5G4BA

Crystal structure of aura virus capsid protein in complex with piperazine.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
152
structure length
152
Chain Sequence
DRTFAVKNEDGKIMGYAVAMEGKVIKPLHVKGTIDHPALAKLKFTKSSSYDMEFAKLPTEMKSDAFGYTTEHPEGFYNWHHGAVQFSGGRFTIPTGAGGPGDSGRPILDNSGKVVAIVLGGANEGARTALSVVTWNKKGAAIKTTHEDTVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAPSID PROTEIN
publication title Crystal Structure of Capsid Protein from Aura Virus in Complex with Piperazine
rcsb
source organism Aura virus
molecule tags Hydrolase
total genus 31
structure length 152
sequence length 152
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 2016-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5g4bA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5g4bA01
1GJ9B 3OYPA 2CHAC 5ESBA 1NM6A 5JPMH 5EQQA 4NWKA 2ANYA 2FYRA 4Y79A 1YPJH 1OP2A 1FY1A 4Q2KA 1XXDA 5GXPA 3SV9A 2ZFQH 5ESTE 4MQAA 1Y3WA 1BMAA 4RSPA 4FUEA 3RM0H 4AB9A 4B74A 2FM2A 3QZRA 1TGCA 1BHXB 1RTFB 4MTBA 1JRSA 4O9VA 1MTNC 1P2QA 1YPLH 1Z6EA 5HXFA 3TJNA 1EJAA 1SHHB 1HAVA 5E8EH 1AZ8A 1Y3YA 4AB8A 2PFEA 4R8TB 4JZEH 3ZZAA 4UEHH 4I8LA 1RJXB 1GI3A 1EOJA 3ZZDA 1A0LA 2ZDNA 2OC1A 1YF4A 4B71A 1ZHMA 2F9NA 2UUFB 3K65B 4Y8XA 2V3HH 3FFGA 1OWIA 1P03A 1HLTH 2BQ7B 1WU1A 4ZKNU 1PPCE 2ZQ1A 1WSSH 3GY7A 8LPRA 3O8BA 5L30H 4D76A 3RU4D 3A7ZA 1W10U 5EW2H 1WTHD 1MAYA 3BTQE 4ZUHA 2ZTZA 1DLEA 2FIRH 1C5NH 3EYDA 3ZVBA 1CBWC 1OP0A 3RXPA 1QHRB 1ELAA 1O3DA 1QRWA 2NU2E 3SJ8A 1DICA 1ZRKA 4BNRA 3U8TH 2D26C 3Q3YA 1NTPA 4MPWA 2UUKB 1VITG 3K6ZA 3UWJH 1CGHA 3LU9B 1BTPA 2HPQH 1C5TA 3EGKH 4LK4A 2A2XH 2BY5X 1EP5A 1AQ7A 1D6WA 4IBLH 2VJ1A 3BF6H 3HGPA 3UOPA 2WV5A 3SI4H 3SU0A 4CREA 1BQYA 1O2VA 2HRVA 1O2WA 2BDYA 3Q77A 1NS3A 1MKWH 1GI7B 2Z3CA 3RXEA 4MNWA 2O8LA 3VB5A 4ABFA 5LPRA 1T8LA 4IN1A 5C2ZA 6GCHF 2UUJB 3DA9B 1W2KH 3T62A 5FCKA 2BD3A 1EOLA 1C2JA 4F4OC 3DT0H 1IQGA 1O5GH 1H4WA 2FOGA 1WYKA 2D2DA 1AWFH 2BXUH 1TPAE 3SU3A 1GBDA 2XBVA 2ULLA 2J38A 5LPEA 1H8IH 4RKJB 1BTWA 2Y5GA 3RLYH 2ZU1A 1CGJE 1AB9B 3E8LA 3EE0B 2ZPSA 1SLWB 4MLFB 4BXSA 1MKWK 1EJMA 1Z71A 3U98H 4HTCH 1HFDA 3SNAA 1S84A 3SU2A 3ZYDA 1HAPH 5CE1A 1NN6A 4DIHH 2BQ6B 1TMTH 3LONA 1OP8A 1K9OE 1F0SA 1KXCA 1BBRE 2DE8A 3CS7A 4GPGA 5FCRA 2GKVE 1SOZA 1QQUA 1XUFA 1GVLA 2GCHG 1Z8GA 2FS9A 1C1UH 5JB8S 3F9HA 2WPJS 1V2VT 3HGNA 1P11E 1FNIA 4IN2A 3KEEA 4NZQA 2QIQA 2R0KA 4FU8A 3UWIA 4X6OA 1O3CA 1MMJN 1DE7H 3OX7U 4ABGA 1FDPA 4DOQA 1ZMNA 2J94A 1Z6JH 1ABIH 3VGCC 5C20A 3U1IB 4OS6A 3SUEA 1BB0B 3BTME 1C2FA 7ESTE 3SBKA 2LNCA 3LIWA 4D9QA 3A84A 4Y7BA 3BIVH 1FJSA 3LGWA 4MPVA 4JK6A 4OS4A 1S5SA 2B0FA 2W5EA 1DWCH 1KYNA 1ACBE 2FDAA 2BDAA 2Y82A 3A8AA 4FU7A 4YT7H 2XYAA 5EXNA 1CO7E 2UWPA 3AW0A 2G81E 3CENA 4LXBH 1K1MA 2FXRA 2ZZUH 1H9IE 2Q1JA 2R2MB 2VH0A 4U01A 1L4ZA 1E37B 1MH0A 4MVNA 3BEIB 4I33A 1UMAH 1IQFA 2VVVA 2PTCE 2GV7A 2XTTB 2O8TA 2BQWB 1O2UA 3T29A 3OY6U 1EAWA 3ZZ8A 4DVAU 1C5MD 4ZKOU 2P16A 4ESTE 3DHKH 1N1LA 1XKBC 2Z94A 1W0YH 1PQ8A 4O3TA 3KF2A 1O3FA 1EXFA 4LOYH 1NRQH 2VWMA 1V2JT 5DP9A 4YOJA 1XUGA 5SGAE 3UY9A 1V2LT 4WMEA 4BOHA 1L1JA 1TBRH 1EQ9A 1KIGH 1PYTD 1LTOA 1HIAA 3GOVB 3SUGA 1VITF 5EXMA 1GI9B 2OD3B 4Y8YA 3SU5A 1BDAA 1NC6A 2BD9A 1HAVB 1KTTB 2QY0B 4IS5A 2FI4E 1S82A 1O5CB 3PMAB 2A4RA 2ALPA 3FZDA 5DP5A 5GIBA 5E2PA 3VB6A 1UTOA 4KTSA 1LDTT 1C4U2 5EG4A 1UTKA 3AVZA 4NGAH 5T6GA 4MG3A 2PSXA 2CXVA 1FN8A 1GI6A 4GLYA 1P9UA 3MO3A 5BPEA 2EI8A 2H2ZA 2ZHEH 3A82A 1UVPA 5HM9A 1PQ5A 5EQSA 4AFZA 1RIWC 1ANBA 3KL6A 1TNJA 1YC0A 2GGVB 2H6MA 3M7UA 4WY3A 4Y6DA 3VXFH 1LVMA 1ID5H 2OC8A 1GJ8B 2KAIA 1ZJDA 1IQJA 4FVBA 4ABHA 1EB1H 2ZGBH 3LJJA 2ZTYA 4YLUA 4KGAA 1BRAA 5AFZH 2BDIA 2FEQH 1KDQB 1ZHRA 1GHYH 1GBCA 2A45B 1MTUA 1PPBH 4I31A 1AFQB 4BAMB 3SNCA 1QB1A 1HV7A 2Z9GA 2XC4A 2V6NA 3PYHA 3TK9A 4A7IB 2SGEE 2GCHF 3BTTE 2TBSA 4E7RG 2PUXB 1O33A 2XW9A 2PWXA 1GBFA 3I77A 1P57B 4A1XA 5AVDA 4CRAA 1QL9A 1SGFA 2Z9LA 5EXLA 1TNKA 1LVOA 2AS9A 2F83A 1C2DA 1HXFH 1XUIA 4AGJA 1OKXA 1O2LA 2OLGA 1VR1H 2W3IA 4ZROA 4XOJA 3RXHA 1BTZA 1GDUA 1QL7A 2A7HA 2WPMS 4DW2U 4Y0YE 4ZAEA 1OXGA 3SU6A 1C1RA 1A5IA 3PB1E 4WH8A 1F0UA 1HUTH 1HYLA 1V2WT 2PKSB 2ZCLP 3TK6A 2ANKH 4XBBA 1P8VC 5GDSH 1QRZA 3GCTG 1BZXE 1WQSA 2BY7X 4H6TA 2ODPA 3SGBE 2ASUB 4QT8C 4JZDH 3EA7A 4F49A 2TGDA 3M5OA 1EZQA 1W7XH 2WPHS 3E0NB 2EI6A 1O3EA 2R0LA 3E3TA 4YM9A 4YLQH 1HB0B 1GHVH 2Y7XA 1AVXA 1G3CA 3PLPA 2WINI 3RXOA 1GI4A 1UTPA 1K1OA 5J4QA 1NFUA 1DANH 3R3GB 1GDNA 2Q6FA 1D4PB 2XWAA 4AG2A 4X8UH 5B6OA 1KXFA 2QA9E 2ZNKH 4WMFA 4K1TA 3UQOA 5F6MA 1UVUH 5I25A 4UFGH 1OWHA 1GI1A 1OWEA 1O3NA 2QXJA 1TIOA 3DFLA 3M7QA 2QV1A 2SNVA 1C9PA 1RD3B 1SFIA 1LPZB 1IQKA 3D23A 5EPNA 2ZU5A 1O37A 2IN2A 2VWLA 4BAKB 1E34B 3RXUA 2AEIH 2ZHFH 1VCPA 4ZXYH 1C5YB 4SGAE 1GGDC 4DY7B 1TLDA 2NU4E 2ANMH 3E16B 1VCWA 1Q31A 1QRXA 1ZYOA 2AMQA 5E0GA 2ZEBA 1AKSA 1D9IA 2ZC9H 1ZGIA 4X1PU 4NFFA 2AERH 1SLUB 2ZFFH 4IC5A 4UE7H 4ISIH 5DO4H 1K1LA 1FZZA 1V2TT 1B5GH 3K6YA 5JBTA 1N6YA 3F6UH 5AFYH 3G01A 4BXWA 1NROH 4X0WU 3TITA 1MKXH 1FAXA 1C5SA 1THSH 5E0JA 4AORA 1GCDA 1GL0E 5FHTA 4ZHMU 2GZ7A 1HIAB 2BY6X 1D3PB 1GHWH 1TRYA 2JETB 3T26A 3RMMH 2FOAA 2BDCA 5FPYA 2FODA 4JCNA 4K1SA 3PO1B 4B2BA 1MTWA 