5G4KA

Phloroglucinol reductase from clostridium sp. apo-form
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
264
structure length
264
Chain Sequence
MVNVKKEFVDNMFSVKGKVALVTGATGALGCVLSKAYGYAGAKVFMTGRNEKKLQALEAEFKAEGIDCAYGVADPADEAQVDAMITACVAQYGEVNILAVTHGFNKPQNILEQSVADWQYIMDTDCKSVYVVCKYVAQQMVDQGKGGKIVVVTSQRSKRGMAGYTGYCTSKGGADLMVSSMACDLSAKYGINVNSICPTVFRSDLTEWMFDPESAVYQNFLKREPIGRLAEPEDFVGYALFLSSDASNYITGANCDCSGGYLTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OXIDOREDUCTASE, SHORT CHAIN DEHYDROGENASE/REDUCTASE FAMILY P
publication title Biocatalytic Properties and Structural Analysis of Phloroglucinol Reductases.
pubmed doi rcsb
source organism Clostridium sp.
molecule tags Oxidoreductase
total genus 107
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2016-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5g4kA00
3GK3A 4L8VA 3IJPA 2CVOA 1K2WA 1V0JA 2OP1A 5JYDA 1DO8A 1SEVA 1GQYA 2UYYA 1UAYA 4BO0A 3EZLA 3GMSA 3JYNA 1JAYA 1EVZA 1PGQA 1Y1PA 2XXBA 3WX0A 3G1TA 4CMIB 1PZFA 1NFQA 4A2CA 1Q1NA 1O95A 4RCVA 3WFIA 4YAJA 4CPDA 4U7WA 4WEQA 4YWJA 3PGXA 3NJ8A 3ZWVA 3PDJA 1NR7A 3I5MA 4W9NC 3OJ0A 3LT1A 4E31A 1KC3A 4CL3A 3JQEA 2RCYA 1VKNA 3PJFA 4BGVA 1Q7GA 1ISFA 1H0KA 3JTMA 4DA9A 2OBNA 3FPCA 3VKVA 4F6LA 1LX6A 2WE8A 2WJPA 3K73O 2VWGA 3N58A 4XYLA 5DCUA 5I7FA 5JAIA 2OHXA 4QT0A 1RPNA 3M6IA 4J0EA 4CMBA 3E8XA 1XU9A 3DOJA 4DLAA 1Z75A 1R0KA 3SEFA 4BNLA 4CMGA 4QFCA 9LDTA 4R3NA 3M1AA 3ULKA 4B7UA 3ICCA 5L4NA 4I1IA 1DFIA 5CDSA 1QLJA 1SCUA 2VRCD 4UUNA 2GLXA 2HMTA 2HU2A 2C29D 2ET6A 2VTDA 3JQFA 3NGXA 4FGSA 3SVTA 2OORA 2BLLA 4OKNA 4EGFA 5K6AA 4CM4A 4PLYA 1P3DA 4IGEA 2VYVA 2RIRA 5TGDA 1E1KA 3RC7A 2E82A 4XGIA 1KY5A 3P19A 1Q7BA 5EN4A 2WYWA 4DXHA 1JVBA 4GQAA 3C85A 3M1LA 3KUXA 4E32A 1KVTA 3WXBA 3Q2IA 2EKPA 1ZK1A 4J1QA 1UZMA 4PLFA 2JHGA 4S3MA 4C7JA 5IXSA 2Q45A 2XAAA 4XZ3A 1QV6A 1LDEA 3QSGA 5G0UA 1PL7A 3ZNQA 2HMUA 4MIYA 1O6ZA 2YFQA 1DRWA 3CTMA 4UAGA 4A10A 3TZCA 2D8AA 1Y9EA 4GWGA 4RO0A 3VTFA 3S2FA 4L4XA 5FYDA 1YL5A 4WCFB 1YONA 4XIYA 1D4FA 1DIBA 1R4MB 5ER6A 3ZV4A 4RF5A 1ZSNA 2YQ5A 3JYQA 2YY7A 1B15A 4W82A 1QSGA 2VHZA 1PQWA 3WNQA 4YT2A 1AXEA 2G76A 3PHGA 4OMUA 5L3ZA 2SCUA 2YDYA 1M6WA 3WB9A 4WCFA 1GCOA 5CHEA 4WJZA 2A9FA 3IC5A 4I5DA 4D41A 2VHYA 1BXZA 1B3RA 2EP7A 1ZK0A 3BAZA 4YACA 3DZGA 3F1LA 1LDGA 5I8ZA 5EJ2A 4RPHA 4YT5A 2J5QA 3GMDA 3ZHZA 2DLDA 3BMOB 1Q2XA 1KERA 4FPXA 3KLPX 3H9GA 2O3RA 1UP4A 2Q2VA 1MG0A 1QYWA 1ONNA 3WJAA 1DFGA 4UEKA 4A73A 4RZHA 2DBVO 2P9CA 5CDUA 5EESA 3ZWXA 1DRUA 1MXHA 4RGBA 3IS3A 4J0FA 1Y5MA 3ETDA 3NT4A 1XU7A 3BMOA 5JDCA 3GR6A 3VKUA 3ONFA 1VL6A 3I3OA 5A5EA 3TJRA 2E6UX 1PIWA 3W8FA 4J90A 4CUKA 3W1VA 5TSDA 1HTBA 3FR8A 4GMFA 3OF2A 4PRKA 1N1GA 1NHWA 3PFFA 1ZBQA 2W2LD 3DBHB 3O8QB 4QQRA 2YQ4A 1M67A 3ZZNA 1CDOA 1YJQA 5F5NA 3DR3A 2JCVA 3ABIA 2Y0CA 2EKQA 1N92A 1A9ZA 3DONA 1GL3A 1P44A 3EMKA 3O4RA 4ILKA 5COQA 4H16A 2CY0A 2ZJ0A 5C3MA 3DBHA 4IDEA 4LCJA 2CUKA 3IUSA 2FR1A 1IULA 1LLCA 2X0NA 4G2NA 4P4LA 3DMTA 1Q0LA 2O4UX 4N7RA 4QECA 4R4JA 4UEJA 4QEDA 1N8KA 2CNBA 5IN5A 1NTOA 3SC6A 4BVAA 4G81A 1ZSYA 3K9QO 1H9BA 1RKXA 4YXFA 1JKJA 2VYNA 3ZWAA 4XDYA 3LF2A 1BXKA 2RH8A 3N7UA 4Y6PA 2O2SA 4Q3DA 5CG1A 1H9AA 3BYZA 3V1YA 4YT4A 4KUGA 2C5AA 2FWMX 3I9JA 4R1UA 3F46A 4BNWA 1XKQA 3AY6A 4OH1A 1PR3A 1R4NA 5F21A 5I9NA 1XDWA 1PQUA 5I9MA 3DTYA 2P4QA 1P1HA 1WWKA 4XD2A 1ISGA 1M2WA 4RDIA 2RHRA 4BNTA 2Y1FA 3I1JA 4W9NA 4JBIA 1MFPA 3PQEA 3VPFA 2H6EA 5JO0A 3PIIA 3I6QA 3D1LA 4IMRA 2YJZA 5CP8A 4BL5A 5JAMA 4CMEC 1PR9A 4HFRA 3RBVA 5K0ZA 3H9EO 2FN7A 3W4IA 3FNHA 5B4UA 2JFGA 5G4LA 4CMCA 1YQGA 1H6BA 2VOEA 4W4TA 5T67A 1GZ4A 2BH9A 3C1AA 4PN3A 5LDHA 3GGGA 4B8WA 1KOLA 4B8ZA 3HFGA 2CF6A 2Q50A 4FFLA 3CUKA 3ONDA 2DBQA 1DC3A 1GYPA 3D5TA 3AK4A 4MVJA 1P1JA 3CMCO 3E48A 2VZ8A 2PWZA 3NTOA 3CZMA 2C07A 4X54A 2FSSA 3AI2A 1P1KA 3DHEA 3QV1A 4K28A 1E6WA 2B0JA 1ZNQO 4FR5A 4XX0A 2E49A 4Z0HO 5IAAA 3MEQA 1G0OA 3QW2A 3OIDA 1SB8A 3PLNA 1MC5A 2FPIA 4CLEA 2IZ0A 3QWHA 4CMHA 4R68A 3TF5A 2GD1O 4KZPA 3PJDA 2OXIA 3D7LA 4FOOA 5A03A 4TROA 3CIFA 3KSZO 2PGDA 4YAKA 1NVGA 2P9EA 3BMQB 4K26A 1P31A 3OIFA 2ZB7A 4BO2A 3OFSA 2YDXA 3K92A 1NVTA 2HK7A 1YGYA 3GVPA 2EP5A 8ADHA 1SAYA 4EYEA 5BNTA 3GGPA 1HE5A 2NTJA 1RWBA 2XOXA 3AJRA 3QA9A 1JA9A 1VJ1A 5L7YA 4GWKA 1ISJA 2O7QA 3PTZA 2NVUA 3PPIA 4YJFB 2NV6A 4XQCA 4NU5A 1HDGO 3HJAA 3HN2A 5KIAA 2NLOA 2I6TA 4LN1A 1XR3A 3AY7A 4IM7A 1BMDA 3FNFA 1B0AA 1CF2O 4BKOA 5C7IO 2BGKA 3A1NA 1X0XA 3BIOA 4FQ8A 4TKMA 1G6KA 2I3GA 5A02A 4PG7A 1BGVA 3K2EA 3GA0A 2JFFA 2FMUA 4YJFA 3U62A 4E2WA 4YJGB 1RM0A 1YL7A 2EG9A 5JCJD 1ZK2A 3AUTA 2GYYA 1NQ5A 