5G4BA

Crystal structure of aura virus capsid protein in complex with piperazine.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
152
structure length
152
Chain Sequence
b'DRTFAVKNEDGKIMGYAVAMEGKVIKPLHVKGTIDHPALAKLKFTKSSSYDMEFAKLPTEMKSDAFGYTTEHPEGFYNWHHGAVQFSGGRFTIPTGAGGPGDSGRPILDNSGKVVAIVLGGANEGARTALSVVTWNKKGAAIKTTHEDTVEW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAPSID PROTEIN
publication title Crystal Structure of Capsid Protein from Aura Virus in Complex with Piperazine
rcsb
source organism Aura virus
molecule tags Hydrolase
total genus 31
structure length 152
sequence length 152
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 2016-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5g4bA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5g4bA01
3EA7A 1MZAA 2FM2A 2BOKA 1F5KU 3PV4A 1UVOA 1P04A 1W7XH 4BTTB 3RM0H 2VJ1A 3SV7A 1AFEH 1C1RA 1GBCA 2BB4A 1T8MA 1HIAB 1HCGA 2G4UA 2A32A 1O2SA 2P95A 1W12U 3R0FA 1S6FA 1ZJKA 1LPZB 4NIYA 1V2NT 1V2OT 1K1LA 4ZXXH 1H8DH 4DOQA 1W13U 1PPBH 3A8BA 1CA8B 4U32A 4X1RU 4FUGA 1IHSH 1ETSH 1N6YA 5LPRA 2TPIZ 2V0BA 4DW2U 3FP6E 1ZTKA 1ELAA 4Y7BA 1RRKA 4DY7B 3SW2B 3ATIA 1TQ0B 1LQDB 4SGAE 1F7ZA 4DIHH 2A7CA 2PKSB 2OBQA 2WPLS 3KF2A 5FAHA 5ESBA 1O3OA 2GMTC 1OP0A 5A0BA 1GHBG 4B71A 4FUBA 1GMHF 3HKIB 1QFKH 4AZ2B 1HXEH 3LGIA 1BB0B 1MTNB 1VCWA 4K1TA 2PGBB 2GV7A 4IW4E 3Q3KA 5AFYH 3SV8A 3BF6H 2RA0A 2EC9H 1GJ6A 1CBWC 3SJIA 4Y71A 1H8IH 4WJG2 3VB7A 3RXTA 2JH6D 1WU1A 1O2KA 1GI6A 1GG6B 1O38A 1OWIA 1ZHPA 2P8OB 4A5TS 1NZQH 1TONA 5FHTA 5EXMA 1O2IA 1H9HE 2BX4A 5C1XA 3PO1B 1T8LA 1SHHB 2VVVA 1MTSA 3S7HB 5H4IB 2ZHQH 1GMHG 1AU8A 2OLGA 5DK1A 1AQ7A 1MTWA 3A80A 3P70B 3CENA 4KTSA 5FBIA 1OWJA 4ABJA 2UUJB 2XYAA 1DY9A 3AAUA 1AUJA 1B7XB 1OWDA 1SGQE 4XOJA 4X8VH 4ZMAH 1G3EA 5L2ZH 3NWUA 1TLDA 3SV2H 4INLA 8ESTE 2HNTE 1C1VH 3F9FA 2AS9A 3A8CA 5C2ZA 1JWTA 1O2LA 1XUJA 1SLWB 1J9CH 4Y0ZE 1G37A 1V2MT 5E2OA 1A3BH 1Y8TA 4NWKA 2B7DH 3U8TH 1NU7B 1AVXA 1NPMA 1S81A 1O2GH 3BG8A 1GJ7B 4Y76A 1TGTA 1IQMA 3PLBA 1UJ1A 3ZV9A 3ZZDA 2WPJS 1NFYA 1GI3A 4E06H 2K1QA 1HXFH 5C5NA 1K22H 5HM9A 2ZEBA 1BDAA 2W3IA 5GXPA 3FVFB 3TVJB 2O8UA 7GCHG 2WINI 4ABFA 2AMPA 2D2DA 1CO7E 5C20A 3BTGE 3E91A 4B2BA 2B9LA 2ODPA 1QJ7B 2BD2A 4MPWA 4ABIA 2TGPZ 1H9IE 4U30A 2FS8A 4AOQA 1C5UA 1L0ZA 3E6PH 3RXEA 3TLOA 5TCCA 1ARBA 2RG3A 1GBIA 1ANBA 3M5MA 3NKKA 1RS0A 5GDSH 3ZZ8A 3GCHC 1HAIH 2FYRA 2VVCA 2P3TB 1TPOA 1BRCE 1SQAA 2CXVA 2VWLA 1O2ZA 1GBMA 2CJIA 3LIWA 3ZVDA 1FIWA 3RXRA 1O34A 2FIRH 5L2YH 2P59A 4IMZA 1TA2A 1HAOH 4BANB 4GUXA 1C5WB 1QB1A 1V3XA 5I46H 4ISNA 5DP6A 2PWXA 3F9EA 3AAVA 4JZEH 4WMFA 1ELVA 2GT7A 4O97A 3DD2H 4YZUA 1PQAA 4IC6A 3ATMA 1ZZZA 3EAJA 1BTYA 3NUMA 1O5EH 2G81E 1DWEH 1FY1A 3SBKA 5CMXH 1W10U 1XUGA 2AMQA 1PFXC 1SOZA 2ZFTA 3E1XB 1AVGH 1TYNA 2FLBH 2RA3A 2Z9GA 3T28A 1FV9A 6CHAB 1SGYE 1OWEA 3EYDA 3LGVA 1X7AC 1AFQB 3RLYH 1BBRH 2JETC 6ESTA 2DE8A 2BVSH 3Q3YA 1ABIH 4H6SB 3JZ2B 1MQ6A 5FPTA 1C9TA 2ZFRH 2ASUB 4B74A 4KELA 3L6PA 3QK1A 1G2MA 1P2MA 1VGCB 4XSKU 1UTJA 2AIQA 1XM1A 1ZOMA 3TK5A 1YC0A 2UUKB 1AZZA 4HI3A 3STJA 2RCEA 1PPEE 5C5OA 1TIOA 3SI4H 1WTGH 2FMJA 4ABAA 1AE5A 1HAYB 2FESH 2XNIA 3MWIU 2VH0A 2J92A 2WPMS 2EI6A 3I78A 2R3YA 3AASA 5JBCS 2G52A 1JOUB 3DFLA 3SJKA 5BRRE 2O8LA 2BDGA 1GHXH 3MO9A 3LJJA 1RD3B 3P95A 1A7SA 3BTKE 1TBZH 2HNTF 1MMJN 3BTTE 1W14U 2J2UA 3GICB 2AGGX 4K8BA 1DPOA 1O2QA 3EE0B 2ZHDA 8GCHG 3UTUH 1HDTH 3HPTB 1GGDB 5SGAE 4JMYA 1OPHB 4D9QA 1IOEA 2IPHA 2WUCA 3RMLH 1ZYOA 1ARCA 1EPTA 1UK3A 5LH8A 3GY3A 3A89A 4Y79A 2ZU5A 3GY7A 1IQNA 1GPZA 4UFGH 1L1JA 1SLUB 4OGXA 1HJ9A 1ID5H 2A4RA 4NFFA 3UQOA 3MH7A 1YPHE 2OC0A 2VIPA 1AUTC 4JZDH 3KHVA 5DGJA 2TRMA 2A45B 1G3BA 1Q2WA 2EI8A 4BTIB 1Z6JH 4ZAEA 5JBTA 1B0EA 1F0RA 1ANDA 4UONA 4X2XA 5A8ZA 2ZGBH 1BRUP 1MZDA 3KGPA 2ZECA 3BSQA 5HMAA 1PQ5A 4JK6A 4H42U 1OWHA 1ZR0A 1QHRB 1YPKH 2OQUA 1DWCH 1KXBA 3UR6A 1F5RA 2B0FA 4GLYA 2BD7A 4YOGA 1QB9A 1C2FA 2H9TH 2F9UA 3FFGA 4HZHA 4ZROA 1SFQB 1BMAA 1YPMH 3HATH 1PJPA 4B76A 4XBCA 1GBAA 1VITF 1N8OB 1AKSA 1XMNB 2PKAA 1GDQA 1RTKA 3BIVH 1GI1A 3MH4A 1P12E 2QF0A 1P2KA 2GT8A 2GDEH 4AYVB 3W95A 1BTHH 3TJNA 2WUBA 4MPUA 1NRSH 1Q31A 1Y5AT 2ZHWH 4NCYA 3SGQE 1W2KH 2PGQB 1NESE 3V3MA 3NCLA 3FZZA 1RIWC 2WV4A 1ETRH 1FONA 2NU4E 4FUFA 1TRNA 2ALPA 3M7TA 4RSPA 2UWOA 3SJ8A 1P3EA 5AVDA 3UQVA 5ETXA 2HNTC 7KMEH 2ANKH 4TWWA 1CSOE 2QXJA 1GBLA 1LHFH 3TGJE 2ZQ2A 3A8DA 3M5LA 1FJSA 4AFSA 1G30B 1CE5A 1SBWA 3MHWU 4Y10E 5GCHG 1O5AB 2BQ6B 1BHXF 2H5CA 1SVPA 3LJOA 2A2XH 4X8TH 2GX4A 2P93A 4X0WU 2ZU2A 1P9SA 4UFDH 1BTPA 5EPNA 3IWMA 1ANCA 1O39A 4JZ1A 3A82A 1C1TA 3U8OH 2FX6A 1O36A 1EZXC 1N6XA 1BA8B 1CGJE 1QQ4A 3T62A 4CREA 3ZZCA 2G5VA 1FZZA 4JK5A 3A7WA 2XBVA 1NM6A 2Z3CA 3O8CA 3M61U 1TNKA 2BZAA 4ABDA 1CQQA 2P16A 1O3KA 4INHA 5EW2H 1DICA 3OYPA 3A86A 1T8NA 1BMNH 5IYTA 2ANYA 2FOFA 1E34B 3RXVA 1HAHH 3ZVEA 4NWLA 3KQEA 4MNYA 1O30A 1DUEA 1NT1A 1AIXH 2GZ8A 1W11U 4YLQH 1O2UA 1Z6EA 3OTJE 3OY6U 4FXGH 1PQ8A 3RXOA 2BD8A 3DA9B 3UPEA 2BY8X 2VWOA 2BY5X 3DUXH 3UNQA 3F9GA 3UWIA 3RMNH 5A0AE 1KTSB 3NZIA 1GL0E 3TNSA 3NPSA 1YLCA 1VITH 3PWCA 5G4BA 1QRXA 1CGHA 3KL6A 1C5ZB 4GSOA 3EA8A 5DP5A 1NFUA 4XE4A 1BMMH 3ZZ9A 