4TPIZ 3IITA 3I78A 1HAZB 2BYAX 1O2JA 1A61H 1IQHA 1V2RT 1C1OA 5I46H 4UD9H 1ZTKA 2O9QA 3S9AA 1J15A 5T6FA 2HLCA 5FBIA 2CMYA 1C1MA 1XXFA 1SSXA 4CBOA 1P2KA 1C4V2 3S9CA 1GHBF 4ABAA 1XX9A 1GJ7B 4M7GA 1GDQA 1QB6A 2AH4X 2ZECA 3LC5A 1RIWB 3DD2H 1DFPA 1O3GA 1MKXK 3A80A 3C27B 1G9IE 3P70B 3FAOA 1QJ1B 1ELEE 1C1QA 1BITA 3ATLA 2VVUA 3BTEE 1MZAA 1WTGH 3MH7A 3RMOH 1CVWH 1KXBA 3NUMA 3GCNA 4HI3A 1DUEA 1P2JA 1LO6A 3JZ2B 3ZVFA 1L1NA 1HAGE 2A32A 4IC6A 3ZZ4A 1K22H 3GY4A 4I8JA 5DP7A 2XBXA 3RMNH 1GI5A 5A0AE 1AU8A 1IOEA 3MOCA 1HRTH 1K1PA 2TPIZ 1ZPCA 4HGCA 1Z1IA 1K28D 1Y59T 2W7SA 3TIUA 1WUNH 3V0XA 4K2YA 3PV4A 4Q7XA 1UTMA 3SV6A 1JOUB 5LH8A 1ELTA 2QN5T 3FP6E 3GCTF 2H9TH 3BN9A 6ESTA 3EDXB 1SQOA 3BTHE 3MU8A 3PMBB 1FY3A 5FX6A 1G30B 1O39A 4BAQB 1BJVA 1Z1JA 5DP3A 1C1WH 4Q7YA 3SV7A 2GZ9A 2WPLS 2ZQ2A 1C5OH 3S69A 2STAE 3O8RA 3KHVA 4YO9A 3SU4A 2AFQB 2P3UB 2H1UA 2OBOA 4GUXA 3ATKA 3SNBA 1H1BA 1YLCA 1GJ6A 1XUHA 3AAVA 2PW8H 2GCTC 1TPPA 3VFEA 2Y7ZA 1TRMA 3SI3H 3TJVA 3RU4E 1UTNA 1DSTA 2I6SA 4Y76A 2BLOA 2XRCA 2F9BH 1GBJA 5GCHG 3T5FH 1DY9A 3SHCH 4UFEH 1OYQA 5JBAS 1CE5A 2HPPH 1F7ZA 2SNWA 2PLXA 1TPOA 1BTYA 2XCNA 1BJUA 1O5DH 3UR9A 1Z8IB 2A1DB 1GBBA 2ZGJA 1VITH 1AY6H 4AFUA 1ZSKA 3MH6A 8ESTE 1JWTA 1T8NA 1V2KT 2C8WB 4E7NA 2GT8A 4X1SU 5JYIA 3ATIA 2JKHA 3P6ZB 2K1QA 3BG8A 3MNBA 2RDLA 2QYIA 4ZHAA 2V0BA 2FI3E 3VEQB 1HNEE 3SV8A 1A2CH 3BEFB 2BD5A 1O0DH 1EZUC 2PKAA 2VIPA 3M7TA 1HXEH 2QCYA 4E05H 2G51A 1TMBH 2OCVB 1YPKH 1P10A 2OQUA 4O3UA 4AX9H 1BUIA 2IJOB 1SHYA 1Y3VA 1EASA 1S85A 2BXTH 3EAJA 2PSYA 3GY8A 4I7YH 5JBCS 1HAXB 5FBEA 1GJCB 2ZIQH 4JYUH 1TNHA 1AFQC 2WYGA 4B1TA 7LPRA 2W26A 3TPIZ 3A8DA 4D9RA 1BCUH 2SGAA 4NIYA 1QIXB 1TNIA 1GGDB 1N6XA 1N8OC 3VB4A 1TGBA 1ELDE 2LPRA 4Y8ZA 3T27A 3P8GA 1GHZA 2FX4A 1TX7A 1SL3A 3A89A 3A7YA 3UREA 2BM2A 1GMCG 3OTJE 1SGQE 2QXIA 2G52A 2TGTA 1ZSJA 2GDEH 4BANB 1PPHE 1C1PA 4FUJA 4I8HA 1BRCE 1GBTA 3TGIE 1CHOG 4X2WA 4KKDA 1V2UT 1AUJA 5DG6A 4B73A 5L6NH 5C67A 2P59A 4XBCA 2G8TA 5C5OA 1EP6A 2F91A 2SGQE 1F5KU 1FONA 4J1YA 1SFQB 2FTLE 3FZZA 5EQRA 3N7OA 1P3CA 1DLKB 2PKSC 4B76A 1C1VH 5C3NA 3QDZB 1TMUH 3GY5A 3P8OA 3TH3H 1AMHA 4WWYA 2R3YA 3BTWE 5GWZA 2ZKSA 3UIRA 3KCGH 2BLQA 3H5CB 1V2OT 4NZLA 3NXPA 3EA8A 3TJOA 3JZ1B 4MNXA 1LKAA 4XBDA 1O2XA 4CRBA 1ABJH 2XNIA 2BX4A 4KTUA 3BEUA 4O97A 2Z9KA 4UDWH 1YLDA 1EATA 4ISLA 1Y3XA 3GY3A 3M5NA 1J8AA 1S81A 4U32A 2FLRH 1RFNA 1MQ6A 1P2MA 1QJ6B 1UJ1A 1ZOMA 3KQEA 1QFKH 2IPHA 4K69A 4O03A 3MU4A 3UQVA 3ENSB 4GAWA 5T3HA 2Y5HA 1LVYA 3BTKE 1O2GH 1MTVA 1XMNB 2BLWA 1NRSH 5EW1H 2GD4B 3TH4H 2SFAA 1ETSH 3ZVCA 1A3EH 1P2NA 4GHQA 1KXDA 4GVUA 5T6DA 1ETTH 4TWYA 4JYVH 5H4IB 3W95A 1KTSB 1QJ7B 2VINA 1MCVA 4B75A 3RXVA 1SMFE 3E0PB 3Q76A 1TABE 1X7AC 4H6SB 1V6DA 4FUDA 4UFFH 2FMJA 3KIDU 3LGTA 3MI4A 1G3BA 1XUJA 2A5IA 3VB3A 3MFJA 3C1KA 1SGIB 3U9AH 1VZQH 3M3SA 2F9VA 1SI5H 1J9CH 1NU9A 2QXGA 4ABDA 2J95A 1O2NA 1Y5UT 1QCPA 2AGEX 1TPSA 2THFB 1A0HB 1MD8A 4ABBA 1UTLM 1QBVH 1YPHE 3LPRA 5E2OA 4DURA 4TY7A 3RU4T 4NSYA 1AFEH 2GP9B 2XC0A 8KME2 1P06A 1GBEA 2H9HA 3ESTA 3E6PH 3PM3A 1A0JA 1HAIH 1TE0A 3TU7H 1HAOH 5FX5A 2G4UA 3HPTB 3MNXA 3PWBA 3O8DA 3V7TA 1MU8B 1P2IA 2VGCB 1MZDA 1GMDG 3O8CA 1EPTA 4A92A 2YNAA 1C5QA 1P3EA 3MU1A 4ISNA 2GCTB 2VVCA 1TQ7B 2BD8A 4J2YB 1ZR0A 1NRNH 3RXCA 1DWBH 3RXLA 1TBQH 3QTVH 1QNJA 2JETC 1KY9A 1O36A 3KNXA 5HGGA 1AGJA 1D3TB 3PO1C 4CH8B 1CT4E 1QL8A 3RMLH 3Q00A 2Q6DA 2J4IA 4CBNA 4NIVA 1HJ8A 1ELCA 1QY6A 3KQBA 4Y7AA 3PTNA 1OSSA 4DG4A 5C1YA 1A7SA 1INCA 3TVJB 3BSQA 3OU0A 1CT2E 1HAHH 4B2CA 1QBNA 5JDUB 1GPZA 2D8WA 2V3OH 3UR6A 1O3MA 1C5PA 1HBTH 4VGCB 1GBKA 2IOTA 1WOFA 3MHWU 5F8ZA 2Y80A 2ZCKP 2EA3A 1HPGA 1MBQA 1LHFH 1NRPH 2VNTA 1CU1A 4NWLA 4AGKA 1ZTLA 3B9FH 1J17T 5K0HA 4D7GA 4R0IA 1O5AB 5EOKA 1UHBA 2ZF0H 1EAXA 1QBOA 1IHTH 1TNLA 1GJ4H 9LPRA 1BMLA 1C5VA 3M5LA 3SHAH 2EEKA 1GMCF 3QO6A 1Q2WA 1GHAG 1VJAU 5DPAA 3P92A 1VGCB 2QGRA 1BMMH 1S83A 3OSYA 1B0FA 1EUFA 5TCCA 2A31A 2FO9A 2O8WA 3STJA 1HGTH 2HNTC 1F5RA 2GVFA 1CHOF 4FUGA 1DOJA 8GCHG 1OWDA 1ESAA 1GVZA 1LPKB 2Z7FE 1H8DH 1ZSLA 1EZXC 2VIVA 5JB9S 1BA8B 1F5LA 3D65E 2ZG0H 1TOMH 2ZPQA 3LGUA 1YYY1 4INHA 4FUBA 1N8OB 2EI7A 3KGPA 1AO5A 1XVOA 3IG6B 4BTIB 1CSOE 4XFQA 1V2QT 1C5UA 1F92A 3UOUA 3SNEA 3I29A 3KQCA 2FZZA 1E0FD 1C5WB 3LGYA 4NA8A 1MTSA 2BD2A 3GISB 1FIZA 3KN2A 4TY6A 4XDEA 2C90B 1LQDB 3RXKA 1K1JA 1TOCB 2ZHDA 1W13U 2BD7A 3FANA 1E36B 1ARBA 1QURH 3DFJA 1T8MA 3QGJA 1O31A 1YBWA 1GJ5H 4A5TS 1BRBE 4YOIA 2FI5E 4NA9H 1BTHH 3QGNB 3GCHB 1UO6A 2BOKA 1TWXB 2WUBA 3TK5A 4Z6AH 2GX4A 1W0ZU 2BY9X 1PPGE 4JZFH 2M5TA 1NFWA 3M3VA 3RXJA 4HFPB 3P95A 2PR3A 3GYMA 4YESB 1BOQA 4XSKU 2G55A 1H9LB 3UPEA 1CA0C 2ZDLA 1GJDB 5FXLA 2XBWA 3M35A 3M37A 1P12E 5A8XA 3QWCH 4Z0KA 3VXEH 4CRFA 4OGYA 1A5GH 2GDDA 1IQIA 1TGSZ 3FP7E 2ZDVH 4AYVB 1JRTA 1W7GH 1QA0A 1IQMA 1Z7KA 1V2NT 5C1UA 5K7RA 5CHAB 1YCPM 1L2EA 1O2KA 1KLIH 1QA7A 1TQ0B 4GCHG 1V3XA 3RXRA 4E06H 1C2MA 1S6FA 1GBHA 2XBYA 5GPIB 1BIOA 1FLEE 4ABJA 5TJXA 1SGRE 3BV9B 3MH4A 1SVPA 4WF8A 2YOLA 3PMJA 4AFSA 3LC3A 1SQAA 1C2GA 1S0QA 1O3PB 1VJ9U 1O32A 4NIWA 3MMGA 4XE4A 1Q3XA 3URCA 4ISOA 3U1JB 1O38A 3KQDA 1NFXA 3UNQA 4CHAC 3AASA 1AUTC 4MNVA 1QGFA 2QAAA 1O2TA 1OWJA 1C9TA 4K60A 4YZUA 