4YIJA 1EL0A 2IL8A 4QCLA 3QWNA 2DN8A 4EQNA 4I7ZC 1O7ZA 5M5YB 1IKLA 5J39A 3C1FA 4TQUS 3S2DB 3M3YB 1JWMD 3CU7A 3URYA 2WINB 4FXDA 1H9SA 4LK1C 3MXNA 3NHHA 4J1MA 2RDHA 4CBVA 1PXUA 3RD4A 2F4IA 2KUMA 4TKOB 4A93B 3L7ZC 5KRUA 3DXJC 4WORA 5IIFA 1IHZA 1PRTB 1SNOA 1BDOA 5ELCA 1TIID 4KI0A 1EWHA 5JEAJ 3J80L 2HDLA 3NPPA 2BCOA 2FJ2A 1QNKA 1HPCA 2EYMA 1BBXC 5BN4A 4HCSA 5KEEA 4RCOA 2BA1A 3BYTB 5IODA 3GV6A 2ZXOA 2YU9B 1ENCA 3NWSA 4HN7A 4Y7NB 3GV3A 2D9UA 1DOKA 5F2DA 2AUKA 5J1ZA 1FYCA 4LJZC 1EYCA 2F0EA 1G2TA 5FLXE 4DFAA 1RD9D 4RGMA 5EPJA 4HMJA 5I9OA 1SFOB 4K2KA 3DWPA 2WKCA 1IYVA 2CW0D 2K5WA 3D3RA 4MHEA 5CBEE 3C46A 3GP7A 1OXUA 5EBCA 2I07B 3IAYA 1HTLD 2R61A 3OSOA 5JAVA 3PMFA 4AYBB 3P1HA 3S1QB 1RTOA 3WOEA 5C0XI 4UDUC 3NTKA 1MSGA 4E6IA 3X3MA 1B3AA 4PMWA 3ONAB 4IALA 2JA8B 5K36H 1WVLA 3AB9A 3FPPA 2E2HB 1LV9A 4KTAA 2I46A 2J0TD 1DD2A 3QOLA 1FNVA 3MXGA 5JEAH 3CKIB 3MWYW 1U4RA 1J8IA 1ILQA 1OXVA 3WOFA 1TY0A 1I4HA 2NVXB 2LS01 1SNMA 1O7LA 3QJYA 3A54A 1BF4A 3VR6A 1CTMA 5JPMC 2JXMB 3G7LA 3I8ZA 1EY0A 2MUYA 2KHSA 2ICIA 4Z9CB 2E2JB 1EFID 2A69C 2EYLA 1RHPA 2WAQB 1WD0A 4Q0FA 5M5WB 4GZYC 3S1MB 1CHQD 1EYDA 1S5DD 1SJED 1ZYRC 3OHXC 1U9RA 3FKIB 3KF8A 2MHVA 1ESFA 1Q1BA 1M4VA 5C4ZA 3TZUA 1ONLA 3ND8A 3OMCA 3IFDA 3NSWA 1KDCA 2GA4B 3K5LA 1JCKB 1VDZA 3BDLA 3LX0A 1S5ED 2A74C 1HQMC 2F0HA 4OGQC 1L0YB 1LTGD 1EOTA 1ENFA 2L9HA 3V05A 3VYTA 3S14B 2A69D 4IUQA 4K14A 4K5VA 3D6CA 1VF5C 3QIAA 3GTMB 1Z47A 1V1PB 1ESRA 2OXPA 1CM9A 1PZID 2DNEA 1JB3A 2ZXPA 3BVZA 3V2TA 4G7OC 1S4ZA 1X3QA 2BOSA 1ZXTA 1PTOF 3RMHA 3K6OA 1GXDC 3V96A 1EY6A 1CZWA 2J4XA 2K28A 2VUMB 3TZDA 1QE6A 5D65A 1SBBB 1CQFA 4R9WA 4A3JB 2EZVA 5FO7B 4L63B 3R2TA 4IZ8A 3P75A 1TY2A 3D8GA 1CFMA 2XRQD 3D6WA 3GQBA 1XTCD 4X3TA 2K01A 2SEBD 3NBHA 4HAEA 1BOSA 2D2CC 4A3MB 2F0OA 4PNYA 2NN6G 5D3DA 1WTWA 5CV7A 2E2DC 2F0GA 4B9WA 4DK1A 1PTOB 5A35A 1CA6A 4WRDA 1EQVA 2L55A 1K83B 3J81E 1I6HB 1D2BA 5EKIA 1NR2A 1EZ6A 2QEJC 2M9VA 2NBFA 1BCPC 1HFGA 4FO2A 3OWFA 4DAVA 1D1KA 4KN4C 1NUCA 1KTKA 5C3EB 4K6LA 4ZK9B 3W3AA 1AZQA 1V43A 3SR1A 3PO2B 4KHVA 5M9OA 3HOWB 2K5QA 1B50A 1DYQA 3NK9A 2PW7A 5IOCA 1DXMA 4IQZA 1LT5D 4RGTA 1B9MA 3OPOA 3CHBD 4IUUA 5KNCA 1WCMB 2VB2X 3S15B 1KDAA 4ZLTF 2B8FA 2EYHA 3HZXA 4ME5A 2DY7A 1PTOH 2XN9C 5E3FA 3RUZA 1W6KA 1LTRD 3SK6A 4RGOS 4BS9A 2XWJB 5CV6A 4MIUA 2O5JC 4F7XA 1F9SA 2D62A 4CJ0B 4RCNA 5C6AA 1IW7D 2PW5A 1H9MA 2JP1A 3GTLB 1LTTD 2AQ2B 1YNJC 3TP7A 4KKUA 1SNDA 3VR3A 2NTSA 4HCEA 5BN3A 2TSSA 2XIWA 5IGCA 5T1IA 5DEHA 3PUXA 1V1OA 4HMIA 4HTHA 3K57A 5G3LF 4OIKA 3DWAA 1PRTC 3DM1A 1STGA 1SYGA 4K6DA 4LAAA 4N9TA 2CHBD 3I91A 2F3VA 3M4YA 1DOLA 3L9AX 1GOZA 3HGBA 1D5MC 2FMCA 1Q3LA 2D5DA 3L3OC 3IL8A 2F1MA 2A68C 4G7ZC 4ZKCB 1YNND 2Q8IB 2LMCB 1SYBA 4QB4A 3VA5A 1B1ZA 4ZRZA 1YNJD 5KIXA 2M00A 5C4HA 1SE2A 1JQYD 5FK9C 2SNSA 4HR7B 4BBSB 2C5CA 3VYUA 4FF3A 2HUGA 4NW2A 4C3HG 1E0BA 2X6GA 3KBGA 2WP8J 3I73A 1ENAA 1S5CD 2A6HC 1BUVT 3OOCA 1NR4A 1G91A 3N52A 5JOBA 4FYDA 1GUOA 3VA7A 2HCCA 3RZDB 1G6ZA 1GJXA 1MBYA 3HOZB 4EQPA 3SE0A 3NE5B 3VR4A 5C44B 4KMUC 3E5SA 1STHA 2PYKA 4G4KA 5CR3A 1LO5D 2A68D 4V190 3A7AB 1PMRA 4WJWA 3TBIB 1ILPA 3TP6A 3UI2A 4CKBA 5KNBA 5KYLA 4L6TB 5CV5A 2AQ3B 1SNQA 3D31A 5NUCA 1IYUA 3T16A 4IN3A 1B2TA 4IFDJ 1EY4A 2A6HD 1PFNA 2F0LA 1SMYC 2KCNA 4G57A 3Q24A 2QDBA 1K8MA 1W6JA 2F0KA 1VCIA 1ET9A 4K5WA 1E2WA 1H9RA 1X3PA 2E74C 3PUYA 4RFBA 4A3BB 3DMUA 4JK1C 5AFWA 3HEJA 3J7AV 3LWUA 1UAPA 4RGNA 5CORA 3ND9A 2H1EA 2MP1A 3NTHA 3X3NA 5C0XJ 5M5XB 1EQTA 1SYDA 5CV9A 1B4OA 4ULLA 1ET6A 3VR5A 1D5ZC 2B2YC 2NYZD 2EY6A 4J8QA 4IFDI 5BN5A 4P2CB 1EU3A 4KJNA 4TRDA 5DNFA 3GTPB 3S16B 2WKDA 2CQAA 3T4AC 1NCVA 5IGGA 2EE1A 4B9XA 4FF2A 5LL6S 1Q1EA 2EYPA 2B2VA 3MAQA 2PNRC 3OIPA 1SMYD 2B2UC 2RQXA 2VNUD 4EVOA 1D5XC 2JEBI 3I4NB 3ZYYX 2E75C 1SDFA 3LNNA 1I4QA 1C4QA 3A8IE 3QO2A 4OO1G 1DCZA 2PZWA 5DM63 3Q0AA 1GUSA 3H0GB 2WB1B 1MI2A 2FHTA 4Q5VA 2IWHA 2DNCA 3K7AB 2MJ8A 2KA7A 5C5LA 1SE4A 2AWOA 4FF1A 2K1BA 1I3QB 1Z7TA 1U4PA 3I4LA 4X3UA 2E2IB 1HFNA 1QG7A 4CKCA 1MD2D 2EPBA 1TWHB 3SK8A 1BO0A 1AN8A 4IFDH 3TMEA 4BBRB 3K5OA 4XTCS 4OL7A 3S1NB 5I2YA 5EKKA 1LLRD 1LT4D 2NVQB 1DONA 1II3A 2K7VA 1RTNA 5FLXL 2PZTA 2JYOA 1DJRD 3SVMA 3PUWA 4ZKBB 1HA6A 5C0XH 4H13C 1RCVD 1B53A 1OO9B 5FO8B 4NP5A 4S3SA 3FMCA 2BDNA 1EY9A 3TDQA 1VMCA 4DA2A 2KEDA 4TSSA 3E0JA 1GUWA 1ZEQX 1KABA 1GHJA 3A8KE 1TR5A 3DWQA 1AW7A 2PO4A 1EY5A 1BQQT 3WDNA 4QUCA 4RHSA 3TN2A 2F3WA 2JSOA 4DN4M 1WTPA 1UEAB 2M2LA 3K5NA 1VF7A 3PUZA 4C56C 1SYFA 4N9PA 2MGSA 4LMQD 3HKZB 5EGTA 2K5DA 3ITPA 1TS3A 5IT9E 1FGBD 1MSHA 1F9PA 3MZ5A 1G8ZD 1EEFD 3MFYA 3NBIA 2XVSA 3A7LA 1EEID 2BDOA 2ZT9C 3TSSA 3O13A 3RZOB 4RKLA 2IX1A 4A3GB 1ZYRD 4A3KB 1UNSA 5EPKA 4U68A 3HOYB 2EJMA 4ZUJA 1L0XB 1TWAB 5ELEA 1GUNA 2ID0A 1SSOA 3EJIA 3NTIA 4C2MB 2LFNA 1A3UA 2K33A 2R93B 1XYIA 3FEWX 2Z4IA 4C3JB 1IKMA 4NDXA 2R92B 5HURA 3DUZA 1Q90A 1EY7A 2WV6D 1KLUD 2X6LA 1TQOA 4WFN3 2WACA 1ZKOA 1WTVA 1RKNA 1WTQA 2RVLA 4QIWB 2HQEA 4IUTA 1I4RA 3T53B 3C2PA 3I4MB 2OEOA 4BY1B 1EU4A 3K0YA 5A2QE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QCB D;  4FNF A;  5G3L F;  4FP5 D;  5G3L D;  4FO2 A;  1TII D;  1QB5 D; 
#chains in the Genus database with same CATH topology