4OOFA 1YO6A 1VL8A 1CQIA 4AICA 4P22A 2X0RA 3WSWA 4EW6A 3IKVA 1LI4A 2V7PA 3X2FA 4YJGA 2B4TO 1AHIA 2UAGA 3ROMA 1P1FA 4B3HA 3PI7A 1ONOA 4A0SA 4NJOA 3QVSA 3GUYA 4ZHSA 2D4AA 1FK8A 4FFRA 4TRNA 1B3BA 3GQVA 1ZO8A 2V6GA 2VNAA 4B4UA 4E12A 4J9VA 2HDHA 2GN9A 3GDFA 1T26A 3VDQA 2GASA 2JCXA 2E37A 4BMVA 4CM5A 2G1UA 4CM8B 3EAGA 1OC2A 2GZ1A 3WGGA 2P5YA 2TMGA 1R12A 4RPKA 2CZCA 5DF1A 4OKIA 3ZNNA 3DOOA 1U28A 3EYWA 4PGFA 5HRUA 4NG5A 1YVEI 4XYGA 1LRJA 1XHLA 2IDZA 4HWKA 3PJEA 2OUIA 1GZ6A 3JD3A 5TX7A 3ZNOA 1V8BA 2UUPA 5F1KA 3WGOA 4EUHA 3B1FA 4CM8A 4HNHA 4PLPA 2EV9A 3OJLA 5L7WA 1ENYA 2EW8A 4OQYA 4EDFA 1DC4A 4ALKA 2WTBA 3HG7A 3JYOA 4PFJA 5TF4A 4B4WA 3NJ4A 4PLGA 3IJRA 4IQGA 3D4OA 1H93A 2QRJA 3IMFA 2PD4A 2IODA 5TNXA 1UDBA 2ZKLA 1ZEMA 3WLFA 1E7YA 4R51A 1WZIA 4D43A 3GN2A 3INGA 1ZIDA 3Q0EA 4BO3A 2RAFA 2GN6A 3RIHA 4ZICA 4OXKA 1ULUA 3QQPA 1EVIA 2NM0A 1B26A 4JJGA 4MVJI 3NDRA 3KBOA 4PZEA 4R01A 4YDRA 3SLKA 4OO3A 1Y8QB 4A27A 3I6IA 3QHAA 3L6DA 4P4GA 5G4KA 1YKFA 1X14A 2Q99A 3DTTA 4K6FA 4YR9A 4LK3A 2GN4A 4TWRA 1M75A 3WGYA 2J5KA 3HZZA 1PU2A 2BGMA 3LT0A 3QE3A 1B7GO 5L4LA 2NTVA 4DGSA 3VPGA 3GZNB 4IXWA 2DAPA 4IZIA 1H6CA 3T4EA 4GVLA 2LDXA 1F17A 5BSHA 1CERA 4CQMD 5KJ1A 1MGOA 3U0BA 3DZIA 4E0BA 2W2KA 9LDBA 1I30A 1PWXA 3ONEA 1PJ3A 4YRDA 2NQTA 5KVCA 1D1SA 1WMAA 4BGUA 4N18A 3JYLA 1T4BA 3GPDG 3VTZA 4CR6A 4QSMA 1NYTA 3V5NA 1FJHA 1VRWA 4RLSA 3EHEA 3ZGYA 3VH2A 3AW9A 4K6CA 4FBGA 5JLAA 2IYOA 3UFXA 4CMEA 3PXXA 3JQAB 1UAGA 2DKNA 5DZSA 2BGLA 4EUEA 1HWYA 4XA8A 1DEHA 2Q1SA 3H9JA 4KUEA 2PKQO 3EUWA 1MG5A 3IUPA 4N54A 4NBVA 4M87A 1QXSA 1EE2A 4WLNA 3DZFA 5KKCA 1Y9AA 3U4CA 3PWZA 4Z3DA 1RYDA 2CDCA 5C7OO 1C0PA 1DXYA 1ZJYA 2NU6A 2PR2A 1EDOA 1V3TA 3NKLA 3RCBA 2YYYA 7ADHA 1WAMA 3UHAA 3C8MA 4L0QA 4ZRMA 3BMCA 1B2LA 4QXMA 5A5FA 1BVUA 3R0IA 1C0LA 1HYGA 1YH3A 4YAGA 5HA5A 3H8VA 4N5LA 4Q3AA 1HL3A 3L6OO 4R5MA 3GEGA 1E77A 1IPFA 3NDIA 4HFNA 4IDBA 1T25A 5HM8A 3W4KA 3CPSA 4XCVA 2QRKA 5A9SB 2CVQA 4XYEA 2OP0A 3WGTA 3WWYA 4EJ6A 1KYQA 1YBAA 3BA1A 4YTEA 1X1TA 1W8DA 2HMSA 3DBVO 4TZTA 3VZPA 4YRBA 1VC2A 2PV7A 3K5PA 4NFYA 4PVDA 3NEPX 3E82A 1OBFO 3ZWCA 1ULSA 3JQCA 4BO7A 4CM9A 4J1TA 5A9SA 4XR4A 4FJ1A 4WLOA 3GG9A 2YV3A 3GAZA 3PHLA 4ND5A 3I9LA 3RUCA 5L4SA 3KYCB 1E7SA 1WDLA 2O50A 1A7AA 3F1KA 2UUOA 1N7HA 4Y8VA 3I9MA 2Y0DA 2YZ7A 3NV9A 4WCFC 3JQGB 1YB1A 4XWYA 4EEZA 1DJNA 4NBTA 1G0NA 1I3KA 5A1TA 4WLVA 2X58A 5IDXA 1X7HA 1YB5A 5C5IA 1GUFA 1KVSA 3QWIA 4FC7A 1QV7A 5G2OA 5L51A 1WDMA 1Z7BA 3V1UA 1DB3A 1H2BA 4B79A 3OSUA 1XELA 4FS3A 3S2EA 1ISHA 1R6DA 2P9GA 3GVHA 1LLUA 4BO8A 1F06A 3JQGA 1ADFA 3LT4A 4ZQGA 4Q3NA 1ZXBA 4M54A 4HV4A 4LW8A 2X9GA 2AHRA 3I83A 4BNUA 1FF9A 4ALJA 4MVJM 3IKTA 4DQVA 5JDCC 1Q0QA 4CV1A 3L77A 4EZBA 2VN8A 4QTZA 2PKRA 3AM4A 3CXRA 1AGNA 2X7HA 1AHHA 1C3VA 1YE3A 2H5LA 2J3KA 3ASUA 4J49A 4L74A 3TOZA 3F6YA 3H3JA 4NBWA 4Z9YA 1EQ2A 4FDAA 3JD0A 1SC6A 4YA6A 1LBEA 3RJ9A 5CDGA 1P77A 3FWNA 4IDAA 2DUWA 2HJSA 3U5TA 3D64A 4KTTE 2O48X 5TQVA 3SJ7A 3E5MA 1ARZA 4YJHB 3QLJA 2PGLA 1F8FA 2PH5A 1IHXA 1YDWA 3L4BA 1CYDA 4Y6RA 1A27A 5KVSA 6ADHA 2RH4A 1U3WA 4WE3A 1JWAB 3LDHA 3D3EA 3TRIA 5FEUA 1O9BA 1YBMA 3DMTC 2VWPA 4M49A 5ILOA 2VTEA 2HCTA 2PZKA 5TLSA 2E48A 3BXXA 4R1SA 2C2XA 4Q3EA 1ZCJA 1DRVA 1CRWG 2AE2A 5G0VA 3PQDA 4GX1A 3IIEA 5EINA 3ZWPA 5KVVA 2AEJA 2Y66A 3TOXA 1FDWA 3H7AA 1VSUA 2AMFA 3GPIA 3HDHA 4RF3A 2YV1A 1ENOA 5G0WA 2IXAA 2GRAA 1K3TA 5FWNA 4B7XA 5H83A 5AXCA 4BV9A 3ZU5A 1UXHA 1PL6A 1TI7A 1UXJA 4Y67A 3OQ6A 4DRYA 1BTOA 3VOSA 4J6FA 1I36A 1KETA 3HSKA 4GLOA 2HKIA 3RSHA 4CR7A 4D3DA 5ADHA 1VKOA 5TJHA 3VAZA 4GLLA 3IL2A 4DC1A 4IS2A 4Z0PA 3LYLA 4BB5A 1RM4A 1PGJA 4CMIA 5C7LO 4AJJA 3KHUA 4RVUA 4WK6A 4IDGA 5F3RA 1XSEA 3OETA 1LDNA 1GDHA 1Y6JA 1QG6A 1ZEJA 1DLIA 5F5LA 4R69A 1BG6A 5ICMA 5A4DA 3GG2A 1DC6A 1HDXA 3ETGA 3EVNA 2ZK7A 4HADA 4KOAA 4DVJA 4HNGA 4AJIA 1MV8A 3SX2A 1R66A 1E3JA 5L53A 1LTHR 4U6QA 1PJLA 1UJMA 4O1MA 1LUAA 1M66A 3RC2A 3TFQA 2IZ1A 5JS6A 4Z9FA 1J49A 4JIGA 2CF5A 4KP7A 5JMPA 3ASVA 1I01A 3HFSA 3UAGA 4D3SA 3OHSX 4BNJA 1EK5A 3WNVA 1KC1A 3D0OA 3G17A 3O9ZA 1GEEA 3OM9A 2I76A 3ZHBA 3U4HA 2JD2A 1QYVA 3L9XA 1YBVA 4UUPA 2FPGA 3V2UA 3D4PA 4NBRA 1BSVA 4E5YA 3ZW8A 5CDTA 4KWIA 5IDYA 3W4JA 2C7VA 4ID9A 1LNQA 2RHCA 4R54A 3QY9A 3A4VA 4DBVO 1E1LA 1PZHA 2D5AA 2ZTMA 4JX8A 3RI3A 4MKRA 4Q3BA 4R3WA 1HDYA 1V35A 1UDCA 3R6DA 2PZMA 1VPDA 4PLWA 5A3JA 1NASA 5TC4A 4NH4A 4CLRB 2ZJ1A 1K89A 2Y1DA 3C7CB 3NDJA 4TQGA 1I3NA 4PLZA 3UXYA 1QYXA 4QUKA 5JMWA 5BSEA 3DDNA 4RF4A 1PS0A 2VRCA 1BW9B 2EIHA 1ADGA 2DTDA 4R1NA 2VCYA 4EI2A 3BTUA 1DBVO 2H63A 3OICA 1U4OA 2D0IA 4CLRA 1S7CA 3ORFA 3QWAA 1P0CA 4ZA2A 3COSA 