5G3WA

Structure of hdac like protein from bordetella alcaligenes in complex with the photoswitchable inhibitor cew65
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
369
structure length
369
Chain Sequence
HAIGYVWNTLYGWVDTGTGSLAAANLTARMQPISHHLAHPDTKRRFHELVCASGQIEHLTPIAAVAATDADILRAHSAAHLENMKRVSNLPTGGDTGDGITMMGNGGLEIARLSAGGAVELTRRVATGELSAGYALVNPPGHHAPHNAAMGFCIFNNTSVAAGYARAVLGMERVAILDWDVHHGNGTQDIWWNDPSVLTISLHQHLCFPPDSGYSTERGAGNGHGYNINVPLPPGSGNAAYLHAMDQVVLPALRAYRPQLIIVGSGFDASMLDPLARMMVTADGFRQMARRTIDCAADICDGRIVFVQEGGYSPHYLPFCGLAVIEELTGVRSLPDPYHEFLAGMGGNTLLDAERAAIEEIVPLLADIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE DEACETYLASE-LIKE AMIDOHYDROLASE
publication title Toward Photopharmacological Antimicrobial Chemotherapy Using Photoswitchable Amidohydrolase Inhibitors.
pubmed doi rcsb
source organism Bordetella
molecule tags Hydrolase
total genus 136
structure length 369
sequence length 369
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00850 Hist_deacetyl Histone deacetylase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.20 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Histone deacetylase domain 5g3wA00
5EF8A 5D1BA 1ZZ0A 1C3PA 3F07A 4BZ5A 3SFHA 5D1DA 4CBTA 4RN0A 3Q9CA 3C10A 2V5XA 3EW8A 3EZTA 4QA1A 5G0YA 5IWGA 5G17A 3C0YA 3MENA 4RN1A 5EFBD 5G1AA 5ICNB 1C3SA 5FUEA 4ZUQA 4CBYA 4BZ8A 5JI5A 4QA4A 3F06A 3F0RA 5DC6A 3Q9EA 5EEIA 5EFJD 4ZUMA 2VQWG 5EEMA 5G13A 1C3RA 4BKXB 4ZUOA 5EENA 5A2SA 4ZURA 1ZZ1A 2VCGA 5G0IA 5EF7A 5G0JA 3ZNSA 2VQVA 3EWFA 5G0XA 5EEFA 2VQMA 1VKGA 5THVA 5IX0A 4BZ6A 3ZNRA 5EEKA 5DC7A 4BZ9A 3MZ4A 5EFKB 5D1CA 5THTA 5G1CA 5G10A 4A69A 4BZ7A 4QA6A 5G12A 5G0HA 5G1BA 4QA0A 2GH6A 3Q9BA 2VQQA 3Q9FA 4ZUPA 3MZ6A 4QA2A 1ZZ3A 5THSA 3RQDA 4RN2A 5DC8A 4QA7A 2VQJA 3MZ7A 5G3WA 5EFGA 5G0GA 5THUA 1T67A 5FCWA 5EFNA 1T64A 1T69A 5BWZA 4QA5A 4QA3A 5DC5A 5EFHA 3EZPA 3MAXA 4ZUNA 3C0ZA 4LY1A 4CQFA 3SFFA 1W22A 5G11A 3MZ3A 2V5WA 2VQOA 4LXZA 5LI3A
chains in the Genus database with same CATH superfamily