1MUEB 1OPHB 2P3FH 2C4FH 2DE9A 4ASHA 3NKKA 3ITIA 4MNYA 1JBUH 5EODA 1PFXC 4IGDA 2PUQH 3U8OH 1ZMLA 1F2SE 1EZSC 3A81A 1W14U 2RA3A 4JYTA 3NCLA 2V35A 1A5HA 2ZDKA 3RLWH 5C5NA 1UVOA 1EB2A 3VB7A 3P17H 2OBQA 3QLPH 1P02A 1EKBB 1GBAA 2ZP0H 1J14A 3ZVGA 1A4WH 2UWOA 3MTYA 2GT7A 1IQNA 2W7UA 2ILNA 1G3EA 3ZYEA 3ZZ3A 1GHAF 1PQ7A 1OX1A 4ISHH 3WY8A 9ESTA 3M36A 2HNTE 4OS5A 2WV4A 4CRCA 3A87A 5BRRE 2P93A 1TRNA 1LQEA 4IMZA 1DUAA 1O5BB 2UWLA 2YNBA 1GBIA 2A5KA 1T4VH 4X1RU 3UNSA 3A8CA 2OTVA 1SQTA 4TWWA 4CR9A 3MH5A 1UK4A 1G3DA 4FUCA 4INKA 4INLA 4Y11E 4AG1A 2C8XB 5DP6A 4ABIA 5L2YH 3V12A 1BBRH 4RN6A 2AIPA 1BHXF 2ZFPH 1AD8H 1AI8H 1OYTH 1SLVB 4YT6H 3AW1A 5EU8A 4WJG2 3SW2B 2XCFA 5IDKA 1LPGB 1ESBA 3TH2H 1Z8RA 2ZU3A 4ZXXH 1DM4B 3A7VA 1C2EA 2BVRH 1ZHPA 1SGTA 2KAIB 1O2YA 1ANDA 1SGDE 1ZRBA 3GDVA 2RCEA 1BRUP 3F9EA 1SC8U 1FY8E 2TIOA 3S0NA 3NPSA 1OWKA 1PPEE 1DXPA 1DITH 1MBMA 2BOHB 2P8OC 1HJAB 1O2RA 3P8NA 4CR5A 1UTQA 1UVTH 3A7XA 3L3TA 1BBRK 4X8TH 2ZFTA 1V2MT 1SR5C 1NU7B 3MYWA 1SGCA 2NU1E 2VU8E 1FY5A 1O35A 1RTLA 2B8OH 3BTFE 5HMAA 2WYJA 1CQQA 4KP0A 3V13A 1T32A 2JH5D 1WAYB 3K9XB 2VH6A 1NPMA 1ORFA 1O3LA 3RXTA 1F0RA 2BB4A 4JZ1A 3ZZ5A 2VGCC 1DWEH 1NFYA 1TX8A 5DJ7A 3A7WA 1KLJH 3L6PA 5DGJA 3SJIA 1QR3E 1D6RA 2CJIA 3D49H 3CP7A 3GY2A 1YGCH 1EJNA 3W94A 1Z8JB 1SG8B 2P95A 4GCHF 3K2UA 2A4GA 4KTCA 1W8BH 3RXAA 3QX5H 3AAUA 1LHGH 1GI0A 1SGPE 1V2ST 2C93B 1FQ3A 4MPUA 7GCHG 4ZHLU 3SGAE 1YPHC 4ZH8A 3E1XB 1C2KA 1GJBB 2FOEA 2H9EH 1ANEA 1PYTC 3ZV8A 4VGCC 1CA0B 1O5EH 3RXDA 1NZQH 1P05A 1XVMA 4ZKRU 1CGIE 4GSOA 5EGMA 2Z9JA 2BTCE 2VIDA 3HKIB 2NWNA 1BTUA 3S7HB 2CV3A 1FPHH 2ZFSA 3F1SB 2BVSH 2ZTXA 1DX5M 3U69H 3H7TA 3EQ0H 1MD7A 4TYDA 5DKMA 5IYTA 3RC5A 1PPZA 5CMXH 1VGCC 1ETRH 2FOMB 1ZLRA 1AZZA 3RDZA 5A8ZA 2BY8X 3PROA 1GBLA 2J9NA 3ODFA 1EX3A 1VCQA 5DK1A 1C5LH 1WBGB 1FAKH 1QB9A 1RTKA 2AGIX 2QC2A 3LH3A 4UFDH 3MNCA 2G5NA 1P9SA 1DXWA 3T25A 1KDQA 2XXLA 2ZO3H 1O5FH 4NIXA 3SGQE 2Y6TA 1C2IA 4CHAB 2Z6BD 3SUDA 1MAXA 1THRH 2BDBA 1UK3A 4AOQA 3TNTA 1C5ZB 3MNSA 3SU1A 2QXHA 1GCTB 2UUYA 6CHAB 4X2VA 2ZPRA 3F68H 3GYLB 4OS2A 4U2WA 4MPXA 1AE5A 1NY22 2PGQB 1MCTA 3LOXA 1AKSB 3UNRA 2C8ZB 2RA0A 4ZKSU 1BT7A 2XC5A 4D8NA 3TNSA 4A6LA 1AVWA 1D3DB 2ANWA 3LKWA 1C1SA 3HKJB 3RM2H 4Y71A 1A3BH 4BAHB 1AE8H 1ELBA 1O2PA 2HOBA 3S9BA 1U6QA 3SZNA 4DGJA 1LHEH 4UONA 1TX6A 2J92A 3ODDA 3ZVDA 2A0QB 3T2NA 1A1RA 3T28A 2CF9H 1GHXH 1FV9A 4BAOB 3HK3B 1O2MA 2ZU4A 3GCHC 2NU3E 3S7KB 1L1GA 3M3TA 3QTOH 1T4UH 4WMDA 1OS8A 1KXEA 5AF9H 1FIWA 5L2ZH 1JXPA 2VB0A 3RC4A 1GWAA 4OS7A 1Y5BT 1GG6C 3PTBA 1HAYB 2TGPZ 4K3JA 2VIOA 1J16A 1ZZZA 5HM2A 2JH6D 4U30A 3A8BA 1LHDH 1WV7H 1XM1A 3RXFA 5LPFA 5HYOA 1SGNE 3ZZ6A 1C2LA 4DIIH 2A5AA 1LCYA 2HALA 2ZGHA 5CHAC 1D3QB 2Y81A 3D62A 1GI2A 1UCYH 3GDUA 3TGKE 3ZV9A 1XKAC 4GHTA 1W3CA 3RP2A 2ZA5A 2BLVA 1UTJA 2ZHWH 1GBMA 1DY8A 4ABEA 1Y8TA 1S0RA 2PHBA 1O2HA 1FUJA 3BG4B 2TGAA 2XWBI 1ZTJA 1KXAA 3U8RH 2F9OA 1G2MA 1T8OA 1YM0A 1H9HE 4I32A 1O2ZA 1LVBA 3FVFB 4NFEA 3VPKA 2P8OB 5GCHF 5PTPA 1DS2E 2PGBB 1RXPA 1NO9H 4Y10E 3BIUH 2VWOA 5GJ4B 4K5ZA 4KELA 3ZVAA 1TAWA 3LT3A 3SORA 5A09A 4D7FA 7GCHF 1UCYK 1UVSH 2G4TA 3NZIA 2CHAB 1DDJA 2O8MA 3UTUH 1SLXB 2CN0H 3SQHE 4Y0ZE 3QUMP 1G2LA 1IAUA 2C8YB 2SGDE 1ZMJA 1P09A 2ALVA 1E38B 2J2UA 2FOHA 1YPEH 3ELAH 1C1TA 2RG3A 1O2OA 2ZU2A 3LDXH 4ZMAH 3HK6B 1RGQA 3NK8A 2GTBA 3SQEE 4K8BA 1MTNB 1GI8B 1O3KA 3F9GA 2ZGCA 1RS0A 3A7TA 1P2OA 2I6QA 1TALA 2FOBA 1EPTC 2ZWLH 5JBBS 1O34A 1BMNH 1W12U 1O3AA 1ESTA 3QN7A 2OXSA 1CA8B 2ZDAH 5DP8A 4LZ1H 4JZIA 2B5TB 2SGFE 2OC7A 3ZVEA 2ZCHP 4X8SH 4AZ2B 1DT2A 5E0HA 4A1TA 2A7CA 1FPCH 1K1IA 3IWMA 2BDGA 4YTAA 2STBE 1C5XB 1FI8A 1IHSH 1HDTH 2R9PA 1ZPBA 1XUKA 1Y5AT 2B7DH 1FXYA 1TGTA 1O3HA 3SJ9A 2C3SA 4X8VH 1TFXA 2OINA 1KSNA 1CBWB 3RC6A 1ELGA 2AMPA 3H7OA 2BDHA 4BTUB 2BMGB 1HJ9A 4DJZB 3TJUA 3MO9A 2WPIS 1F0TA 2PKAB 4RKOB 1SB1H 4THNH 3GICB 3SJKA 4LZ4B 2WPKS 3E90B 5EPYA 1GMHG 2Z9IA 2JH0D 3OY5U 5F03A 1TBZH 1O3IA 3TGJE 1FMGA 2GMTC 4FVDA 4K8YA 3A83A 4H42U 1L4DA 2FPZA 2A2QH 4OS1A 5TCAA 4FUHA 1HJAC 2P3TB 1O30A 2ESTE 2VIWA 4X6MA 1DSUA 4FUIA 2BVXH 1ELVA 2Z3EA 1O2SA 4IW4E 2Y5FA 2EC9H 4I8KA 2B9LA 3ZZ9A 3A88A 5ABWA 3RXGA 3Q3KA 3NWUA 1G32B 1GHBG 4JK5A 1AIXH 2SGPE 2TRMA 3RUOA 2F9UA 3LGVA 5DP4A 1O2IA 1NRRH 1SGEE 1O3BA 2OC0A 1SGFG 1JIMA 1CHGA 1MQ5A 3A86A 2FESH 3L33A 3PLKA 1K2I1 5A2MH 5FAHA 1WQVH 4HZHA 2G00A 1P0SH 4CRGA 5C1XA 3LH1A 1EAUA 1YKTA 3R0FA 5LGOA 3ATWA 5AHGH 2GZ8A 2NU0E 4K1EA 1THPB 2DUCA 2FTMA 4DCDA 3RXBA 2FX6A 7KMEH 2O8UA 4IMQA 2FP7B 2CF8H 3ATMA 1FN6A 1LHCH 2H5DA 2GV6A 5A0CA 1GG6B 3MU5A 1UCYE 4SGBE 1FY4A 2J34A 1P01A 4A1VA 2G5VA 1A46H 3MWIU 1RRKA 1O3JA 4FUFA 1YP9A 2Z3DA 1Y3UA 2ZDMA 3STIA 3GY6A 4OGXA 2QF0A 3P8FA 2WUCA 1AN1E 2HVXA 3E91A 3TLOA 3VGCB 2D1JA 5F8XA 2BX3A 1JMOH 3UUZA 4JMYA 2R2WU 2FLBH 4WH6A 5ETXA 3ZZBA 1DWDH 2W3KA 1GMDF 4TPYA 1UK2A 5FPSA 1SGYE 2FWWA 3HATH 3MU0A 4X1NU 1QTFA 2FYQA 3SN8A 3FP8E 1DVAH 1O3OA 2HWLB 2PV9B 3RXSA 4X2XA 5F8TA 1ELFA 2P94A 1DPOA 4B2AA 2Q6GA 1PQAA 2VWNA 6LPRA 3ZZCA 3GDSA 5A0BA 4WXVA 1ZPZA 3PWCA 4YOGA 1AWHB 1NESE 1C1NA 2AYWA 4NSVA 3SUFA 3V3MA 1NT1A 1TB6H 3SNDA 2R3UA 1SPJA 3DUXH 1GCTC 3M5MA 4AYYB 1TA2A 6CHAC 4X1QU 1KLTA 3EA9A 2ZI2H 4CH2B 