1T2FA 4MO2A 1W4ZA 3B20A 2O3UA 1UUFA 3DFUA 3H5RA 4GX2A 4R5HA 4XYBA 4YCAA 1NFFA 3F47A 4RVDA 4LCEA 4WGGA 1UR5A 4I9NA 1BRMA 2WD8A 3E9MA 5DBFA 3WBBA 1EVYA 3VDRA 3KRTA 5CEEA 4GI2A 4J7UA 3OIGA 3DAPA 3K96A 4CR8A 2HJRA 1E3SA 1E1NA 4GSKA 4ROSA 1GV0A 1R4MA 4AJ4A 4UVGA 3AUUA 4M89A 4HKTA 1HLDA 2FZWA 3NTRA 4F45A 4ONEA 4YB8A 1CEQA 3K6JA 2CDBA 4UREA 5BNIA 3GVXA 5KJFA 2B83A 2JKVA 3FRJA 4ZGWA 4IQ8A 4JXKA 4A7PA 2EXXA 2HQ1A 1Q7CA 2OGUA 3PGJA 3ZU2A 1I24A 1SPXA 1DPGA 2J8ZA 1BDMA 4D44A 2OL4A 3Q2KA 4EITA 4FCCA 3MJ4A 5LCXA 4NBUA 3MJEA 1UXKA 2BMAA 3LF1A 1E5LA 3DHNA 2GDZA 1GPDG 4II2A 2FSVA 3AOEC 3GFBA 4W7HA 1FDSA 1WXDA 3WYEA 4LMRA 4BKQA 1U9JA 1MXFA 4CLHA 2EWMA 5DBGA 5JBIA 1FDTA 1K6IA 1XG5A 2IYPA 4BKPA 4O59O 1C0IA 1SNYA 2ZCVA 4EJMA 5JAQA 1C1XB 4U6SA 1YJ8A 3GNTA 4NJMB 5IXYA 2VNSA 4FJ2A 1LRKA 1KIFA 2J3JA 3MJSA 4IIVA 1P0FA 4D7AA 1PZGA 4S1VA 3UCXA 4Z6KA 3NT5A 3WGHA 1VSVA 3CINA 1UH5A 4R41A 3WFJA 5COAA 3MZ0A 1U3TA 1RYEA 5I9LA 1HE4A 3PWSA 5DP2A 2X4GA 1C1XA 2B36A 4KDFA 4DPMA 3DBLB 1U2GA 2VYND 4E21A 2NU7A 4NJMA 1YWGO 4JP3A 3O8QA 3U4IA 1JN0A 2BELA 3DZBA 1ISMA 2DTEA 2R6JA 3WSVA 1P1RA 2V6BA 4R1TA 5AOVA 4AJNA 3IOYA 4OL9A 3VH3A 1U5AA 1U4SA 3VHRA 1GUZA 1ISIA 2Q4EA 3I4CA 2DBZA 2G5CA 5EIOA 2I67A 4YJDA 1N9GB 3DBLA 4IBOA 4R9RA 3O26A 2NVBA 4JP2A 1MLDA 2ZYGA 4IXTA 3M2TA 2PZLA 4L4SA 2JFHA 4G5HA 1JU9A 3F5SA 2CDAA 2IRWA 4ZJUA 1E92A 5HTOA 3A28A 4UUMA 3WYBA 3F3SA 1ZJZA 3LLVA 1WDKA 5EPOA 5A3VA 4E5NA 4C4OA 4W7IA 4W6ZA 1LQUA 1QMGA 3ENNA 1ZZEA 1SOVA 4ALLA 3WQSB 2UDPA 3ON5A 1O8CA 4CUZA 4UVEA 2BFOA 2IXBA 2VHXA 1VJTA 3JSAA 1KVQA 4FD3A 3GAFA 1CJCA 1H6AA 3E03A 1C14A 4LMPA 5BNFA 2Y1EA 4MPDA 1U3UA 3UCEA 3DWFA 2P4HX 4JJFA 4MVJG 4RZIA 3K31A 3ZU3A 3IDSA 1DAPA 1ZKMA 2FHSA 2ZQYA 4UVHA 3V8BA 1T1RA 4E5MA 1GD1O 1GU7A 3HQ4O 4MVJD 2Y93A 2WD7B 4NK5A 2X5JO 4XR9A 2IEBA 3WLEA 3L6EA 2JAPA 2PH3A 4M8SA 1SEPA 4PIVA 2I5PO 1DIHA 1NWCA 2Z1NA 1U2DA 3UCFA 1GPJA 3KYDB 1GCUA 2J3HA 4CQLB 5IZ4A 3DMYA 3LC7O 1EEHA 1YS4A 1PL8A 2WD7A 3VC7A 2AG5A 3GT0A 3GDOA 4WOJA 1E7WA 5C37A 2UVDA 1X0VA 4TMFA 1GQ2A 1RM5A 2Q4BA 2YHIB 3UVEA 3WGIA 3KYDA 3IP3A 3WQQA 3T4XA 3PYLA 5AYVA 1ZFNA 4C7KA 1T4DA 1UP6A 3HE3A 5HWSA 1U5CA 3GVIA 4J2HA 2PLAA 1M6HA 3I4FA 2YHIA 4IJWA 1SO8A 4O63O 3UF0A 1P33A 3PK0A 4XJSA 1GUYA 5DDIP 3FD8A 1QLHA 3HDYA 4FGWA 4K1LA 2F00A 4PZCA 1E3EA 1Y8RB 3BMQA 3Q9UA 5JO9A 3FBGA 4GGPA 3WGZA 1DIGA 3QWBA 1E6UA 2BRUA 4DPKA 1UXIA 5DULA 1I8TA 1JQBA 3E5RA 2J6IA 1KBZA 3AU9A 1NP3A 5HBRA 2YUTA 4GVXA 3LK7A 2B69A 4XJTA 2X9NA 1NQTA 1CIVA 4BV8A 1YXMA 4WECA 1HSZA 2VOJA 4DL9A 1TVEA 3H9QA 1UDAA 2NWQA 4DPLA 4IGFA 4I08A 2OO5A 1T24A 4E2XA 2GZ2A 3RWBA 4UUOA 1W73A 3DEYX 1DJQA 3G0OA 4J1NA 4BUCA 2HRBA 1XWFA 3PYXA 3ZWYA 4BMNA 4YEDA 1FDVA 4FB5A 4DMMA 4H7PA 1OOEA 4BO6A 4LRSB 4ND1A 3CKYA 2PK3A 3QVWA 4XYMA 4O0LA 4DQXA 3KZVA 3JQ8B 4XRGA 4A5OA 4WASA 5JXWA 4CV2A 3PQFA 1GY8A 4I9HA 5KKAA 3L07A 3GN1A 5LC1A 3TL2A 4IIUA 5L7TA 2D2IA 2P2SA 3WG9A 1KEVA 2NACA 4J2OA 2HUNA 5DP1A 4I5FA 3UKOA 3FNGA 3KLMX 5KWEA 1I5RA 3SJUA 1JKFA 2EERA 3JQ8A 1I2ZA 3KYBA 3AOEA 2QQ5A 3ANNA 4TRRA 4XRRA 4J4TA 4LVUA 1LXCA 3AUAA 3FI9A 1J5PA 3L4BC 4DIBA 1TXGA 1IYZA 1JAXA 3PZRA 3Q1LA 1R16A 3BZUA 4P8RA 4HBGA 1GFSA 4YAIA 1PQPA 4IPTA 3WIDA 2HRZA 1N1EA 4E13A 1Z7EA 2IEDA 1JKIA 2O23A 4MVJE 3F9IA 1LU9A 1NAHA 2FP4A 3LQFA 2BF7A 3EZYA 3I23A 2R2GA 4MP6A 3ITDA 2I9PA 1BXGB 1DHTA 3KSDO 4J16A 1N7GA 2JJYA 5BSFA 5COBA 1LDBA 1LSOA 1K6JA 2A92A 5H81A 1MC4A 1NXQA 3ZV6A 2H9IA 1MFZA 4U8GA 3OECA 5FF9A 2O3TA 2V6FA 1ZK3A 2AA3A 1UXGA 4BGEA 5B4TA 5B4VA 4II3A 3P2OA 4YQZA 5AXBA 5IZCA 3G49A 1ENPA 3BHJA 4RVFA 1F0YA 5K9ZA 2Q1TA 2GGSA 1BXGA 5LDGA 2H1SA 2PFGA 3RQSA 5I8WA 1NPYA 5BSGA 4BO1A 2X0JA 4JGBA 3WJ7A 1DLJA 1ZUD1 4J91A 4ZU3A 1LC3A 2WSBA 1Z73A 1Y8QA 4E2ZA 3GUCA 1V6AA 3VH4A 3NYWA 4DIOA 1OC4A 4YYZA 4XGKA 3HDJA 4RVHA 5IDWA 3OP4A 2WWRA 3PHJA 3FPLA 3B1JA 4FFOA 4NNJA 2WMDA 3KETA 3P2YA 1ZVMA 3FWZA 4I9UA 3PIDA 2JCYA 1TT5B 3ST7A 2W98A 3W6UA 2AG8A 5JFOA 4D3FA 2Q1UA 3GZNA 3OEWA 5U9CA 1DDOA 1CWUA 2YW9A 3CSDA 1IB6A 1I32A 2X23A 4FFNA 4HXYA 2GN8A 4J1SA 2C82A 3K2BA 4NHEA 1OZAA 3MTGA 2QX7A 4LSMA 4CQMB 2D59A 1HF3A 1KY4A 3AWDA 4TVBA 2BFPA 2CVZA 2Q2QA 3H2ZA 2EEZA 2GO1A 2ZTVA 2E4AA 4NU6A 1B16A 1EK6A 3HN7A 2GSDA 1C0KA 4FC6A 1HYHA 3WMWA 1ML3A 3GNQA 4HX5A 3JQAA 3ADOA 3PRJA 4WLUA 1F14A 3C7DB 4RPJA 4KQWA 3STHA 6LDHA 5KJCA 3ZN2A 1VM6A 3AY3A 4IUYA 5THQA 3WICA 4BNVA 4CM6A 2QW8A 3LC2O 1X7DA 2A94A 3RD5A 3NX4A 2LDBA 3TPCA 1HDRA 5G0SA 1HZZA 3LZ6A 4CV0A 1O5IA 3TSCA 3QP9A 3D4NA 4NQZA 1Z82A 3MOGA 4M1QA 2DVMA 2J3IA 4KTVE 4BQPA 4OJNA 3S8MA 4CM9D 1LJ8A 1KVUA 5JC8A 4ALMA 2BKAA 1B14A 4E30A 