 1XPO A;  4JI5 L;  1SYE A;  3PO3 B;  2NVY B;  1VQB A;  1D6E C;  3ZJY C;  4RWS C;  5C4X B;  4QF4 A;  4PV1 C;  4EQO A;  1F2L A;  3Q6S A;  2Y0S B;  4DV6 L;  2QEX A;  2B2W C;  4IUV A;  4IOC A;  3D0F A;  5JVH 3;  4POF A;  1VQI A;  1LTS D;  3H91 A;  1IL8 A;  4A3K H;  4LFB L;  1MKH A;  4XQJ A;  2B2V C;  3AU7 A;  5IT9 L;  4V0B A;  4DV3 L;  3HOY H;  3Q23 A;  2KQ3 A;  3GTK B;  1TWA H;  4GOP A;  1S5F D;  1XNQ Q;  2JA9 A;  3HOZ G;  3ICE A;  1F9Q A;  3NUC A;  1QZG A;  2XNA C;  1H9S B;  2B2Y A;  4A3E H;  2R93 H;  1SJH D;  1STN A;  2FMM A;  3BVG A;  3TRZ A;  1LYL A;  1YBY A;  5DAU A;  5ELN A;  2PPB C;  4QGU A;  1ML0 D;  4A93 G;  5CC4 A;  1IL2 A;  2EYF A;  1EWC A;  2ICE C;  1B9N A;  2EOT A;  3BZC A;  3KLS A;  3FPU B;  2VB3 X;  1HUM A;  2UUC L;  1PZK D;  5I6Y A;  4FF4 A;  1PH1 A;  5JJK A;  3AMU A;  3CF5 A;  4XDX A;  3GTJ B;  5EKL A;  2G9D A;  3I70 A;  2B2U A;  3H3V C;  3CCR A;  3S1R B;  4RA8 A;  4LF8 Q;  3BG3 A;  3GO5 A;  4K0K L;  1BKB A;  1TU2 B;  4BY1 H;  1C48 A;  1OXS C;  1BCP D;  2KJX A;  4MN3 A;  2R7Z B;  3F1Z A;  4KJO A;  5K36 G;  3PO3 H;  2NVY H;  4XQQ A;  2XSC A;  2HDM A;  2A73 B;  2WII B;  4UP9 A;  3MVV A;  5C4X H;  5I4D A;  2VQF L;  5IWA L;  2EY5 A;  2RCF A;  3J7Y W;  1E2V A;  4APV A;  4JBM A;  4RHR A;  3SGI A;  3QG1 A;  3ER0 A;  1ICF B;  1NJI C;  1JJ2 A;  3M7N A;  3F2C A;  1MGS A;  5JEA G;  3JAM E;  1VMP A;  1YIJ A;  4LF4 L;  4IJH A;  1HQR D;  1JE4 A;  1Q8I A;  4C3I B;  1HHV A;  4X65 L;  5E1F A;  1D1I A;  1TWG H;  3J81 L;  1H9J A;  1V1P A;  3GTK H;  3T56 B;  2L5T A;  1HA5 A;  3S24 A;  3IFT A;  4CHT B;  5LMU Q;  4IPD A;  5IY0 A;  3OMG A;  1VQ9 A;  1QIL A;  1LTA D;  3VYS A;  4PMC A;  2BE5 C;  2E76 C;  1B70 B;  2I5H A;  1L2F A;  4JV5 Q;  5D14 A;  4Y52 H;  3JC6 6;  1CK1 A;  5IYD H;  1K3R A;  3HG9 A;  4NPS A;  2F0F A;  3QB3 A;  4QMG A;  4X3K A;  2X69 A;  3H6M A;  4O2D A;  2PNH A;  1QVG A;  1K8O A;  2XRS D;  4AYB G;  3GTJ H;  3I55 A;  4JVZ A;  2LKV A;  4LF6 Q;  1LAB A;  3HP3 A;  2K03 A;  2K6A A;  4XT3 B;  3N6R A;  4HJA A;  3S1R H;  4IOA A;  4N8F A;  3UDI A;  2UXB Q;  1A6X A;  4RH6 A;  3J80 E;  1Z6H A;  2KCM A;  4DV5 Q;  5IT9 c;  4MZ9 A;  4ID6 A;  1KAW A;  1CQV A;  2Q8R E;  4UP7 A;  2JA8 G;  1Q12 A;  4ABN A;  4L5S A;  3GTG H;  3KK7 A;  3ERO A;  2B63 B;  1A3T A;  1QVC A;  3CME A;  1PYW D;  5K5P A;  1JOQ A;  2KOL A;  1STE A;  2KHJ A;  1BR9 A;  5I6W A;  2ZM6 L;  1BVS A;  3M85 A;  3DM3 A;  4HSV A;  4G7H C;  4KY7 A;  3CCV A;  4PZ6 A;  5KND A;  3U9S A;  1I4P A;  3A5U A;  3LWE A;  1LTB D;  2PMZ E;  3GD7 A;  2NN6 I;  3AQQ A;  2BE5 D;  1T5X D;  3RLO A;  2Z9H A;  1AP0 A;  2QIL A;  4UP8 A;  1Y1W B;  1PRT D;  1IBK Q;  1JR0 D;  3I4O A;  1PH6 A;  2RDF A;  1EY8 A;  4EX5 A;  1GHK A;  3F8T A;  4XYQ A;  3C3L A;  3A0J A;  3JAM L;  3B6Y A;  2F0M A;  1NAP A;  5IP9 H;  5IGD A;  1VQO A;  2IX0 A;  4DAM A;  4DR1 Q;  4BA1 I;  2R6G A;  4AQY Q;  5FOB B;  3TQY A;  1VQN A;  1SAP A;  2CWP A;  1FVI A;  4IUN A;  3M4O B;  2GVA A;  1V8Q A;  4O1N A;  4JV5 L;  1R9T B;  3NXW A;  5ISR A;  3HOX B;  1FD7 D;  2WAQ G;  4UAI A;  1I50 B;  2BA0 A;  4LFC L;  3M7G A;  1Y8N B;  3S17 B;  4FDB A;  4DF7 A;  2L1B A;  4B3S L;  1F77 A;  1EIH A;  4GN5 A;  1XMO Q;  4NXN Q;  4DXF A;  4RKB A;  1B44 D;  1EYA A;  4A3I B;  1X32 A;  1TVX A;  3I90 A;  3J81 c;  4B3M L;  4DU9 A;  2ZJR A;  2B63 H;  2G9H D;  2KHI A;  1JT8 A;  4DV1 Q;  2UXB L;  1R4Q B;  3FKI G;  2JEA I;  1J5E L;  3UDF A;  1N34 Q;  2CW0 C;  1CKM A;  4M8A A;  3KF8 B;  1ICW A;  1CSQ A;  1KNE A;  3NWT A;  1PFM A;  2CVR A;  2I5L X;  2NN6 H;  5IP7 G;  5T1G A;  3PF5 A;  2B39 A;  4ODG A;  3BYY B;  4OON A;  3A55 A;  2E5L L;  2I5M X;  1DOM A;  5LHY 1;  4A3D B;  1JOO A;  1Y69 U;  1Y1W H;  2L11 A;  1ROD A;  1AFP A;  4FNF A;  3E6Z X;  1TWC B;  3A8J E;  4GOP C;  1TT2 A;  4JBW A;  4NKL A;  1E1O A;  5ELB A;  4KKS A;  3PIO A;  1IBK L;  4HSP A;  4B3T Q;  4HJ7 A;  3FP9 A;  1E3P A;  4JC0 A;  3M4O H;  4A3C G;  1BXT A;  1R9T H;  1KHI A;  2F0J A;  4OX9 L;  5L37 A;  1QOH A;  1I50 H;  2KBN A;  3PV0 A;  3K58 A;  3PUV A;  2MPM A;  1CZG A;  1VQH A;  3SEB A;  2QF7 A;  3F2B A;  2B2W A;  3MTS A;  3S17 H;  1PZJ D;  1AEX A;  4BY7 B;  3CCE A;  4A3G G;  3FRP B;  2LY7 A;  2NZO A;  2ENB A;  2MNA A;  4QQB X;  4FVM A;  4ZUI A;  2SOB A;  4JCV E;  4AYB E;  1KLG D;  1KRT A;  2RHS B;  5KGU A;  5CYU A;  1C7Y A;  2WFW A;  3VYR A;  1MJE A;  2QCP X;  3GTO B;  4A3J G;  3NEM A;  5JPN C;  4NXN L;  1TS4 A;  2K05 A;  5ELD A;  4F8M A;  2HCI A;  4B3R Q;  1PYS B;  1AH9 A;  1KDB A;  4LWC A;  2N55 A;  3ULP A;  1CKO A;  4C3J G;  1HH2 P;  4FXG C;  3JAM c;  2R92 G;  1HZA A;  1A2T A;  1CHP D;  3CRL C;  4YCW A;  2AQ1 B;  2SNM A;  3RNU A;  1SRO A;  3SK4 A;  4M1U B;  4DV1 L;  4NXM L;  1WTH A;  2JA6 B;  2GN5 A;  1DZ1 A;  4ZYS A;  1N34 L;  2B2T A;  1F2Z A;  4QJF A;  4DK3 C;  4A3D H;  5CBA E;  1WTR A;  3S9W A;  1CKN B;  5D3I B;  1NBW A;  1QWY A;  1STY A;  2RKS A;  3NQI A;  3NBH B;  4A3M G;  1J9O A;  2F0W A;  1TWC H;  3ULJ A;  1PHJ A;  4K5X A;  1LAC A;  3I4M G;  4H7B A;  3EFX D;  3EA6 A;  3MFG A;  4GKJ Q;  1X3E A;  1UE6 A;  1WFQ A;  5IYB G;  2O4X A;  4C3H B;  4IPC A;  4ZQ3 A;  3P20 A;  3I2Z A;  2A19 A;  3I3C A;  3SXH A;  3K0X A;  2NZ1 D;  4XIG S;  1SYC A;  2JA7 B;  2SDF A;  4K8I A;  1E24 A;  2EY1 A;  1H9K A;  2UU9 Q;  1JC7 A;  2Y0S G;  3EQL C;  2F0T A;  5JJI A;  1U4L A;  1O7I A;  2D0P A;  1R4P B;  4KN7 C;  4B3T L;  4BY7 H;  1B3Q A;  2AWN A;  2Q2U A;  2EDG A;  2LXK A;  5C3E G;  3GTQ B;  1Q46 A;  3M9B A;  4KKT A;  2NUC A;  1HTP A;  2WAQ E;  2ASB