4JYVH 2P94A 3BTQE 1ZMLA 1N1LA 1DSTA 2CHAC 1FMGA 2BY7X 4Y8ZA 4ZKRU 3T29A 2A5KA 3EA9A 3GCOA 1BJUA 3BEIB 5FCRA 3SQHE 1A4WH 1UK4A 2J9NA 2BDIA 2SGAA 1SC8U 2JKHA 1EZUC 1GMDF 2GD4B 1E0FD 3RP2A 1ZTJA 1DDJA 2H6MA 3E90B 2PV9B 2STAE 1SQTA 2BTCE 3S69A 1V2JT 4GCHG 5B6OA 1PPCE 5L6NH 3ZVBA 4GPGA 1QCPA 1D3QB 2BXTH 1TX6A 1QIXB 2SGDE 4AG1A 4X8UH 4DVAU 1Y3VA 1GJCB 1UVPA 2NU1E 1C2EA 1Z71A 3KN2A 5CE1A 4BAMB 1UMAH 2AFQB 2ZI2H 1UTNA 4DGJA 1HJAC 4WWYA 4D7GA 3ATLA 2HALA 1SR5C 1W0YH 1A2CH 1AVWA 1ELTA 4H4FA 2J34A 2WV5A 2Q6GA 1KYNA 1LVYA 2LNCA 1BBRE 1AD8H 1Z8IB 3URDA 4MLFB 1XVMA 3SU2A 4B75A 4K2YA 3SOSA 2CGAA 4MDSA 1C2MA 3BTFE 3SV6A 2BLWA 2FOHA 3LONA 1GHAF 2UUYA 4ZXYH 1QL7A 1GL1A 2BDBA 1KXCA 4CR9A 5HYOA 4AB8A 5F6MA 3RXBA 4AX9H 4I7YH 1UVSH 2VVUA 2I6SA 2NU2E 1D9IA 4WVPE 2AGEX 3RMOH 1EAUA 1GI4A 2OUAA 1P2OA 3GCTG 3BTME 1G36A 3PMAB 4NIVA 4YM9A 1EAWA 1YGCH 4MNWA 4YESB 2VH6A 4JCNA 1CT4E 4AORA 1MTUA 2BQWB 1A0JA 4WMEA 4UFFH 3LGTA 1ZGVA 2AYWA 1G9IE 1K1JA 3RXPA 4E05H 2WYGA 2H9EH 2F9VA 4IN1A 1GJ4H 2CF8H 2ZZUH 1YPHC 2FTMA 3QDZB 2ODQA 3RU4D 3T26A 5JB8S 4X1SU 1GHAG 3VGCC 5TJXA 4Y8YA 2FO9A 3M7UA 3PM3A 4ZKOU 1ESBA 1DXPA 1C1SA 3SV9A 3TU7H 5A8YA 1OYQA 2F9NA 4MNXA 4NA8A 3TH3H 3B23B 1CGIE 3ZVFA 1O3MA 2G8TA 4I31A 1GHWH 1FN8A 2HRVA 3ODDA 5T6FA 1IQKA 1HPGA 1T32A 1OSSA 1O3LA 1SFIA 1BCUH 1HJ8A 1YPEH 2A5AA 1HNEE 5JBAS 4MNVA 3W94A 4CHAC 1UCYH 2TGDA 3LOXA 3VFEA 3D49H 5CHAC 1ETTH 1TWXB 4YT7H 1TNJA 1D4PB 1BQYA 2A31A 4MTBA 5E0HA 2FZZA 2ESTE 1V2VT 2XWAA 2GCHF 4B2CA 1HAGE 3C1KA 3GCNA 2THFB 3UR9A 3KNXA 1OKXA 2ZFPH 2GMTB 3V7TA 4Z0KA 2R0LA 1FY4A 3RXAA 5E8EH 4OS4A 1YPLH 3Q00A 1WV7H 1Z8RA 4OGYA 1ESAA 1GBTA 1IHTH 3HGPA 1UTQA 1CBWB 1E37B 1C2DA 2O9QA 1ELDE 1D3PB 3R3GB 3RC4A 1EPTC 1WYKA 3ESTA 3T5FH 4NZQA 3QN7A 2W5EA 1EJNA 5AHGH 1HV7A 1TNIA 1O3JA 1QY6A 3PYHA 1V2TT 4FUIA 2GCTC 1KXFA 3B8JA 2QV1A 1W0ZU 2Z94A 1LVBA 2QGRA 2BD3A 1KXEA 3AVZA 4UE7H 1SSXA 2VB0A 3P8FA 3H5CB 3RXQA 1LKAA 1O5BB 4KTUA 1T8OA 1THSH 3CP7A 3SU3A 4YOJA 1O3DA 6GCHF 2ZTYA 1NC6A 1AWFH 2WPIS 2FEQH 1OYTH 3TJVA 1E35B 1O32A 3E8LA 5ESTE 4B73A 1AMHA 1O2NA 1HAZB 3FP7E 1O5DH 2H1UA 1TRYA 1L1GA 1WOFA 2OD3B 3SUDA 3ZZ3A 3S9AA 1O3BA 3ZZBA 3VB4A 1GCTC 2BDAA 4KTCA 4MPVA 3A8AA 1HAVA 2ZO3H 1AZ8A 2TBSA 1F0UA 2XBWA 1QJ6B 1AKSB 2PKAB 4KGAA 4ZKSU 1PYTC 1FY8E 1WCZA 2AH4X 2QCYA 3M5OA 1IAUA 3RXSA 1A5GH 1K1NA 3EDXB 3O8BA 3ZYDA 4CBOA 1DANH 4IMQA 2XCNA 1TNLA 3VEQB 1QBOA 1FUJA 1DWDH 2XW9A 2BXUH 1O2VA 3M35A 1GI9B 3K2UA 1EASA 3UWJH 1TGBA 2Q6FA 1QL8A 1ZSJA 1TMUH 3T25A 1ELEE 2B8OH 1P03A 2EI7A 2O8TA 1DLEA 2BDYA 6LPRA 4Y7AA 1KTTB 3TK6A 3E0PB 3QGNB 1NRQH 1FIZA 1XVOA 3GCHB 2WPHS 2QC2A 3A84A 3SJ9A 1QRZA 3LGYA 3P8OA 3HK3B 1EAXA 2VWMA 4NZLA 3SUFA 4LZ4B 4AFUA 1YLDA 1Z8JB 2FI5E 2Y81A 4LZ1H 3ZVGA 2NU3E 1TGSZ 5FXLA 1C5RA 4I32A 4WXIA 1GVZA 1NRPH 1TA6A 2R2MB 4OS1A 2R3UA 1BUIA 2FI4E 3BN9A 2XRCA 4DG4A 1ZMNA 4A1XA 2H2ZA 4H6TA 1WQSA 1O2JA 5A0CA 3U1JB 1PYTD 2A2QH 1AN1E 1ZTLA 2YNAA 1VJ9U 1NRRH 1JIRA 2IOTA 3K6ZA 3RMMH 1GCDA 5C1UA 2XBYA 1LVMA 2D26C 2PUXB 3OU0A 3P8NA 4BXSA 2XBXA 1HAXB 2V6NA 1LMWB 1UHBA 3M7QA 3RU4E 3PROA 3TIUA 2JETB 5GIBA 3M3SA 3MNSA 1CHOF 1P9UA 4FU8A 2A7JA 5E2PA 3ZZAA 1C1QA 1YKTA 4VGCC 2CV3A 3ZV8A 2BLVA 3PLPA 1O33A 3RXHA 2QXIA 2CF9H 1ACBE 5FX6A 3SUEA 1YCPM 1BRBE 1C5OH 1GI8B 3I29A 3SJOA 2HLCA 4X6PA 1Y5BT 3RLWH 1GBDA 5JPMH 1LHCH 1YP9A 2PSXA 3GOVB 1AHTH 2GKVE 5DP9A 1KSNA 1GBKA 2BX3A 1C5QA 1W7GH 2JH0D 5FX5A 1OWKA 1C4Y2 3GY6A 1MU8B 1H4WA 3A81A 1FPCH 2P3UB 1C5XB 1Y5UT 1C2IA 5K7RA 1XUKA 3A7YA 2BMGB 2ZKSA 2HWLB 4BAKB 5J4SA 3VB6A 1HYLA 2FLRH 1BIOA 2XC5A 1MAYA 4A6LA 1RJXB 4F4OC 3HKJB 4B1TA 2ZGHA 1EB2A 1GI7B 3MU4A 5L30H 2W3KA 1THPB 4ESTE 3BTHE 2ZDLA 5EW1H 1P09A 1TQ7B 2BQ7B 5HXFA 4YLUA 3ATKA 2XTTB 2ZGJA 4I33A 1LQEA 2F91A 3TJOA 1BBRK 1D3DB 1V2RT 1TGNA 1O31A 1C5NH 4OS2A 3LU9B 1TX7A 4K3JA 3QTVH 3BTEE 2FOEA 1TB6H 5EGMA 3SO3A 2SNVA 2C8XB 3LKWA 1UCYE 5DPAA 1AO5A 4R8TB 3RXDA 2GTBA 1JIMA 2A0QB 1P05A 1EKBB 1DITH 4NG9H 3E3TA 2XC4A 2XC0A 1T4VH 2C90B 1SGIB 1K21H 1TOCB 3RDZA 3C27B 1TGCA 3BEFB 3ZZ6A 3GY2A 3TGKE 1GMCF 1MD8A 4ZKNU 4THNH 4IN2A 1ZHRA 1BT7A 2EEKA 1SPJA 1WQVH 4YOIA 3U8RH 3S9CA 1PPHE 2ZTXA 1D6WA 4OS6A 1O3IA 4A7IB 4CRAA 3HGNA 2VIOA 2OC1A 1GHYH 1S82A 1GJ5H 1ZJDA 2VINA 2JH5D 2V3HH 4NSYA 3G01A 4BTUB 2ZPQA 2ZWLH 3VPKA 1RIWB 1U6QA 1O2HA 2FX4A 3V13A 3L3TA 3MU1A 1WAYB 4J2YB 2UUFB 1EQ9A 1VITG 3M3VA 2Z9LA 1ZLRA 3MNBA 3KQDA 2WYJA 3F68H 4CRFA 1W8BH 1GJ8B 3TNTA 5FBEA 2PTCE 3MI4A 1C2GA 1P2IA 1S0QA 1P2JA 1EOJA 1VJAU 1C9PA 1ZPZA 1CA0C 1VR1H 1C1UH 1HB0B 3GISB 1DWBH 1P0SH 4X6NA 1V2WT 1TNGA 4FVBA 4FUCA 3A85A 2F83A 2OCVB 3OSYA 7LPRA 1EOLA 2XXLA 1DOJA 2AERH 1AGJA 3PB1E 4ABGA 3SU1A 3HK6B 5I25A 1C1MA 1C2LA 1PPFE 3BG4C 5IDKA 1ANEA 3UNSA 1HGTH 2BLQA 4AN7A 3V0XA 3UOUA 2VWNA 3K6YA 1BZXE 2HPQH 5HM2A 5PTPA 3KQBA 4DIIH 1BOQA 3SN8A 1DFPA 2G55A 1P11E 1QL9A 1GHZA 2I6QA 3RXUA 2W26A 5DP8A 3A7TA 2TGAA 1D6RA 1MH0A 2ZGXH 1O35A 4Q80A 4X8SH 5A8XA 1O5CB 3SQEE 5ABWA 2ZU3A 4Z6AH 1TE0A 2Y7ZA 1MCTA 3H7TA 1SI5H 1TPPA 1ORFA 1IQHA 1AB9C 4LK4A 3ZZ4A 3SU6A 2Z3EA 1ELCA 3RXJA 2ZU4A 2VNTA 1BTXA 8KME2 3GDUA 1YBWA 3MH6A 4DT7B 1QBNA 4XBBA 5F03A 1J17T 3RU4T 1C2KA 2BM2A 1IQIA 3FZDA 1GVLA 