4CM7A 2AW5A 3WTCA 1V9LA 1PJBA 5DT9A 3JQ9C 1W6UA 2BFAA 5TJ9A 1PEDA 4IDFA 5ITWA 5L95A 4PLTA 1PGPA 1B8UA 2GUGA 1TA4A 1R0LA 4XB1A 1CETA 3U49A 4MKXA 3ZU4A 4E5KA 5L45A 1C1DB 5EQFA 2POQX 3DBRB 1MUUA 1U8XX 1HE2A 3DOCA 4AJOA 1H2HA 3FCOA 2NNLD 5A04A 3BMNB 3GVCA 4NMHA 3ZV5A 1PJCA 4A26A 4BGIA 2JAHA 3UN1A 1C1DA 4DYVA 4BNHA 5ENVA 1BVRA 1A4UA 4N5MA 3KYCA 4GX5A 5T64A 4WLFA 2GERA 4P4NA 4BS9A 3BTVA 2C54A 4HFMA 4AJ2A 1XYGA 2V65A 3S2GA 2CMDA 3KO8A 5U4QA 1ONPA 2WYUA 3BMNA 3D5QA 1SMKA 2GR9A 3L4SO 4IJVA 2FOIA 3RKRA 4Z9XA 1Y7TA 1HLPA 1JLLA 2PZJA 2UV8A 3TNLA 1IE3A 3N74A 4KDEA 2Q3EA 3GEMA 1SOWA 1B8PA 1K0UA 4YT8A 3H65A 1EBUA 2NTNA 4RF2A 3AM3A 3C24A 1DIAA 4JBGA 3V2HA 3ZHXA 3G1UA 3KEOA 2GPTA 4RPGA 4BHTA 1NBOA 2AEMA 4AJLA 3H4VA 3CE6A 2ZYDA 3ZHYA 4NPCA 3O03A 3LVFO 4UVIA 1EZ4A 4RL6A 1EQUA 3I9OA 5JYEA 1EMDA 1UP7A 3NTQA 4AJKA 1EVJA 5IFLA 2AXQA 2EKLA 5EMHA 2D3TA 5JE8A 4MDHA 1QP8A 3ROQA 8LDHA 3OQBA 4PRLA 4W99A 3KSUA 1X15A 3JYPA 5G0TA 4F3YA 3ZI0A 4GKVA 3TZHA 4E5PA 1OMOA 4HP8A 4ND4A 1QYCA 4JK3A 4GBJA 1NVMB 2C7GA 3PZBA 1PS9A 4RJTA 2ZTUA 1YB4A 4YJHA 5T6BA 4H15A 4JNKA 5IG2A 1HT0A 3RUIA 4UVDA 4YVFA 1NAIA 4G65A 1EE9A 5JPIA 2AQHA 5EERA 3DFZA 2EGGA 4GPD1 2VUSA 5JSFA 3DQPA 1IZ9A 5I7SA 1EBFA 3INRA 3RFXA 3DHYA 3QVOA 1E3WB 1ORRA 1LRLA 3BTOA 5IF3A 4E4YA 2VT2A 1PJTA 3UW3A 1E6EA 5TT0A 1AXGA 2OFPA 3E18A 4H3VA 3RU7A 3P5SA 3Q3CA 4FN4A 3E9QA 3ITKA 3ZWBA 5THKA 3QJ5A 4WOKA 3SLGA 3QRWA 4BOYA 1E3WA 3RC9A 3I9KA 3RFVA 2DU8A 1GQQA 1HETA 5ENDA 3BTSA 3ZNPA 3RBZA 4CJXA 3RJ5A 1JW9B 5T57A 4IZHA 1PZEA 3S2IA 4B3JA 2R00A 1A71A 4J7CA 2DT5A 4LSWA 1GTMA 4BO5A 3UH1A 5IJZA 1YOVB 1R0SA 4ALNA 3PWKA 4ZQFA 3RUFA 4DQUA 4D0RA 2W4QA 4AFNA 5JAZA 5KCZA 4BMSA 1T2CA 3AFMA 2B4RO 2PD6A 2PY6A 1GZ3A 2Y1OA 5DN9A 1YOVA 4FIZA 1O94A 1WMBA 4D79A 1LSUA 4IY1A 1ZMOA 2YV2A 2VYVD 4RLHA 1ZW1A 2Z95A 3ROPA 3OJOA 4FJ0A 4NFSA 2G0TA 4OXYA 4ND2A 3A14A 3I9NA 4OQZA 4PG4A 4U0KA 1LLQA 4LRTB 4LVCA 4XQGA 3PFWO 1Q0HA 3EDMA 2CSUA 2VZ0A 5EL0A 2JD0A 2Z5LA 1LC0A 2VQ3A 5F1OA 4FFMA 4CM4B 1H5QA 4U0JA 5JDIA 3FN4A 4ESOA 5ILGA 4WNIA 4J7XA 1HSOA 1GAEO 5DNAA 4NIMA 1ZXLA 3F4LA 2G82A 3H2SA 5KJEA 2FR8A 3SXPA 2DQ4A 2EF1A 4AJEA 4YBZA 3BHMA 2DFVA 4R16A 2XPCA 4TKLA 2XF8A 2BHLA 1FXSA 4MP3A 5FI5A 5JY1A 4TZKA 2HLPA 2VHWA 4J3FA 1JTVA 3JQ9A 4JJIA 2X9VA 1V3UA 3KM0A 4BO4A 1IPEA 4PVCA 3VZSA 2OMEA 3H5NA 3QVXA 2VHVA 1YQDA 1T2AA 3DAGA 4INAA 4CM3A 3HWRA 4ZD6A 3PJGA 4CMKA 1QR6A 3DZJA 4R9SA 3PP8A 2AQKA 4IQ0A 1GADO 2I66A 3FHLA 3UOGA 1BW9A 1G1AA 1I10A 2A4KA 5B1YA 2EHDA 4RQUA 4A03A 4ND3A 2VRBA 2FY8A 5A9RA 4I5GA 3VVCA 1D3AA 2G17A 2ZIZA 1HDOA 2PTGA 2PGJA 4XQEA 3U9LA 3ZH2A 5JNLA 1YDEA 3SBOA 3JCZA 4ZN6A 2X5OA 1MP0A 4U5QA 4BNFA 2VWQA 3ZV3A 2GNAA 2Y1GA 1AUPA 5IDQA 5CG2A 1WP4A 4NR0A 5ITVA 2AQ8A 1U8FO 5KNLA 2P91A 1D7OA 3CEAA 4B7CA 3JQBC 4E6PA 4AJHA 1NM5A 3UUWA 2FR0A 3EC7A 4XGNA 1MA0A 2B5WA 3RROA 3JQDA 1Z6ZA 4PLHA 3GGOA 3TDKA 3B6ZA 4D45A 3AFNA 2F1KA 1DFHA 2X5KO 4RPLA 4I8XA 1XLTA 3ZCXA 1GYRA 3B1KA 4IJKA 4GX0A 3H6KA 5JCXA 2YFHA 1ZSVA 4XB2A 4WEOA 1ENZA 3GLQA 5CPFA 1E5QA 2GCGA 4YPOA 5HS6A 4NDNE 3VVBA 5KTKA 1GYQA 3HB4X 3AOGA 3PLRA 4HFJA 4JCOA 4RDHA 4I5EA 3MWDB 5BR7A 5MDHA 1NX6A 1Z45A 1ADCA 1PWZA 4OXNA 3Q6IA 4JROA 2QYTA 3EVTA 2Y68A 1XQ1A 3DB2A 3HUDA 1PGOA 4XIJA 1N5DA 3JQ7B 2BD0A 3FR7A 3JD2A 3MJTA 4OM8A 1P74A 2GZ3A 5IZCC 3RFTA 4MINA 1D1TA 2Q1WA 2X0IA 1S6YA 3C1TA 4KMSA 1I3MA 1JWBB 3INTA 1A9YA 2PA3A 4BQRA 1DAOA 2YHUA 1W0CA 4L75A 2NQ8A 3CH6A 3OH8A 1TEHA 3AI1A 4Q39A 4WNCA 2W2LA 3PEFA 1GEGA 3JQ7A 2XXJA 3RKUA 4OIMA 4IINA 4OHUA 1LSSA 1PJ4A 3Q9NA 2NU9A 1IHYA 2QZ9A 4TRMA 2Y0EA 1AN9A 1LQTA 4ITUA 1E7QA 1N9GA 1WPQA 2V6MA 2ZB8A 1NFRA 3TL3A 4MIEA 3RUHA 2ZTLA 4HUJA 1R4NB 3G3EA 1P1IA 4Z3KA 1X1EA 5KJ6A 4Q9NA 2QZZA 3VPXA 1I2CA 1XQ6A 4OSOA 2IZZA 1MB4A 1O89A 1IZ0A 2Q49A 4ALIA 3WGQA 3GEDA 1K5HA 2BFMA 5ICSA 3DZKA 3LU1A 2IE0A 3AI3A 1DIRA 3MCVA 3OMLA 1LSJA 4XQ9A 2VT3A 4MIOA 3TWOA 1SZJG 1E1MA 1A72A 1BHSA 1RJWA 3B70A 3FTPA 3OA2A 4Y9DA 3ZWMA 3WMXA 2AE1A 4L9RA 2B35A 2DUUA 1X13A 4B3IA 4WCDA 3W8EA 4EJ0A 5L9AA 1XCBA 1NNUA 4OYRA 1HYEA 2QIOA 2FZEA 2C0CA 4DWVA 1E7RA 1KS9A 2P68A 3ICPA 3L0DA 4TRJA 3ROKA 2W8ZA 5CAEA 1U1IA 4K9DA 1OFGA 2B37A 1L7DA 4AVYA 3WTBA 4F6CA 3DC2A 4CQLA 1UZLA 2NADA 5A05A 1HXHA 3A06A 1E0DA 3CMMA 2DM6A 4GMGA 1YL6A 1WNTA 4OOEA 3FBTA 3F4BA 4IS3A 3VPHA 2HK9A 2A35A 4RVSA 3LC1O 4CLXA 3E1KA 5KVQA 3GFGA 4BNZA 1HEUA 3F5QA 4OSPA 4HY3A 1HZJA 5TT1A 4DLBA 3HB5X 4AG3A 5JY6A 4CL8A 3U09A 5T8KC 4J9UE 4DC0A 3VPSA 1EDZA 3VZQA 2WDZA 2Y99A 1UZNA 2PNFA 2D5CA 3PYMA 1E3IA 1WZEA 3FTNA 2NVUB 1H94A 3AUSA 1PJSA 1YRLA 2X22A 2EW2A 3ENKA 1QYDA 4MVJF 2I3AA 