1XFKA 4Q3QA 1P8QA 1PQ3A 5D1BA 1ZZ0A 5EF8A 1C3PA 3F07A 4Q3VA 4BZ5A 4I06A 3SFHA 5D1DA 4CBTA 1P8PA 2PLLA 4Q41A 4RN0A 3MFWA 3MFVA 3Q9CA 1TBHA 3C10A 1HQHA 4FCKA 2V5XA 4Q3RC 5RLAA 1T4TA 1D3VA 3EW8A 3EZTA 4IXUA 1HQ5A 4QA1A 5G0YA 1P8MA 5G17A 5IWGA 1P8SA 5A2SA 3C0YA 4GWDA 3SL0A 3MENA 4RN1A 1TBJA 5EFBD 4GWCA 4Q42A 2EF4A 2ZAVA 3MMRA 3NIQA 4IE2A 3E8ZA 4Q3UA 2AEBA 5G1AA 5ICNB 1T5FA 1C3SA 4IU4A 5FUEA 4ZUQA 5CEVA 1TBLA 1WVBA 3LP4A 4CBYA 4GSMA 4BZ8A 5JI5A 4QA4A 3F06A 3F0RA 5DC6A 3Q9EA 5EEIA 4IU0A 5EFJD 4ZUMA 2VQWG 5EEMA 5G13A 2RLAA 4HWWA 3THEA 1T4PA 4BZ9A 3E8QA 4IU1A 1C3RA 1WOIA 4BKXB 4ZUOA 1P8NA 2A0MA 3CEVA 3E6KA 4GSVA 5EENA 3THJA 4ZURA 1ZZ1A 2VCGA 3NIOA 4ITYA 5G0IA 3GMZA 4RLAA 5EF7A 5G0JA 3ZNSA 2VQVA 3EWFA 4Q3RA 4IXVA 5G0XA 1T5GA 4HZEA 5EEFA 3E6VA 2VQMA 3LP7A 1VKGA 5THVA 4IU5A 4RHQA 1HQGA 5IX0A 4DZ4A 3TH7A 4BZ6A 3ZNRA 4GSZA 1WOHA 3PZLA 3NIPA 5EEKA 1ZPEA 3M1RA 1CEVA 3MZ4A 4RHJA 1P8RA 4RHKA 5DC7A 5EFKB 3SL1A 4Q3SA 3RLAA 3E9BA 5D1CA 5THTA 5G1CA 5G10A 4A69A 4BZ7A 4MYNA 4QA6A 5G12A 5HJAA 2PHAA 5G0HA 5G1BA 4QA0A 2GH6A 3Q9BA 1GQ7A 2PHOA 2VQQA 1WVAA 3Q9FA 3GN0A 4ZUPA 3MZ6A 3SKKA 3TF3A 4FCIA 4QA2A 1ZZ3A 5THSA 1HQFA 3RQDA 4IE3A 4RN2A 4QA7A 5DC8A 5HJ9A 3MJLA 3KV2A 2VQJA 1WOGA 3MZ7A 5G3WA 5EFGA 4MYKA 3F80A 1T4RA 5G0GA 5THUA 1ZPGA 1GQ6A 1RLAA 1T67A 2CEVA 3DJ8A 5EFNA 5FCWA 3THHA 1T64A 4IE1A 1T69A 4MYFA 5BWZA 4QA5A 4QA3A 5DC5A 4G3HA 3LHLA 4MYLA 5EFHA 4HXQA 4RHIA 3SJTA 4Q3TA 1TA1A 3EZPA 3MAXA 3C0ZA 4LY1A 4MXRA 4ZUNA 4Q40A 1HQXA 1R1OA 4Q3PA 1P8OA 3SFFA 4CQFA 4RHMA 4CEVA 1W22A 4RHLA 3MZ3A 1T4SA 5G11A 2EIVA 2V5WA 2VQOA 4LXZA 2EF5A 5LI3A
chains in the Genus database with same CATH topology
5EF8A 5D1BA 1ZZ0A 1C3PA 3F07A 4BZ5A 3SFHA 5D1DA 4CBTA 4RN0A 3Q9CA 3C10A 2V5XA 3EW8A 3EZTA 4QA1A 5G0YA 5IWGA 5G17A 3C0YA 3MENA 4RN1A 5EFBD 5G1AA 5ICNB 1C3SA 5FUEA 4ZUQA 4CBYA 4BZ8A 5JI5A 4QA4A 3F06A 3F0RA 5DC6A 3Q9EA 5EEIA 5EFJD 4ZUMA 2VQWG 5EEMA 5G13A 1C3RA 4BKXB 4ZUOA 5EENA 5A2SA 4ZURA 1ZZ1A 2VCGA 5G0IA 5EF7A 5G0JA 3ZNSA 2VQVA 3EWFA 5G0XA 5EEFA 2VQMA 1VKGA 5THVA 5IX0A 4BZ6A 3ZNRA 5EEKA 5DC7A 4BZ9A 3MZ4A 5EFKB 5D1CA 5THTA 5G1CA 5G10A 4A69A 4BZ7A 4QA6A 5G12A 5G0HA 5G1BA 4QA0A 2GH6A 3Q9BA 2VQQA 3Q9FA 4ZUPA 3MZ6A 4QA2A 1ZZ3A 5THSA 3RQDA 4RN2A 5DC8A 4QA7A 2VQJA 3MZ7A 5G3WA 5EFGA 5G0GA 5THUA 1T67A 5FCWA 5EFNA 1T64A 1T69A 5BWZA 4QA5A 4QA3A 5DC5A 5EFHA 3EZPA 3MAXA 4ZUNA 3C0ZA 4LY1A 4CQFA 3SFFA 1W22A 5G11A 3MZ3A 2V5WA 2VQOA 4LXZA 5LI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EF8 A;  5D1B A;  1ZZ0 A;  1C3P A;  3F07 A;  4BZ5 A;  3SFH A;  5D1D A;  4CBT A;  4RN0 A;  3Q9C A;  3C10 A;  2V5X A;  3EW8 A;  3EZT A;  4QA1 A;  5G0Y A;  5IWG A;  5G17 A;  3C0Y