2AMDA 3LGIA 1T31A 4BTTB 2HGTH 4FXGH 4NA7A 4AN7A 1P04A 3QZQA 3RXMA 4DT7B 1YPGH 3LJOA 1MU6B 2BZ6H 1ANCA 3SJOA 3B8JA 4X6PA 1SBWA 2FOCA 3MO6A 1AB9C 3BTGE 4MDSA 1CT0E 3BTDE 1EPTB 1YPMH 1K21H 2BHGA 2F9PA 1PJPA 3RXQA 1ZJKA 1AVGH 1SOTA 1HCGA 1C4Y2 1YCPH 2ODQA 1TGNA 2BD4A 4NCYA 2AGGX 8GCHF 1GMHF 1EAIA 2HNTF 6GCHG 2BZAA 4I8GA 1B0EA 2F3CE 4FU9A 3SV2H 1QQ4A 1GL1A 3SO3A 3SOSA 2A7JA 4AFQA 3PMHB 2ZGXH 1LKBA 1O2QA 1PPFE 2A4QA 2FOFA 3M61U 4WVPE 2ODYB 3QK1A 1E35B 1V2PT 1G37A 3UFAA 3F9FA 1ARCA 1G36A 1T7CA 1ZGVA 5FPTA 2PTNA 1BTXA 4PROA 2ZFRH 3ZZ7A 4X2YA 4CRDA 1L0ZA 3RXIA 3A85A 5A8YA 1IQEA 2ZHQH 1AHTH 5G4BA 1W11U 1YCPK 2VIQA 4H4FA 2QF3A 1UHBB 2AIQA 1TA6A 3PLBA 1OOKB 1S6HA 4NG9H 2FS8A 4X6NA 2OP9A 3BG4C 3URDA 3CS0A 1C5RA 1K1NA 1TYNA 1B7XB 2A4OA 2GMTB 2H5CA 4WXIA 1GJAB 2CGAA 1IQLA 2OUAA 5J4SA 1JIRA 1WCZA 1M9UA 4Q7ZA 1C2HA 1TNGA 1TONA 1GVKB 3Q3XA 1LMWB 3GCOA 2OQ5A 3B23B 4Q80A
chains in the Genus database with same CATH superfamily
1GJ9B 3OYPA 2CHAC 5ESBA 1NM6A 5JPMH 5EQQA 4NWKA 2ANYA 2FYRA 4Y79A 1YPJH 1OP2A 1FY1A 4Q2KA 1XXDA 5GXPA 3SV9A 2ZFQH 4RT1A 5ESTE 4MQAA 1Y3WA 1BMAA 4RSPA 4FUEA 3RM0H 4AB9A 4B74A 2FM2A 3QZRA 1TGCA 1BHXB 1RTFB 4MTBA 1JRSA 4O9VA 1MTNC 1P2QA 1YPLH 1Z6EA 5HXFA 3TJNA 1EJAA 1SHHB 1HAVA 5E8EH 1AZ8A 1Y3YA 4AB8A 2PFEA 4R8TB 4JZEH 3ZZAA 4UEHH 4I8LA 1RJXB 1GI3A 1EOJA 3ZZDA 1A0LA 2ZDNA 2OC1A 1YF4A 4B71A 1ZHMA 2F9NA 2UUFB 3K65B 4Y8XA 2V3HH 5C17A 3FFGA 1OWIA 1P03A 1HLTH 2BQ7B 1WU1A 4ZKNU 1PPCE 2ZQ1A 1WSSH 2OQ5A 3GY7A 8LPRA 3O8BA 5L30H 4D76A 3RU4D 3A7ZA 1W10U 5EW2H 1WTHD 1MAYA 3BTQE 4ZUHA 2ZTZA 1DLEA 2FIRH 1C5NH 3EYDA 3ZVBA 1CBWC 1OP0A 4F55A 3RXPA 1QHRB 3DSGA 1ELAA 1O3DA 1QRWA 2NU2E 3SJ8A 1DICA 1ZRKA 4BNRA 3U8TH 2D26C 3Q3YA 1NTPA 4MPWA 2UUKB 1VITG 3K6ZA 3UWJH 1CGHA 3LU9B 1BTPA 2HPQH 1C5TA 3EGKH 5T1VA 4LK4A 2A2XH 2BY5X 1EP5A 1AQ7A 1D6WA 4IBLH 2VJ1A 2F43B 3BF6H 3HGPA 3UOPA 2WV5A 3SI4H 3SU0A 4CREA 1BQYA 1O2VA 2HRVA 1O2WA 2BDYA 3Q77A 1NS3A 1MKWH 1GI7B 2Z3CA 3RXEA 4MNWA 2O8LA 3VB5A 4ABFA 5LPRA 1T8LA 4IN1A 5C2ZA 6GCHF 2UUJB 3DA9B 1W2KH 3T62A 2WSSD 5FCKA 2BD3A 1EOLA 1C2JA 4F4OC 3DT0H 1IQGA 1O5GH 3F2FA 1H4WA 2FOGA 1WYKA 2D2DA 4XD7D 1AWFH 2BXUH 1TPAE 3SU3A 1GBDA 2XBVA 2ULLA 2J38A 5LPEA 1H8IH 4RKJB 1BTWA 2Y5GA 3RLYH 2ZU1A 1CGJE 1AB9B 3E8LA 2EQNA 3EE0B 2ZPSA 1SLWB 4MLFB 4BXSA 1MKWK 1EJMA 1Z71A 3U98H 4HTCH 1HFDA 3SNAA 1S84A 3SU2A 3ZYDA 1HAPH 5CE1A 1NN6A 4DIHH 2BQ6B 1TMTH 3LONA 1OP8A 1K9OE 1F0SA 1KXCA 1BBRE 2DE8A 3CS7A 4GPGA 5FCRA 2GKVE 1SOZA 1QQUA 1XUFA 1GVLA 2GCHG 1Z8GA 2FS9A 1C1UH 5JB8S 3F9HA 2WPJS 1V2VT 3HGNA 5CDFE 1P11E 1FNIA 4IN2A 3KEEA 4NZQA 2QIQA 2R0KA 4FU8A 3UWIA 1E1QD 4X6OA 1O3CA 1MMJN 1DE7H 3OX7U 4ABGA 1FDPA 4DOQA 1ZMNA 2J94A 1Z6JH 1ABIH 3VGCC 5C20A 3U1IB 4OS6A 3SUEA 1BB0B 3BTME 1C2FA 2KFWA 7ESTE 3SBKA 2LNCA 3LIWA 4D9QA 3A84A 4Y7BA 3BIVH 1FJSA 3LGWA 4MPVA 4JK6A 4OS4A 1S5SA 2B0FA 2J98B 2W5EA 1DWCH 1KYNA 1ACBE 5C94A 2FDAA 2JIZD 2BDAA 2YMSC 2Y82A 3A8AA 4FU7A 4YT7H 2XYAA 5EXNA 1CO7E 2UWPA 3AW0A 2G81E 3CENA 4LXBH 1K1MA 3KYGA 2FXRA 2ZZUH 1H9IE 2Q1JA 2R2MB 2VH0A 4U01A 4B6EA 1L4ZA 1E37B 1MH0A 4MVNA 3BEIB 4I33A 1UMAH 1IQFA 2VVVA 2PTCE 2GV7A 2XTTB 2O8TA 2BQWB 1O2UA 3T29A 3OY6U 1EAWA 3ZZ8A 4DVAU 1C5MD 4ZKOU 2P16A 4ESTE 5CHBA 3DHKH 1N1LA 1XKBC 2Z94A 1W0YH 1PQ8A 4O3TA 3KF2A 1O3FA 1EXFA 4LOYH 1NRQH 2VWMA 1V2JT 5DP9A 4YOJA 1XUGA 5SGAE 3UY9A 1V2LT 4WMEA 4BOHA 1L1JA 1TBRH 3F3BA 1EQ9A 1KIGH 1PYTD 1LTOA 1HIAA 3GOVB 3SUGA 1VITF 5EXMA 1GI9B 2OD3B 4Y8YA 3SU5A 1BDAA 1NC6A 2BD9A 1HAVB 1KTTB 2QY0B 4IS5A 2FI4E 1S82A 1O5CB 3PMAB 2A4RA 2ALPA 3FZDA 5DP5A 5GIBA 5E2PA 3VB6A 1UTOA 4KTSA 1LDTT 1C4U2 5EG4A 1UTKA 3AVZA 4NGAH 5T6GA 4MG3A 3OEED 2PSXA 3VG8A 2CXVA 1FN8A 1GI6A 4GLYA 1P9UA 3MO3A 5BPEA 2EI8A 4Z1MD 2H2ZA 2ZHEH 3A82A 1UVPA 5HM9A 2CK3D 1PQ5A 5EQSA 4AFZA 1RIWC 1ANBA 3KL6A 1TNJA 3NRLA 1YC0A 2GGVB 2H6MA 3M7UA 4WY3A 4Y6DA 3VXFH 1LVMA 1ID5H 2KCPA 2OC8A 1GJ8B 2KAIA 1ZJDA 1IQJA 4FVBA 4ABHA 1EB1H 2ZGBH 3LJJA 2ZTYA 4YLUA 4KGAA 1BRAA 5AFZH 2BDIA 2FEQH 1KDQB 1ZHRA 1GHYH 1GBCA 2A45B 1MTUA 1PPBH 4I31A 1AFQB 4BAMB 3SNCA 1QB1A 1HV7A 2Z9GA 2XC4A 2V6NA 3PYHA 3TK9A 4A7IB 2SGEE 2GCHF 3BTTE 2L6OA 2TBSA 4E7RG 2PUXB 1O33A 2KCYA 2XW9A 2PWXA 1GBFA 3I77A 1P57B 4A1XA 5AVDA 4CRAA 1QL9A 1SGFA 2Z9LA 5EXLA 3AK5A 1TNKA 1LVOA 2AS9A 2F83A 1C2DA 1HXFH 1XUIA 4AGJA 1OKXA 1O2LA 2OLGA 1VR1H 2W3IA 4ZROA 4XOJA 3RXHA 1BTZA 1GDUA 1QL7A 2A7HA 2WPMS 4DW2U 4Y0YE 4ZAEA 1OXGA 3PV2A 3SU6A 1C1RA 1A5IA 3PB1E 4WH8A 1F0UA 1HUTH 1HYLA 1V2WT 2PKSB 2ZCLP 3TK6A 2ANKH 4XBBA 3WWBA 1P8VC 5GDSH 1QRZA 2AHME 3GCTG 1BZXE 1WQSA 2BY7X 4H6TA 2ODPA 3SGBE 2ASUB 4QT8C 3OTPA 4JZDH 3EA7A 4F49A 2TGDA 3M5OA 1EZQA 1W7XH 2WPHS 3E0NB 2EI6A 1O3EA 1QZ8A 2R0LA 3E3TA 5F53A 4YM9A 4YLQH 4P00A 1HB0B 1GHVH 2Y7XA 1AVXA 1G3CA 3PLPA 2WINI 3RXOA 1GI4A 1UTPA 1K1OA 5J4QA 1NFUA 1DANH 3R3GB 1GDNA 2Q6FA 1D4PB 2XWAA 4AG2A 4X8UH 4P02A 5B6OA 1KXFA 2QA9E 2ZNKH 4WMFA 4K1TA 3UQOA 5F6MA 1UVUH 5I25A 4UFGH 1OWHA 1GI1A 1OWEA 1O3NA 2QXJA 1TIOA 3DFLA 3M7QA 2QV1A 2SNVA 1C9PA 1RD3B 1SFIA 1LPZB 1IQKA 3D23A 5EPNA 2ZU5A 1O37A 2IN2A 2VWLA 4BAKB 1E34B 3RXUA 2AEIH 2ZHFH 1VCPA 4ZXYH 1C5YB 4HG6A 1GGDC 4SGAE 4DY7B 1TLDA 2NU4E 