5L40A 4DUPA 2X86A 1Z74A 4M86A 3FNEA 3RUEA 1JDJA 3MJVA 4DMLA 2Q46A 5A06A 2DFDA 1Y8RA 4JQCA 2J5RA 2HK8A 3PHIA 4BNGA 3JV7A 7MDHA 5GZ6A 3OJEA 1PS8A 4E33A 2PD3A 2JL1A 3JD1A 3DZHA 3A9WA 3RUAA 1E7MA 1L1FA 4Y98A 4BNXA 1WW8A 5T5QA 4KQXA 3W6ZA 2WM3A 1T2EA 3NGLA 2O3SA 1XGKA 3GOHA 2QG4A 5HS4A 5I7VA 1O0SA 5CPBA 3Q11A 3TQHA 4GKBA 3T7EA 1DOHA 4MVJP 4BKUA 1NHGA 2CD9A 3IP1A 1GR0A 4PCVA 5U1PA 4O6VA 3S1LA 1QORA 3EK2A 5KOIA 1BDBA 2ZCUA 1ID1A 1ZH8A 2QHXA 1LA2A 1XA0A 5DOVA 1DC5A 3GNSA 3GHHA 3JQBA 3ANLA 3I52A 2DTXA 4BO9A 3VZRA 2I65A 3RBXA 3RASA 1U7TA 4PG5A 3V2GA 3PDUA 3GZ4A 4L76A 4RORA 4DLLA 4NFHA 4MKZA 3RC1A 3TZ6A 4PG6A 4FSHA 4D0SA 1NR1A 2DC1A 3G79A 3LSYA 2EJWA 2O3JA 3R1IA 2RBEA 3DO5A 3R3SA 2DBRA 4FFPA 4CLDA 3RU9A 4EEXA 3GY0A 3KTDA 3WBFA 3UICA 3KV3O 3OEYA 1HDCA 4NI5A 4P38A 1P9LA 4RQTA 1KEUA 3OBBA 2BI7A 5CFZA 3ADPA 3MJCA 3E9NA 1VI2A 4GL4A 3WWZA 3ZW9A 3KB6A 2ZATA 4IMPA 2QRLA 2ZB3A 1R37A 3NUGA 2I99A 4WPGA 3KEQA 4BB6A 2O2YA 3V1TC 1JVSA 2Y05A 2ILTA 3HNPA 3C7AA 3WIEA 2W90A 4BIIA 2CFCA 2BI8A 5F1PA 3UGKA 5GMOA 4BNIA 4BKRA 2VZ9A 1EUZA 5IN4A 4ZQHA 5B37A 3JD4A 1K6XA 4BNKA 1VLLA 4Y6SA 3KXDA 4J4HA 3TZQA 5BT9A 5G4KB 1OI7A 3U4DA 5TIIA 3DXFA 1T1SA 1RM3A 3M2PA 4QO7A 3NRCA 4IDCA 1TB4A 3HADA 1YQXA 4JBHA 5TRTA 1NPTO 3H3FA 1FDUA 3KOUA 4QFDA 1D8AA 4XEHA 2R00C 3ZWWA 4CMAA 3OJFA 5TS3A 1WLYA 2C5EA 4NZ9A 4CM1A 4XKJA 1IY8A 5DOZA 4PLVA 1EFKA 3EY4A 4RVGA 5DCYA 3QWFA 1PX0A 1PGNA 2X1HA 4AJPA 1L7EA 2W2KB 1SBYA 1I2BA 1M76A 1TT7A 3P7MA 3WYCA 5JCJA 1NWHA 4E3ZA 3PHHA 3GHYA 4BNNA 2WE7A 2HAEA 4OGWA 1J4AA 4J43A 4CMJA 3D3WB 2OOSA 4O5OA 4YRAA 1LDYA 3RVDA 1ZMTA 4CODB 4UULA 2FRDA 5ER9A 3JQAD 1TT5A 3FSRA 1I3LA 2HSDA 3H5AA 1LDMA 4GSLA 1Y81A 5MGBA 1LLDA 5B12A 1QRRA 5I7EA 1PJQA 3D3WA 3OQ1A 4B4OA 3MOIA 4CQMA 1P45A 3HHPA 4NK4A 3FF4A 4L73A 3DAFA 2P5UA 5J23A 5ES3A 5JDIC 4BNMA 5GZ3A 4JLWA 1EFLA 3KVOA 4JN6B 4WLEA 1VE9A 3WOHA 2GF2A 5DBIA 2C2YA 1SB9A 2O7SA 2JD1A 1KEPA 3WR5A 3BMCB 1N2SA 3O38A 1U7HA 1XEAA 1DSSG 2DPHA 3DL2A 3JQFC 4AJ1A 3QVTA 2ZYAA 4ZRNA 1XIVA 5K6AC 3WDSA 1IOLA 3GC6A 1TLTA 4J4BA 4XDZA 1B8VA 1I33A 4KWHA 4EBFA 1VL0A 1PSDA 5A9TA 1IUKA 4BNYA 2NVWA 2ZB4A 3C1OA 3R3JA 5GZ1A 2O4CA 3WQRA 2C20A 5T8KA 4GGOA 2C59A 3RAJA 4RV9A 4D42A 4KUHA 2FPPA 1KEWA 2Y1CA 4QO8A 5H82A 4TVOA 3EGOA 4DTIA 2EJVA 4GAEA 3MWEB 4D46A 4YQYA 4DYDA 3TFOA 2HMWA 2O3QA 4DBZA 1NPDA 2B5VA 5CDYA 3PVZA 4MVJH 5AVOA 5FI3A 3TN7A 3DBRA 1GV1A 3X2EA 1LEHA 1DHRA 3ZWNA 1H6DA 3ZDFA 3K8ZA 4CUJA 2WYVA 2TMDA 2HO5A 4LGVA 2VUTA 4ZQBA 4L4RA 2OZPA 2OBYA 2DPGA 1T2DA 4N5NA 1IL0A 2NSDA 4GH5A 3H9UA 3NT2A 1PTJA 4IDDA 4PLCA 4Q3CA 5FFFA 3TZKA 1V3VA 3GH3A 3WS7A 2Z1MA 1HKUA 4LISA 4MOWA 1EUDA 1NQAO 3BHIA 1PJ2A 1R15A 3K30A 1A7KA 3QIVA 3LLSA 1ZK4A 4M55A 1FMCA 2PKQP 5JW6A 1AE1A 3EW7A 5CEFA 2B4QA 3IQDB 4URFA 1A4IA 1CQJA 4MJLA 1J6UA 1Y5RA 3GRKA 3MTJA 4DIFA 3C3XA 4MP8A 3VH1A 3AM5A 1J0XO 3S55A 4E2YA 2NU8A 4ZQEA 5AQ1A 3ETEA 2Q2WA 4FOSA 2AEFA 5CEJA 4EUFA 4CV3A 1E3LA 1A5ZA 1NQOA 4IJUA 1ADBA 1HDZA 2D1YA 4WKGA 3U3XA 3CZRA 2JHFA 4PG8A 4TSKA 4CLOB 1WVGA 3GDGA 2HMVA 1VJ0A 5DCWA 4FW8A 2NUAA 4DREA 3JQ6A 1X7GA 4YAEA 2ZQZA 1U3VA 4Z0TA 3SC4A 2WEKA 1HE3A 4PZDA 4UEOA 4ZVVA 5BQFA 3ANMA 3NAQA 2X8LA 4B4VA 1BWSA 2X6TA 1QKIA 4AL4A 4CLOA 3IAHA 3ZWOA 3AU8A 3GRPA 3W8DA 2EGHA 3L9WA 1I0ZA 3RUDA 3E6AA 4QX6A 2VUUA 2AQIA 1MX3A 3OA0A 5EQDA 4F46A 1F12A 4WUVA 3HDQA 1F8GA 2VWHA 1EUCA 1HRDA 5AXDA 5JC1A 5GY7A 2QYSA 5AXAA 3T7CA 2Y67A 1KVRA 3LT2A 4OAQA 3GF4A 1OAAA
chains in the Genus database with same CATH superfamily
2EX1A 3IJPA 2BKVA 4BN5A 3QFCA 3TG2A 3RG2A 4YRSA 2R5FA 2ES4A 3MRSA 1V0JA 2OP1A 4S2EA 1DO8A 1MQAA 1I9CA 5JJKA 1UFQA 2UYYA 1HPLA 2PKYX 2VF8A 3Q7IA 4JL8A 4KK3A 3ZE2B 4C2BA 1D03A 1DQSA 3ENZA 4ISCA 5T4FA 1UK7A 3B5IA 3E81A 2DP4E 4KE9A 1JXOA 4Z3OA 3KT3A 1NFQA 4A2CA 1Q1NA 3MWGA 2BFCB 4K9LA 4RCVA 4MV6A 1XCOA 2FQWA 4YAJA 2DF8A 1JDBC 4U7WA 4WERA 2PJUA 4IWXA 4BLTA 5ALWA 1E9CA 3AUXA 2AJ8A 2DCMA 1Y6FA 3KTAA 3T3MB 4PGMA 1LBSA 4K9QA 4DLSA 3IA2A 3LV8A 3H0CA 4B85A 1JQAA 1QH1A 3Q8XB 2RCYA 4FXOA 4F60A 5CXSA 2C84A 3T7IA 1O0BA 4KMRA 3FPCA 1MB0A 4P35A 3IBTA 2B7LA 3K73O 3TQFA 4EHNA 4KSBA 1XN4A 3UMFA 5I7FA 1DPFA 8AT1A 2ZEJA 2DT8A 3B8HA 1AZSC 1CR6A 1X7XA 4JBWA 5EAIA 1Z3IX 1SCUB 3M6IA 1JKXA 3EDQA 1EJBA 2RGCA 2G4VA 3ICQB 3K1AB 1SXHA 5G1PA 3HXKA 1EXVA 4DLAA 2VK4A 2VXYA 1FYDA 1V4NA 3L0OA 3KAKA 3SEFA 4A2WA 4JL5A 4F4DA 4P80A 1ZL0A 3DLBA 3A1TA 4V38A 4R3NA 5T4EA 4B7UA 5JTUA 1M54A 2XBMA 4KO8A 3ZY5A 2G72A 3F7TA 1B8OA 4P3XA 1NOKA 1RWKA 2FPSA 1DFIA 3DDSA 4I1IA 3HMQA 5F1YA 5GWXA 3SHTA 4RMHA 5EPUA 3ZZ0A 5LZ4A 3I1FA 4NICA 4NVRA 3WWCA 3HB0A 4DC9A 