A;  1CSP A;  2F0P A;  2YYZ A;  1I4X A;  1S72 A;  2DGY A;  2A8V A;  4IUR A;  3PO2 G;  2OCE A;  1Q81 C;  3HOW G;  1XWE A;  4HIO A;  1HZC A;  4C1N I;  2NVT B;  3Q8D A;  3DHQ A;  1TWF B;  1EIG A;  5FKA C;  2IHF A;  4BXX H;  4JYA L;  3S1Q H;  4X3S A;  3HOU B;  5M3M B;  1PH3 A;  3G6J B;  4XXE A;  5J22 A;  1PVO A;  3K7U C;  3R93 A;  4B3R L;  1QCB D;  2F0D A;  1UUP A;  1VQE A;  3R2I A;  4DK0 A;  2H4O A;  3K5M A;  1IZ6 A;  4XYO A;  4C1N K;  1PTO C;  4KHZ A;  1PLF A;  5IGE A;  3KBX A;  1WCM G;  3T51 B;  3CRK C;  2K32 A;  3E3X A;  4CDE C;  3PIO 3;  4ALP A;  3CPW A;  4CGY B;  3J7Z C;  1FNW A;  5BR8 Q;  2QGQ A;  1RF2 D;  1M8A A;  4KY6 A;  1G2S A;  1QNU A;  4C3H H;  2R7Z G;  1LT6 D;  2F0I A;  5I9P A;  3NEN A;  4CDC C;  3UDX A;  3BDC A;  3K81 C;  2OT2 A;  1WD1 A;  2O2L D;  4A3L H;  2N49 A;  4MNO A;  2P5Z X;  1X9N A;  2IW3 A;  2DJF C;  4K8J A;  2K04 A;  2VXW A;  3D4W A;  5EBD A;  3NQT A;  1PH2 A;  4JI8 L;  3H94 A;  3BVM A;  1YJ9 A;  1VQG A;  3GTQ H;  2MO1 A;  1HNW Q;  1VQK A;  4H0L C;  2N88 A;  4C3I G;  2KCC A;  4ILW A;  3FDT A;  4LF9 L;  2E8G A;  2Q2I A;  3SK5 A;  2OTJ A;  2IT1 A;  4DV7 L;  2NVT H;  2L12 A;  2RA4 A;  4TVA B;  1HCZ A;  1TWF H;  2Z6K A;  4CDD C;  1XXG A;  3MXU A;  4CKE A;  5AJ3 Q;  3KJO A;  2JA5 B;  1PTO D;  4KV6 A;  1VQD A;  3FVQ A;  4ZAI A;  5C3X A;  3HOU H;  3HRZ C;  4J6H A;  5M3M H;  4A3E B;  5E4W C;  3TP8 A;  2NTT A;  2FFK B;  2IJ0 A;  4JG2 A;  3LGJ A;  4KY5 A;  4LW1 A;  5EQ0 A;  2RF4 A;  4DXG A;  1OXT A;  4LF7 Q;  4R8I A;  1O80 A;  1BNZ A;  1IBL Q;  3BU2 A;  3CCS A;  3KF6 A;  2J7Z A;  3RLF A;  3U9O A;  1FR3 A;  2TMP A;  2KEE A;  4KD3 A;  1TKW B;  3MEH A;  1JJC B;  1A15 A;  4K0K Q;  1P8L A;  2EY2 A;  2RSO A;  1PFB A;  3DEP A;  2L15 A;  4IPG A;  3U4V A;  2IPK D;  1DGS A;  3P7J A;  3G4S A;  5M3F B;  1A0I A;  4L8J A;  2F0U A;  4CJ2 C;  4OO1 I;  3EVQ A;  3OW7 A;  2VQF Q;  1T5E A;  2RDG A;  3SDZ A;  1U4M A;  5CV8 A;  2F4V Q;  5EJW A;  3H09 A;  3MC0 B;  1BBW A;  3C1E A;  5BR8 L;  2KEC A;  4LUV A;  4BBS G;  4LFA L;  4R8N A;  4OHJ A;  2ZJQ A;  1SXT A;  4HED A;  4LF4 Q;  4DNR B;  1STB A;  3I72 A;  4X65 Q;  3W1B A;  3OIQ A;  2F03 A;  2XWB B;  1C8C A;  4PQX A;  4DAY A;  3CC2 A;  2VZA A;  2UXD Q;  2F0N A;  3PIP 3;  3E9I A;  4NB3 A;  4EGV A;  5HGT A;  1SNP A;  1XX8 A;  3D4D A;  5CV4 A;  1E2Z A;  1CT1 D;  1GO3 E;  4GLA C;  2HT1 A;  1O78 A;  3IKJ A;  3WWV A;  5C4J B;  1TWG B;  1HNW L;  4YCV A;  4QUF A;  3ERS X;  4RAU C;  4BA2 I;  3PQI A;  4GLV B;  4O42 A;  2JA5 H;  3TEH B;  4CDF C;  2IHE A;  2NWG A;  3TP5 A;  4A3F B;  4DGZ A;  3MXN B;  1I4G A;  1CI3 M;  3MEF A;  2AHO B;  4IUP A;  1WTX A;  2VUM H;  5C44 G;  3L2P A;  4DNT B;  1LTI D;  1F9R A;  4PMB A;  1IW7 C;  1HUN A;  4DAP A;  4L5T A;  5AJ3 L;  3HOX G;  5IGF A;  3I56 A;  1GUT A;  4LNQ A;  4I65 A;  2B2T C;  2LXJ A;  4KD4 A;  4XQN A;  3DEO A;  4PZ7 A;  4LF7 L;  1GUG A;  1WTO A;  3MXP A;  2EJG C;  3MHB A;  4OO1 H;  2NZH A;  1IBL L;  1JE5 A;  4UY8 C;  1P16 A;  4A3I G;  1A3V A;  3R3O A;  1DM0 B;  5M3F H;  1HNX Q;  2V4D A;  5EPL A;  3D4R A;  4QL5 A;  2BH8 A;  3RN5 A;  1EZ8 A;  2DY8 A;  2HD3 A;  5IYC H;  1K8G A;  4U67 3;  2Z4H A;  3ERQ A;  2ZM6 Q;  2F0Q A;  1Y1V B;  4JI4 Q;  1GM5 A;  3QOJ A;  1BCP F;  3Q22 A;  3FHW A;  3CQZ B;  1Y8O B;  3GTG B;  1NSN S;  4DR3 L;  2AUJ D;  1O7Y A;  3KUP A;  3NEL A;  5C5M A;  2QKI C;  4K2L A;  1F2Y A;  1SEB D;  5LMN L;  4H02 A;  1STA A;  4EQ5 A;  2ZXR A;  2Z1C A;  2F4V L;  1TS2 A;  4FXK C;  2FXQ A;  4DPG A;  2ATW A;  2OWO A;  2ES2 A;  4A3B G;  1Y8P B;  2DJG C;  2F0S A;  3BZD B;  1SE3 A;  5IGB A;  3W2D A;  5A2Q L;  4RG1 A;  5C4J H;  2PCF B;  1F2M A;  3U50 C;  2C9O A;  5LL6 X;  4KK7 A;  2A6E C;  1K8A C;  1QJO A;  1RJT A;  1YNN C;  2UXD L;  4IFD G;  2Z8L A;  2NB0 A;  4CJ1 B;  4OWW B;  4X62 Q;  3HOV B;  2EJF C;  4A3F H;  2PZU A;  2F0V A;  4P72 A;  1A2U A;  1JWS D;  2EYJ A;  4XT1 B;  1JWU D;  3BJU A;  2O5I C;  1XPR A;  1AZP A;  2KVM A;  3AEV A;  1UE5 A;  1JMC A;  4LFC Q;  4F87 A;  4X64 L;  3J7A F;  5EAY A;  4JI0 L;  4B3S Q;  2JE6 I;  3F2U A;  1HXY D;  3CP0 A;  3K59 A;  1JOK A;  3R8B A;  3VR2 A;  1BCP B;  3HS0 C;  1I6V C;  3KLR A;  4L5R C;  2PQE A;  4H44 C;  5C3W A;  1JIC A;  3F2D A;  5G3L D;  3TRE A;  3NP8 A;  5C0X G;  4B3M Q;  3S2H B;  2R3Z A;  1SNC A;  1LUZ A;  1KNA A;  3EBE A;  1FJG L;  4F88 A;  1OXX K;  3A56 A;  4P75 A;  1J5E Q;  1E22 A;  2B3G A;  3UE0 A;  2RSN A;  3I4N G;  2IX3 A;  1QB5 D;  1Y1V H;  5E4X A;  2L4N A;  3M4P A;  2L0C A;  5CGK A;  3KLS X;  5FO9 B;  5FLM H;  3CQZ H;  3U4Z A;  5TSS A;  4MTN A;  3S15 H;  4B08 A;  1HNX L;  1HRJ A;  4FP5 D;  4YWM A;  2Q8T A;  2A5H A;  2E5L Q;  3H0G G;  2WB1 G;  2H5X A;  4BWG B;  4YWK A;  5KYI A;  4JI4 L;  2JA6 G;  1G29 1;  2EXZ A;  2A6E D;  4O0A A;  5I2X A;  4NMZ A;  1JOR A;  3BDO A;  3BS1 A;  1TS5 A;  2OF1 A;  2EYO A;  1KAA A;  5JJZ A;  2RBM A;  3CCL A;  3CAM A;  4R1J A;  1OTC A;  2HHH L;  3SHL A;  2R7F A;  1EIF A;  1S5B D;  2B8G A;  1CA5 A;  2EVB A;  1LT3 D;  3J81 i;  1PRT F;  5JVG 3;  4OIJ A;  5ELF A;  1FNU A;  2FIN B;  3MA2 B;  5CMD A;  3T13 A;  3HOV H;  5DM7 3;  4BBR G;  1VQ4 A;  1RDP D;  2VQE L;  3H3V I;  2VL6 A;  2Z6K C;  2PMZ B;  5COY A;  1PDQ A;  3OWE B;  4IPH A;  2EQS A;  4OX9 Q;  2JA7 G;  1N32 Q;  4YIJ A;  1EL0 A;  2IL8 A;  2ALY B;  4X62 L;  4DR5 L;  