A;  3MEN A;  4RN1 A;  5EFB D;  5G1A A;  5ICN B;  1C3S A;  5FUE A;  4ZUQ A;  4CBY A;  4BZ8 A;  5JI5 A;  4QA4 A;  3F06 A;  3F0R A;  5DC6 A;  3Q9E A;  5EEI A;  5EFJ D;  4ZUM A;  2VQW G;  5EEM A;  5G13 A;  1C3R A;  4BKX B;  4ZUO A;  5EEN A;  5A2S A;  4ZUR A;  1ZZ1 A;  2VCG A;  5G0I A;  5EF7 A;  5G0J A;  3ZNS A;  2VQV A;  3EWF A;  5G0X A;  5EEF A;  2VQM A;  1VKG A;  5THV A;  5IX0 A;  4BZ6 A;  3ZNR A;  5EEK A;  5DC7 A;  4BZ9 A;  3MZ4 A;  5EFK B;  5D1C A;  5THT A;  5G1C A;  5G10 A;  4A69 A;  4BZ7 A;  4QA6 A;  5G12 A;  5G0H A;  5G1B A;  4QA0 A;  2GH6 A;  3Q9B A;  2VQQ A;  3Q9F A;  4ZUP A;  3MZ6 A;  4QA2 A;  1ZZ3 A;  5THS A;  3RQD A;  4RN2 A;  5DC8 A;  4QA7 A;  2VQJ A;  3MZ7 A;  5G3W A;  5EFG A;  5G0G A;  5THU A;  1T67 A;  5FCW A;  5EFN A;  1T64 A;  1T69 A;  5BWZ A;  4QA5 A;  4QA3 A;  5DC5 A;  5EFH A;  3EZP A;  3MAX A;  4ZUN A;  3C0Z A;  4LY1 A;  4CQF A;  3SFF A;  1W22 A;  5G11 A;  3MZ3 A;  2V5W A;  2VQO A;  4LXZ A;  5LI3 A; 
#chains in the Genus database with same CATH topology
 1XFK A;  4Q3Q A;  1P8Q A;  1PQ3 A;  5D1B A;  1ZZ0 A;  5EF8 A;  1C3P A;  3F07 A;  4Q3V A;  4BZ5 A;  4I06 A;  3SFH A;  5D1D A;  4CBT A;  1P8P A;  2PLL A;  4Q41 A;  4RN0 A;  3MFW A;  3MFV A;  3Q9C A;  1TBH A;  3C10 A;  1HQH A;  4FCK A;  2V5X A;  4Q3R C;  5RLA A;  1T4T A;  1D3V A;  3EW8 A;  3EZT A;  4IXU A;  1HQ5 A;  4QA1 A;  5G0Y A;  1P8M A;  5G17 A;  5IWG A;  1P8S A;  5A2S A;  3C0Y A;  4GWD A;  3SL0 A;  3MEN A;  4RN1 A;  1TBJ A;  5EFB D;  4GWC A;  4Q42 A;  2EF4 A;  2ZAV A;  3MMR A;  3NIQ A;  4IE2 A;  3E8Z A;  4Q3U A;  2AEB A;  5G1A A;  5ICN B;  1T5F A;  1C3S A;  4IU4 A;  5FUE A;  4ZUQ A;  5CEV A;  1TBL A;  1WVB A;  3LP4 A;  4CBY A;  4GSM A;  4BZ8 A;  5JI5 A;  4QA4 A;  3F06 A;  3F0R A;  5DC6 A;  3Q9E A;  5EEI A;  4IU0 A;  5EFJ D;  4ZUM A;  2VQW G;  5EEM A;  5G13 A;  2RLA A;  4HWW A;  3THE A;  1T4P A;  4BZ9 A;  3E8Q A;  4IU1 A;  1C3R A;  1WOI A;  4BKX B;  4ZUO A;  1P8N A;  2A0M A;  3CEV A;  3E6K A;  4GSV A;  5EEN A;  3THJ A;  4ZUR A;  1ZZ1 A;  2VCG A;  3NIO A;  4ITY A;  5G0I A;  3GMZ A;  4RLA A;  5EF7 A;  5G0J A;  3ZNS A;  2VQV A;  3EWF A;  4Q3R A;  4IXV A;  5G0X A;  1T5G A;  4HZE A;  5EEF A;  3E6V A;  2VQM A;  3LP7 A;  1VKG A;  5THV A;  4IU5 A;  4RHQ A;  1HQG A;  5IX0 A;  4DZ4 A;  3TH7 A;  4BZ6 A;  3ZNR A;  4GSZ A;  1WOH A;  3PZL A;  3NIP A;  