2JI8A 2HU2A 2P65A 2C29D 2O6HA 2X0FA 3K5HA 1KZYC 1YR1A 3C6YA 4CM4A 4JUIA 1GZSA 3A32A 5FBHA 1WXQA 3CEHA 3G82C 1LFAA 1YJBA 2QZJA 2BN4A 1QTNA 5DWDA 5BQOA 3QUCA 1A69A 2VK8A 4Q3OA 1FFGA 4KJZA 1JHOA 1MD9A 3BXFA 1XP5A 1JFSA 1KZ1A 2Z5GA 5EN4A 1JVBA 1K98A 3M1LA 1FNBA 4E32A 4AP9A 1KVTA 1JH8A 3G8AA 4G25A 1UPAA 2E89A 2B30A 4ZCTA 4S3MA 2X15A 1JQEA 4K5QA 3QMPA 4XZ3A 1GL9B 2X6RA 3OEHA 3P52A 1IJFA 3IDFA 4KVZA 5CMLA 2HY7A 3C48A 3CH5A 2IBTA 2WVHA 3UQZA 1U8UA 5EJ4A 1ORHA 4MIYA 1V8PA 4ENRA 1TJ5A 4UAGA 4X8HA 5LQDA 3VOTA 2RARA 3HJCA 4D99A 1BIFA 1OI3A 1ZNWA 2FDRA 4WD3A 3KR2A 1IM8A 2ECOA 4V39A 2IXDA 3PXEA 3VBEA 5FBVB 1R4MB 3TLCA 1TQHA 4MQLA 4CT5A 4Q18A 1Z22A 3D1VA 2BPOA 3ZJVA 2JS7A 2VDQB 4EJ2A 4TWIA 1YHZA 4BQFA 2GPNA 1AG9A 1PWYE 3G2LA 3K8QA 3LVBA 5LIRA 1QSGA 2C9CA 2E1PA 4NAHA 4J94A 1CULC 4RTKA 2DQKA 2ZM5A 3G6KA 4DLUA 4PAGA 2G76A 4DG8A 4L28A 2UXDB 5L3ZA 2SCUA 2Z8YA 3WRXC 4FYVA 4LUCA 4IOMA 4ZCLA 1D6JA 3BBPA 3L5OA 5HZHA 3BWMA 4MV3A 5CHEA 2FW7A 3C6KA 4JQSA 1RWXA 2GDJA 2LZ0A 4D41A 1AMNA 4C5CA 1BXZA 5AW6A 4QDKA 4H17A 4KLRA 2EP7A 4ZYYA 3G8CA 4ZDWA 2PBRA 2IIBA 3MD0A 4FD2A 5DWQA 3D54D 3CRMA 4DZTA 1P17A 1VLMA 2JFNA 2WT4A 4HDSB 3T7SA 1JXAA 4N40A 4C7BA 4NYJQ 3WLOA 5GAJA 5E0OA 3HEAA 5C8YA 3VJRA 2NYAA 3E23A 3WJAA 4JA0A 4M1YA 2V5VA 4NCJA 4A73A 2DBVO 3PDWA 1UKEA 4XE5A 4EQ6B 2WDPA 5EPEA 5LYJA 1Q22A 3GJXC 5CDUA 4UE6A 4MUYA 1VSQA 4UU7A 5HZMA 1GPNA 4Q1FA 4JYCA 4B6RA 1UJCA 4ESEA 4FU0A 1BO6A 3K20A 1QF6A 1VL6A 4N0QA 3BL5A 4U2CA 3KJQA 1M8PA 3W8FA 4MEBA 1MTOA 3T5CA 1X42A 1G21B 1YQTA 3ENVA 3PFCA 1MNAA 3P27A 2Z04A 4ND8B 5B3JA 5F5NA 2JCVA 4C03A 2FZGA 2YC2C 4HYTA 5LOVA 3KWFA 5KNCH 3EMKA 3BQ9A 2M6SA 2LR0A 1AV6A 2RHHA 3F3MA 4H16A 3LYHA 2ZJ0A 5B3AA 1GKKA 3WYDA 4QU9A 2Z58A 3OX1A 4LCJA 3IUSA 2R4TA 5D5QA 2FR1A 1IXKA 4P5EA 1VIVA 5AI8A 2XNDD 3ORQA 1V4VA 1O54A 1O9GA 1WCXA 2W6JD 3I12A 4UEJA 1SUWA 2JLSA 2W7TA 1U0HC 2JZNA 4BVAA 4G81A 1CR2A 1T5DX 2HFJA 4DKXA 5JAOA 4LJRA 1K5GA 1JSLA 1CUIA 3W0LB 2OCXA 1E61A 1JKJA 2VYNA 4RU1A 4ZC8A 1LBIA 3HO1A 2CXHA 3LF2A 4B75A 2RH8A 1Z0KA 3WLLA 5JD4A 4KHPB 1TCBA 2JGMA 4Q3DA 4RJ2A 5JRDS 3BRQA 3BYZA 1EX6A 4QDXA 1NMYA 2QAGA 4YT4A 4B6PA 4KUGA 3WQHA 2H11A 4AB1A 4D80A 2FWMX 1JE0A 3T7RA 5HP4A 4ZKEA 1PSZA 1RQRA 4BNWA 2BI4A 3REFA 4RA9A 4MGIR 5F21A 1M6EX 2IIQA 2GAAA 4Y1RB 3FGOA 1P9NA 5I9MA 3QLUC 3DTYA 2FE4A 1XD2B 4Y30A 3VUFA 2NT3A 5DEIA 1JEYA 2EQ5A 3I1JA 3RVJA 4KREA 4L8FA 2EJBA 2AJBA 3KDSE 2R96A 3A0UA 4QFBA 3VPFA 4OQEA 3PIIA 2PQMA 4AZVA 3CUUA 5FUMA 1DX6A 3FIJA 1KZ4A 1P81A 3AYXB 4LJ8A 2MSWA 2A1UA 4BX8A 1FYWA 3F90A 5JYCA 1NJ6A 1PR9A 2IP1A 2GO7A 1GUAA 3OTIA 4HFRA 1C7JA 5FOSA 5K0ZA 5CITA 1M73E 2BP7A 1SU7A 2DUMA 2FN7A 3FNHA 2H4XA 3O2JA 3UH0A 2Z6QA 1MRNA 3KQUA 4I55A 1YQGA 4HT3B 4UAJA 1C3XA 1MX5A 4OHRA 3T7JA 3BHNA 4B5LA 3ECSA 3GGGA 1XCPA 3VNRA 4B8WA 5D2CA 1CE8B 4G8JA 4IGIA 1AKUA 2QTCA 1H5NA 1YR6A 4V0ME 5LSAA 3U19A 1H05A 4NYMR 2R11A 1VLQA 3IUJA 1T5SA 3D5TA 1KJ9A 4MVJA 4PR3A 3CMCO 2FPWA 1G9SA 4FKBA 4U6NA 2FRXA 3EEQA 3AUJB 2FSPA 1IK4A 3QV1A 4IICA 2BGNA 2ICAA 2RDMA 2B0JA 2GZMA 1QIDA 3P94A 4FDVA 5F77A 3RK1A 5KTOA 1C2TA 5ALYA 1BH6A 1YT5A 4B6SA 1ZCFA 4EKGA 1X1BA 4EFDA 3OIDA 1SB8A 4ZMRA 2BZ1A 1RRPA 1MC5A 4MMXB 1IQPA 3JVIA 4HJRA 5GJWC 4CLEA 2HGZA 1H8EA 2GBLA 2P9ZA 5L3QA 2C3PA 1EHYA 3AVPA 3QKRA 4FOOA 4RDXA 2IYZA 5A03A 3AB8A 3HV2A 2P9EA 1SKMA 2BHRA 4ZAWA 5LQSA 2F1IA 2VDNB 2ZB7A 3OIFA 5I7WA 10MHA 4QJIA 3AEQB 3PUYA 5C32A 3NDBB 2D7CA 4JKIA 2NXEA 1E1QA 3ZVKA 1HQCA 3PE3A 2JFOA 4EYEA 3GGPA 2DECA 4JVMA 1HE5A 1KQNA 1RWBA 4BRSA 3QA9A 1PK9A 4JR0A 4G41A 1N57A 2C5HA 5L7YA 2IU0A 2ZS9A 4P4TA 2O7QA 3X2SA 2NVUA 4YJFB 4YDSA 2HXGA 5EXEA 2NV6A 3E3NA 4K9NA 3LY7A 3WYFA 4B6FA 1GM5A 4Z4FA 3KU1A 4M60A 5KOJA 3EXG2 3UV7A 2JJ2D 4MB2A 5CDSA 3L84A 3IE2A 3NMUF 3FNFA 1B0AA 3BERA 4AKTA 5DN6D 1S8NA 1JBQA 2YC4C 4FR0A 4KJXA 3THXA 3OE5A 2QTZA 2GEUA 3HCWA 2OC4A 1A8PA 1VDMA 1BGVA 1N9KA 1YZNA 1SVIA 4HRYA 2CJXA 2F90A 3WAGA 1IBMB 1EWTA 5KYGA 1LW7A 2GHRA 1QQ5A 4YJGB 2O1SA 3FG9A 1RM0A 3U26A 5A3SA 4FBMA 5CJ2A 4RY9A 2GYYA 2F6RA 3LC0A 2C03A 1GTL1 4WDQA 2VEOA 1CQIA 2FH5B 3P4XA 4P3NA 4AICA 4W5QA 1W48A 5KEIA 3DEHA 1CIJA 1E96A 2B1IA 2XODA 1TX4B 1QDEA 2ZLBA 5HQJA 4EW6A 4EVQA 2HLNA 3X2FA 3GAMA 3V1MA 1AQNA 1BX0A 3NALA 1X7YA 1QUFA 4Z4CA 1JPUA 1ZOSA 1U3FA 3B85A 4AYXA 4B3HA 4YO7A 1E5XA 3FOEC 1UBOS 4A0SA 3NVKI 2D0PB 3QVSA 4QUGA 4HB2A 1PNRA 2VBGA 3EC2A 2NO9A 5JZ9A 2O8CA 2C3UA 1FK8A 1A9PA 1ZLYA 2I2BA 4MWCA 4NH0A 1NDUA 1ZO8A 2FGJA 2WYIA 2ZBPA 3E61A 2HWUA 3OFVA 4J9VA 2ACVA 3GDFA 3LTNC 4LZWA 3FVQA 3JAWA 2IITA 1WOYA 1L5NA 2H3EA 1RSZA 2QL7A 2PG3A 1FQWA 5CA0A 3P9KA 2CXNA 