4QCL A;  3QWN A;  3PSI A;  2D0O A;  2DN8 A;  4EQN A;  4I7Z C;  1O7Z A;  5M5Y B;  1TXY A;  1IKL A;  5J39 A;  3C1F A;  4TQU S;  3S2D B;  3M4Q A;  3M3Y B;  1JWM D;  3CU7 A;  3KLW A;  3TS0 A;  3URY A;  2WIN B;  3S2H H;  4FXD A;  1H9S A;  4LK1 C;  1V1Q A;  3MXN A;  3NHH A;  4J1M A;  2RDH A;  4CBV A;  4OEM B;  3G6E A;  5HGQ A;  1PXU A;  3RD4 A;  2KCT A;  3UDG A;  1KL9 A;  2F4I A;  4JBK A;  2KUM A;  2OQ0 A;  4TKO B;  4JI3 Q;  4A93 B;  3L7Z C;  1WJJ A;  5KRU A;  3DXJ C;  2UUB Q;  4WOR A;  2Z6B A;  1SRU A;  4NXM Q;  5IIF A;  1IHZ A;  1PRT B;  1SNO A;  1BDO A;  5ELC A;  4DKA C;  1TII D;  4KI0 A;  1EWH A;  5JEA J;  1IBM L;  3J80 L;  2HDL A;  3NPP A;  5FJ8 H;  2BCO A;  2FJ2 A;  1QNK A;  1PA6 A;  1XNR Q;  1HPC A;  2EYM A;  4R4I A;  1BBX C;  5BN4 A;  1YZ6 A;  4HCS A;  5KEE A;  3CCQ A;  4RCO A;  2BA1 A;  3KDF B;  2CFM A;  3BYT B;  5IOD A;  2I0Q A;  3GV6 A;  4YWL A;  1KC8 C;  2ZXO A;  2DUD A;  3HKZ G;  1L1O B;  2YU9 B;  1ENC A;  4DK6 C;  3NWS A;  4HN7 A;  2CCZ A;  4Y7N B;  3GV3 A;  3JAM i;  2D9U A;  2JQO A;  1DOK A;  5F2D A;  1D7Q A;  2AUK A;  5J1Z A;  1FYC A;  4LJZ C;  1EYC A;  5M5Y H;  2F0E A;  1G2T A;  5FLX E;  3S2D H;  4DFA A;  3M3Y H;  1N32 L;  1RD9 D;  4RGM A;  3HOZ H;  5EPJ A;  4HMJ A;  2JK8 A;  1G6P A;  5I9O A;  4A3K G;  1SFO B;  4K2K A;  1HZ9 A;  3DWP A;  3HOY G;  2WKC A;  1IYV A;  2MQH A;  2CW0 D;  4P73 A;  4JYA Q;  4A93 H;  1NMG A;  2K5W A;  3D3R A;  4MHE A;  5CBE E;  3C46 A;  1GD7 A;  3GP7 A;  1E7Z A;  1VQF A;  1OXU A;  3T1H Q;  3TS2 A;  1C9O A;  5EBC A;  2I07 B;  2PI2 E;  3IAY A;  4A3E G;  1HTL D;  1ASY A;  2R61 A;  1YI2 A;  2R93 G;  3OSO A;  4L5Q A;  4JW0 A;  5JAV A;  3PMF A;  4AYB B;  3P1H A;  4JI3 L;  3S1Q B;  1B7Y B;  1RTO A;  3WOE A;  2UUB L;  5C0X I;  4DR4 Q;  1LM0 A;  2WB1 E;  4UDU C;  4GLX A;  3NTK A;  1MSG A;  4OWX B;  4E6I A;  1VQP A;  3PGZ A;  3X3M A;  2RCN A;  1B3A A;  3EIV A;  4PMW A;  1A63 A;  3ONA B;  4IAL A;  4KHP Q;  2JA8 B;  1I5F A;  5K36 H;  1WVL A;  3AB9 A;  2JJQ A;  3FPP A;  2E2H B;  1QUQ B;  2QA4 A;  1LV9 A;  4DR7 Q;  1T9H A;  1XNR L;  4KTA A;  2I46 A;  2J0T D;  2YU9 H;  1DD2 A;  1X6O A;  3QOL A;  3PF4 A;  4BY1 G;  1FNV A;  3MXG A;  4Y7N H;  5JEA H;  4HJ5 A;  3CKI B;  3CXC A;  4JI8 Q;  3MWY W;  3PO3 G;  1U4R A;  1J8I A;  1ILQ A;  1JJG A;  5C4X G;  3QR8 A;  1PFS A;  2A1A A;  1OXV A;  1I94 Q;  3W1G A;  4RMF A;  3WOF A;  2YTY A;  4LF9 Q;  1TY0 A;  2UUA Q;  1I4H A;  2NVX B;  1A62 A;  2LS0 1;  1SNM A;  1SN8 A;  4LF5 L;  3J80 c;  4PZ8 A;  1O7L A;  3G48 A;  3QJY A;  3A54 A;  1BF4 A;  4DV7 Q;  1SFO H;  3VR6 A;  1CTM A;  1BBU A;  5JPM C;  1X56 A;  2JXM B;  3G7L A;  3I8Z A;  1EY0 A;  4A4I A;  1G51 A;  2MUY A;  3GTP H;  2YTX A;  2KHS A;  4GOP B;  1VQ8 A;  2ICI A;  4Z9C B;  2E2J B;  1EFI D;  2A69 C;  2EYL A;  1NMF A;  1EFW A;  2K75 A;  1YNX A;  1RHP A;  2WAQ B;  2HIX A;  1WD0 A;  2QW7 A;  2OQK A;  4Q0F A;  3IRB A;  4R4T A;  5IYD G;  5M5W B;  1VQL A;  3STB C;  3T1H L;  4GZY C;  1PV4 A;  3S1M B;  1KRS A;  1CHQ D;  1K73 C;  1EYD A;  2JA8 H;  1S5D D;  1SJE D;  1QZH A;  2E2H H;  1EUJ A;  1ZYR C;  4DR4 L;  3OHX C;  1U9R A;  3CCM A;  2N78 A;  3FKI B;  3KF8 A;  2MHV A;  1ESF A;  1Q1B A;  1M4V A;  5C4Z A;  3TZU A;  1ONL A;  3ND8 A;  3OMC A;  3IFD A;  2CQO A;  4KHP L;  2YTV A;  3NSW A;  1KDC A;  1MJC A;  4LFA Q;  2GA4 B;  3K5L A;  1JCK B;  4UHV A;  1VDZ A;  4HJ9 A;  3HKZ E;  4DR7 L;  3BDL A;  1WOC A;  3LX0 A;  4KLK A;  3OTO L;  1GKH A;  1S5E D;  1SR3 A;  2A74 C;  1HQM C;  3KDF A;  1YVC A;  2F0H A;  4OGQ C;  1L0Y B;  2NVX H;  1LTG D;  4GNX B;  1EOT A;  3E9H A;  1ENF A;  2L9H A;  1L1O A;  3V05 A;  3VYT A;  4X66 Q;  3S1N H;  4QY7 A;  3I7F A;  4AIM A;  3S14 B;  2A69 D;  1VQA A;  4IUQ A;  2BH2 A;  1I94 L;  2HQL A;  4K14 A;  4K5V A;  3D6C A;  1VF5 C;  2G5D A;  3QIA A;  3GTM B;  2UUA L;  1Z47 A;  1V1P B;  1ESR A;  1M1K C;  2OXP A;  5GQO A;  1CM9 A;  1PZI D;  2DNE A;  1JB3 A;  2ZXP A;  2E2J H;  3BVZ A;  3V2T A;  4G7O C;  1S4Z A;  3PCO B;  4DUY Q;  1X3Q A;  2BOS A;  1ZXT A;  1PTO F;  1KQS A;  1XJV A;  3RMH A;  3K6O A;  1EQR A;  5IP9 G;  1GXD C;  5M5W H;  3V96 A;  1EY6 A;  1CZW A;  2J4X A;  1VQ6 A;  3S1M H;  2K28 A;  2VUM B;  3TZD A;  1PH5 A;  2K5N A;  1QE6 A;  5D65 A;  1SBB B;  2VS1 A;  1CQF A;  4R9W A;  4A3J B;  2EZV A;  2ZTE A;  3EN2 A;  5FO7 B;  3H15 A;  2UXC Q;  3T1Y Q;  4L63 B;  4HID A;  3KYH C;  3FKI H;  4JOI C;  4ME3 A;  1B8A A;  3R2T A;  3ULL A;  4IJL A;  1QVF A;  4YY3 Q;  3AFQ A;  2ZTD A;  1VQM A;  1HR0 L;  4DR3 Q;  4QIW E;  5IP7 H;  4IZ8 A;  5J3B A;  3P75 A;  5LMN Q;  2B63 G;  5LMN W;  1N33 L;  1TY2 A;  3D8G A;  1CFM A;  1CKN A;  2XRQ D;  3D6W A;  3GQB A;  5GRO A;  1XTC D;  4X3T A;  2K01 A;  2SEB D;  3NBH A;  4HAE A;  1BOS A;  2D2C C;  3AYH B;  4A3M B;  2F0O A;  4PNY A;  2NN6 G;  5D3D A;  1WTW A;  5CV7 A;  2E2D C;  1K0S A;  2F0G A;  4B9W A;  4DK1 A;  1PTO B;  5A35 A;  1JB7 A;  2Y0S E;  1CA6 A;  4WRD A;  1EQV A;  3S14 H;  5H1S E;  4YCU A;  1X54 A;  3GTM H;  2N8N A;  5HY6 A;  2L55 A;  1Y1W G;  1K83 B;  3J81 E;  1I6H B;  1D2B A;  2XTI A;  4X66 L;  4JI2 L;  4JBJ A;  5EKI A;  1NR2 A;  4A3C H;  1EZ6 A;  1Y14 B;  2B29 A;  2M9V A;  2QEJ C;  2NBF A;  1BCP C;  1HFG A;  4FO2 A;  4X64 Q;  3OWF A;  4DAV A;  3RZO H;  4JI0 Q;  1D1K A;  4A3G H;  4KN4 C;  1EIY B;  5E7N A;  1NUC A;  