5EQSA 1LHGH 5DJ7A 4OS7A 1PPZA 5F8XA 2CHAB 4BXWA 8LPRA 3F9HA 3LDXH 2IN2A 1JMOH 5AFZH 1MD7A 4FUHA 4CH2B 1L4DA 4X1QU 2H5DA 1SQOA 1Y3WA 2F9PA 5LGOA 1TBQH 3VB5A 2Y5GA 3ZVAA 4ABBA 2VU8E 4GVUA 1F92A 2BLOA 2ZDAH 1BHXB 2FPZA 1TBRH 1P2QA 1O2OA 1HAVB 1YYY1 4Y0YE 1BTWA 1GWAA 5E0GA 4DJZB 5A2MH 2OBOA 1HJAB 4FUJA 1GMDG 2ZP0H 3M5NA 5K0HA 2G51A 4IBLH 4A92A 1NS3A 3GDSA 1UVTH 3MFJA 1XXFA 1L4ZA 3KQCA 3T2NA 1GHVH 2XWBI 5F8ZA 2ZC9H 3Q77A 4MG3A 2GV6A 1SB1H 7ESTE 2ZU1A 2ZFSA 3GDVA 1HAPH 1O2XA 4XFQA 1QNJA 1EJAA 3QWCH 3F6UH 2ILNA 4I8KA 4CRCA 1MU6B 2TIOA 4M7GA 1ABJH 1BTZA 1OP8A 1GBEA 4X2VA 1A46H 4BAHB 1K1MA 5JDUB 1SL3A 1XKAC 1FAXA 2BD5A 3VXEH 4X2WA 4CRBA 4MQAA 5FCKA 3GY4A 1EZQA 2R2WU 1FI8A 4ISOA 4JYUH 2QAAA 2IJOB 2VGCC 4X6MA 1YCPK 4LXBH 4ISIH 1QQUA 4O3TA 5TCAA 3RXCA 2GDDA 2SGEE 3VGCB 5T3HA 1YPJH 5GPIB 3UIRA 1O5GH 2SGPE 4E7RG 1UTPA 2Y7XA 1DUAA 3A7ZA 4D9RA 3SI3H 1YM0A 2XCFA 3EGKH 3MMGA 2Z7FE 5DO4H 5DKMA 4X2YA 4CRDA 3FANA 1CU1A 1F2SE 2FDAA 3LH3A 3SHCH 4AGKA 4K8YA 4A1TA 1UHBB 2PR3A 4NFEA 3NXPA 1EB1H 1BITA 4CH8B 1GVKB 1UVUH 3WY8A 4CHAB 3ZYEA 4X6OA 2BYAX 2PLXA 3PLKA 1C4U2 3S0NA 1EXFA 1GHBF 2ZGCA 1J8AA 2Z9JA 1CT2E 4WH8A 5CHAB 1FN6A 1T31A 2ZDMA 2Y5HA 2SNWA 1J15A 1PQ7A 4NA7A 1MKWK 1Y3XA 2ZCLP 1V2UT 4LOYH 2W7UA 1RXPA 1GDUA 3LT3A 1ELFA 1F0SA 1NU9A 2AEIH 1O3FA 1Z1IA 1DS2E 2FP7B 2KAIA 4QT8C 2PKSC 1MKXK 4JYTA 1SGCA 3P6ZB 1O2RA 3U69H 2A5IA 3SU5A 1TNHA 3QUMP 1UK2A 3BV9B 4JZFH 1MQ5A 3P92A 4K1EA 1DLKB 1J14A 3RXFA 3SHAH 1MTNC 4U01A 1TFXA 5DP4A 5JB9S 2FOAA 1EPTB 1C1NA 2GCHG 4Q2KA 3QO6A 1S0RA 2BD4A 2ZF0H 3F1SB 2ZPSA 1P01A 3PWBA 1GG6C 3BTDE 2GCTB 2P8OC 2Z3DA 1S83A 1A5HA 1C5VA 1JRSA 1KDQA 2OTVA 3CS0A 4GAWA 4K60A 2Q1JA 1XUFA 3LGWA 1GI2A 1T7CA 3PO1C 2BOHB 2QF3A 2FOMB 3MTYA 2HPPH 2PUQH 1MTVA 1C5TA 1GJDB 1P3CA 2BVXH 1HBTH 1UCYK 4UDWH 1P8VC 1FY3A 2WPKS 3D23A 4BNRA 1IQFA 1O0DH 1Y3YA 5JYIA 2ZIQH 5EQRA 1NROH 1WSSH 1D3TB 2OC8A 4WH6A 5C1YA 1SHYA 4UD9H 4AG2A 2Z9IA 1KLJH 7GCHF 3M37A 3K65B 4U2WA 4UFEH 2GVFA 1O3NA 5EQQA 2UWPA 1GCTB 1FAKH 1UTMA 2SFAA 1B5GH 1FDPA 1O2PA 2QXHA 9LPRA 2GP9B 4TY7A 1P10A 4TYDA 5LPFA 4Q7YA 1O5FH 1EJMA 3T27A 1ELBA 6GCHG 1LTOA 1OOKB 2J4IA 3SNDA 2BHGA 2ULLA 3TH2H 2CMYA 1NFWA 1LPGB 3VB3A 2ZCHP 5BPEA 1DSUA 1F5LA 1ZGIA 3GY8A 1DVAH 1FQ3A 3N7OA 1QGFA 1SMFE 3CS7A 2EA3A 5DP7A 3OX7U 4JZIA 1IQJA 9ESTA 3SU0A 3Q76A 3LH1A 3RC5A 2FI3E 3LC5A 1UTKA 2Z9KA 4AGJA 3JZ1B 2A1DB 2FOGA 3RUOA 3AW0A 3FP8E 2VIQA 1S85A 4HGCA 4UEHH 1H9LB 5HGGA 1TABE 5EXNA 4TPYA 1HFDA 2C8ZB 4RN6A 4DURA 1Y59T 4FVDA 2Y6TA 1ZHMA 2AGIX 2FWWA 4NA9H 3OY5U 2J94A 2OP9A 1MBQA 4TWYA 5AF9H 4TY6A 3TH4H 3RXIA 3O8RA 2B5TB 1C5YB 3TK9A 1Y3UA 1TAWA 2PW8H 4R0IA 4AFZA 3P8GA 2PFEA 3RM2H 3UNRA 1EAIA 1B0FA 1P57B 2VIDA 4I8JA 2R0KA 2D8WA 5J4QA 1TMBH 3UY9A 5GWZA 3LPRA 1QURH 1JRTA 1PPGE 4BAOB 1H1BA 4O9VA 2FS9A 1O2MA 1IQLA 3MOCA 1HIAA 1WTHD 2BD9A 1EP5A 1V6DA 2BY6X 1E38B 1XKBC 6CHAC 2Y82A 3ENSB 1TMTH 4VGCB 1O3GA 4BOHA 1AFQC 3RXLA 3A87A 4CRGA 1FY5A 1OS8A 2OXSA 2FYQA 4Y11E 2ANMH 1C1PA 2A7HA 4IC5A 1O37A 4ZHAA 1P2NA 3QZQA 2GZ9A 1VGCC 2YOLA 2W7SA 1BTUA 1QR3E 3SZNA 8GCHF 3QLPH 2ZQ1A 1V2ST 2QYIA 3V12A 4ZHMU 5EPYA 4AB9A 4Y6DA 3TITA 1OX1A 4ABHA 1G3CA 1ZRBA 4HFPB 5FPSA 1NO9H 3B9FH 5C67A 1TOMH 1CHOG 2O8MA 2AIPA 5A09A 3TPIZ 2ZCKP 4A1VA 1SGFG 2C4FH 3IG6B 3RXGA 1YF4A 1KIGH 1LO6A 4ISLA 1HLTH 1SG8B 1A61H 3U98H 4WXVA 1A0HB 1VCQA 1ELGA 1TALA 4I8LA 1AI8H 1GI5A 1XUIA 3BEUA 4YT6H 1GGDC 3KIDU 4D76A 2HOBA 2P3FH 3KEEA 1AWHB 1LHDH 4ZHLU 4MVNA 1LKBA 1O3AA 2BVRH 1Z8GA 3AW1A 4BAQB 3ZVCA 3TGIE 1V2PT 1GBFA 1K1IA 1L1NA 1DM4B 3SU4A 1GJAB 2PSYA 2HVXA 3U1IB 4KP0A 2VIWA 1KXAA 4RKJB 4K1SA 1GJ9B 1HRTH 2ZTZA 1GJBB 3MNCA 1S84A 1EP6A 3FAOA 2QY0B 3ELAH 1K2I1 4PROA 4J1YA 3E0NB 5LPEA 1C2JA 1ZMJA 1ZPBA 4XDEA 4WY3A 2FXRA 3D65E 3L33A 4D8NA 2F3CE 1EX3A 2PHBA 1S5SA 2A4GA 4F49A 4TPIZ 5EXLA 1LVOA 1O3HA 3DHKH 3Q3XA 2FOCA 4YO9A 1KLIH 2ZDKA 1KLTA 3GYLB 3P17H 3SORA 1NTPA 1EATA 3U9AH 2J95A 1G2LA 4B2AA 5FPYA 4Y8XA 1VCPA 2GGVB 3SNAA 3GY5A 1UTOA 1SGTA 1KXDA 3QGJA 1AE8H 2CN0H 3S7KB 1NN6A 1G3DA 2G4TA 1N8OC 5DP3A 4XBDA 5DG6A 1SGDE 3A88A 5GJ4B 1SLXB 2A4OA 3H7OA 2Y80A 3A7VA 5EODA 1C5MD 1Z7KA 3BIUH 1O3PB 1RTLA 5T6GA 1BMLA 4FU7A 4ABEA 1LPKB 1CVWH 1LDTT 4O03A 4SGBE 2M5TA 3UFAA 4CBNA 5GCHF 1ESTA 3UOPA 2ZFFH 2ZHFH 1GMCG 1OXGA 2C8WB 4GHTA 2ZHEH 1A5IA 3STIA 3TJUA 1C5LH 1C5PA 1O2TA 2QXGA 3RXKA 4HTCH 1CA0B 2BZ6H 1TPSA 2C8YB 1TX8A 1P02A 3A83A 2A4QA 2G00A 1LHEH 3SNBA 4O3UA 1ZPCA 1JBUH 3MNXA 4GHQA 1UO6A 2BY9X 3MO3A 3ZZ7A 1DY8A 1LCYA 3NK8A 1FNIA 1OP2A 2Z6BD 1O3CA 4NSVA 1V2KT 4YTAA 3LC3A 1MUEB 3BG4B 1ZSKA 3K9XB 1QBVH 2O8WA 1A3EH 5F8TA 1EZSC 4IGDA 1FXYA 4K5ZA 3SGAE 1GI0A 4FU9A 5JBBS 3IITA 5EOKA 1P06A 1Z1JA 1SGRE 4X1PU 1K9OE 1QA7A 1V2LT 2KAIB 1MCVA 1QB6A 1VZQH 3RXMA 5EG4A 5T6DA 2OC7A 3UREA 3LGUA 1A0LA 2ZFQH 4ZUHA 2AMDA 1EUFA 2RDLA 3ZZ5A 1YPGH 4NIXA 4CR5A 1RFNA 4OS5A 3PMBB 1CHGA 1AB9B 2QA9E 2STBE 2ANWA 2VIVA 3S9BA 1F0TA 2D1JA 4NGAH 1MBMA 1NY22 1KDQB 1CT0E 2HGTH 1GBHA 1SGEE 3EQ0H 2TGTA 1K1OA 2QN5T 1QJ1B 1S6HA 3SNEA 3E16B 1E36B 2G5NA 1O2WA 2FODA 4K69A 1WUNH 3M3TA 3MH5A 1SLVB 3A7XA 1QTFA 2ZDVH 3QZRA 4GCHF 1V2QT 2FOBA 5E0JA 4ZH8A 4DCDA 2ODYB 1ZSLA 1SGPE 4I8HA 