2ODTX 4GRDA 4E7OA 1MW8X 1R12A 1Z26A 2I78A 3DOOA 4RHTA 3AEXA 5HRUA 4RTLA 5IUKC 2Z2XA 4S1NA 2ZJOA 1JDUA 4XYGA 4WINA 5EJFA 4QM7A 4K8OA 1IZ8A 3VR4H 4MQFB 3KDPA 4CKCB 1XMSA 1JHAA 2OUIA 1QIMA 1ONBA 3JD3A 5M04A 1HT2E 1UOQA 1F8YA 4E14A 1ESNA 3SVLA 2EW8A 2H65A 5HM6A 3EOZA 4EDFA 2DLCX 1DC4A 1DINA 5FPQA 3HG7A 1YUMA 3AJAA 1T2UA 1LPAB 1XQ9A 4PLGA 3IJRA 4HEJA 2PD4A 3DMDA 2P27A 3BJRA 5E6RA 5KS2A 2ALJA 1L5QA 4U7GA 4ZCIA 5IBCA 3II6X 4AN1A 1ZIDA 1Y4ZA 4HZUA 2PYIA 3RIHA 1Q1QA 4K6OA 1GRQA 3QQPA 3V4FA 3VR6A 3DHWC 3JARA 4YDRA 4JJGA 3S5JA 3SLKA 4IH1A 4JEHA 4C0LA 4X44A 1XQXA 3ZGOA 7REQA 2MCFA 3UXHA 5I01A 3I6IA 2VJBA 3MUFA 1E2FA 1UBMS 4AY5A 1BROA 3B1YA 3FMFA 2XZLA 2Q99A 3RO7A 1JDVA 5DBHX 3WSTA 4YH1A 1P3Y1 4O2BB 1NC3A 2J5KA 3I04A 1WPGA 2CHFA 2W2QA 4FXPA 4Y6QA 1PU2A 3LT0A 3SI7A 1UBNA 4IQ4A 3ZZ1A 3HB1A 5C4GB 1DCFA 4TQAA 3TYXA 1T3SA 4WZAB 2JHCA 5KAPA 4RNDB 1Z5NA 4F8YA 2GZDA 2LDXA 1F17A 3RYFB 1J8FA 5JRJA 1Z68A 3ZY6A 1WBBA 4ZQCB 1MGOA 1XTJA 3EHDA 1R8JA 3EZ2A 1QTRA 4YRDA 1ESEA 2YZ2A 3P0EA 4KODA 5EUBA 3SX4A 4U7DA 1WMAA 3FZEA 4KGDA 3I9FA 4BGUA 3A6PC 4TTPA 3SF0A 1CLEA 2J4DA 3OOEA 1V8ZA 1XTZA 3PXBA 1NYTA 1E2KA 1FJHA 1VHTA 3CLSD 5FI0B 5P21A 5BOSB 3KJGA 3ZGYA 2XITA 3VH2A 4UFPA 1JZSA 4FBGA 5KC9A 3PLAE 1AC5A 3B6MA 2IPNA 4PS0A 3TW8B 3VDXA 2CKMA 4D3ZA 4PWZA 2FLKA 3PXXA 1OSNA 3O74A 4WFJA 5TQJA 1QE3A 2XVYA 4GRAA 2IY8A 1HE1C 1ZJWA 4LJ7A 2AC4A 4RE6A 4B7AA 3D6HA 2QVBA 2G04A 2QZ4A 3DEAA 1N1DA 2PKQO 2ZRQA 3H9JA 3R6GA 4IFEA 4QQ8A 4PBRA 3UWDA 3IGFA 4FWTA 3ECCA 1TPZA 4M87A 4O2BF 3ZI7A 1EE2A 2AI3A 4IRMA 2GWHA 4UTOA 4WLNA 3PWZA 3P20A 1DEXA 3U4CA 1RYDA 5FPTA 3OHPA 4NWIA 4YQFA 2VQEB 4LDQA 3FHCB 1Q1GA 4PYJA 5L6LB 4WTOA 2PR2A 3JVVA 2DX7A 5TMEA 3RCBA 3JRNA 3S2UA 4CW7A 4DCTA 2ZVQX 2YYYA 7ADHA 2RKOA 3FWKA 3TEMA 3UHAA 2V9ZA 4L0QA 5DLEA 4H6PA 1BVUA 2VPTA 3IV6A 1C0LA 4BWYA 3ANTA 4Q4AA 5CIQA 5JANA 3Q12A 2HHLA 4QNMA 3REQB 1EFDN 2ZJ6A 3L6OO 1UMDB 4K05A 4R5MA 2BFWA 1FQKA 1P2GA 1EWYA 3DLCA 2I7VA 1IPFA 4JUCA 5BP7A 3AL0C 5IWAB 2HWKA 2W00A 4IDBA 4EYKA 1IXRC 1XL1A 2DCUA 3L7OA 2ZYRA 2IF2A 2ZU6A 2JJ1D 1BD3A 4YRQA 2OXCA 2E4UA 2G67A 2CVQA 4JI7B 4CFYA 5DHFA 3WWYA 5AKZA 4B46A 1KYQA 2XYPA 3L7DA 3NPAA 3MFYA 3BA1A 2B3TA 4YTEA 3WB1A 4C4TA 1W8DA 1JGTA 2AHOA 2WPNA 1P7YA 3JWEA 3OTGA 1D6NA 3PENA 4DLZA 4R2LA 4B0OA 2W43A 5CA1F 2PV7A 4TYWA 2G8NA 4J0CA 3B6IA 3E82A 3RIEA 1C3OB 1RQXA 4JMPA 3JQCA 4BO7A 2IP2A 1VP3A 4J1TA 4V0RA 3BE6A 1DDIA 3D6VA 4FJ1A 4NS4A 3RH0A 2ISQA 4EOGA 1XTTA 4ND5A 1RYYA 5L4SA 3HDTA 3KYCB 1ZRSA 3MWEA 1W29A 2O50A 3Q88A 1L5GB 2UUOA 4Z4EA 1B1CA 2I80A 3PEEA 3U56A 3FDZB 1U94A 2BHSA 3I9MA 4RXUA 2FWRA 2QRVB 3HO8A 4WCFC 2OV8A 1N6HA 1YTLA 1IFXA 2QS9A 1DJNA 3LX4A 3OP1A 4G2TA 2VTVA 4XWYA 1H9CA 4OHBA 3CY6A 1G0NA 2G9VA 5FOXA 1W76A 2IYLD 2KYRA 2C0PA 5REQA 2JRLA 3F8SA 1YB5A 1GUFA 1KF0A 1P9OA 1QV7A 5DSTA 1Z7BA 1T2NA 4ZHQB 4JI5B 2HADA 3OSUA 3S2EA 1ISHA 2P9GA 1KQ3A 4BO8A 3KLBA 4I4IA 3VR1A 4JC5A 2VHJA 4KVFA 2NAFA 2LE0A 4ZGBA 5AM4A 3S7ZA 4CG2A 4LW8A 1E79D 4ZOCA 1BFDA 1ABBA 2AHRA 5FR1A 3I83A 2ZUBA 2HUPA 2RK4A 1FF9A 3CUSA 5FLXA 4ALJA 2LCIA 3GZTB 3HKBB 2HN9A 3HR4A 3MMXA 1Z38A 5EMLA 3RS2A 2V3WA 1LTKA 1Q0QA 4EZBA 2HWYA 1DZ3A 1C4XA 3L77A 4FJ0A 4ZKDA 4CEHB 4KVGA 2O0LA 1MV5A 4FZJA 4TTQA 2AJLI 4KIJA 3CXRA 5JJIA 3SBEA 2B2NA 1X19A 1C3VA 5GQSA 5HXAA 1RHJA 2UVPA 4J49A 4K3VA 4X1IA 4B1FA 2ANCA 3P4UA 4Z9YA 4FDAA 4ZU6X 1T9GS 1LX7A 2Z2YA 4NMWA 1QB8A 1UK6A 3PUKA 1OCEA 4M0UA 2YYZA 3FWNA 3Q3EA 4JDPA 1SBHA 3HACA 4H35A 2DUWA 4URUR 5H4HA 1DJLA 5K01A 4KTTE 1VPVA 1X87A 2C4TA 2F17A 2Q8PA 3E5MA 2C31A 4YXWA 4C30A 3SD7A 4MAAA 4AF8A 5EGSA 4YJHB 4ZVOA 2FFBA 5LR6A 3SU8A 3TM4A 4ZHQF 5LP6F 3C8UA 4ROTA 3L7MA 2A1IA 4H6XA 2FP3A 3FNRA 4K9OA 2WF6A 3M1IA 1JWAB 3TX2A 4IP0A 3W6OA 3P1JA 2VWPA 1EXNA 2M1XA 2XJ4A 2PHZA 2PZFA 4X6UA 1IDOA 5HMLA 4DXAA 4DE5A 1BMFA 2E48A 1ECGA 3EEFA 1LWOA 4Q3EA 1JMVA 3W9SA 4BBJA 3LKDA 4IYRA 2IYNA 3LD9A 3SFVA 3P9RA 3PQDA 3IIEA 2Y2UA 5EINA 5G02A 1TUBA 2CB0A 4L5IA 1OYOA 1PVDA 4H1UA 3VI4B 3UT6A 4BECA 1IBKB 2Y66A 1Z6XA 1ZIXA 2IHUA 2V1XA 2VK2A 3OTQA 4F5EA 5CYGA 4HGPA 1XMQB 3H7AA 3N2EA 3ND9A 4RF3A 2HHCA 1GN8A 1ZJ4A 1QJCA 2ZIGA 5AVJA 2PM8A 3TLMA 2HNBA 4E2FA 2E4YA 5LMUB 2RGNC 2Z9DA 3BKXA 4QDOA 3WHIA 3WP0A 5H83A 2HHJA 5FQOA 2PVPA 5AXCA 1YDHA 2YJNA 3EFHA 5H80A 1MQSA 1V43A 4JMLA 4Y67A 3HJGA 4YV7A 1YA4A 2I3ZA 4Z4HA 4PYRA 4J6FA 3HSKA 5HIIA 4QASA 1UF9A 3GLSA 4GLOA 2HKIA 3RSHA 4TMXA 5ADHA 3L3BA 4Q12A 1GLVA 2WR8A 3TR0A 2QNRA 2G40A 4GLLA 4DC1A 5D51S 4M1EA 3IUQA 2GKSA 3OJCA 3F3KA 4Z0PA 4AMYA 4BB5A 3P97A 1L8LA 4GDFA 4AJJA 3GD5A 3BL8A 5MFPA 1EGMB 1ZJ5A 3OETA 2AYXA 1GDHA 4Z0NA 