3OW2 A;  1KTK A;  4LUO A;  5C3E B;  4DR2 L;  3BZK A;  4DUY L;  4JI7 L;  4K6L A;  4ZK9 B;  1K9M C;  3W3A A;  4P71 A;  1AZQ A;  1V43 A;  1U5K A;  3SR1 A;  4POG A;  3PO2 B;  4KHV A;  4A3J H;  5M9O A;  3HOW B;  1FJG Q;  4C2M H;  1YHQ A;  2K5Q A;  1B50 A;  1DYQ A;  4AH6 A;  3NK9 A;  2PW7 A;  4C3J H;  2XGT A;  5IOC A;  1DXM A;  2R92 H;  1E1T A;  5ELO A;  4DV4 Q;  4IQZ A;  2UXC L;  1LT5 D;  3T1Y L;  1YHA A;  2PQA B;  4RGT A;  3CPF A;  2F52 A;  3VDY A;  1B9M A;  4YY3 L;  3OPO A;  3CHB D;  4IUU A;  1N9W A;  5KNC A;  1WCM B;  2VB2 X;  3HFZ B;  3S15 B;  4A3M H;  1KDA A;  4ZLT F;  1NY4 A;  2B8F A;  2EYH A;  3HZX A;  4ME5 A;  2DY7 A;  1PTO H;  2XN9 C;  5E3F A;  1S40 A;  3I4M H;  2HHH Q;  3RUZ A;  1W6K A;  5IYB H;  1LTR D;  2K52 A;  3CMA A;  3SK6 A;  4RGO S;  4BS9 A;  4A3D G;  2XWJ B;  1AE2 A;  1KXL A;  2C35 B;  1K83 H;  5CV6 A;  3KOJ A;  4MIU A;  1NTG A;  1K0R A;  2VQE Q;  1I6H H;  2O5J C;  4F7X A;  1F9S A;  2D62 A;  4CJ0 B;  4RCN A;  5C6A A;  1IW7 D;  2PW5 A;  1H9M A;  2JP1 A;  2KEN A;  4GNX A;  4DR5 Q;  3GTL B;  1H95 A;  1CUK A;  1LTT D;  2AQ2 B;  2IY5 B;  1YNJ C;  3TP7 A;  4KKU A;  4X6A H;  1SND A;  5C3E H;  3VR3 A;  1UE7 A;  3CW2 C;  1XMQ Q;  2NTS A;  4JI6 Q;  3PO2 H;  2EXD A;  4HCE A;  5BN3 A;  3HOW H;  2TSS A;  5IE8 A;  2XIW A;  5IGC A;  1M90 C;  5T1I A;  3KFU A;  4BY7 G;  4P74 A;  3A5Z B;  5DEH A;  3PUX A;  1V1O A;  4HMI A;  4HTH A;  3AFP A;  5GAD C;  3K57 A;  5G3L F;  4OIK A;  3DWA A;  3RLN A;  1VQ5 A;  1PRT C;  3RN2 A;  1XNQ L;  3DM1 A;  1STG A;  1SYG A;  4K6D A;  4LAA A;  4N9T A;  1UEB A;  1YIT A;  2CHB D;  3I91 A;  2YV5 A;  2F3V A;  3M4Y A;  1DOL A;  3L9A X;  1GOZ A;  1IBM Q;  1WCM H;  3DLL A;  4BXX G;  3HGB A;  1MIU A;  4R4Q A;  4DV4 L;  3CC4 A;  1XPU A;  1D5M C;  2FMC A;  4DR6 Q;  1Q3L A;  2D5D A;  2N3S A;  4DNI A;  3L3O C;  3IL8 A;  2F1M A;  2A68 C;  4G7Z C;  1W2B A;  4ZKC B;  1EOV A;  1YNN D;  2Q8I B;  2LMC B;  2R7Z H;  1L1O C;  1SYB A;  4QB4 A;  1NE3 A;  1X65 A;  3VA5 A;  1B1Z A;  4ZRZ A;  1YNJ D;  5KIX A;  2M00 A;  5C4H A;  1SE2 A;  4LF8 L;  1JQY D;  5FK9 C;  3U58 A;  2SNS A;  4HR7 B;  4BBS B;  2C5C A;  1A8V A;  3VYU A;  1YHB A;  4FF3 A;  3GTL H;  2HUG A;  3HKS A;  4NW2 A;  4C3H G;  1E0B A;  2X6G A;  3KBG A;  1UWV A;  5GAG C;  2WP8 J;  3I73 A;  1ENA A;  1S5C D;  4C3I H;  2A6H C;  1BUV T;  3OOC A;  1NR4 A;  4A3L G;  1G91 A;  3N52 A;  5JOB A;  4FYD A;  1GUO A;  3VA7 A;  2HCC A;  3RZD B;  1G6Z A;  1GJX A;  1MBY A;  1XMQ L;  3HOZ B;  4EQP A;  1U0L A;  4JI6 L;  3SE0 A;  3NE5 B;  4GN4 B;  5LMU L;  2Q2T A;  2HIV A;  3VR4 A;  5C44 B;  4KMU C;  3E5S A;  1STH A;  2PYK A;  4G4K A;  5CR3 A;  1LO5 D;  2A68 D;  4V19 0;  3A7A B;  4MTK A;  1PMR A;  4WJW A;  3HOU G;  3TBI B;  1FL0 A;  5M3M G;  1ILP A;  3TP6 A;  3UI2 A;  4CKB A;  5KNB A;  5KYL A;  1W3S A;  2ZTC A;  1GVP A;  4L6T B;  5CV5 A;  2K4K A;  1VS0 A;  1LTL A;  2AQ3 B;  2PQA A;  1SNQ A;  3D31 A;  3KJP A;  5NUC A;  4LF6 L;  4DR6 L;  2OTL A;  1IYU A;  1PH9 A;  2VW9 A;  3T16 A;  4IN3 A;  1B2T A;  4JOI A;  1IYJ B;  4DV5 L;  4IFD J;  1EY4 A;  2A6H D;  1PFN A;  3H3V H;  2F0L A;  4BBS H;  2QDL A;  1SMY C;  2KCN A;  4G57 A;  3Q24 A;  4UPA A;  2QDB A;  1K8M A;  1W6J A;  2F0K A;  2GVB A;  1VCI A;  4A75 A;  1ET9 A;  4K5W A;  3CCJ A;  1E2W A;  1H9R A;  1X3P A;  2E74 C;  3PUY A;  4RFB A;  4A3B B;  2V1C C;  3DMU A;  2VY3 A;  4R4O A;  2Z0S A;  4JK1 C;  4LF5 Q;  3K8A A;  5AFW A;  3HEJ A;  3J7A V;  3LWU A;  1UAP A;  4RGN A;  3RZD H;  5COR A;  3ND9 A;  2H1E A;  2MP1 A;  3NTH A;  3X3N A;  5C0X J;  5M5X B;  1EQT A;  1SYD A;  5CV9 A;  1B4O A;  4ULL A;  1ET6 A;  1Q8K A;  3VR5 A;  1D5Z C;  2B2Y C;  1MHW C;  3G71 A;  2NYZ D;  2EY6 A;  1K28 A;  4J8Q A;  4IFD I;  1K3B C;  5BN5 A;  4IO9 A;  4P2C B;  5C44 H;  1EU3 A;  4KJN A;  4TRD A;  5DNF A;  3HOX H;  3GTP B;  3S16 B;  1J6Q A;  2WKD A;  2JA5 G;  2CQA A;  3T4A C;  3K80 C;  1NCV A;  4DR1 L;  4AQY L;  4GKK Q;  5IGG A;  2R7D A;  2EE1 A;  4B9X A;  4FF2 A;  5LL6 S;  2VUM G;  4ZCK A;  1Q1E A;  2EYP A;  2B2V A;  4A3I H;  3MAQ A;  2PNR C;  2CH4 W;  3OIP A;  3OYY A;  1SMY D;  2B2U C;  2RQX A;  2VNU D;  4EVO A;  1D5X C;  1XTD A;  2JEB I;  3KF6 B;  3J80 i;  3I4N B;  1XMO L;  3ZYY X;  2CKZ B;  4HJ8 A;  2E75 C;  1SDF A;  3LNN A;  1I4Q A;  1C4Q A;  3A8I E;  4DV0 Q;  3QO2 A;  4OO1 G;  1HZB A;  1VQC A;  1N36 Q;  1X55 A;  1DCZ A;  5M3F G;  2PZW A;  5DM6 3;  3Q0A A;  1GUS A;  3J81 j;  3H0G B;  2WB1 B;  3OTO Q;  1MI2 A;  2FHT A;  4Q5V A;  4GNX C;  1Z9F A;  5IYC G;  2IWH A;  2DNC A;  3K7A B;  3CD6 A;  4WJ4 A;  4A3B H;  2MJ8 A;  1Q7Y C;  2KA7 A;  5C5L A;  1SE4 A;  2AWO A;  4FF1 A;  2K1B A;  1I3Q B;  1Z7T A;  4HIK A;  1U4P A;  3I4L A;  4X3U A;  2E2I B;  1HFN A;  1YEZ A;  3A74 A;  1QG7 A;  4CKC A;  1MD2 D;  2EPB A;  5M5X H;  1TWH B;  2LSS A;  5DLQ E;  3SK8 A;  1BO0 A;  1AN8 A;  3GDE A;  4IFD H;  4DUZ Q;  2AMC B;  3TME A;  4BBR B;  3K5O A;  4XTC S;  4OL7 A;  4DAY B;  3S1N B;  2K5V A;  5I2Y A;  1HNZ Q;  5EKK A;  1LLR D;  1LT4 D;  2NVQ B;  3L0O A;  1DON A;  4GS3 A;  1II3 A;  1D8L A;  2EIF A;  2K7V A;  3E0E A;  1RTN A;  3S16 H;  5FLX L;  1S3O A;  4OWT B;  4A3F G;  2PZT A;  2JYO A;  1DJR D;  3SVM A;  3PUW A;  4ZKB B;  1HA6 A;  5C0X H;  3J7A 5;  4H13 C;  2Q2H A;  1RCV D;  2K14 A;  1AE3 A;  1IXR A;  1B53 A;  1OO9 B;  5FO8 B;  4NP5 