3MU8A 1A1RA 1TRMA 1SGNE 4I8GA 1QRWA 1C2HA 3VXFH 3O8DA 4Q7XA 5C3NA 1T4UH 1C1WH 3QX5H 1KY9A 2H9HA 2C3SA 1L2EA 2PTNA 1YCPH 2V3OH 1INCA 4Q7ZA 1THRH 1RGQA 4RKOB 1RTFB 1NRNH 2F9BH 2SGFE 1GBJA 1SOTA 4NIWA 1ZRKA 2V35A 4AFQA 2ALVA 2DUCA 4FUDA 1DT2A 1TPAE 1W3CA 4WMDA 3MYWA 2YNBA 3URCA 1WBGB 3SGBE 3SUGA 4INKA 1BJVA 1MAXA 2BDCA 3DFJA 4MPXA 4E7NA 1XUHA 1UTLM 2Q6DA 2F9OA 3GCTF 1JXPA 4X1NU 3SNCA 3UUZA 3BTWE 4D7FA 1XXDA 2NWNA 2ZNKH 1FPHH 1C1OA 3D62A 2SGQE 1NFXA 1Q3XA 1FLEE 1BRAA 1SGFA 2ZG0H 4ISHH 1C5SA 2LPRA 3ODFA 2R9PA 3I77A 2J38A 4IS5A 3MO6A 3MU5A 3ITIA 2ZDNA 3PMJA 1MKWH 1O2YA 1DX5M 1DE7H 3RC6A 5EU8A 2ZA5A 4AYYB 1C4V2 4FUEA 1GDNA 1O3EA 2UWLA 3QTOH 1IQEA 3PMHB 2ZPRA 1K28D 2VGCB 1J16A 1IQGA 1G32B 1AY6H 1MKXH 1QA0A 2QIQA 1DXWA 2Y5FA 1M9UA 3ATWA 1GBBA 2OQ5A 3GYMA 3MU0A 4ASHA 4WF8A 2BDHA 3PTBA 1K1PA 4KKDA 2NU0E 2GZ7A 2C93B 1HUTH 2OINA 3M36A 3PTNA 3DT0H 1XX9A 3KCGH 2FTLE 2DE9A
chains in the Genus database with same CATH superfamily
3EA7A 1MZAA 2FM2A 2BOKA 1F5KU 3PV4A 1UVOA 1P04A 1W7XH 2KCPA 3RM0H 4BTTB 2VJ1A 1NBME 3SV7A 1AFEH 1C1RA 1GBCA 1E1RD 2BB4A 1T8MA 1HIAB 1HCGA 2G4UA 2A32A 1O2SA 2P95A 1W12U 3R0FA 1S6FA 1ZJKA 1LPZB 4NIYA 1V2NT 1V2OT 1K1LA 4ZXXH 1H8DH 4DOQA 1W13U 1PPBH 3A8BA 1CA8B 4U32A 4X1RU 4FUGA 3AK5A 1IHSH 1ETSH 1N6YA 5LPRA 2TPIZ 2V0BA 4DW2U 3FP6E 1ZTKA 1ELAA 4Y7BA 2XNDD 1RRKA 4DY7B 3SW2B 3ATIA 1TQ0B 1LQDB 4SGAE 1F7ZA 4DIHH 2A7CA 2PKSB 2OBQA 2WPLS 3KF2A 5FAHA 5ESBA 1O3OA 2IPQX 2GMTC 1OP0A 5A0BA 1GHBG 4B71A 4FUBA 1GMHF 3DCLA 3HKIB 1QFKH 4AZ2B 1HXEH 3LGIA 1BB0B 1MTNB 1VCWA 4K1TA 2PGBB 2GV7A 4IW4E 3Q3KA 5AFYH 3SV8A 3BF6H 2RA0A 2EC9H 1GJ6A 1CBWC 3SJIA 4Y71A 1H8IH 4WJG2 2W6ID 3VB7A 3RXTA 2JH6D 1WU1A 1O2KA 1GI6A 1GG6B 1O38A 1OWIA 1ZHPA 2P8OB 4A5TS 1UW7A 1NZQH 1TONA 5FHTA 1BMFD 5EXMA 1O2IA 1H9HE 2BX4A 5C1XA 3PO1B 5C0TA 1T8LA 1SHHB 2VVVA 1MTSA 3S7HB 5H4IB 2ZHQH 1GMHG 1AU8A 2OLGA 5DK1A 1AQ7A 1MTWA 4Z1MD 3A80A 3P70B 3CENA 4KTSA 5FBIA 1OWJA 4ABJA 2UUJB 2XYAA 1DY9A 3AAUA 1AUJA 1B7XB 1OWDA 1SGQE 4XOJA 4X8VH 4ZMAH 1G3EA 5L2ZH 3NWUA 1TLDA 5C94A 3SV2H 4INLA 8ESTE 2HNTE 1C1VH 3F9FA 2AS9A 3A8CA 5C2ZA 1JWTA 1O2LA 1XUJA 1SLWB 1J9CH 4Y0ZE 1G37A 1V2MT 5E2OA 1A3BH 1Y8TA 4NWKA 2B7DH 3U8TH 1NU7B 1AVXA 2OK5A 1NPMA 1S81A 1O2GH 3BG8A 1GJ7B 4Y76A 1TGTA 1IQMA 3PLBA 1UJ1A 3ZV9A 3ZZDA 2WPJS 1NFYA 1GI3A 4E06H 2K1QA 1HXFH 3F0PA 5C5NA 1K22H 5HM9A 2ZEBA 1BDAA 2W3IA 5GXPA 1H8HD 3FVFB 3TVJB 2O8UA 7GCHG 2WINI 4ABFA 2AMPA 2D2DA 1CO7E 4OM9A 5C20A 2VBCA 3BTGE 3E91A 3PRDA 4B2BA 2B9LA 2ODPA 1QJ7B 2BD2A 4MPWA 4ABIA 2TGPZ 1H9IE 4U30A 2FS8A 4AOQA 1C5UA 1L0ZA 3E6PH 3RXEA 3TLOA 5TCCA 1ARBA 1SQRA 2RG3A 1GBIA 1ANBA 3M5MA 3NKKA 1RS0A 5GDSH 3ZZ8A 3GCHC 1HAIH 2FYRA 2VVCA 2P3TB 1TPOA 1BRCE 1SQAA 2CXVA 2VWLA 1O2ZA 1GBMA 2CJIA 3LIWA 3ZVDA 1FIWA 2LELA 3RXRA 1O34A 2FIRH 5L2YH 2P59A 4IMZA 1TA2A 1HAOH 4BANB 4GUXA 5HIZA 1C5WB 3MQKC 1QB1A 1V3XA 5I46H 4ISNA 5DP6A 2PWXA 3F9EA 3AAVA 4JZEH 4WMFA 1ELVA 2GT7A 4O97A 4ACAA 4YZUA 3DD2H 1PQAA 4IC6A 3ATMA 1ZZZA 3EAJA 1BTYA 3NUMA 1O5EH 2G81E 1DWEH 1FY1A 3SBKA 5CMXH 1W10U 1XUGA 2AMQA 1PFXC 1SOZA 1VKYA 2ZFTA 1AVGH 3E1XB 1TYNA 2FLBH 2RA3A 2Z9GA 3T28A 1FV9A 6CHAB 1SGYE 1OWEA 3EYDA 3LGVA 1X7AC 1AFQB 3RLYH 1BBRH 2JETC 6ESTA 2DE8A 5HKKD 2BVSH 3Q3YA 1ABIH 4H6SB 3JZ2B 1MQ6A 5FPTA 1C9TA 2ZFRH 2ASUB 4B74A 4KELA 3L6PA 3QK1A 1G2MA 1P2MA 1VGCB 4XSKU 1COWD 1UTJA 2AIQA 1XM1A 1ZOMA 3TK5A 1YC0A 2UUKB 1AZZA 4HI3A 3STJA 2RCEA 2YMSB 1PPEE 5C5OA 1TIOA 3SI4H 1WTGH 2FMJA 4ABAA 1AE5A 1HAYB 2FESH 2XNIA 3MWIU 2VH0A 2J92A 2WPMS 2EI6A 3I78A 2R3YA 3AASA 5JBCS 2G52A 1JOUB 3DFLA 3SJKA 5BRRE 2O8LA 2BDGA 1GHXH 3MO9A 3LJJA 1RD3B 3P95A 1A7SA 3BTKE 1TBZH 2HNTF 1MMJN 3BTTE 1W14U 2J2UA 3GICB 3FO8D 2AGGX 4K8BA 1DPOA 1O2QA 3EE0B 2ZHDA 8GCHG 3UTUH 1HDTH 3HPTB 1GGDB 5SGAE 4JMYA 1OPHB 4D9QA 1IOEA 2IPHA 2WUCA 3RMLH 1ZYOA 1ARCA 1EPTA 1UK3A 5LH8A 3GY3A 3A89A 4Y79A 2ZU5A 3GY7A 1OHHD 1IQNA 1GPZA 4UFGH 1L1JA 1SLUB 4OGXA 1HJ9A 1ID5H 2A4RA 4NFFA 3UQOA 3MH7A 1YPHE 2OC0A 2VIPA 1AUTC 4JZDH 3KHVA 5DGJA 2TRMA 2A45B 1G3BA 1Q2WA 2EI8A 4BTIB 1Z6JH 4ZAEA 5JBTA 1B0EA 1F0RA 1ANDA 4UONA 3WWFA 4X2XA 5A8ZA 2ZGBH 1BRUP 1MZDA 2J98B 2ZECA 3BSQA 3KGPA 5HMAA 1PQ5A 4JK6A 4H42U 1OWHA 1ZR0A 1QHRB 1YPKH 2OQUA 1DWCH 1KXBA 3UR6A 1F5RA 2B0FA 4GLYA 4DT4A 2BD7A 4YOGA 1QB9A 1C2FA 2H9TH 2F9UA 3FFGA 2JJ1D 4HZHA 4ZROA 1SFQB 1BMAA 1YPMH 3HATH 1PJPA 4B76A 4XBCA 1GBAA 1VITF 2J97A 1N8OB 1AKSA 1XMNB 2PKAA 1GDQA 1RTKA 3BIVH 1GI1A 3MH4A 1P12E 2QF0A 1P2KA 2GT8A 2GDEH 4AYVB 3W95A 1BTHH 3TJNA 4FETA 2WUBA 4MPUA 1NRSH 1Q31A 1Y5AT 2ZHWH 4NCYA 3SGQE 1W2KH 2PGQB 1NESE 3V3MA 3NCLA 3FZZA 1RIWC 2WV4A 1ETRH 1FONA 2NU4E 4FUFA 1TRNA 2ALPA 3M7TA 4RSPA 2UWOA 3SJ8A 1P3EA 5AVDA 3UQVA 5ETXA 2HNTC 7KMEH 3VG8A 2ANKH 4TWWA 1CSOE 2QXJA 3ZIAD 1GBLA 1LHFH 3TGJE 2ZQ2A 3A8DA 3M5LA 1FJSA 4AFSA 1G30B 1CE5A 1SBWA 3MHWU 4Y10E 5GCHG 1O5AB 2BQ6B 1BHXF 2H5CA 1SVPA 3LJOA 2A2XH 4X8TH 2GX4A 2P93A 4X0WU 2ZU2A 1P9SA 4UFDH 1BTPA 5EPNA 3IWMA 1ANCA 1O39A 4JZ1A 3A82A 1C1TA 3U8OH 2FX6A 1O36A 1EZXC 1N6XA 1BA8B 1CGJE 1QQ4A 3T62A 4CREA 5DN6D 3ZZCA 2G5VA 1FZZA 4JK5A 3A7WA 2XBVA 1NM6A 2Z3CA 3O8CA 3M61U 1TNKA 2BZAA 4ABDA 1CQQA 2P16A 1O3KA 