2ANMH 3E16B 1VCWA 1Q31A 1QRXA 1ZYOA 2AMQA 5E0GA 2ZEBA 1AKSA 1D9IA 2ZC9H 1ZGIA 4X1PU 4NFFA 2AERH 1SLUB 2ZFFH 4IC5A 4UE7H 4ISIH 5DO4H 1K1LA 3N7DA 2W6JD 1FZZA 1V2TT 1B5GH 3K6YA 5JBTA 1N6YA 3F6UH 5AFYH 3G01A 4BXWA 1NROH 4X0WU 3TITA 1MKXH 1FAXA 1C5SA 1THSH 5E0JA 1NBMD 4AORA 2K8IA 1GCDA 1GL0E 5FHTA 4ZHMU 2GZ7A 1HIAB 2BY6X 1D3PB 1GHWH 1TRYA 2JETB 3T26A 3RMMH 2FOAA 2BDCA 5FPYA 2FODA 4JCNA 4K1SA 3PO1B 4B2BA 1MTWA 4TPIZ 4F48B 3IITA 3I78A 1HAZB 2BYAX 1O2JA 1A61H 1IQHA 1V2RT 1C1OA 5I46H 4UD9H 1ZTKA 2O9QA 3S9AA 1J15A 5T6FA 2HLCA 5FBIA 2CMYA 1C1MA 1XXFA 1SSXA 4CBOA 1P2KA 1C4V2 3S9CA 1GHBF 4ABAA 1XX9A 1GJ7B 4M7GA 1GDQA 1QB6A 2AH4X 2ZECA 3LC5A 1RIWB 3DD2H 1DFPA 1O3GA 1MKXK 3A80A 3C27B 1G9IE 3P70B 3FAOA 1QJ1B 1ELEE 1C1QA 1BITA 3ATLA 2VVUA 3BTEE 1MZAA 1WTGH 3MH7A 3RMOH 1CVWH 3EE7A 1KXBA 3NUMA 3GCNA 4HI3A 1DUEA 1P2JA 1LO6A 3F2GA 3JZ2B 3ZVFA 1L1NA 1HAGE 2A32A 4IC6A 3ZZ4A 2XNDD 1K22H 3GY4A 4I8JA 5DP7A 2XBXA 3RMNH 1GI5A 5A0AE 2RFKC 1AU8A 1IOEA 3MOCA 1HRTH 1K1PA 2TPIZ 1ZPCA 4HGCA 4TT3D 1Z1IA 3F2HA 1K28D 1Y59T 2W7SA 3TIUA 1WUNH 3V0XA 4K2YA 3PV4A 4Q7XA 1UTMA 3SV6A 1JOUB 4I86A 2KZ4A 1ELTA 2QN5T 5LH8A 3FP6E 3GCTF 2H9TH 3BN9A 6ESTA 3EDXB 1SQOA 3BTHE 3MU8A 4Q63A 3PMBB 1FY3A 5FX6A 1G30B 1O39A 4BAQB 1BJVA 1Z1JA 5DP3A 1C1WH 4Q7YA 3SV7A 2GZ9A 2WPLS 2ZQ2A 1C5OH 3S69A 2STAE 3O8RA 3KHVA 4YO9A 3SU4A 2AFQB 2P3UB 2H1UA 2OBOA 4GUXA 3ATKA 3SNBA 1H1BA 1YLCA 1GJ6A 1XUHA 3AAVA 2PW8H 2GCTC 1TPPA 3VFEA 2Y7ZA 1TRMA 3SI3H 3TJVA 3RU4E 1UTNA 1DSTA 2I6SA 5EJZA 4Y76A 2BLOA 2XRCA 2F9BH 1GBJA 5GCHG 3T5FH 1DY9A 3SHCH 4UFEH 1OYQA 5JBAS 1CE5A 2HPPH 1F7ZA 3WW7A 2SNWA 2PLXA 1TPOA 1BTYA 2XCNA 1BJUA 1O5DH 3UR9A 1Z8IB 2A1DB 1GBBA 2ZGJA 1VITH 1AY6H 4AFUA 1ZSKA 3MH6A 8ESTE 1JWTA 1T8NA 1V2KT 2C8WB 4E7NA 2GT8A 2JDID 4FETA 4X1SU 5JYIA 3ATIA 2JKHA 3P6ZB 2K1QA 3BG8A 3MNBA 2RDLA 2QYIA 3DCLA 4ZHAA 2V0BA 2FI3E 1EFRD 3VEQB 1HNEE 3SV8A 1A2CH 3BEFB 2BD5A 1O0DH 1EZUC 2PKAA 2VIPA 3M7TA 1HXEH 2QCYA 4E05H 2G51A 1TMBH 2OCVB 1YPKH 1P10A 2OQUA 4O3UA 5KGOA 1BUIA 4AX9H 5EJLA 2IJOB 1SHYA 1Y3VA 1EASA 1S85A 2BXTH 3EAJA 2PSYA 3GY8A 4I7YH 5JBCS 1HAXB 5FBEA 1GJCB 2ZIQH 4JYUH 1TNHA 1AFQC 4OM9A 2WYGA 4B1TA 7LPRA 2W26A 3TPIZ 3A8DA 4D9RA 1BCUH 2SGAA 4NIYA 1QIXB 1TNIA 1GGDB 1N6XA 1N8OC 3VB4A 1TGBA 1ELDE 2LPRA 4Y8ZA 3T27A 3P8GA 1GHZA 2FX4A 1TX7A 1SL3A 3A89A 3A7YA 5KEDA 3UREA 2BM2A 1GMCG 3OTJE 1SGQE 2QXIA 3U28C 2G52A 2TGTA 1ZSJA 2GDEH 4BANB 1PPHE 1C1PA 3SYJA 4FUJA 4I8HA 1BRCE 1GBTA 5FL7D 3TGIE 1CHOG 4X2WA 4KKDA 1V2UT 1AUJA 5DG6A 4B73A 5L6NH 5C67A 2P59A 4XBCA 2G8TA 5C5OA 1EP6A 2F91A 2SGQE 1F5KU 1FONA 4J1YA 1SFQB 2FTLE 3FZZA 5EQRA 3N7OA 1P3CA 1DLKB 2PKSC 4B76A 1C1VH 5C3NA 3QDZB 1TMUH 3GY5A 3P8OA 3TH3H 1AMHA 4WWYA 2R3YA 5GNDA 3BTWE 5GWZA 2ZKSA 3UIRA 3KCGH 2BLQA 3H5CB 2JJ1D 1V2OT 4NZLA 3NXPA 5DN6D 3EA8A 5HKKD 3TJOA 3JZ1B 4MNXA 1LKAA 4XBDA 1O2XA 4CRBA 1ABJH 2XNIA 2BX4A 4KTUA 3BEUA 4O97A 2Z9KA 4UDWH 1YLDA 1EATA 4ISLA 1Y3XA 3GY3A 3M5NA 1J8AA 1S81A 4U32A 2FLRH 1RFNA 1MQ6A 1P2MA 1QJ6B 1UJ1A 1ZOMA 3KQEA 1QFKH 2IPHA 4K69A 4O03A 3MU4A 3UQVA 3ENSB 4GAWA 5T3HA 2Y5HA 1LVYA 3BTKE 1O2GH 1MTVA 1XMNB 2BLWA 1NRSH 5EW1H 2GD4B 3TH4H 2SFAA 5HIYA 1ETSH 3ZVCA 1A3EH 1P2NA 4GHQA 1KXDA 4GVUA 5T6DA 1ETTH 4RI0A 4TWYA 4JYVH 5H4IB 3W95A 1KTSB 1QJ7B 2VINA 1MCVA 4B75A 1COWD 3RXVA 1SMFE 3E0PB 3Q76A 1TABE 1X7AC 4H6SB 1V6DA 4FUDA 4UFFH 2FMJA 3PRDA 3KIDU 3LGTA 3MI4A 1G3BA 1XUJA 2A5IA 3VB3A 3MFJA 3C1KA 1SGIB 3U9AH 1VZQH 3M3SA 2F9VA 1SI5H 1J9CH 1NU9A 2QXGA 4ABDA 2J95A 1O2NA 1Y5UT 1QCPA 2AGEX 1TPSA 2THFB 1A0HB 1MD8A 4ABBA 1UTLM 1QBVH 1YPHE 3LPRA 5E2OA 4DURA 4TY7A 3RU4T 4NSYA 1AFEH 2GP9B 2LELA 2XC0A 8KME2 1P06A 1GBEA 2H9HA 3ESTA 3E6PH 3PM3A 1A0JA 1HAIH 1TE0A 3TU7H 1HAOH 5FX5A 2G4UA 3HPTB 3MNXA 3PWBA 3O8DA 3V7TA 1MU8B 1P2IA 2VGCB 1MZDA 1GMDG 3O8CA 1EPTA 4A92A 2YNAA 1C5QA 1P3EA 3MU1A 4ISNA 1KMHB 2GCTB 3W1EA 2VVCA 1TQ7B 3F0OA 2BD8A 4J2YB 1ZR0A 1NRNH 3RXCA 1DWBH 3RXLA 1TBQH 3QTVH 1QNJA 2JETC 1KY9A 1O36A 3KNXA 5HGGA 1AGJA 1D3TB 3PO1C 4CH8B 1CT4E 1QL8A 3RMLH 3Q00A 2Q6DA 2J4IA 4CBNA 4NIVA 1HJ8A 1ELCA 1QY6A 3KQBA 4Y7AA 3PTNA 1OSSA 4DG4A 5C1YA 1A7SA 1INCA 3TVJB 3BSQA 3OU0A 1CT2E 1HAHH 4B2CA 1QBNA 5JDUB 1GPZA 2D8WA 2V3OH 3UR6A 1O3MA 1C5PA 1HBTH 4VGCB 1GBKA 2IOTA 1WOFA 3MHWU 2VBCA 5F8ZA 2Y80A 2ZCKP 2EA3A 1HPGA 1MBQA 1LHFH 1NRPH 2VNTA 1CU1A 4NWLA 4AGKA 1ZTLA 3B9FH 1J17T 3WWFA 5K0HA 4D7GA 4R0IA 1O5AB 5EOKA 5IK2D 1UHBA 2ZF0H 1EAXA 1QBOA 1IHTH 1TNLA 1GJ4H 9LPRA 1BMLA 1C5VA 3M5LA 2KX4A 3SHAH 2EEKA 1GMCF 3QO6A 1Q2WA 2XOKD 1GHAG 1VJAU 5DPAA 3P92A 1VGCB 2K0QA 2QGRA 1BMMH 1S83A 3OSYA 1B0FA 1EUFA 5TCCA 2A31A 2FO9A 2O8WA 3STJA 1HGTH 2HNTC 1F5RA 2GVFA 1CHOF 4FUGA 1DOJA 8GCHG 1OWDA 1ESAA 1GVZA 1LPKB 2Z7FE 1H8DH 1ZSLA 1EZXC 2VIVA 5JB9S 1BA8B 1F5LA 3D65E 2ZG0H 1TOMH 2ZPQA 3LGUA 1YYY1 4INHA 4FUBA 1N8OB 2EI7A 3KGPA 1AO5A 1XVOA 3IG6B 4BTIB 1CSOE 4XFQA 1V2QT 1C5UA 1F92A 3UOUA 3SNEA 3I29A 3KQCA 2FZZA 1E0FD 1C5WB 3LGYA 4NA8A 1MTSA 2BD2A 3GISB 1SKYE 1FIZA 3KN2A 4TY6A 4XDEA 2C90B 1LQDB 2RDEA 3RXKA 1K1JA 1TOCB 2ZHDA 1W13U 2BD7A 3FANA 1E36B 1ARBA 1QURH 3DFJA 1T8MA 3QGJA 1O31A 1YBWA 1GJ5H 4A5TS 1BRBE 4YOIA 2FI5E 4NA9H 1BTHH 3QGNB 3GCHB 1UO6A 