5EEK A;  1ZPE A;  3M1R A;  1CEV A;  3MZ4 A;  4RHJ A;  1P8R A;  4RHK A;  5DC7 A;  5EFK B;  3SL1 A;  4Q3S A;  3RLA A;  3E9B A;  5D1C A;  5THT A;  5G1C A;  5G10 A;  4A69 A;  4BZ7 A;  4MYN A;  4QA6 A;  5G12 A;  5HJA A;  2PHA A;  5G0H A;  5G1B A;  4QA0 A;  2GH6 A;  3Q9B A;  1GQ7 A;  2PHO A;  2VQQ A;  1WVA A;  3Q9F A;  3GN0 A;  4ZUP A;  3MZ6 A;  3SKK A;  3TF3 A;  4FCI A;  4QA2 A;  1ZZ3 A;  5THS A;  1HQF A;  3RQD A;  4IE3 A;  4RN2 A;  4QA7 A;  5DC8 A;  5HJ9 A;  3MJL A;  3KV2 A;  2VQJ A;  1WOG A;  3MZ7 A;  5G3W A;  5EFG A;  4MYK A;  3F80 A;  1T4R A;  5G0G A;  5THU A;  1ZPG A;  1GQ6 A;  1RLA A;  1T67 A;  2CEV A;  3DJ8 A;  5EFN A;  5FCW A;  3THH A;  1T64 A;  4IE1 A;  1T69 A;  4MYF A;  5BWZ A;  4QA5 A;  4QA3 A;  5DC5 A;  4G3H A;  3LHL A;  4MYL A;  5EFH A;  4HXQ A;  4RHI A;  3SJT A;  4Q3T A;  1TA1 A;  3EZP A;  3MAX A;  3C0Z A;  4LY1 A;  4MXR A;  4ZUN A;  4Q40 A;  1HQX A;  1R1O A;  4Q3P A;  1P8O A;  3SFF A;  4CQF A;  4RHM A;  4CEV A;  1W22 A;  4RHL A;  3MZ3 A;  1T4S A;  5G11 A;  2EIV A;  2V5W A;  2VQO A;  4LXZ A;  2EF5 A;  5LI3 A; 
#chains in the Genus database with same CATH homology
 5EF8 A;  5D1B A;  1ZZ0 A;  1C3P A;  3F07 A;  4BZ5 A;  3SFH A;  5D1D A;  4CBT A;  4RN0 A;  3Q9C A;  3C10 A;  2V5X A;  3EW8 A;  3EZT A;  4QA1 A;  5G0Y A;  5IWG A;  5G17 A;  3C0Y A;  3MEN A;  4RN1 A;  5EFB D;  5G1A A;  5ICN B;  1C3S A;  5FUE A;  4ZUQ A;  4CBY A;  4BZ8 A;  5JI5 A;  4QA4 A;  3F06 A;  3F0R A;  5DC6 A;  3Q9E A;  5EEI A;  5EFJ D;  4ZUM A;  2VQW G;  5EEM A;  5G13 A;  1C3R A;  4BKX B;  4ZUO A;  5EEN A;  5A2S A;  4ZUR A;  1ZZ1 A;  2VCG A;  5G0I A;  5EF7 A;  5G0J A;  3ZNS A;  2VQV A;  3EWF A;  5G0X A;  5EEF A;  2VQM A;  1VKG A;  5THV A;  5IX0 A;  4BZ6 A;  3ZNR A;  5EEK A;  5DC7 A;  4BZ9 A;  3MZ4 A;  5EFK B;  5D1C A;  5THT A;  5G1C A;  5G10 A;  4A69 A;  4BZ7 A;  4QA6 A;  5G12 A;  5G0H A;  5G1B A;  4QA0 A;  2GH6 A;  3Q9B A;  2VQQ A;  3Q9F A;  4ZUP A;  3MZ6 A;  4QA2 A;  1ZZ3 A;  5THS A;  3RQD A;  4RN2 A;  5DC8 A;  4QA7 A;  2VQJ A;  3MZ7 A;  5G3W A;  5EFG A;  5G0G A;  5THU A;  1T67 A;  5FCW A;  5EFN A;  1T64 A;  1T69 A;  5BWZ A;  4QA5 A;  4QA3 A;  5DC5 A;  5EFH A;  3EZP A;  3MAX A;  4ZUN A;  3C0Z A;  4LY1 A;  4CQF A;  3SFF A;  1W22 A;  5G11 A;  3MZ3 A;  2V5W A;  2VQO A;  4LXZ A;  5LI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...