4INHA 5EW2H 1DICA 3OYPA 3A86A 1T8NA 3PV2A 1BMNH 5IYTA 2ANYA 2FOFA 1E34B 1YLNA 3RXVA 1HAHH 3ZVEA 4NWLA 3KQEA 4MNYA 1O30A 1DUEA 1NT1A 1AIXH 2GZ8A 1W11U 4YLQH 1O2UA 1Z6EA 3OTJE 3OY6U 4FXGH 1PQ8A 3RXOA 2BD8A 3DA9B 3UPEA 2BY8X 2VWOA 2BY5X 2K8IA 2EY4C 3DUXH 3UNQA 3F9GA 3UWIA 1E1QD 3RMNH 5A0AE 1KTSB 3NZIA 1GL0E 3TNSA 3NPSA 1YLCA 1VITH 2KCYA 3PWCA 5G4BA 1QRXA 3DSOA 1CGHA 3KL6A 1C5ZB 4GSOA 3EA8A 5DP5A 1NFUA 4XE4A 1BMMH 3ZZ9A 4JYVH 2P94A 3BTQE 3OAAD 1ZMLA 1N1LA 1DSTA 2CHAC 1FMGA 2BY7X 4Y8ZA 4ZKRU 3T29A 2A5KA 3EA9A 1MABB 3GCOA 1BJUA 3BEIB 5FCRA 3SQHE 1A4WH 1UK4A 2J9NA 2BDIA 2SGAA 1SC8U 2JKHA 1EZUC 1GMDF 2GD4B 1E0FD 3RP2A 1ZTJA 1DDJA 2H6MA 3E90B 2PV9B 4TT3D 2STAE 1SQTA 2BTCE 3S69A 1V2JT 4GCHG 5B6OA 1PPCE 5L6NH 3ZVBA 4GPGA 1QCPA 1D3QB 2BXTH 1TX6A 1QIXB 2SGDE 4AG1A 4X8UH 1K0HA 4DVAU 1Y3VA 1GJCB 1UVPA 2NU1E 1C2EA 1Z71A 3KN2A 2QE7D 5CE1A 4BAMB 1UMAH 2AFQB 2ZI2H 1UTNA 4DGJA 1HJAC 4WWYA 4D7GA 3ATLA 2HALA 1SR5C 1W0YH 1A2CH 1AVWA 1ELTA 4H4FA 2J34A 2WV5A 2Q6GA 1KYNA 1LVYA 2LNCA 1BBRE 3KYFA 1AD8H 1Z8IB 3URDA 4MLFB 1XVMA 3SU2A 3DSGA 4B75A 4K2YA 3SOSA 2CGAA 4MDSA 1C2MA 3FOAA 3BTFE 3SV6A 4RT1A 2BLWA 2FOHA 3LONA 1GHAF 2UUYA 4ZXYH 3OTPA 1QL7A 1GL1A 2BDBA 1KXCA 4CR9A 5HYOA 4AB8A 5F6MA 3RXBA 4AX9H 4I7YH 1UVSH 2VVUA 2I6SA 2NU2E 3F2FA 1D9IA 4WVPE 4B6FA 3EE7A 2AGEX 3RMOH 1EAUA 1GI4A 2OUAA 1P2OA 3GCTG 4TSFD 3BTME 1G36A 3PMAB 4NIVA 4YM9A 1EAWA 1YGCH 4MNWA 4YESB 2VH6A 4JCNA 1CT4E 4AORA 1MTUA 3GS9A 2BQWB 1A0JA 1FX0B 4WMEA 4UFFH 2XOKD 3LGTA 1ZGVA 2AYWA 1G9IE 1K1JA 3RXPA 4E05H 2WYGA 2H9EH 2F9VA 4IN1A 1GJ4H 2CF8H 2ZZUH 1YPHC 2FTMA 3QDZB 2ODQA 3RU4D 3T26A 5JB8S 4X1SU 1GHAG 3VGCC 5F53A 5TJXA 4Y8YA 2FO9A 3M7UA 3PM3A 4ZKOU 1ESBA 1DXPA 1C1SA 3SV9A 3TU7H 5A8YA 1OYQA 2F9NA 4MNXA 4NA8A 3TH3H 3B23B 1CGIE 3ZVFA 1O3MA 2G8TA 4I31A 1GHWH 1FN8A 2HRVA 3ODDA 5T6FA 1IQKA 1HPGA 1T32A 1OSSA 1O3LA 1SFIA 3CNRA 1BCUH 1HJ8A 1YPEH 2A5AA 1HNEE 5JBAS 4MNVA 3W94A 4CHAC 1UCYH 2TGDA 3LOXA 3VFEA 3D49H 5CHAC 1ETTH 1TWXB 4YT7H 3N7EA 3N7DA 1TNJA 1D4PB 1BQYA 2A31A 4MTBA 5E0HA 2FZZA 2ESTE 1V2VT 2XWAA 2GCHF 4B2CA 1HAGE 3C1KA 3GCNA 2THFB 3UR9A 3KNXA 1OKXA 2ZFPH 2GMTB 2WZQA 3V7TA 4Z0KA 2R0LA 1FY4A 3RXAA 5E8EH 4OS4A 1YPLH 3Q00A 1WV7H 1Z8RA 4OGYA 1ESAA 1W0KD 1GBTA 1IHTH 3HGPA 1UTQA 1CBWB 1E37B 1C2DA 2O9QA 1ELDE 4ASUD 1D3PB 2JIZD 2WSSD 3R3GB 3RC4A 1EPTC 1WYKA 3ESTA 3T5FH 4NZQA 3QN7A 2W5EA 1EJNA 5AHGH 1HV7A 1TNIA 1O3JA 3UAIC 1QY6A 3PYHA 1V2TT 4FUIA 2GCTC 3F2GA 1KXFA 3B8JA 2QV1A 1W0ZU 2Z94A 1LVBA 2QGRA 2KM0A 3DSPA 5EIYA 2JJ2D 2BD3A 1KXEA 3AVZA 4UE7H 1SSXA 2VB0A 3P8FA 3H5CB 3RXQA 1LKAA 1O5BB 4KTUA 1T8OA 1E79D 1THSH 3CP7A 3SU3A 4YOJA 1O3DA 6GCHF 2ZTYA 1NC6A 1AWFH 2WPIS 2FEQH 1OYTH 3TJVA 4M9FA 1E35B 1O32A 3E8LA 5ESTE 4B73A 1AMHA 1O2NA 2WV9A 1HAZB 3FP7E 1O5DH 2H1UA 1TRYA 1L1GA 1WOFA 2OD3B 2QF5A 3SUDA 2KCAA 3S9AA 3ZZ3A 1O3BA 3ZZBA 3VB4A 1GCTC 2BDAA 4KTCA 4MPVA 3A8AA 1HAVA 2ZO3H 1AZ8A 2TBSA 1F0UA 2XBWA 2V7QD 1QJ6B 1AKSB 2PKAB 4KGAA 4ZKSU 1PYTC 1FY8E 1WCZA 2AH4X 2QCYA 4YXWD 3M5OA 1IAUA 3RXSA 1A5GH 1K1NA 3EDXB 3O8BA 2PP6A 3ZYDA 4CBOA 1DANH 4IMQA 2XCNA 1TNLA 3VEQB 1QBOA 1FUJA 1DWDH 2XW9A 2BXUH 1O2VA 3M35A 1GI9B 3K2UA 1EASA 3UWJH 1TGBA 2Q6FA 5B6LA 1QL8A 1ZSJA 1TMUH 3T25A 1ELEE 2B8OH 1P03A 2EI7A 2O8TA 1DLEA 2BDYA 6LPRA 4Y7AA 1KTTB 3TK6A 3E0PB 3QGNB 1NRQH 1FIZA 1XVOA 3GCHB 2WPHS 2QC2A 3A84A 2KFWA 3SJ9A 1QRZA 3LGYA 3P8OA 3HK3B 1EAXA 2VWMA 4NZLA 3SUFA 4LZ4B 3OFND 4AFUA 1YLDA 1Z8JB 2FI5E 2Y81A 4LZ1H 3ZVGA 2NU3E 1TGSZ 5FXLA 2GJGA 1C5RA 4I32A 4WXIA 1GVZA 1NRPH 1TA6A 2R2MB 3F3BA 4OS1A 2R3UA 1BUIA 2FI4E 1EFRD 3BN9A 2XRCA 4DG4A 1ZMNA 4A1XA 2H2ZA 2W6JD 4H6TA 1WQSA 1O2JA 5A0CA 3U1JB 1PYTD 2A2QH 1AN1E 1ZTLA 2YNAA 1VJ9U 3UB0A 1NRRH 1JIRA 2IOTA 3K6ZA 3RMMH 1GCDA 5C1UA 2XBYA 1LVMA 2D26C 2PUXB 3OU0A 3P8NA 4BXSA 2XBXA 1HAXB 3U28C 2V6NA 1LMWB 1UHBA 3M7QA 3RU4E 3PROA 3TIUA 2JETB 5GIBA 3M3SA 3MNSA 1CHOF 1P9UA 4FU8A 2A7JA 5E2PA 3ZZAA 5T1VA 1C1QA 1YKTA 4VGCC 2CV3A 3ZV8A 2BLVA 3PLPA 1O33A 3RXHA 2QXIA 2CF9H 1ACBE 5FX6A 3SUEA 1YCPM 1BRBE 1C5OH 1GI8B 3I29A 3SJOA 2HLCA 4X6PA 1Y5BT 3RLWH 1GBDA 5JPMH 1LHCH 1YP9A 2PSXA 3GOVB 1AHTH 2GKVE 5DP9A 1KSNA 1GBKA 2BX3A 1C5QA 1W7GH 2JH0D 5FX5A 1OWKA 1C4Y2 3GY6A 1MU8B 1H4WA 3A81A 1FPCH 2P3UB 1C5XB 1Y5UT 1C2IA 5K7RA 1XUKA 3A7YA 2BMGB 2ZKSA 2HWLB 4BAKB 5J4SA 3VB6A 1HYLA 2FLRH 1BIOA 2XC5A 1MAYA 4A6LA 5HIYA 1RJXB 4F4OC 3HKJB 4B1TA 2ZGHA 1EB2A 1GI7B 3MU4A 1KMHB 5L30H 2W3KA 2WHXA 1THPB 4ESTE 3BTHE 2ZDLA 5EW1H 1P09A 1TQ7B 2BQ7B 5HXFA 2RDEA 4YLUA 3ATKA 2XTTB 2ZGJA 5KGOA 4I33A 1LQEA 2F91A 3TJOA 1BBRK 1D3DB 1V2RT 1TGNA 1O31A 1C5NH 4OS2A 3LU9B 1TX7A 4K3JA 5KEDA 3QTVH 3BTEE 2FOEA 1TB6H 3KQ5A 5EGMA 3SO3A 2SNVA 2C8XB 3LKWA 1UCYE 5DPAA 1AO5A 4R8TB 3RXDA 2GTBA 1JIMA 2A0QB 1P05A 1EKBB 1DITH 4NG9H 3E3TA 2YMSD 2XC4A 2XC0A 2KR7A 1T4VH 2C90B 1SGIB 1K21H 1TOCB 3RDZA 4P00A 1YWUA 3C27B 4F55A 1TGCA 3BEFB 3OEED 3ZZ6A 3GY2A 3TGKE 1GMCF 1MD8A 4ZKNU 4THNH 4IN2A 1ZHRA 5C17A 1BT7A 2EEKA 1SPJA 1WQVH 4YOIA 3U8RH 3S9CA 1PPHE 1YY3A 2ZTXA 1D6WA 4OS6A 1O3IA 4A7IB 4CRAA 3HGNA 2VIOA 2OC1A 1GHYH 1S82A 3OEHD 1GJ5H 1ZJDA 2VINA 2JH5D 2V3HH 4NSYA 3G01A 4BTUB 2ZPQA 2ZWLH 3VPKA 1RIWB 1U6QA 1O2HA 