2BOKA 1TWXB 2WUBA 3TK5A 4Z6AH 2GX4A 1W0ZU 2BY9X 1PPGE 4JZFH 2M5TA 1NFWA 3M3VA 3FO8D 3RXJA 4HFPB 3P95A 2PR3A 3GYMA 4YESB 1BOQA 4XSKU 2G55A 1H9LB 3UPEA 1CA0C 2ZDLA 1GJDB 5FXLA 2XBWA 3M35A 3UAIC 3M37A 4ACBA 1P12E 5A8XA 3QWCH 2YMSD 4Z0KA 3VXEH 4CRFA 4OGYA 1A5GH 2GDDA 1IQIA 1TGSZ 3FP7E 2ZDVH 4AYVB 1JRTA 1W7GH 1QA0A 1IQMA 1Z7KA 1H8ED 1V2NT 5C1UA 5K7RA 5CHAB 1YCPM 1L2EA 1O2KA 1KLIH 1QA7A 1TQ0B 2IPQX 4GCHG 1V3XA 3RXRA 4E06H 1C2MA 1S6FA 1GBHA 2XBYA 5GPIB 1BIOA 1FLEE 4ABJA 5TJXA 1SGRE 3BV9B 3MH4A 2LP6A 1SVPA 4WF8A 2YOLA 4RT0A 3PMJA 4AFSA 3LC3A 1SQAA 3GS9A 1C2GA 1S0QA 1O3PB 1MABB 1VJ9U 1O32A 4NIWA 3MMGA 4XE4A 1Q3XA 3URCA 4ISOA 3U1JB 1O38A 3KQDA 1NFXA 3UNQA 4CHAC 3AASA 1AUTC 4MNVA 4DT4A 1QGFA 2QAAA 1O2TA 1OWJA 1C9TA 4K60A 4YZUA 1MUEB 1OPHB 2P3FH 2C4FH 2DE9A 4ASHA 3NKKA 3ITIA 4MNYA 1JBUH 5EODA 1PFXC 4IGDA 2PUQH 3U8OH 1ZMLA 1F2SE 1EZSC 2QF4A 3A81A 1W14U 2RA3A 4JYTA 1NBME 3NCLA 2V35A 1A5HA 2ZDKA 3RLWH 5C5NA 1UVOA 1EB2A 3VB7A 1UW7A 3P17H 2OBQA 3QLPH 1P02A 1EKBB 1GBAA 2ZP0H 1J14A 3ZVGA 1A4WH 2UWOA 3MTYA 2GT7A 1IQNA 2W7UA 2ILNA 1G3EA 3ZYEA 3ZZ3A 1GHAF 1PQ7A 1OX1A 4ISHH 3WY8A 1BMFD 9ESTA 1WXRA 3M36A 2HNTE 2V3MA 3KQ5A 4OS5A 2WV4A 4CRCA 3A87A 5BRRE 2P93A 1TRNA 1LQEA 4IMZA 1DUAA 3FKSD 1O5BB 2UWLA 2YNBA 1GBIA 2A5KA 1T4VH 4X1RU 3UNSA 3A8CA 2OTVA 1SQTA 4TWWA 4CR9A 3MH5A 1UK4A 1G3DA 4FUCA 4INKA 4INLA 4Y11E 4AG1A 2C8XB 5DP6A 4ABIA 5L2YH 3V12A 1BBRH 4RN6A 2AIPA 1BHXF 2ZFPH 1AD8H 1AI8H 1OYTH 1SLVB 4YT6H 3AW1A 5EU8A 4WJG2 3SW2B 2XCFA 5IDKA 1LPGB 1ESBA 3TH2H 1Z8RA 3OEHD 2ZU3A 4ZXXH 2J98A 4M9FA 3A7VA 1C2EA 2BVRH 1ZHPA 1SGTA 2KAIB 1O2YA 1ANDA 1SGDE 1ZRBA 3GDVA 2RCEA 1BRUP 4FOUC 2KCAA 3F9EA 1SC8U 1FY8E 1YLNA 2TIOA 3S0NA 3NPSA 1OWKA 1PPEE 1DXPA 3OE7D 1DITH 1MBMA 2BOHB 2P8OC 1HJAB 1O2RA 3P8NA 4CR5A 1UTQA 1UVTH 2J97A 3A7XA 3L3TA 1BBRK 4X8TH 2ZFTA 1V2MT 1SR5C 1NU7B 3MYWA 1SGCA 2NU1E 2VU8E 1FY5A 1O35A 1RTLA 2B8OH 3BTFE 5HMAA 3DSPA 2WYJA 1CQQA 4KP0A 3V13A 1T32A 2JH5D 1WAYB 3K9XB 2VH6A 1NPMA 1ORFA 1O3LA 3RXTA 1F0RA 2BB4A 4JZ1A 3ZZ5A 2VGCC 1DWEH 1NFYA 1TX8A 5DJ7A 1SQRA 3A7WA 1KLJH 3L6PA 4AC9A 5DGJA 3SJIA 1QR3E 1S6LA 2KR7A 1D6RA 2CJIA 3D49H 3CP7A 3GY2A 1YGCH 1EJNA 3W94A 1W0KD 1OHHD 1Z8JB 1SG8B 2P95A 4GCHF 3K2UA 2A4GA 4KTCA 1W8BH 3RXAA 3QX5H 3AAUA 1LHGH 1GI0A 1SGPE 1V2ST 2C93B 1FQ3A 4MPUA 7GCHG 4ZHLU 3SGAE 1YPHC 4ZH8A 3E1XB 1C2KA 1GJBB 2FOEA 2H9EH 1ANEA 1PYTC 3ZV8A 4VGCC 1CA0B 1O5EH 3RXDA 1NZQH 1P05A 1XVMA 4ZKRU 1CGIE 4GSOA 5EGMA 2Z9JA 2BTCE 2VIDA 3HKIB 2NWNA 1BTUA 3S7HB 2CV3A 1FPHH 2ZFSA 3F1SB 2BVSH 2ZTXA 1DX5M 3U69H 3H7TA 3EQ0H 1MD7A 4TYDA 5DKMA 5IYTA 3RC5A 1PPZA 5CMXH 1VGCC 1ETRH 2FOMB 1ZLRA 1AZZA 3RDZA 5A8ZA 2BY8X 3PROA 1GBLA 2J9NA 3ODFA 1EX3A 1VCQA 5DK1A 1C5LH 1WBGB 1FAKH 1QB9A 1RTKA 2AGIX 3F0PA 2QC2A 3LH3A 4UFDH 3MNCA 2G5NA 1P9SA 1DXWA 3T25A 1KDQA 2XXLA 2ZO3H 2L74A 1O5FH 4NIXA 3SGQE 2Y6TA 1C2IA 4CHAB 2Z6BD 3SUDA 3FOAA 1MAXA 1THRH 2BDBA 1UK3A 4AOQA 3TNTA 1C5ZB 3MNSA 3SU1A 2QXHA 1GCTB 2UUYA 3DSOA 6CHAB 4X2VA 2ZPRA 3F68H 3GYLB 4OS2A 4U2WA 4MPXA 1AE5A 1NY22 2PGQB 1MCTA 3LOXA 1AKSB 3UNRA 2C8ZB 2RA0A 3N99A 4ZKSU 1BT7A 2XC5A 4D8NA 3TNSA 4A6LA 1AVWA 1D3DB 2ANWA 3LKWA 1C1SA 3HKJB 3RM2H 4Y71A 1A3BH 4BAHB 1AE8H 1ELBA 1O2PA 2HOBA 3S9BA 1U6QA 3SZNA 4DGJA 1LHEH 4UONA 1TX6A 2J92A 3ODDA 3ZVDA 4ZCNA 4Q4LA 2A0QB 3T2NA 1A1RA 3T28A 2CF9H 1GHXH 2KM0A 1FV9A 4BAOB 3HK3B 1O2MA 2ZU4A 3GCHC 2NU3E 3S7KB 1L1GA 3M3TA 2OK5A 3QTOH 1T4UH 4WMDA 1OS8A 1KXEA 2JJ2D 5AF9H 1FIWA 5L2ZH 1JXPA 2VB0A 3RC4A 5KECA 1GWAA 4OS7A 1Y5BT 1GG6C 3PTBA 1HAYB 2TGPZ 4K3JA 2VIOA 1J16A 1ZZZA 5HM2A 2JH6D 4U30A 3A8BA 1LHDH 1WV7H 1XM1A 3RXFA 5LPFA 5HYOA 1SGNE 3ZZ6A 1C2LA 4DIIH 2A5AA 1LCYA 2HALA 2ZGHA 5CHAC 1D3QB 2Y81A 3D62A 1GI2A 1UCYH 3GDUA 3TGKE 3ZV9A 1XKAC 4GHTA 1W3CA 3RP2A 2ZA5A 2BLVA 1UTJA 2ZHWH 1GBMA 1DY8A 4ABEA 1Y8TA 1S0RA 2PHBA 1O2HA 1FUJA 3BG4B 2TGAA 2XWBI 1ZTJA 1KXAA 3U8RH 2F9OA 3FN8A 1G2MA 1T8OA 1YM0A 1H9HE 4I32A 1O2ZA 1LVBA 3FVFB 4NFEA 3VPKA 2P8OB 5GCHF 5PTPA 1DS2E 2PGBB 1RXPA 1NO9H 4Y10E 3BIUH 2VWOA 5GJ4B 4K5ZA 4KELA 3ZVAA 1TAWA 3LT3A 3SORA 5A09A 4D7FA 7GCHF 1UCYK 1UVSH 2G4TA 3NZIA 2CHAB 1DDJA 2O8MA 3UTUH 1SLXB 2CN0H 3SQHE 4Y0ZE 3QUMP 1G2LA 1IAUA 2C8YB 2SGDE 1ZMJA 1P09A 2ALVA 1E38B 3CNRA 2J2UA 2FOHA 1YPEH 3ELAH 1C1TA 2RG3A 1O2OA 2ZU2A 3LDXH 4ZMAH 3HK6B 1RGQA 3NK8A 5DSFA 2GTBA 3SQEE 4K8BA 1MTNB 1GI8B 1O3KA 2M2AA 3F9GA 2ZGCA 1RS0A 3A7TA 1P2OA 2I6QA 1TALA 2FOBA 1EPTC 2ZWLH 5JBBS 1O34A 4YXWD 1BMNH 1W12U 1O3AA 1ESTA 3N7EA 3QN7A 2OXSA 1CA8B 2PP6A 2ZDAH 5DP8A 4LZ1H 4JZIA 2B5TB 2SGFE 2OC7A 3ZVEA 2ZCHP 4X8SH 4AZ2B 1DT2A 5E0HA 4A1TA 2A7CA 1FPCH 3OAAD 1K1IA 3IWMA 2J5UA 2BDGA 4YTAA 2STBE 1C5XB 1FI8A 1IHSH 3UB0A 1HDTH 1W0JD 2R9PA 1K0HA 1FX0B 1ZPBA 1XUKA 1Y5AT 2B7DH 1FXYA 1TGTA 1O3HA 2WPDD 3SJ9A 2C3SA 4X8VH 1TFXA 2OINA 1KSNA 1CBWB 3RC6A 1ELGA 2AMPA 3H7OA 2BDHA 4BTUB 2BMGB 1HJ9A 4DJZB 4TSFD 3MO9A 3TJUA 2WPIS 1F0TA 1YWUA 2PKAB 4RKOB 1SB1H 4THNH 3GICB 3SJKA 4LZ4B 2WPKS 3E90B 5EPYA 1GMHG 1H8HD 2Z9IA 2JH0D 3OY5U 5F03A 1TBZH 3H09A 1O3IA 3TGJE 1FMGA 2GMTC 4FVDA 4K8YA 3A83A 4H42U 1L4DA 2GJGA 2FPZA 2A2QH 4OS1A 5TCAA 4FUHA 1HJAC 2P3TB 1O30A 2ESTE 2VIWA 4X6MA 1DSUA 3SZEA 