A;  4LUZ A;  3GTO H;  4S3S A;  3FMC A;  4GKK L;  2BDN A;  1EY9 A;  4I7A A;  3TDQ A;  1VMC A;  4DA2 A;  3I4N H;  4PG3 A;  2KED A;  3W5O A;  1WI5 A;  1X3G A;  4TSS A;  3E0J A;  3PIP A;  1ZEQ X;  1HR0 Q;  1GUW A;  1HR0 W;  2AKW B;  4N8X 1;  1KAB A;  1GHJ A;  1SMX A;  3A8K E;  3H0G H;  1TR5 A;  1PYB A;  1N33 Q;  1PH4 A;  5GAH C;  2ZJP A;  3DWQ A;  2JA6 H;  1AW7 A;  2PO4 A;  3K7A H;  1EY5 A;  1PH7 A;  1BQQ T;  4WJ3 M;  3WDN A;  1Y1V G;  4DV0 L;  4J15 A;  4QUC A;  1N36 L;  4RHS A;  3TN2 A;  2F3W A;  1VQ7 A;  5FLM G;  1I3Q H;  2JSO A;  4R4C A;  4DN4 M;  4OEL B;  4HIM A;  1WTP A;  2MFI A;  2E2I H;  1UEA B;  4YHH Q;  1RIP A;  1YJN A;  4JI1 Q;  1TWH H;  1WYD A;  4DV2 Q;  2M2L A;  3K5N A;  1VF7 A;  3PUZ A;  4C56 C;  1SYF A;  4JI5 Q;  4BBR H;  1VQJ A;  4N9P A;  2MGS A;  2CWA A;  4LMQ D;  4JI2 Q;  3HKZ B;  5EGT A;  2NVQ H;  2K5D A;  1N8R C;  2JA7 H;  3ITP A;  1Q82 C;  1PH8 A;  1EYG A;  1TS3 A;  5IT9 E;  4DV6 Q;  4DUZ L;  4GKJ L;  1EWI A;  1FGB D;  1MSH A;  1F9P A;  3MZ5 A;  1G8Z D;  1EEF D;  3STB D;  1RL2 A;  3HOV G;  4DR2 Q;  3MFY A;  3NBI A;  4JPB W;  1HNZ L;  2XVS A;  4LFB Q;  3A7L A;  1EEI D;  4DV3 Q;  1KIX A;  4JI7 Q;  1HJP A;  2BDO A;  2ZT9 C;  3TSS A;  3O13 A;  3RZO B;  4RKL A;  2UU9 L;  2IX1 A;  4A3G B;  4OXP A;  1ZYR D;  4A3K B;  1UNS A;  5EPK A;  1YJW A;  4U68 A;  3HOY B;  4A76 A;  2EJM A;  1L0W A;  4ZUJ A;  1L0X B;  1TWA B;  1X3F A;  5ELE A;  1GUN A;  4GN3 B;  3CC7 A;  2ID0 A;  1SSO A;  3EJI A;  1SE8 A;  3NTI A;  1FGU A;  4C2M B;  2LFN A;  1A3U A;  2UUC Q;  2K33 A;  2R93 B;  1XYI A;  3FEW X;  2Z4I A;  1SLJ A;  4C3J B;  1IKM A;  4NDX A;  1C0A A;  2R92 B;  2K5H A;  2MO0 A;  5HUR A;  1EQQ A;  1ASZ A;  3UE1 A;  3DUZ A;  1Q90 A;  1EY7 A;  2CH4 A;  2WV6 D;  5FLX c;  1KLU D;  2PI2 A;  5JJL A;  1NNX A;  5GAE C;  2F3I A;  1UE1 A;  2X6L A;  1TQO A;  1QUQ A;  4WFN 3;  2WAC A;  1ZKO A;  1WTV A;  1RKN A;  1WTQ A;  2RVL A;  4QIW B;  1Q86 C;  2K50 A;  2HQE A;  4IUT A;  1I4R A;  3T53 B;  5FJ8 G;  2RHQ B;  3C2P A;  3CCU A;  3I4M B;  5IWA Q;  2OEO A;  2JN4 A;  4YHH L;  1KD1 C;  1V9P A;  4BY1 B;  1EU4 A;  4JI1 L;  4DV2 L;  3K0Y A;  5A2Q E;  3RR5 A; 
#chains in the Genus database with same CATH homology
 1SYE A;  3PO3 B;  2NVY B;  1D6E C;  4RWS C;  5C4X B;  4QF4 A;  4PV1 C;  4EQO A;  1F2L A;  3Q6S A;  2Y0S B;  2B2W C;  4IUV A;  5JVH 3;  1LTS D;  3H91 A;  1IL8 A;  4XQJ A;  2B2V C;  3AU7 A;  5IT9 L;  4V0B A;  3Q23 A;  2KQ3 A;  3GTK B;  1S5F D;  1F9Q A;  3NUC A;  2XNA C;  1H9S B;  2B2Y A;  1SJH D;  1STN A;  2FMM A;  3BVG A;  5DAU A;  2PPB C;  1ML0 D;  5CC4 A;  2EYF A;  1EWC A;  2ICE C;  1B9N A;  2EOT A;  3KLS A;  3FPU B;  2VB3 X;  1HUM A;  1PZK D;  5I6Y A;  4FF4 A;  3AMU A;  4XDX A;  3GTJ B;  5EKL A;  2G9D A;  3I70 A;  2B2U A;  3H3V C;  3S1R B;  4RA8 A;  3BG3 A;  3GO5 A;  1TU2 B;  1C48 A;  1OXS C;  1BCP D;  2KJX A;  4MN3 A;  2R7Z B;  4KJO A;  5K36 G;  4XQQ A;  2XSC A;  2HDM A;  2A73 B;  2WII B;  3MVV A;  5I4D A;  2EY5 A;  3J7Y W;  1E2V A;  4RHR A;  3QG1 A;  3M7N A;  1MGS A;  5JEA G;  3JAM E;  1VMP A;  1HQR D;  1JE4 A;  1Q8I A;  4C3I B;  1HHV A;  5E1F A;  1D1I A;  3J81 L;  1H9J A;  1V1P A;  3T56 B;  2L5T A;  1HA5 A;  3IFT A;  4CHT B;  3OMG A;  1QIL A;  1LTA D;  3VYS A;  4PMC A;  2BE5 C;  2E76 C;  5D14 A;  1CK1 A;  3HG9 A;  2F0F A;  3QB3 A;  4QMG A;  4X3K A;  2X69 A;  3H6M A;  1K8O A;  2XRS D;  2LKV A;  1LAB A;  3HP3 A;  2K03 A;  2K6A A;  4XT3 B;  3N6R A;  1A6X A;  4RH6 A;  3J80 E;  1Z6H A;  4ID6 A;  1CQV A;  2Q8R E;  1Q12 A;  4ABN A;  3KK7 A;  3ERO A;  2B63 B;  1A3T A;  1PYW D;  5K5P A;  1JOQ A;  2KOL A;  1STE A;  1BR9 A;  5I6W A;  3M85 A;  4HSV A;  4G7H C;  4KY7 A;  5KND A;  3U9S A;  1I4P A;  3LWE A;  1LTB D;  3GD7 A;  2NN6 I;  2BE5 D;  1T5X D;  1AP0 A;  2QIL A;  1Y1W B;  1PRT D;  1JR0 D;  2RDF A;  1EY8 A;  1GHK A;  4XYQ A;  3C3L A;  3JAM L;  2F0M A;  1NAP A;  5IGD A;  2IX0 A;  4BA1 I;  2R6G A;  5FOB B;  1SAP A;  4IUN A;  3M4O B;  1V8Q A;  4O1N A;  1R9T B;  3NXW A;  5ISR A;  3HOX B;  1FD7 D;  4UAI A;  1I50 B;  2BA0 A;  3M7G A;  1Y8N B;  3S17 B;  4DF7 A;  2L1B A;  1F77 A;  1EIH A;  4DXF A;  4RKB A;  1B44 D;  1EYA A;  4A3I B;  1X32 A;  1TVX A;  3I90 A;  4DU9 A;  2G9H D;  1R4Q B;  2JEA I;  2CW0 C;  4M8A A;  1ICW A;  1KNE A;  3NWT A;  1PFM A;  2CVR A;  2NN6 H;  5T1G A;  2B39 A;  4ODG A;  3BYY B;  3A55 A;  1DOM A;  5LHY 1;  4A3D B;  1JOO A;  1Y69 U;  2L11 A;  1ROD A;  1AFP A;  4FNF A;  3E6Z X;  1TWC B;  3A8J E;  1TT2 A;  4JBW A;  4NKL A;  5ELB A;  4KKS A;  4HSP A;  1BXT A;  2F0J A;  1QOH A;  3PV0 A;  3K58 A;  3PUV A;  2MPM A;  1CZG A;  3SEB A;  2QF7 A;  2B2W A;  3MTS A;  1PZJ D;  1AEX A;  4BY7 B;  3FRP B;  2LY7 A;  2ENB A;  4FVM A;  4ZUI A;  2SOB A;  1KLG D;  5KGU A;  5CYU A;  3VYR A;  2QCP X;  3GTO B;  5JPN C;  1TS4 A;  2K05 A;  5ELD A;  4F8M A;  2HCI A;  1KDB A;  2N55 A;  4C3J G;  4FXG C;  3CRL C;  1A2T A;  1CHP D;  2AQ1 B;  2SNM A;  3SK4 A;  4M1U B;  2JA6 B;  1DZ1 A;  4ZYS A;  2B2T A;  1F2Z A;  5CBA E;  1WTR A;  3S9W A;  5D3I B;  1QWY A;  1STY A;  2RKS A;  3NQI A;  1J9O A;  2F0W A;  4K5X A;  1LAC A;  4H7B A;  3EFX D;  3EA6 A;  3MFG A;  2O4X A;  4C3H B;  4ZQ3 A;  3P20 A;  3I3C A;  3SXH A;  2NZ1 D;  4XIG S;  1SYC A;  2JA7 B;  2SDF A;  4K8I A;  2EY1 A;  1H9K A;  1JC7 A;  3EQL C;  2F0T A;  1U4L A;  