2FX4A 3V13A 3L3TA 3MU1A 1WAYB 4J2YB 2UUFB 1EQ9A 1VITG 3M3VA 2Z9LA 1ZLRA 3MNBA 2CK3D 3KQDA 2WYJA 3F68H 4CRFA 1W8BH 1GJ8B 3TNTA 5FBEA 2PTCE 3MI4A 1C2GA 1P2IA 4XD7D 3SYJA 1S0QA 1P2JA 1EOJA 1VJAU 1C9PA 1ZPZA 1CA0C 1VR1H 1C1UH 1HB0B 3GISB 1DWBH 1P0SH 4X6NA 1V2WT 2M2AA 1TNGA 4FVBA 3SZEA 4FUCA 3A85A 2F83A 2OCVB 3OSYA 7LPRA 1EOLA 2XXLA 1DOJA 2AERH 1AGJA 3PB1E 3PRBA 4ABGA 3SU1A 3HK6B 5I25A 1C1MA 1C2LA 1PPFE 3BG4C 5IDKA 1ANEA 2L74A 3UNSA 1HGTH 2BLQA 4AN7A 3V0XA 3UOUA 2VWNA 2RFKC 3K6YA 1BZXE 2HPQH 5HM2A 5PTPA 3KQBA 4DIIH 1BOQA 3SN8A 1DFPA 2G55A 1P11E 1QL9A 1GHZA 2I6QA 3RXUA 2W26A 5DP8A 3A7TA 2TGAA 1D6RA 1MH0A 2ZGXH 1O35A 4Q80A 4X8SH 5A8XA 1O5CB 3SQEE 4ZCNA 5ABWA 2ZU3A 4Z6AH 1TE0A 3N99A 2Y7ZA 1H8ED 1MCTA 3H7TA 1SI5H 1TPPA 1ORFA 1IQHA 1AB9C 4LK4A 3ZZ4A 3SU6A 1WXRA 2Z3EA 1ELCA 3RXJA 2ZU4A 2VNTA 1BTXA 8KME2 3GDUA 1YBWA 3MH6A 4DT7B 1QBNA 4XBBA 5F03A 1J17T 3RU4T 1C2KA 2BM2A 1IQIA 3FZDA 1GVLA 5EQSA 1LHGH 5DJ7A 4F48B 4OS7A 1PPZA 5F8XA 2CHAB 4BXWA 5EJZA 8LPRA 3F9HA 3LDXH 2IN2A 1JMOH 5AFZH 1MD7A 4FUHA 4CH2B 1L4DA 4X1QU 2H5DA 1SQOA 1Y3WA 3WW7A 2F9PA 5LGOA 1TBQH 3VB5A 2Y5GA 3ZVAA 4ABBA 2VU8E 4GVUA 1F92A 2BLOA 2ZDAH 1BHXB 2FPZA 1TBRH 1P2QA 1O2OA 1HAVB 1YYY1 4Y0YE 1BTWA 1GWAA 5E0GA 4DJZB 5A2MH 2OBOA 1HJAB 4FUJA 5DSFA 1GMDG 2ZP0H 3M5NA 5K0HA 2G51A 4IBLH 4A92A 1NS3A 3GDSA 1UVTH 3MFJA 1XXFA 1L4ZA 3KQCA 3T2NA 1GHVH 2XWBI 5F8ZA 2ZC9H 3Q77A 4MG3A 2GV6A 1SB1H 7ESTE 2ZU1A 2ZFSA 3GDVA 1HAPH 1O2XA 4XFQA 1QNJA 1EJAA 3QWCH 3F6UH 2ILNA 2WPDD 4I8KA 4CRCA 1MU6B 2TIOA 3FN8A 4M7GA 1ABJH 1BTZA 1OP8A 1GBEA 4X2VA 1A46H 4BAHB 1K1MA 5JDUB 1SL3A 1XKAC 1FAXA 2BD5A 3VXEH 4X2WA 3WWBA 4MQAA 4CRBA 5FCKA 3GY4A 4ACBA 1EZQA 2R2WU 1FI8A 4ISOA 4JYUH 2QAAA 2IJOB 2VGCC 4X6MA 1YCPK 4LXBH 4ISIH 1QQUA 4O3TA 3H09A 5TCAA 3RXCA 2GDDA 2SGEE 3VGCB 5T3HA 1YPJH 5GPIB 2HLDD 3UIRA 1O5GH 2SGPE 4E7RG 1UTPA 2Y7XA 1DUAA 3A7ZA 4D9RA 3SI3H 1YM0A 2XCFA 3EGKH 3MMGA 2Z7FE 5DO4H 2AHME 5DKMA 4X2YA 4CRDA 3FANA 1CU1A 1F2SE 2FDAA 3LH3A 3SHCH 4AGKA 4K8YA 4A1TA 1UHBB 2PR3A 4NFEA 3NXPA 1EB1H 1BITA 4CH8B 1GVKB 1UVUH 3WY8A 4CHAB 3ZYEA 4X6OA 2BYAX 2PLXA 4RI0A 3PLKA 1C4U2 3S0NA 1EXFA 1GHBF 2ZGCA 1J8AA 2Z9JA 1CT2E 4WH8A 5CHAB 1FN6A 1T31A 2ZDMA 2Y5HA 2SNWA 1J15A 5IK2D 1PQ7A 4NA7A 1MKWK 1Y3XA 2ZCLP 1V2UT 4LOYH 2W7UA 1RXPA 1GDUA 3LT3A 1ELFA 1F0SA 1NU9A 2AEIH 1O3FA 1Z1IA 1DS2E 2FP7B 2KAIA 4QT8C 2PKSC 1MKXK 4JYTA 1SGCA 3P6ZB 1O2RA 2IJD1 3U69H 2A5IA 3SU5A 1TNHA 3QUMP 1UK2A 3BV9B 4AC9A 4JZFH 1MQ5A 3P92A 4K1EA 1DLKB 1J14A 3RXFA 3SHAH 1MTNC 4U01A 1TFXA 5DP4A 5JB9S 2FOAA 1EPTB 1C1NA 2GCHG 4Q2KA 3QO6A 1S0RA 2BD4A 2ZF0H 3NRLA 3F1SB 3PV5A 2ZPSA 1P01A 3PWBA 1GG6C 3BTDE 2GCTB 2P8OC 2Z3DA 2LP6A 1S83A 1A5HA 1C5VA 1JRSA 1KDQA 2OTVA 3CS0A 4GAWA 4K60A 5EJ1A 2Q1JA 1XUFA 3LGWA 1GI2A 1T7CA 3PO1C 2BOHB 2QF3A 2FOMB 3MTYA 2HPPH 2PUQH 5FL7D 1MTVA 1C5TA 1GJDB 1P3CA 2BVXH 1HBTH 1UCYK 4UDWH 1P8VC 1FY3A 2WPKS 3D23A 4BNRA 1IQFA 1O0DH 1Y3YA 5JYIA 2ZIQH 5EQRA 1NROH 1WSSH 1D3TB 2OC8A 4WH6A 5C1YA 1SHYA 4UD9H 4AG2A 2Z9IA 1KLJH 7GCHF 3M37A 3K65B 4U2WA 4UFEH 2GVFA 1O3NA 4FOUC 5EQQA 2UWPA 1GCTB 1FAKH 1UTMA 2SFAA 1B5GH 1FDPA 1O2PA 2QXHA 2K0QA 2GP9B 4TY7A 9LPRA 1P10A 4TYDA 4I86A 4Q63A 5LPFA 4Q7YA 1O5FH 1EJMA 3T27A 1ELBA 6GCHG 1LTOA 1OOKB 2J4IA 3SNDA 2BHGA 2ULLA 3TH2H 2CMYA 1NFWA 1LPGB 3VB3A 2ZCHP 5BPEA 1DSUA 5C0UA 1F5LA 1ZGIA 3GY8A 1DVAH 1FQ3A 3N7OA 1QGFA 1SMFE 3CS7A 2EA3A 5DP7A 3OX7U 4JZIA 1IQJA 9ESTA 3SU0A 3Q76A 3LH1A 3RC5A 2FI3E 3LC5A 1UTKA 2Z9KA 4AGJA 3JZ1B 2A1DB 1S6LA 2FOGA 3RUOA 3AW0A 5CHBA 3FP8E 2VIQA 1S85A 4HGCA 4UEHH 1SKYE 1H9LB 5HGGA 1TABE 5EXNA 4TPYA 1HFDA 2C8ZB 4RN6A 4DURA 1Y59T 4FVDA 2Y6TA 1ZHMA 2AGIX 2FWWA 4NA9H 3OY5U 2J94A 2OP9A 1MBQA 4TWYA 5AF9H 4TY6A 2QF4A 3TH4H 3RXIA 3O8RA 2B5TB 1C5YB 3TK9A 1Y3UA 1TAWA 2F43B 2PW8H 4R0IA 4AFZA 3P8GA 2PFEA 3RM2H 2JDID 3UNRA 1EAIA 1B0FA 1P57B 2VIDA 4I8JA 2R0KA 2D8WA 5J4QA 1TMBH 3UY9A 5GWZA 3LPRA 1QURH 1JRTA 1PPGE 4BAOB 1H1BA 4O9VA 2FS9A 1O2MA 1IQLA 3MOCA 1HIAA 1WTHD 2BD9A 1EP5A 1V6DA 2BY6X 2KX4A 1E38B 1XKBC 6CHAC 2Y82A 3ENSB 1TMTH 4VGCB 1O3GA 4BOHA 1AFQC 3RXLA 3A87A 4CRGA 1FY5A 1OS8A 2OXSA 2FYQA 4Y11E 2ANMH 1C1PA 2A7HA 4IC5A 1O37A 4ZHAA 1P2NA 3QZQA 2GZ9A 1VGCC 2YOLA 2W7SA 1BTUA 1QR3E 3SZNA 8GCHF 3QLPH 2YMSC 2ZQ1A 1V2ST 2QYIA 3V12A 4ZHMU 5EPYA 4AB9A 4Y6DA 3TITA 1OX1A 4ABHA 1G3CA 1ZRBA 4HFPB 5FPSA 1NO9H 3B9FH 5C67A 1TOMH 1CHOG 2O8MA 2AIPA 4Q4LA 5A09A 3TPIZ 2ZCKP 4A1VA 1SGFG 2C4FH 3IG6B 3RXGA 1YF4A 1KIGH 1LO6A 4ISLA 1HLTH 1SG8B 1A61H 2KCOA 3U98H 4WXVA 1A0HB 1VCQA 1ELGA 1TALA 4I8LA 1AI8H 1GI5A 1XUIA 3BEUA 4YT6H 1GGDC 3KIDU 4D76A 2HOBA 2P3FH 3KEEA 1AWHB 1LHDH 4ZHLU 4MVNA 1LKBA 1O3AA 2BVRH 1Z8GA 3AW1A 4BAQB 3ZVCA 5KECA 3TGIE 1V2PT 1GBFA 1K1IA 1L1NA 1DM4B 3SU4A 1GJAB 3W1EA 2PSYA 2HVXA 3U1IB 4KP0A 2VIWA 1KXAA 4RKJB 4K1SA 1GJ9B 1HRTH 2ZTZA 1GJBB 3MNCA 1S84A 1EP6A 3FAOA 2QY0B 3ELAH 1K2I1 4PROA 4J1YA 3E0NB 5LPEA 1C2JA 1ZMJA 1ZPBA 4XDEA 4WY3A 3OE7D 2FXRA 3D65E 3L33A 4D8NA 2F3CE 1EX3A 2PHBA 1S5SA 2A4GA 4F49A 4TPIZ 5EXLA 1LVOA 1O3HA 3DHKH 3Q3XA 2FOCA 4YO9A 1KLIH 2ZDKA 1KLTA 3GYLB 3P17H 3SORA 1NTPA 1EATA 3F2HA 3U9AH 2J95A 1G2LA 4B2AA 5FPYA 4Y8XA 1VCPA 2GGVB 3SNAA 3GY5A 