4FUIA 2BVXH 1ELVA 2Z3EA 1O2SA 4IW4E 5HIZA 2Y5FA 2EC9H 4I8KA 2B9LA 2F4LA 3ZZ9A 3A88A 5ABWA 3RXGA 3Q3KA 2HLDD 3NWUA 1G32B 1GHBG 2V7QD 4JK5A 1AIXH 2SGPE 2TRMA 3RUOA 2F9UA 2W6ID 3LGVA 5DP4A 1O2IA 1NRRH 1SGEE 1O3BA 2OC0A 1SGFG 1JIMA 1CHGA 1MQ5A 3A86A 2FESH 3L33A 3PLKA 1K2I1 5A2MH 5FAHA 1WQVH 4HZHA 2G00A 1P0SH 4CRGA 5C1XA 3LH1A 1EAUA 1YKTA 3R0FA 5LGOA 3ATWA 5AHGH 2GZ8A 2NU0E 4K1EA 2WZQA 1THPB 2DUCA 2FTMA 4DCDA 3RXBA 2FX6A 2IJD1 7KMEH 5C0TA 2O8UA 4IMQA 2FP7B 2CF8H 3ATMA 1FN6A 1LHCH 2H5DA 2GV6A 5A0CA 1GG6B 3MU5A 1UCYE 4SGBE 3MQKC 1FY4A 2J34A 1P01A 4A1VA 2G5VA 1A46H 3MWIU 1RRKA 1O3JA 4FUFA 1YP9A 2Z3DA 1Y3UA 1YY3A 2ZDMA 3STIA 3GY6A 4OGXA 2QF0A 3P8FA 2WUCA 1E79D 1AN1E 2HVXA 3E91A 3TLOA 3VGCB 2D1JA 5F8XA 2BX3A 4XRNA 1JMOH 3UUZA 4JMYA 2R2WU 2FLBH 4WH6A 5C0UA 2KCOA 5ETXA 3ZZBA 1DWDH 2W3KA 1GMDF 4TPYA 1UK2A 5FPSA 1SGYE 2FWWA 3HATH 3MU0A 4X1NU 1QTFA 2FYQA 3SN8A 3FP8E 2WV9A 1DVAH 1O3OA 2HWLB 2PV9B 3RXSA 5EJ1A 4X2XA 5F8TA 3PV5A 1ELFA 2P94A 1DPOA 4B2AA 2Q6GA 2YMSB 1PQAA 2VWNA 6LPRA 3ZZCA 3GDSA 5A0BA 4WXVA 1ZPZA 3PWCA 4YOGA 1AWHB 1NESE 1C1NA 2AYWA 4NSVA 3SUFA 3V3MA 1NT1A 1TB6H 3SNDA 2R3UA 1SPJA 3DUXH 1GCTC 3M5MA 4AYYB 1TA2A 6CHAC 2QE7D 4X1QU 1KLTA 3EA9A 2ZI2H 4CH2B 2AMDA 3LGIA 1T31A 4BTTB 2HGTH 4FXGH 4NA7A 4AN7A 1P04A 5EIYA 3QZQA 3RXMA 4DT7B 1YPGH 3LJOA 1MU6B 2BZ6H 1ANCA 3SJOA 3B8JA 4X6PA 1SBWA 2FOCA 3MO6A 1AB9C 3BTGE 4MDSA 1CT0E 3BTDE 2HVYB 1EPTB 1YPMH 1K21H 2BHGA 2F9PA 1PJPA 3RXQA 1ZJKA 1AVGH 1SOTA 1HCGA 1C4Y2 4B6FA 1YCPH 2ODQA 1TGNA 2BD4A 4NCYA 2AGGX 8GCHF 1GMHF 1EAIA 2HNTF 6GCHG 2BZAA 4I8GA 1B0EA 3OFND 2F3CE 4FU9A 3SV2H 1QQ4A 2EY4C 1GL1A 3SO3A 3KYFA 3SOSA 2A7JA 4AFQA 3PMHB 2ZGXH 1LKBA 1O2QA 1PPFE 2A4QA 2FOFA 3M61U 4WVPE 2ODYB 3QK1A 1E35B 1V2PT 1G37A 3UFAA 3F9FA 1ARCA 1G36A 1T7CA 1ZGVA 5FPTA 2PTNA 3PRBA 1BTXA 4PROA 2ZFRH 3ZZ7A 4X2YA 2WHXA 4CRDA 1L0ZA 3RXIA 3A85A 5A8YA 1IQEA 2ZHQH 1AHTH 5G4BA 1W11U 1YCPK 2VIQA 4H4FA 2QF3A 1UHBB 2AIQA 1TA6A 3PLBA 1OOKB 1S6HA 4NG9H 2FS8A 4X6NA 2OP9A 3BG4C 3URDA 3CS0A 4ASUD 1C5RA 1K1NA 5B6LA 1TYNA 1B7XB 2A4OA 1VKYA 3ZIAD 2QF5A 2GMTB 2H5CA 4WXIA 1GJAB 2CGAA 1IQLA 2OUAA 5J4SA 1JIRA 1WDIA 1WCZA 1M9UA 4Q7ZA 1C2HA 1TNGA 1TONA 4ACAA 1E1RD 1GVKB 3Q3XA 1LMWB 3GCOA 1DM4B 3B23B 4Q80A
chains in the Genus database with same CATH topology
1GJ9B 3OYPA 2CHAC 5ESBA 1NM6A 5JPMH 5EQQA 4NWKA 2ANYA 2FYRA 4Y79A 1YPJH 1OP2A 1FY1A 4Q2KA 1XXDA 5GXPA 3SV9A 2ZFQH 5ESTE 4MQAA 1Y3WA 1BMAA 4RSPA 4FUEA 3RM0H 4AB9A 4B74A 2FM2A 3QZRA 1TGCA 1BHXB 1RTFB 4MTBA 1JRSA 4O9VA 1MTNC 1P2QA 1YPLH 1Z6EA 5HXFA 3TJNA 1EJAA 1SHHB 1HAVA 5E8EH 1AZ8A 1Y3YA 4AB8A 2PFEA 4R8TB 4JZEH 3ZZAA 4UEHH 4I8LA 1RJXB 1GI3A 1EOJA 3ZZDA 1A0LA 2ZDNA 2OC1A 1YF4A 4B71A 1ZHMA 2F9NA 2UUFB 3K65B 4Y8XA 2V3HH 3FFGA 1OWIA 1P03A 1HLTH 2BQ7B 1WU1A 4ZKNU 1PPCE 2ZQ1A 1WSSH 3GY7A 8LPRA 3O8BA 5L30H 4D76A 3RU4D 3A7ZA 1W10U 5EW2H 1WTHD 1MAYA 3BTQE 4ZUHA 2ZTZA 1DLEA 2FIRH 1C5NH 3EYDA 3ZVBA 1CBWC 1OP0A 3RXPA 1QHRB 1ELAA 1O3DA 1QRWA 2NU2E 3SJ8A 1DICA 1ZRKA 4BNRA 3U8TH 2D26C 3Q3YA 1NTPA 4MPWA 2UUKB 1VITG 3K6ZA 3UWJH 1CGHA 3LU9B 1BTPA 2HPQH 1C5TA 3EGKH 4LK4A 2A2XH 2BY5X 1EP5A 1AQ7A 1D6WA 4IBLH 2VJ1A 3BF6H 3HGPA 3UOPA 2WV5A 3SI4H 3SU0A 4CREA 1BQYA 1O2VA 2HRVA 1O2WA 2BDYA 3Q77A 1NS3A 1MKWH 1GI7B 2Z3CA 3RXEA 4MNWA 2O8LA 3VB5A 4ABFA 5LPRA 1T8LA 4IN1A 5C2ZA 6GCHF 2UUJB 3DA9B 1W2KH 3T62A 5FCKA 2BD3A 1EOLA 1C2JA 4F4OC 3DT0H 1IQGA 1O5GH 1H4WA 2FOGA 1WYKA 2D2DA 1AWFH 2BXUH 1TPAE 3SU3A 1GBDA 2XBVA 2ULLA 2J38A 5LPEA 1H8IH 4RKJB 1BTWA 2Y5GA 3RLYH 2ZU1A 1CGJE 1AB9B 3E8LA 3EE0B 2ZPSA 1SLWB 4MLFB 4BXSA 1MKWK 1EJMA 1Z71A 3U98H 4HTCH 1HFDA 3SNAA 1S84A 3SU2A 3ZYDA 1HAPH 5CE1A 1NN6A 4DIHH 2BQ6B 1TMTH 3LONA 1OP8A 1K9OE 1F0SA 1KXCA 1BBRE 2DE8A 3CS7A 4GPGA 5FCRA 2GKVE 1SOZA 1QQUA 1XUFA 1GVLA 2GCHG 1Z8GA 2FS9A 1C1UH 5JB8S 3F9HA 2WPJS 1V2VT 3HGNA 1P11E 1FNIA 4IN2A 3KEEA 4NZQA 2QIQA 2R0KA 4FU8A 3UWIA 4X6OA 1O3CA 1MMJN 1DE7H 3OX7U 4ABGA 1FDPA 4DOQA 1ZMNA 2J94A 1Z6JH 1ABIH 3VGCC 5C20A 3U1IB 4OS6A 3SUEA 1BB0B 3BTME 1C2FA 7ESTE 3SBKA 2LNCA 3LIWA 4D9QA 3A84A 4Y7BA 3BIVH 1FJSA 3LGWA 4MPVA 4JK6A 4OS4A 1S5SA 2B0FA 2W5EA 1DWCH 1KYNA 1ACBE 2FDAA 2BDAA 2Y82A 3A8AA 4FU7A 4YT7H 2XYAA 5EXNA 1CO7E 2UWPA 3AW0A 2G81E 3CENA 4LXBH 1K1MA 2FXRA 2ZZUH 1H9IE 2Q1JA 2R2MB 2VH0A 4U01A 1L4ZA 1E37B 1MH0A 4MVNA 3BEIB 4I33A 1UMAH 1IQFA 2VVVA 2PTCE 2GV7A 2XTTB 2O8TA 2BQWB 1O2UA 3T29A 3OY6U 1EAWA 3ZZ8A 4DVAU 1C5MD 4ZKOU 2P16A 4ESTE 3DHKH 1N1LA 1XKBC 2Z94A 1W0YH 1PQ8A 4O3TA 3KF2A 1O3FA 1EXFA 4LOYH 1NRQH 2VWMA 1V2JT 5DP9A 4YOJA 1XUGA 5SGAE 3UY9A 1V2LT 4WMEA 4BOHA 1L1JA 1TBRH 1EQ9A 1KIGH 1PYTD 1LTOA 1HIAA 3GOVB 3SUGA 1VITF 5EXMA 1GI9B 2OD3B 4Y8YA 3SU5A 1BDAA 1NC6A 2BD9A 1HAVB 1KTTB 2QY0B 4IS5A 2FI4E 1S82A 1O5CB 3PMAB 2A4RA 2ALPA 3FZDA 5DP5A 5GIBA 5E2PA 3VB6A 1UTOA 4KTSA 1LDTT 1C4U2 5EG4A 1UTKA 3AVZA 4NGAH 5T6GA 4MG3A 2PSXA 2CXVA 1FN8A 1GI6A 4GLYA 1P9UA 3MO3A 5BPEA 2EI8A 2H2ZA 2ZHEH 3A82A 1UVPA 5HM9A 1PQ5A 5EQSA 4AFZA 1RIWC 1ANBA 3KL6A 1TNJA 1YC0A 2GGVB 2H6MA 3M7UA 4WY3A 4Y6DA 3VXFH 1LVMA 1ID5H 2OC8A 1GJ8B 2KAIA 1ZJDA 1IQJA 4FVBA 4ABHA 1EB1H 2ZGBH 3LJJA 2ZTYA 4YLUA 4KGAA 1BRAA 5AFZH 2BDIA 2FEQH 1KDQB 