1R4P B;  4KN7 C;  2AWN A;  2EDG A;  3GTQ B;  4KKT A;  2NUC A;  1HTP A;  2F0P A;  2YYZ A;  1I4X A;  4IUR A;  1XWE A;  4C1N I;  2NVT B;  3DHQ A;  1TWF B;  1EIG A;  5FKA C;  4X3S A;  3HOU B;  5M3M B;  3G6J B;  4XXE A;  5J22 A;  3R93 A;  1QCB D;  2F0D A;  1UUP A;  3R2I A;  4DK0 A;  2H4O A;  3K5M A;  4XYO A;  4C1N K;  1PTO C;  4KHZ A;  1PLF A;  5IGE A;  3KBX A;  3T51 B;  3CRK C;  2K32 A;  3PIO 3;  4CGY B;  1FNW A;  1RF2 D;  1M8A A;  4KY6 A;  1G2S A;  1QNU A;  1LT6 D;  2F0I A;  5I9P A;  3BDC A;  2OT2 A;  1WD1 A;  2O2L D;  2IW3 A;  4K8J A;  2K04 A;  2VXW A;  3D4W A;  5EBD A;  3NQT A;  3H94 A;  3BVM A;  4H0L C;  2N88 A;  4C3I G;  2KCC A;  4ILW A;  3FDT A;  3SK5 A;  2IT1 A;  2L12 A;  2RA4 A;  1HCZ A;  1XXG A;  3MXU A;  4CKE A;  2JA5 B;  1PTO D;  4KV6 A;  5C3X A;  3FVQ A;  4ZAI A;  3HRZ C;  4J6H A;  4A3E B;  5E4W C;  3TP8 A;  2NTT A;  2FFK B;  2IJ0 A;  4KY5 A;  5EQ0 A;  4DXG A;  1OXT A;  4R8I A;  1O80 A;  1BNZ A;  2J7Z A;  3RLF A;  3U9O A;  1FR3 A;  2TMP A;  2KEE A;  4KD3 A;  1TKW B;  3MEH A;  1A15 A;  2EY2 A;  2RSO A;  1PFB A;  3DEP A;  2IPK D;  3P7J A;  5M3F B;  4L8J A;  2F0U A;  4CJ2 C;  4OO1 I;  3EVQ A;  3OW7 A;  1T5E A;  2RDG A;  3SDZ A;  1U4M A;  5CV8 A;  5EJW A;  3H09 A;  3MC0 B;  3C1E A;  2KEC A;  4R8N A;  4OHJ A;  1SXT A;  4HED A;  4DNR B;  1STB A;  3I72 A;  3OIQ A;  2F03 A;  2XWB B;  1C8C A;  4PQX A;  4DAY A;  2F0N A;  3PIP 3;  4EGV A;  5HGT A;  1SNP A;  1XX8 A;  3D4D A;  5CV4 A;  1E2Z A;  1CT1 D;  1O78 A;  3IKJ A;  5C4J B;  1TWG B;  4QUF A;  4RAU C;  4BA2 I;  4O42 A;  2NWG A;  3TP5 A;  4A3F B;  4DGZ A;  1I4G A;  1CI3 M;  4IUP A;  1WTX A;  4DNT B;  1LTI D;  1F9R A;  4PMB A;  1IW7 C;  1HUN A;  4DAP A;  5IGF A;  1GUT A;  4I65 A;  2B2T C;  4KD4 A;  4XQN A;  3DEO A;  1GUG A;  1WTO A;  3MXP A;  2EJG C;  3MHB A;  4OO1 H;  1A3V A;  3R3O A;  1DM0 B;  2V4D A;  5EPL A;  3D4R A;  1EZ8 A;  2DY8 A;  4U67 3;  2Z4H A;  3ERQ A;  2F0Q A;  1Y1V B;  3QOJ A;  1BCP F;  3Q22 A;  3CQZ B;  1Y8O B;  3GTG B;  1NSN S;  2AUJ D;  1O7Y A;  3KUP A;  5C5M A;  2QKI C;  4K2L A;  1F2Y A;  1SEB D;  1STA A;  2ZXR A;  2Z1C A;  1TS2 A;  4FXK C;  1Y8P B;  2F0S A;  3BZD B;  1SE3 A;  5IGB A;  3W2D A;  5A2Q L;  2PCF B;  1F2M A;  2C9O A;  5LL6 X;  4KK7 A;  2A6E C;  1QJO A;  1RJT A;  1YNN C;  4IFD G;  2Z8L A;  2NB0 A;  4CJ1 B;  3HOV B;  2EJF C;  2PZU A;  2F0V A;  1A2U A;  1JWS D;  2EYJ A;  4XT1 B;  1JWU D;  2O5I C;  1AZP A;  2KVM A;  4F87 A;  3J7A F;  2JE6 I;  3F2U A;  1HXY D;  3K59 A;  1JOK A;  3R8B A;  3VR2 A;  1BCP B;  3HS0 C;  1I6V C;  3KLR A;  2PQE A;  4H44 C;  5C3W A;  1JIC A;  5G3L D;  5C0X G;  3NP8 A;  3S2H B;  2R3Z A;  1SNC A;  1KNA A;  4F88 A;  1OXX K;  3A56 A;  2RSN A;  2IX3 A;  1QB5 D;  5E4X A;  2L4N A;  2L0C A;  5CGK A;  3KLS X;  5FO9 B;  5TSS A;  4B08 A;  1HRJ A;  4FP5 D;  2Q8T A;  2A5H A;  4BWG B;  5KYI A;  1G29 1;  2EXZ A;  2A6E D;  5I2X A;  4NMZ A;  1JOR A;  3BDO A;  3BS1 A;  1TS5 A;  2OF1 A;  2EYO A;  1KAA A;  5JJZ A;  2RBM A;  3SHL A;  1S5B D;  2B8G A;  1CA5 A;  2EVB A;  1LT3 D;  5JVG 3;  1PRT F;  4OIJ A;  5ELF A;  1FNU A;  5CMD A;  2FIN B;  3MA2 B;  3T13 A;  5DM7 3;  1RDP D;  5COY A;  2PMZ B;  1PDQ A;  3OWE B;  4YIJ A;  1EL0 A;  2IL8 A;  4QCL A;  3QWN A;  2DN8 A;  4EQN A;  4I7Z C;  1O7Z A;  5M5Y B;  1IKL A;  5J39 A;  3C1F A;  4TQU S;  3S2D B;  3M3Y B;  1JWM D;  3CU7 A;  3URY A;  2WIN B;  4FXD A;  1H9S A;  4LK1 C;  3MXN A;  3NHH A;  4J1M A;  2RDH A;  4CBV A;  1PXU A;  3RD4 A;  2F4I A;  2KUM A;  4TKO B;  4A93 B;  3L7Z C;  5KRU A;  3DXJ C;  4WOR A;  5IIF A;  1IHZ A;  1PRT B;  1SNO A;  1BDO A;  5ELC A;  1TII D;  4KI0 A;  1EWH A;  5JEA J;  3J80 L;  2HDL A;  3NPP A;  2BCO A;  2FJ2 A;  1QNK A;  1HPC A;  2EYM A;  1BBX C;  5BN4 A;  4HCS A;  5KEE A;  4RCO A;  2BA1 A;  3BYT B;  5IOD A;  3GV6 A;  2ZXO A;  2YU9 B;  1ENC A;  3NWS A;  4HN7 A;  4Y7N B;  3GV3 A;  2D9U A;  1DOK A;  5F2D A;  2AUK A;  5J1Z A;  1FYC A;  4LJZ C;  1EYC A;  2F0E A;  1G2T A;  5FLX E;  4DFA A;  1RD9 D;  4RGM A;  5EPJ A;  4HMJ A;  5I9O A;  1SFO B;  4K2K A;  3DWP A;  2WKC A;  1IYV A;  2CW0 D;  2K5W A;  3D3R A;  4MHE A;  5CBE E;  3C46 A;  3GP7 A;  1OXU A;  5EBC A;  2I07 B;  3IAY A;  1HTL D;  2R61 A;  3OSO A;  5JAV A;  3PMF A;  4AYB B;  3P1H A;  3S1Q B;  1RTO A;  3WOE A;  5C0X I;  4UDU C;  3NTK A;  1MSG A;  4E6I A;  3X3M A;  1B3A A;  4PMW A;  3ONA B;  4IAL A;  2JA8 B;  5K36 H;  1WVL A;  3AB9 A;  3FPP A;  2E2H B;  1LV9 A;  4KTA A;  2I46 A;  2J0T D;  1DD2 A;  3QOL A;  1FNV A;  3MXG A;  5JEA H;  3CKI B;  3MWY W;  1U4R A;  1J8I A;  1ILQ A;  1OXV A;  3WOF A;  1TY0 A;  1I4H A;  2NVX B;  2LS0 1;  1SNM A;  1O7L A;  3QJY A;  3A54 A;  1BF4 A;  3VR6 A;  1CTM A;  5JPM C;  2JXM B;  3G7L A;  3I8Z A;  1EY0 A;  2MUY A;  2KHS A;  2ICI A;  4Z9C B;  2E2J B;  1EFI D;  2A69 C;  2EYL A;  1RHP A;  2WAQ B;  1WD0 A;  4Q0F A;  5M5W B;  4GZY C;  3S1M B;  1CHQ D;  1EYD A;  1S5D D;  1SJE D;  1ZYR C;  3OHX C;  1U9R A;  3FKI B;  3KF8 A;  2MHV A;  1ESF A;  1Q1B A;  1M4V A;  5C4Z A;  3TZU A;  1ONL A;  3ND8 A;  3OMC A;  3IFD A;  3NSW A;  1KDC A;  2GA4 B;  3K5L A;  1JCK B;  1VDZ A;  3BDL A;  3LX0 A;  1S5E D;  2A74 C;  1HQM C;  2F0H A;  4OGQ C;  1L0Y B;  1LTG D;  1EOT A;  1ENF A;  2L9H A;  3V05 A;  3VYT A;  3S14 B;  2A69 D;  4IUQ A;  4K14 A;  4K5V A;  3D6C A;  1VF5 C;  3QIA