1UTOA 1SGTA 1KXDA 3QGJA 1AE8H 2CN0H 3S7KB 1NN6A 1G3DA 2G4TA 1N8OC 5DP3A 4XBDA 5DG6A 1SGDE 3A88A 5GJ4B 1SLXB 2A4OA 1NBMD 3H7OA 2Y80A 4HG6A 3A7VA 5EODA 1C5MD 1Z7KA 3BIUH 1O3PB 1RTLA 5T6GA 1BMLA 4FU7A 4ABEA 1LPKB 1CVWH 1LDTT 4O03A 4SGBE 4RT0A 2M5TA 3UFAA 4CBNA 5GCHF 1ESTA 3UOPA 2ZFFH 2ZHFH 3FKSD 1GMCG 1OXGA 2C8WB 4GHTA 2ZHEH 1A5IA 3STIA 1W0JD 1C5LH 1C5PA 1O2TA 2QXGA 3TJUA 3RXKA 4HTCH 1CA0B 2BZ6H 1TPSA 2C8YB 1TX8A 1P02A 3A83A 2A4QA 2G00A 1LHEH 3SNBA 4O3UA 1ZPCA 1JBUH 3MNXA 4GHQA 1UO6A 2BY9X 3MO3A 3ZZ7A 2L6OA 1DY8A 1LCYA 3NK8A 1FNIA 1OP2A 1WDIA 1O3CA 2Z6BD 4NSVA 1V2KT 4YTAA 3LC3A 1MUEB 3BG4B 1ZSKA 3K9XB 1QBVH 2O8WA 1A3EH 5F8TA 1EZSC 4IGDA 1FXYA 4K5ZA 3SGAE 1GI0A 4FU9A 5JBBS 3IITA 5EOKA 1P06A 1Z1JA 1SGRE 4X1PU 1K9OE 1QA7A 1V2LT 2KAIB 1MCVA 1QB6A 1VZQH 3RXMA 5EG4A 5T6DA 2F4LA 2OC7A 3UREA 3LGUA 1A0LA 2ZFQH 4ZUHA 2AMDA 1EUFA 2RDLA 3ZZ5A 1YPGH 4NIXA 4CR5A 1RFNA 4OS5A 3PMBB 1CHGA 1AB9B 2QA9E 2STBE 2ANWA 2VIVA 2J5UA 3S9BA 1F0TA 2D1JA 4NGAH 1MBMA 1NY22 1KDQB 1CT0E 2HGTH 1GBHA 1SGEE 2HVYB 3EQ0H 2TGTA 1K1OA 2QN5T 1QJ1B 1S6HA 3SNEA 3E16B 1E36B 2V3MA 2G5NA 1O2WA 2FODA 4K69A 1WUNH 3M3TA 3MH5A 1SLVB 3A7XA 1QTFA 2ZDVH 3QZRA 4GCHF 1V2QT 2FOBA 5E0JA 5EJLA 2EQNA 4ZH8A 4DCDA 2ODYB 1ZSLA 4B6EA 1SGPE 4I8HA 3MU8A 1A1RA 1TRMA 1SGNE 4I8GA 1QRWA 1C2HA 3VXFH 5CDFE 3O8DA 4Q7XA 5C3NA 1T4UH 1C1WH 3QX5H 4XRNA 1KY9A 2H9HA 2C3SA 1L2EA 2PTNA 1YCPH 2V3OH 1INCA 4Q7ZA 1THRH 1RGQA 4RKOB 1RTFB 1NRNH 2F9BH 2SGFE 2KZ4A 1GBJA 1SOTA 4NIWA 1ZRKA 2V35A 4AFQA 2ALVA 2DUCA 4FUDA 1DT2A 1TPAE 1W3CA 4WMDA 3MYWA 2YNBA 3URCA 1WBGB 3SGBE 3SUGA 4INKA 1BJVA 1MAXA 2BDCA 3DFJA 4MPXA 4E7NA 1XUHA 1UTLM 2Q6DA 2F9OA 3GCTF 1JXPA 4X1NU 3SNCA 3UUZA 3BTWE 4D7FA 1XXDA 2NWNA 2ZNKH 1FPHH 1C1OA 3D62A 1QZ8A 2SGQE 1NFXA 2J98A 1Q3XA 1FLEE 1BRAA 1SGFA 2ZG0H 4ISHH 1C5SA 2LPRA 3ODFA 2R9PA 3I77A 2J38A 4IS5A 3MO6A 3MU5A 3ITIA 2ZDNA 3PMJA 1MKWH 1O2YA 1DX5M 1DE7H 3RC6A 5EU8A 2ZA5A 4AYYB 1C4V2 4FUEA 1GDNA 1O3EA 2UWLA 3QTOH 1IQEA 3PMHB 3F0OA 2ZPRA 1K28D 2VGCB 1J16A 1IQGA 1G32B 1AY6H 1MKXH 1QA0A 3KYGA 4P02A 2QIQA 1DXWA 2Y5FA 1M9UA 3ATWA 1GBBA 2OQ5A 3GYMA 3MU0A 4ASHA 4WF8A 2BDHA 3PTBA 1K1PA 5GNDA 4KKDA 2NU0E 2GZ7A 2C93B 1HUTH 2OINA 3M36A 3PTNA 3DT0H 1XX9A 3KCGH 2FTLE 2DE9A
chains in the Genus database with same CATH topology
3EA7A 1MZAA 2FM2A 2BOKA 1F5KU 3PV4A 1UVOA 1P04A 1W7XH 4BTTB 3RM0H 2VJ1A 3SV7A 1AFEH 1C1RA 1GBCA 2BB4A 1T8MA 1HIAB 1HCGA 2G4UA 2A32A 1O2SA 2P95A 1W12U 3R0FA 1S6FA 1ZJKA 1LPZB 4NIYA 1V2NT 1V2OT 1K1LA 4ZXXH 1H8DH 4DOQA 1W13U 1PPBH 3A8BA 1CA8B 4U32A 4X1RU 4FUGA 1IHSH 1ETSH 1N6YA 5LPRA 2TPIZ 2V0BA 4DW2U 3FP6E 1ZTKA 1ELAA 4Y7BA 1RRKA 4DY7B 3SW2B 3ATIA 1TQ0B 1LQDB 4SGAE 1F7ZA 4DIHH 2A7CA 2PKSB 2OBQA 2WPLS 3KF2A 5FAHA 5ESBA 1O3OA 2GMTC 1OP0A 5A0BA 1GHBG 4B71A 4FUBA 1GMHF 3HKIB 1QFKH 4AZ2B 1HXEH 3LGIA 1BB0B 1MTNB 1VCWA 4K1TA 2PGBB 2GV7A 4IW4E 3Q3KA 5AFYH 3SV8A 3BF6H 2RA0A 2EC9H 1GJ6A 1CBWC 3SJIA 4Y71A 1H8IH 4WJG2 3VB7A 3RXTA 2JH6D 1WU1A 1O2KA 1GI6A 1GG6B 1O38A 1OWIA 1ZHPA 2P8OB 4A5TS 1NZQH 1TONA 5FHTA 5EXMA 1O2IA 1H9HE 2BX4A 5C1XA 3PO1B 1T8LA 1SHHB 2VVVA 1MTSA 3S7HB 5H4IB 2ZHQH 1GMHG 1AU8A 2OLGA 5DK1A 1AQ7A 1MTWA 3A80A 3P70B 3CENA 4KTSA 5FBIA 1OWJA 4ABJA 2UUJB 2XYAA 1DY9A 3AAUA 1AUJA 1B7XB 1OWDA 1SGQE 4XOJA 4X8VH 4ZMAH 1G3EA 5L2ZH 3NWUA 1TLDA 3SV2H 4INLA 8ESTE 2HNTE 1C1VH 3F9FA 2AS9A 3A8CA 5C2ZA 1JWTA 1O2LA 1XUJA 1SLWB 1J9CH 4Y0ZE 1G37A 1V2MT 5E2OA 1A3BH 1Y8TA 4NWKA 2B7DH 3U8TH 1NU7B 1AVXA 1NPMA 1S81A 1O2GH 3BG8A 1GJ7B 4Y76A 1TGTA 1IQMA 3PLBA 1UJ1A 3ZV9A 3ZZDA 2WPJS 1NFYA 1GI3A 4E06H 2K1QA 1HXFH 5C5NA 1K22H 5HM9A 2ZEBA 1BDAA 2W3IA 5GXPA 3FVFB 3TVJB 2O8UA 7GCHG 2WINI 4ABFA 2AMPA 2D2DA 1CO7E 5C20A 3BTGE 3E91A 4B2BA 2B9LA 2ODPA 1QJ7B 2BD2A 4MPWA 4ABIA 2TGPZ 1H9IE 4U30A 2FS8A 4AOQA 1C5UA 1L0ZA 3E6PH 3RXEA 3TLOA 5TCCA 1ARBA 2RG3A 1GBIA 1ANBA 3M5MA 3NKKA 1RS0A 5GDSH 3ZZ8A 3GCHC 1HAIH 2FYRA 2VVCA 2P3TB 1TPOA 1BRCE 1SQAA 2CXVA 2VWLA 1O2ZA 1GBMA 2CJIA 3LIWA 3ZVDA 1FIWA 3RXRA 1O34A 2FIRH 5L2YH 2P59A 4IMZA 1TA2A 1HAOH 4BANB 4GUXA 1C5WB 1QB1A 1V3XA 5I46H 4ISNA 5DP6A 2PWXA 3F9EA 3AAVA 4JZEH 4WMFA 1ELVA 2GT7A 4O97A 3DD2H 4YZUA 1PQAA 4IC6A 3ATMA 1ZZZA 3EAJA 1BTYA 3NUMA 1O5EH 2G81E 1DWEH 1FY1A 3SBKA 5CMXH 1W10U 1XUGA 2AMQA 1PFXC 1SOZA 2ZFTA 3E1XB 1AVGH 1TYNA 2FLBH 2RA3A 2Z9GA 3T28A 1FV9A 6CHAB 1SGYE 1OWEA 3EYDA 3LGVA 1X7AC 1AFQB 3RLYH 1BBRH 2JETC 6ESTA 2DE8A 2BVSH 3Q3YA 1ABIH 4H6SB 3JZ2B 1MQ6A 5FPTA 1C9TA 2ZFRH 2ASUB 4B74A 4KELA 3L6PA 3QK1A 1G2MA 1P2MA 1VGCB 4XSKU 1UTJA 2AIQA 1XM1A 1ZOMA 3TK5A 1YC0A 2UUKB 1AZZA 4HI3A 3STJA 2RCEA 1PPEE 5C5OA 1TIOA 3SI4H 1WTGH 2FMJA 4ABAA 1AE5A 1HAYB 2FESH 2XNIA 3MWIU 2VH0A 2J92A 2WPMS 2EI6A 3I78A 2R3YA 3AASA 5JBCS 2G52A 1JOUB 3DFLA 3SJKA 5BRRE 2O8LA 2BDGA 1GHXH 3MO9A 3LJJA 1RD3B 3P95A 1A7SA 3BTKE 1TBZH 2HNTF 1MMJN 3BTTE 1W14U 2J2UA 3GICB 2AGGX 4K8BA 1DPOA 1O2QA 3EE0B 2ZHDA 8GCHG 3UTUH 1HDTH 3HPTB 1GGDB 5SGAE 4JMYA 1OPHB 4D9QA 1IOEA 2IPHA 2WUCA 3RMLH 1ZYOA 1ARCA 1EPTA 1UK3A 5LH8A 3GY3A 3A89A 4Y79A 2ZU5A 3GY7A 1IQNA 1GPZA 4UFGH 1L1JA 1SLUB 4OGXA 1HJ9A 1ID5H 2A4RA 4NFFA 3UQOA 3MH7A 1YPHE 2OC0A 2VIPA 1AUTC 4JZDH 3KHVA 5DGJA 