1ZHRA 1GHYH 1GBCA 2A45B 1MTUA 1PPBH 4I31A 1AFQB 4BAMB 3SNCA 1QB1A 1HV7A 2Z9GA 2XC4A 2V6NA 3PYHA 3TK9A 4A7IB 2SGEE 2GCHF 3BTTE 2TBSA 4E7RG 2PUXB 1O33A 2XW9A 2PWXA 1GBFA 3I77A 1P57B 4A1XA 5AVDA 4CRAA 1QL9A 1SGFA 2Z9LA 5EXLA 1TNKA 1LVOA 2AS9A 2F83A 1C2DA 1HXFH 1XUIA 4AGJA 1OKXA 1O2LA 2OLGA 1VR1H 2W3IA 4ZROA 4XOJA 3RXHA 1BTZA 1GDUA 1QL7A 2A7HA 2WPMS 4DW2U 4Y0YE 4ZAEA 1OXGA 3SU6A 1C1RA 1A5IA 3PB1E 4WH8A 1F0UA 1HUTH 1HYLA 1V2WT 2PKSB 2ZCLP 3TK6A 2ANKH 4XBBA 1P8VC 5GDSH 1QRZA 3GCTG 1BZXE 1WQSA 2BY7X 4H6TA 2ODPA 3SGBE 2ASUB 4QT8C 4JZDH 3EA7A 4F49A 2TGDA 3M5OA 1EZQA 1W7XH 2WPHS 3E0NB 2EI6A 1O3EA 2R0LA 3E3TA 4YM9A 4YLQH 1HB0B 1GHVH 2Y7XA 1AVXA 1G3CA 3PLPA 2WINI 3RXOA 1GI4A 1UTPA 1K1OA 5J4QA 1NFUA 1DANH 3R3GB 1GDNA 2Q6FA 1D4PB 2XWAA 4AG2A 4X8UH 5B6OA 1KXFA 2QA9E 2ZNKH 4WMFA 4K1TA 3UQOA 5F6MA 1UVUH 5I25A 4UFGH 1OWHA 1GI1A 1OWEA 1O3NA 2QXJA 1TIOA 3DFLA 3M7QA 2QV1A 2SNVA 1C9PA 1RD3B 1SFIA 1LPZB 1IQKA 3D23A 5EPNA 2ZU5A 1O37A 2IN2A 2VWLA 4BAKB 1E34B 3RXUA 2AEIH 2ZHFH 1VCPA 4ZXYH 1C5YB 4SGAE 1GGDC 4DY7B 1TLDA 2NU4E 2ANMH 3E16B 1VCWA 1Q31A 1QRXA 1ZYOA 2AMQA 5E0GA 2ZEBA 1AKSA 1D9IA 2ZC9H 1ZGIA 4X1PU 4NFFA 2AERH 1SLUB 2ZFFH 4IC5A 4UE7H 4ISIH 5DO4H 1K1LA 1FZZA 1V2TT 1B5GH 3K6YA 5JBTA 1N6YA 3F6UH 5AFYH 3G01A 4BXWA 1NROH 4X0WU 3TITA 1MKXH 1FAXA 1C5SA 1THSH 5E0JA 4AORA 1GCDA 1GL0E 5FHTA 4ZHMU 2GZ7A 1HIAB 2BY6X 1D3PB 1GHWH 1TRYA 2JETB 3T26A 3RMMH 2FOAA 2BDCA 5FPYA 2FODA 4JCNA 4K1SA 3PO1B 4B2BA 1MTWA 4TPIZ 3IITA 3I78A 1HAZB 2BYAX 1O2JA 1A61H 1IQHA 1V2RT 1C1OA 5I46H 4UD9H 1ZTKA 2O9QA 3S9AA 1J15A 5T6FA 2HLCA 5FBIA 2CMYA 1C1MA 1XXFA 1SSXA 4CBOA 1P2KA 1C4V2 3S9CA 1GHBF 4ABAA 1XX9A 1GJ7B 4M7GA 1GDQA 1QB6A 2AH4X 2ZECA 3LC5A 1RIWB 3DD2H 1DFPA 1O3GA 1MKXK 3A80A 3C27B 1G9IE 3P70B 3FAOA 1QJ1B 1ELEE 1C1QA 1BITA 3ATLA 2VVUA 3BTEE 1MZAA 1WTGH 3MH7A 3RMOH 1CVWH 1KXBA 3NUMA 3GCNA 4HI3A 1DUEA 1P2JA 1LO6A 3JZ2B 3ZVFA 1L1NA 1HAGE 2A32A 4IC6A 3ZZ4A 1K22H 3GY4A 4I8JA 5DP7A 2XBXA 3RMNH 1GI5A 5A0AE 1AU8A 1IOEA 3MOCA 1HRTH 1K1PA 2TPIZ 1ZPCA 4HGCA 1Z1IA 1K28D 1Y59T 2W7SA 3TIUA 1WUNH 3V0XA 4K2YA 3PV4A 4Q7XA 1UTMA 3SV6A 1JOUB 5LH8A 1ELTA 2QN5T 3FP6E 3GCTF 2H9TH 3BN9A 6ESTA 3EDXB 1SQOA 3BTHE 3MU8A 3PMBB 1FY3A 5FX6A 1G30B 1O39A 4BAQB 1BJVA 1Z1JA 5DP3A 1C1WH 4Q7YA 3SV7A 2GZ9A 2WPLS 2ZQ2A 1C5OH 3S69A 2STAE 3O8RA 3KHVA 4YO9A 3SU4A 2AFQB 2P3UB 2H1UA 2OBOA 4GUXA 3ATKA 3SNBA 1H1BA 1YLCA 1GJ6A 1XUHA 3AAVA 2PW8H 2GCTC 1TPPA 3VFEA 2Y7ZA 1TRMA 3SI3H 3TJVA 3RU4E 1UTNA 1DSTA 2I6SA 4Y76A 2BLOA 2XRCA 2F9BH 1GBJA 5GCHG 3T5FH 1DY9A 3SHCH 4UFEH 1OYQA 5JBAS 1CE5A 2HPPH 1F7ZA 2SNWA 2PLXA 1TPOA 1BTYA 2XCNA 1BJUA 1O5DH 3UR9A 1Z8IB 2A1DB 1GBBA 2ZGJA 1VITH 1AY6H 4AFUA 1ZSKA 3MH6A 8ESTE 1JWTA 1T8NA 1V2KT 2C8WB 4E7NA 2GT8A 4X1SU 5JYIA 3ATIA 2JKHA 3P6ZB 2K1QA 3BG8A 3MNBA 2RDLA 2QYIA 4ZHAA 2V0BA 2FI3E 3VEQB 1HNEE 3SV8A 1A2CH 3BEFB 2BD5A 1O0DH 1EZUC 2PKAA 2VIPA 3M7TA 1HXEH 2QCYA 4E05H 2G51A 1TMBH 2OCVB 1YPKH 1P10A 2OQUA 4O3UA 4AX9H 1BUIA 2IJOB 1SHYA 1Y3VA 1EASA 1S85A 2BXTH 3EAJA 2PSYA 3GY8A 4I7YH 5JBCS 1HAXB 5FBEA 1GJCB 2ZIQH 4JYUH 1TNHA 1AFQC 2WYGA 4B1TA 7LPRA 2W26A 3TPIZ 3A8DA 4D9RA 1BCUH 2SGAA 4NIYA 1QIXB 1TNIA 1GGDB 1N6XA 1N8OC 3VB4A 1TGBA 1ELDE 2LPRA 4Y8ZA 3T27A 3P8GA 1GHZA 2FX4A 1TX7A 1SL3A 3A89A 3A7YA 3UREA 2BM2A 1GMCG 3OTJE 1SGQE 2QXIA 2G52A 2TGTA 1ZSJA 2GDEH 4BANB 1PPHE 1C1PA 4FUJA 4I8HA 1BRCE 1GBTA 3TGIE 1CHOG 4X2WA 4KKDA 1V2UT 1AUJA 5DG6A 4B73A 5L6NH 5C67A 2P59A 4XBCA 2G8TA 5C5OA 1EP6A 2F91A 2SGQE 1F5KU 1FONA 4J1YA 1SFQB 2FTLE 3FZZA 5EQRA 3N7OA 1P3CA 1DLKB 2PKSC 4B76A 1C1VH 5C3NA 3QDZB 1TMUH 3GY5A 3P8OA 3TH3H 1AMHA 4WWYA 2R3YA 3BTWE 5GWZA 2ZKSA 3UIRA 3KCGH 2BLQA 3H5CB 1V2OT 4NZLA 3NXPA 3EA8A 3TJOA 3JZ1B 4MNXA 1LKAA 4XBDA 1O2XA 4CRBA 1ABJH 2XNIA 2BX4A 4KTUA 3BEUA 4O97A 2Z9KA 4UDWH 1YLDA 1EATA 4ISLA 1Y3XA 3GY3A 3M5NA 1J8AA 1S81A 4U32A 2FLRH 1RFNA 1MQ6A 1P2MA 1QJ6B 1UJ1A 1ZOMA 3KQEA 1QFKH 2IPHA 4K69A 4O03A 3MU4A 3UQVA 3ENSB 4GAWA 5T3HA 2Y5HA 1LVYA 3BTKE 1O2GH 1MTVA 1XMNB 2BLWA 1NRSH 5EW1H 2GD4B 3TH4H 2SFAA 1ETSH 3ZVCA 1A3EH 1P2NA 4GHQA 1KXDA 4GVUA 5T6DA 1ETTH 4TWYA 4JYVH 5H4IB 3W95A 1KTSB 1QJ7B 2VINA 1MCVA 4B75A 3RXVA 1SMFE 3E0PB 3Q76A 1TABE 1X7AC 4H6SB 1V6DA 4FUDA 4UFFH 2FMJA 3KIDU 3LGTA 3MI4A 1G3BA 1XUJA 2A5IA 3VB3A 3MFJA 3C1KA 1SGIB 3U9AH 1VZQH 3M3SA 2F9VA 1SI5H 1J9CH 1NU9A 2QXGA 4ABDA 2J95A 1O2NA 1Y5UT 1QCPA 2AGEX 1TPSA 2THFB 1A0HB 1MD8A 4ABBA 1UTLM 1QBVH 1YPHE 3LPRA 5E2OA 4DURA 4TY7A 3RU4T 4NSYA 1AFEH 2GP9B 2XC0A 8KME2 1P06A 1GBEA 2H9HA 3ESTA 3E6PH 3PM3A 1A0JA 1HAIH 1TE0A 3TU7H 1HAOH 5FX5A 2G4UA 3HPTB 3MNXA 3PWBA 3O8DA 3V7TA 1MU8B 1P2IA 2VGCB 1MZDA 1GMDG 3O8CA 1EPTA 4A92A 2YNAA 1C5QA 1P3EA 3MU1A 4ISNA 2GCTB 2VVCA 1TQ7B 2BD8A 4J2YB 1ZR0A 1NRNH 3RXCA 1DWBH 3RXLA 1TBQH 3QTVH 1QNJA 2JETC 1KY9A 1O36A 3KNXA 5HGGA 1AGJA 1D3TB 3PO1C 4CH8B 1CT4E 1QL8A 3RMLH 3Q00A 2Q6DA 2J4IA 4CBNA 4NIVA 1HJ8A 1ELCA 1QY6A 3KQBA 4Y7AA 3PTNA 1OSSA 4DG4A 5C1YA 1A7SA 1INCA 3TVJB 3BSQA 3OU0A 1CT2E 1HAHH 4B2CA 1QBNA 5JDUB 1GPZA 2D8WA 2V3OH 3UR6A 1O3MA 1C5PA 1HBTH 4VGCB 1GBKA 2IOTA 1WOFA 3MHWU 5F8ZA 2Y80A 2ZCKP 2EA3A 1HPGA 1MBQA 1LHFH 1NRPH 2VNTA 1CU1A 4NWLA 4AGKA 1ZTL