A;  3GTM B;  1Z47 A;  1V1P B;  1ESR A;  2OXP A;  1CM9 A;  1PZI D;  2DNE A;  1JB3 A;  2ZXP A;  3BVZ A;  3V2T A;  4G7O C;  1S4Z A;  1X3Q A;  2BOS A;  1ZXT A;  1PTO F;  3RMH A;  3K6O A;  1GXD C;  3V96 A;  1EY6 A;  1CZW A;  2J4X A;  2K28 A;  2VUM B;  3TZD A;  1QE6 A;  5D65 A;  1SBB B;  1CQF A;  4R9W A;  4A3J B;  2EZV A;  5FO7 B;  4L63 B;  3R2T A;  4IZ8 A;  3P75 A;  1TY2 A;  3D8G A;  1CFM A;  2XRQ D;  3D6W A;  3GQB A;  1XTC D;  4X3T A;  2K01 A;  2SEB D;  3NBH A;  4HAE A;  1BOS A;  2D2C C;  4A3M B;  2F0O A;  4PNY A;  2NN6 G;  5D3D A;  1WTW A;  5CV7 A;  2E2D C;  2F0G A;  4B9W A;  4DK1 A;  1PTO B;  5A35 A;  1CA6 A;  4WRD A;  1EQV A;  2L55 A;  1K83 B;  3J81 E;  1I6H B;  1D2B A;  5EKI A;  1NR2 A;  1EZ6 A;  2QEJ C;  2M9V A;  2NBF A;  1BCP C;  1HFG A;  4FO2 A;  3OWF A;  4DAV A;  1D1K A;  4KN4 C;  1NUC A;  1KTK A;  5C3E B;  4K6L A;  4ZK9 B;  3W3A A;  1AZQ A;  1V43 A;  3SR1 A;  3PO2 B;  4KHV A;  5M9O A;  3HOW B;  2K5Q A;  1B50 A;  1DYQ A;  3NK9 A;  2PW7 A;  5IOC A;  1DXM A;  4IQZ A;  1LT5 D;  4RGT A;  1B9M A;  3OPO A;  3CHB D;  4IUU A;  5KNC A;  1WCM B;  2VB2 X;  3S15 B;  1KDA A;  4ZLT F;  2B8F A;  2EYH A;  3HZX A;  4ME5 A;  2DY7 A;  1PTO H;  2XN9 C;  5E3F A;  3RUZ A;  1W6K A;  1LTR D;  3SK6 A;  4RGO S;  4BS9 A;  2XWJ B;  5CV6 A;  4MIU A;  2O5J C;  4F7X A;  1F9S A;  2D62 A;  4CJ0 B;  4RCN A;  5C6A A;  1IW7 D;  2PW5 A;  1H9M A;  2JP1 A;  3GTL B;  1LTT D;  2AQ2 B;  1YNJ C;  3TP7 A;  4KKU A;  1SND A;  3VR3 A;  2NTS A;  4HCE A;  5BN3 A;  2TSS A;  2XIW A;  5IGC A;  5T1I A;  5DEH A;  3PUX A;  1V1O A;  4HMI A;  4HTH A;  3K57 A;  5G3L F;  4OIK A;  3DWA A;  1PRT C;  3DM1 A;  1STG A;  1SYG A;  4K6D A;  4LAA A;  4N9T A;  2CHB D;  3I91 A;  2F3V A;  3M4Y A;  1DOL A;  3L9A X;  1GOZ A;  3HGB A;  1D5M C;  2FMC A;  1Q3L A;  2D5D A;  3L3O C;  3IL8 A;  2F1M A;  2A68 C;  4G7Z C;  4ZKC B;  1YNN D;  2Q8I B;  2LMC B;  1SYB A;  4QB4 A;  3VA5 A;  1B1Z A;  4ZRZ A;  1YNJ D;  5KIX A;  2M00 A;  5C4H A;  1SE2 A;  1JQY D;  5FK9 C;  2SNS A;  4HR7 B;  4BBS B;  2C5C A;  3VYU A;  4FF3 A;  2HUG A;  4NW2 A;  4C3H G;  1E0B A;  2X6G A;  3KBG A;  2WP8 J;  3I73 A;  1ENA A;  1S5C D;  2A6H C;  1BUV T;  3OOC A;  1NR4 A;  1G91 A;  3N52 A;  5JOB A;  4FYD A;  1GUO A;  3VA7 A;  2HCC A;  3RZD B;  1G6Z A;  1GJX A;  1MBY A;  3HOZ B;  4EQP A;  3SE0 A;  3NE5 B;  3VR4 A;  5C44 B;  4KMU C;  3E5S A;  1STH A;  2PYK A;  4G4K A;  5CR3 A;  1LO5 D;  2A68 D;  4V19 0;  3A7A B;  1PMR A;  4WJW A;  3TBI B;  1ILP A;  3TP6 A;  3UI2 A;  4CKB A;  5KNB A;  5KYL A;  4L6T B;  5CV5 A;  2AQ3 B;  1SNQ A;  3D31 A;  5NUC A;  1IYU A;  3T16 A;  4IN3 A;  1B2T A;  4IFD J;  1EY4 A;  2A6H D;  1PFN A;  2F0L A;  1SMY C;  2KCN A;  4G57 A;  3Q24 A;  2QDB A;  1K8M A;  1W6J A;  2F0K A;  1VCI A;  1ET9 A;  4K5W A;  1E2W A;  1H9R A;  1X3P A;  2E74 C;  3PUY A;  4RFB A;  4A3B B;  3DMU A;  4JK1 C;  5AFW A;  3HEJ A;  3J7A V;  3LWU A;  1UAP A;  4RGN A;  5COR A;  3ND9 A;  2H1E A;  2MP1 A;  3NTH A;  3X3N A;  5C0X J;  5M5X B;  1EQT A;  1SYD A;  5CV9 A;  1B4O A;  4ULL A;  1ET6 A;  3VR5 A;  1D5Z C;  2B2Y C;  2NYZ D;  2EY6 A;  4J8Q A;  4IFD I;  5BN5 A;  4P2C B;  1EU3 A;  4KJN A;  4TRD A;  5DNF A;  3GTP B;  3S16 B;  2WKD A;  2CQA A;  3T4A C;  1NCV A;  5IGG A;  2EE1 A;  4B9X A;  4FF2 A;  5LL6 S;  1Q1E A;  2EYP A;  2B2V A;  3MAQ A;  2PNR C;  3OIP A;  1SMY D;  2B2U C;  2RQX A;  2VNU D;  4EVO A;  1D5X C;  2JEB I;  3I4N B;  3ZYY X;  2E75 C;  1SDF A;  3LNN A;  1I4Q A;  1C4Q A;  3A8I E;  3QO2 A;  4OO1 G;  1DCZ A;  2PZW A;  5DM6 3;  3Q0A A;  1GUS A;  3H0G B;  2WB1 B;  1MI2 A;  2FHT A;  4Q5V A;  2IWH A;  2DNC A;  3K7A B;  2MJ8 A;  2KA7 A;  5C5L A;  1SE4 A;  2AWO A;  4FF1 A;  2K1B A;  1I3Q B;  1Z7T A;  1U4P A;  3I4L A;  4X3U A;  2E2I B;  1HFN A;  1QG7 A;  4CKC A;  1MD2 D;  2EPB A;  1TWH B;  3SK8 A;  1BO0 A;  1AN8 A;  4IFD H;  3TME A;  4BBR B;  3K5O A;  4XTC S;  4OL7 A;  3S1N B;  5I2Y A;  5EKK A;  1LLR D;  1LT4 D;  2NVQ B;  1DON A;  1II3 A;  2K7V A;  1RTN A;  5FLX L;  2PZT A;  2JYO A;  1DJR D;  3SVM A;  3PUW A;  4ZKB B;  1HA6 A;  5C0X H;  4H13 C;  1RCV D;  1B53 A;  1OO9 B;  5FO8 B;  4NP5 A;  4S3S A;  3FMC A;  2BDN A;  1EY9 A;  3TDQ A;  1VMC A;  4DA2 A;  2KED A;  4TSS A;  3E0J A;  1GUW A;  1ZEQ X;  1KAB A;  1GHJ A;  3A8K E;  1TR5 A;  3DWQ A;  1AW7 A;  2PO4 A;  1EY5 A;  1BQQ T;  3WDN A;  4QUC A;  4RHS A;  3TN2 A;  2F3W A;  2JSO A;  4DN4 M;  1WTP A;  1UEA B;  2M2L A;  3K5N A;  1VF7 A;  3PUZ A;  4C56 C;  1SYF A;  4N9P A;  2MGS A;  4LMQ D;  3HKZ B;  5EGT A;  2K5D A;  3ITP A;  1TS3 A;  5IT9 E;  1FGB D;  1MSH A;  1F9P A;  3MZ5 A;  1G8Z D;  1EEF D;  3MFY A;  3NBI A;  2XVS A;  3A7L A;  1EEI D;  2BDO A;  2ZT9 C;  3TSS A;  3O13 A;  3RZO B;  4RKL A;  2IX1 A;  4A3G B;  1ZYR D;  4A3K B;  1UNS A;  5EPK A;  4U68 A;  3HOY B;  2EJM A;  4ZUJ A;  1L0X B;  1TWA B;  5ELE A;  1GUN A;  2ID0 A;  1SSO A;  3EJI A;  3NTI A;  4C2M B;  2LFN A;  1A3U A;  2K33 A;  2R93 B;  1XYI A;  3FEW X;  2Z4I A;  4C3J B;  1IKM A;  4NDX A;  2R92 B;  5HUR A;  3DUZ A;  1Q90 A;  1EY7 A;  2WV6 D;  1KLU D;  2X6L A;  1TQO A;  4WFN 3;  2WAC A;  1ZKO A;  1WTV A;  1RKN A;  1WTQ A;  2RVL A;  4QIW B;  2HQE A;  4IUT A;  1I4R A;  3T53 B;  3C2P A;  3I4M B;  2OEO A;  4BY1 B;  1EU4 A;  3K0Y A;  5A2Q E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...