2TRMA 2A45B 1G3BA 1Q2WA 2EI8A 4BTIB 1Z6JH 4ZAEA 5JBTA 1B0EA 1F0RA 1ANDA 4UONA 4X2XA 5A8ZA 2ZGBH 1BRUP 1MZDA 3KGPA 2ZECA 3BSQA 5HMAA 1PQ5A 4JK6A 4H42U 1OWHA 1ZR0A 1QHRB 1YPKH 2OQUA 1DWCH 1KXBA 3UR6A 1F5RA 2B0FA 4GLYA 2BD7A 4YOGA 1QB9A 1C2FA 2H9TH 2F9UA 3FFGA 4HZHA 4ZROA 1SFQB 1BMAA 1YPMH 3HATH 1PJPA 4B76A 4XBCA 1GBAA 1VITF 1N8OB 1AKSA 1XMNB 2PKAA 1GDQA 1RTKA 3BIVH 1GI1A 3MH4A 1P12E 2QF0A 1P2KA 2GT8A 2GDEH 4AYVB 3W95A 1BTHH 3TJNA 2WUBA 4MPUA 1NRSH 1Q31A 1Y5AT 2ZHWH 4NCYA 3SGQE 1W2KH 2PGQB 1NESE 3V3MA 3NCLA 3FZZA 1RIWC 2WV4A 1ETRH 1FONA 2NU4E 4FUFA 1TRNA 2ALPA 3M7TA 4RSPA 2UWOA 3SJ8A 1P3EA 5AVDA 3UQVA 5ETXA 2HNTC 7KMEH 2ANKH 4TWWA 1CSOE 2QXJA 1GBLA 1LHFH 3TGJE 2ZQ2A 3A8DA 3M5LA 1FJSA 4AFSA 1G30B 1CE5A 1SBWA 3MHWU 4Y10E 5GCHG 1O5AB 2BQ6B 1BHXF 2H5CA 1SVPA 3LJOA 2A2XH 4X8TH 2GX4A 2P93A 4X0WU 2ZU2A 1P9SA 4UFDH 1BTPA 5EPNA 3IWMA 1ANCA 1O39A 4JZ1A 3A82A 1C1TA 3U8OH 2FX6A 1O36A 1EZXC 1N6XA 1BA8B 1CGJE 1QQ4A 3T62A 4CREA 3ZZCA 2G5VA 1FZZA 4JK5A 3A7WA 2XBVA 1NM6A 2Z3CA 3O8CA 3M61U 1TNKA 2BZAA 4ABDA 1CQQA 2P16A 1O3KA 4INHA 5EW2H 1DICA 3OYPA 3A86A 1T8NA 1BMNH 5IYTA 2ANYA 2FOFA 1E34B 3RXVA 1HAHH 3ZVEA 4NWLA 3KQEA 4MNYA 1O30A 1DUEA 1NT1A 1AIXH 2GZ8A 1W11U 4YLQH 1O2UA 1Z6EA 3OTJE 3OY6U 4FXGH 1PQ8A 3RXOA 2BD8A 3DA9B 3UPEA 2BY8X 2VWOA 2BY5X 3DUXH 3UNQA 3F9GA 3UWIA 3RMNH 5A0AE 1KTSB 3NZIA 1GL0E 3TNSA 3NPSA 1YLCA 1VITH 3PWCA 5G4BA 1QRXA 1CGHA 3KL6A 1C5ZB 4GSOA 3EA8A 5DP5A 1NFUA 4XE4A 1BMMH 3ZZ9A 4JYVH 2P94A 3BTQE 1ZMLA 1N1LA 1DSTA 2CHAC 1FMGA 2BY7X 4Y8ZA 4ZKRU 3T29A 2A5KA 3EA9A 3GCOA 1BJUA 3BEIB 5FCRA 3SQHE 1A4WH 1UK4A 2J9NA 2BDIA 2SGAA 1SC8U 2JKHA 1EZUC 1GMDF 2GD4B 1E0FD 3RP2A 1ZTJA 1DDJA 2H6MA 3E90B 2PV9B 2STAE 1SQTA 2BTCE 3S69A 1V2JT 4GCHG 5B6OA 1PPCE 5L6NH 3ZVBA 4GPGA 1QCPA 1D3QB 2BXTH 1TX6A 1QIXB 2SGDE 4AG1A 4X8UH 4DVAU 1Y3VA 1GJCB 1UVPA 2NU1E 1C2EA 1Z71A 3KN2A 5CE1A 4BAMB 1UMAH 2AFQB 2ZI2H 1UTNA 4DGJA 1HJAC 4WWYA 4D7GA 3ATLA 2HALA 1SR5C 1W0YH 1A2CH 1AVWA 1ELTA 4H4FA 2J34A 2WV5A 2Q6GA 1KYNA 1LVYA 2LNCA 1BBRE 1AD8H 1Z8IB 3URDA 4MLFB 1XVMA 3SU2A 4B75A 4K2YA 3SOSA 2CGAA 4MDSA 1C2MA 3BTFE 3SV6A 2BLWA 2FOHA 3LONA 1GHAF 2UUYA 4ZXYH 1QL7A 1GL1A 2BDBA 1KXCA 4CR9A 5HYOA 4AB8A 5F6MA 3RXBA 4AX9H 4I7YH 1UVSH 2VVUA 2I6SA 2NU2E 1D9IA 4WVPE 2AGEX 3RMOH 1EAUA 1GI4A 2OUAA 1P2OA 3GCTG 3BTME 1G36A 3PMAB 4NIVA 4YM9A 1EAWA 1YGCH 4MNWA 4YESB 2VH6A 4JCNA 1CT4E 4AORA 1MTUA 2BQWB 1A0JA 4WMEA 4UFFH 3LGTA 1ZGVA 2AYWA 1G9IE 1K1JA 3RXPA 4E05H 2WYGA 2H9EH 2F9VA 4IN1A 1GJ4H 2CF8H 2ZZUH 1YPHC 2FTMA 3QDZB 2ODQA 3RU4D 3T26A 5JB8S 4X1SU 1GHAG 3VGCC 5TJXA 4Y8YA 2FO9A 3M7UA 3PM3A 4ZKOU 1ESBA 1DXPA 1C1SA 3SV9A 3TU7H 5A8YA 1OYQA 2F9NA 4MNXA 4NA8A 3TH3H 3B23B 1CGIE 3ZVFA 1O3MA 2G8TA 4I31A 1GHWH 1FN8A 2HRVA 3ODDA 5T6FA 1IQKA 1HPGA 1T32A 1OSSA 1O3LA 1SFIA 1BCUH 1HJ8A 1YPEH 2A5AA 1HNEE 5JBAS 4MNVA 3W94A 4CHAC 1UCYH 2TGDA 3LOXA 3VFEA 3D49H 5CHAC 1ETTH 1TWXB 4YT7H 1TNJA 1D4PB 1BQYA 2A31A 4MTBA 5E0HA 2FZZA 2ESTE 1V2VT 2XWAA 2GCHF 4B2CA 1HAGE 3C1KA 3GCNA 2THFB 3UR9A 3KNXA 1OKXA 2ZFPH 2GMTB 3V7TA 4Z0KA 2R0LA 1FY4A 3RXAA 5E8EH 4OS4A 1YPLH 3Q00A 1WV7H 1Z8RA 4OGYA 1ESAA 1GBTA 1IHTH 3HGPA 1UTQA 1CBWB 1E37B 1C2DA 2O9QA 1ELDE 1D3PB 3R3GB 3RC4A 1EPTC 1WYKA 3ESTA 3T5FH 4NZQA 3QN7A 2W5EA 1EJNA 5AHGH 1HV7A 1TNIA 1O3JA 1QY6A 3PYHA 1V2TT 4FUIA 2GCTC 1KXFA 3B8JA 2QV1A 1W0ZU 2Z94A 1LVBA 2QGRA 2BD3A 1KXEA 3AVZA 4UE7H 1SSXA 2VB0A 3P8FA 3H5CB 3RXQA 1LKAA 1O5BB 4KTUA 1T8OA 1THSH 3CP7A 3SU3A 4YOJA 1O3DA 6GCHF 2ZTYA 1NC6A 1AWFH 2WPIS 2FEQH 1OYTH 3TJVA 1E35B 1O32A 3E8LA 5ESTE 4B73A 1AMHA 1O2NA 1HAZB 3FP7E 1O5DH 2H1UA 1TRYA 1L1GA 1WOFA 2OD3B 3SUDA 3ZZ3A 3S9AA 1O3BA 3ZZBA 3VB4A 1GCTC 2BDAA 4KTCA 4MPVA 3A8AA 1HAVA 2ZO3H 1AZ8A 2TBSA 1F0UA 2XBWA 1QJ6B 1AKSB 2PKAB 4KGAA 4ZKSU 1PYTC 1FY8E 1WCZA 2AH4X 2QCYA 3M5OA 1IAUA 3RXSA 1A5GH 1K1NA 3EDXB 3O8BA 3ZYDA 4CBOA 1DANH 4IMQA 2XCNA 1TNLA 3VEQB 1QBOA 1FUJA 1DWDH 2XW9A 2BXUH 1O2VA 3M35A 1GI9B 3K2UA 1EASA 3UWJH 1TGBA 2Q6FA 1QL8A 1ZSJA 1TMUH 3T25A 1ELEE 2B8OH 1P03A 2EI7A 2O8TA 1DLEA 2BDYA 6LPRA 4Y7AA 1KTTB 3TK6A 3E0PB 3QGNB 1NRQH 1FIZA 1XVOA 3GCHB 2WPHS 2QC2A 3A84A 3SJ9A 1QRZA 3LGYA 3P8OA 3HK3B 1EAXA 2VWMA 4NZLA 3SUFA 4LZ4B 4AFUA 1YLDA 1Z8JB 2FI5E 2Y81A 4LZ1H 3ZVGA 2NU3E 1TGSZ 5FXLA 1C5RA 4I32A 4WXIA 1GVZA 1NRPH 1TA6A 2R2MB 4OS1A 2R3UA 1BUIA 2FI4E 3BN9A 2XRCA 4DG4A 1ZMNA 4A1XA 2H2ZA 4H6TA 1WQSA 1O2JA 5A0CA 3U1JB 1PYTD 2A2QH 1AN1E 1ZTLA 2YNAA 1VJ9U 1NRRH 1JIRA 2IOTA 3K6ZA 3RMMH 1GCDA 5C1UA 2XBYA 1LVMA 2D26C 2PUXB 3OU0A 3P8NA 4BXSA 2XBXA 1HAXB 2V6NA 1LMWB 1UHBA 3M7QA 3RU4E 3PROA 3TIUA 2JETB 5GIBA 3M3SA 3MNSA 1CHOF 1P9UA 4FU8A 2A7JA 5E2PA 3ZZAA 1C1QA 1YKTA 4VGCC 2CV3A 3ZV8A 2BLVA 3PLPA 1O33A 3RXHA 2QXIA 2CF9H 1ACBE 5FX6A 3SUEA 1YCPM 1BRBE 1C5OH 1GI8B 3I29A 3SJOA 2HLCA 4X6PA 1Y5BT 3RLWH 1GBDA 5JPMH 1LHCH 1YP9A 2PSXA 3GOVB 1AHTH 2GKVE 5DP9A 1KSNA 1GBKA 2BX3A 1C5QA 1W7GH 2JH0D 5FX5A 1OWKA 1C4Y2 3GY6A 1MU8B 1H4WA 3A81A 1FPCH 2P3UB 1C5XB 1Y5UT 1C2IA 5K7RA 1XUKA 3A7YA 2BMGB 2ZKSA 2HWLB 4BAKB 5J4SA 3VB6A 1HYLA 2FLRH 1BIOA 2XC5A 1MAYA 4A6LA 1RJXB 4F4OC 3HKJB 4B1TA 2ZGHA 1EB2A 1GI7B 3MU4A 5L30H 2W3KA 1THPB 4ESTE 3BTHE 2ZDLA 5EW1H