3BXPA 2BFCA 1KI2A 1SVNA 1DLIA 5DHPA 1TVMA 2AOXA 4R69A 1RXWA 5A4DA 2DKFA 2E6KA 3CFYA 1RI2A 3C3AA 2ZK7A 3GJYA 4JI1B 5FOQA 2A1TR 4GFDA 1LKZA 4C1BA 4KVAA 1G6Q1 2BHNA 1RJ9B 4WA7A 1M1NB 4RANA 4M3NA 1R5OA 2H2WA 4WZ6A 3WHPA 1UJMA 1NBME 3FMPB 4YLGA 2NMVA 3DEFA 4O1MA 3TFQA 1RPJA 4WADA 2J4CA 2FLWA 3AVOA 4KP7A 4ZI5A 4OXIA 5KSZA 3C6ZA 4BN0A 1I01A 3HFSA 5AICA 5D5PA 2X13A 4D3SA 4FZ3A 4JZYA 5BPHA 2YOFA 3QUSA 4NC9A 4RZSA 1QGUB 3MT7A 3O9ZA 1GEEA 2VUHB 3K1AA 3OM9A 2FXIA 1LB1B 2ADFA 4GR9A 4MGZR 3RRJA 3U4HA 5ICGA 1Y8AA 1R4AA 1F2TB 2FZLA 4HXEB 5HE8A 2R65A 3SHQA 1IY2A 5CCXA 2G07A 3IE1A 1BSVA 2OB2A 4KWIA 4I8IA 2Y9MB 2ZJ3A 1LNQA 2RHCA 5DLDA 4A1OA 5KTYA 3A4VA 4OMCA 3OEHD 1YC5A 2NZ2A 3FSJX 1WV0A 1R64A 3CKLA 4BDSA 2XXAB 3RI3A 4FLFA 3U2QA 3GEBA 4Q3BA 2CLSA 4R3WA 2GEVA 4CGYA 4ARZB 4KAJA 1XZEA 4GLJA 4V0QA 4UDOA 5TC4A 1FS6A 1SC4A 2ZJ1A 3C7CB 3NDJA 5E4JA 4NHOA 2HV8A 5EOVA 2Y3IA 5A3QA 5JUWA 1D4OA 2PX0A 1GILA 1RFLA 4QUKA 2QQ0A 2XYVA 2YY6A 3DDNA 3L8CA 3WKCA 1NSFA 4BJ6A 5T3YA 4OEHA 1X92A 1RXCA 2NZXA 3HA7A 5CT9A 1GR1A 3FPFA 5DE3A 4EKIA 3OKAA 3SIWA 3RT1A 4JVOA 3BGOS 1OVMA 2VCYA 4JD5A 4KPGA 3DL0A 1CW2B 4MS1B 5AK5A 4X64B 2XB9A 3HM2A 4CLRA 4OK3A 1ZU5A 1CCWA 2RCNA 4H31A 1M72A 3SGLA 1MO6A 4JI0B 4MO2A 4CETA 3GUZA 3UK0A 2O3UA 1UUFA 2QTNA 3H5RA 4FZRA 1Z6GA 4QNRA 2LWIA 4Q7KA 4R5HA 5JR3A 5KTMA 3T3HA 4WGGA 4I9NA 1QMPA 3IKJA 1BRMA 2QENA 1P4SA 3KHKA 4IF4A 5DBFA 3WBBA 2PANA 2X8BA 4OH7A 3VDRA 1YRYE 1HA3A 4DCPA 2PBZA 3R3UA 3QENA 1N2EA 3OIGA 3DAPA 3H17A 3K96A 3EIFA 2P6UA 5E1OA 5JQGA 1G38A 1M6VB 1E3SA 3ZXYA 1R4MA 1Z8HA 4UVGA 3AUUA 4G8DA 1HLDA 4P0QB 3NIFB 1CV2A 2RHDA 1H8HD 1JJAA 2PKEA 2WNIA 3B1VA 2ZYWX 3BIFA 4W5WA 3WFZA 4ZVKA 4ARSA 4PN7A 4UOQA 2CT8A 1G7TA 3GP3A 3K6JA 2CDBA 3UJPA 5KJFA 1NZDA 2B83A 2JKVA 3FRJA 3OPXA 4ZGWA 4U9IS 4A7PA 5ADVA 2F8SA 2OGUA 4QXRA 2G1PA 1N5RA 1BDMA 2E87A 2ZI3A 4AD8A 1PYDA 4X85A 4D44A 2F55A 3ZLBA 1ESDA 3MJ4A 4MAMA 3QSYA 1NA5A 2RGUA 4NBUA 2ZYHA 2OYRA 2BMAA 5DTJA 1IG0A 1ZRMA 4F5YA 2OCKA 3FETA 4HF7A 5FTJA 1ILWA 4HDRB 4HHEA 2EZ4A 2Y1LA 3AP2A 3GFQA 3NC0C 3TD2A 1UJ5A 1UC5B 1VSBA 3UZUA 3SXUB 1UEIA 3CPJB 2XRYA 4CKZA 1U9JA 1MXFA 3DUWA 2R6ZA 4UUQA 4G4IA 1U8ZA 2IYPA 5DBGA 2W4MA 3ZCQA 3N86A 1WMDA 1ZOPA 2WI8A 5JBNA 3X43A 4EJMA 4NXNB 4XM2A 4EHKA 2G80A 3AYZB 1ACMA 3OF5A 3T3NA 3GNTA 4NJMB 1H66A 2VNSA 3HRHA 4FJ2A 5DH9A 3V80A 1N3IA 3THWB 3N5KA 3HFJA 4DLWA 4GICA 1BU5A 4U00A 2WU4A 4IIVA 4WN9B 1C8BA 1BWPA 1P0FA 4PHTA 4MICA 4XVRA 2XQJA 3UWOA 2A57A 2GM3A 3WGHA 1VSVA 3CINA 1UH5A 1N2ZA 2HTFA 3ZWKA 3ACCA 7ABPA 5COAA 3G5UA 3TZEA 2ZU0C 2RE8A 1Q3KA 5I9LA 3BCUA 5DP2A 5C81A 1Q1ZA 3NNNA 1EP9A 1XKXA 1UC4B 2B36A 2Q5FA 3ETNA 1OJ7A 2CVPA 2VYND 4KDFA 1WXWA 3VHLB 3W9UA 2X14A 4JP3A 2AF4C 3ZDBA 4FGLA 3U4IA 1ZZGA 3EE6A 4DFDA 4DQKA 2BELA 2DTEA 2ODNA 2CXOA 2DUJA 5AOVA 4AJNA 3NOQA 4MVXA 4HAYA 4BFVA 3VH3A 1U4SA 1C3LA 4GYJA 1SUBA 2VFAA 2Q4EA 4P81A 2XRFA 1F1JA 3UEOA 4F21A 4L9AA 5CRIA 4I2VA 5EIOA 2HA6A 1RXSA 1AUXA 3DBLA 5F5XA 3I37X 4I2NA 1KAMA 2NVBA 3O26A 4LIPD 1TM1E 1CP2A 3M2TA 3Q7QA 4BFUA 1G5IA 4JEUA 3BD8A 2MR5A 1LPBB 3AJ8A 2MJLA 2RIPA 3JWJA 4ZJUA 3FYHA 1E92A 1T3GA 5HTOA 3A28A 4JUAA 3WYBA 2V96A 5JSZB 4O1HA 4OYLA 1WZ2A 2HD4A 5EJEA 1W94A 3RRBA 4NMLA 2AN1A 4FYJA 2HI0A 3MTDA 3WQSB 4C4YA 1JMYA 2JGDA 4Y0VA 5EUMA 1O8CA 4HNUA 4UVEA 2GHQA 2IXBA 2VHXA 2DPYA 1DADA 3CB2A 2IOHA 2XT6A 4FD3A 3GAFA 1CJCA 4BWVA 1C14A 4UBOA 4DF3A 3EXEB 4G1EB 1IIBA 4FMDB 2ZWIA 1SCIA 3OO1A 4HYQA 4FYYA 2XH8A 1XAHA 2GAIA 3TXAA 1IQUA 3ZU3A 1G66A 3IDSA 5CB4B 1DAPA 1K8RA 1PL0A 3H5WA 4OHKA 3ICVA 1CHDA 2G36A 3SICE 1T1RA 4E5MA 1CT9A 1GU7A 1I4DD 3HQ4O 4MVJD 5CHYA 5FPSA 3X1YA 2WD7B 3X1ZA 4NK5A 5J2TB 3CCCA 3K0SA 1P9RA 1EP2B 3A31A 3CH4B 4FOLA 3WLEA 2UYHA 3L6EA 2JAPA 1U9YA 3KL4A 3F6PA 3G7UA 4EI8A 2D2XA 2Z1NA 1NWCA 4XGRA 5FAXA 4FILA 3UCFA 2QX9A 4KFCA 1JYSA 1GPJA 3S4YA 5LKRA 2J3HA 4CQLB 4Q37A 3F6EX 2LNDA 4MGKR 1UKAA 1EDEA 4LCBA 5ALVA 2G63A 4N0MA 1H8ED 3THYB 1K0FA 2CNKA 4IDQA 3IHTA 3OVMA 1TF7A 5EE1A 5BMVB 2AG5A 1I7LA 4WOJA 2DQSA 2YS6A 3L7AA 3WKAA 1JFTA 2UVDA 1UOEA 4TMFA 1NNSA 3D3NA 2ACEA 3KUKA 1JG7A 1EX1A 1YK0A 1YE5A 5CYPA 2RGWA 3DSRA 2Q4BA 3ETCA 3R0VA 3IP3A 4Z7JA 1Z29A 3WQQA 5DLQC 3V3TA 1E1QD 5D84A 2COKA 5AYVA 1ZFNA 5KC8A 2BFBB 4RK0A 3SYTA 4BBZA 1MDBA 1RS0A 1S3SA 1T4DA 3HE3A 4XUGB 3G0IA 5LQUA 4RSMA 4F97A 3TG8A 1L5OA 4ZAZA 1AHPA 1NVWQ 1NU8A 1U5CA 3UXMA 5CB4F 3GVIA 2V4MA 1NU6A 2VLBA 3O2NA 4HDMA 1ZGHA 2PLAA 2Q9BA 3EA4A 5AKKA 3ESQA 3OU6A 1IQRA 4R2KA 2HNAA 3RVOA 3LL4A 5J2TF 3V4ZA 2HZ7A 1KEEA 3GJRA 1X38A 2XB2A 1Q3TA 5DHTA 1P33A 3AVQA 1Y1LA 1LS1A 4HQRA 4B0PA 1UL1X 2E2WA 2G83A 5DDIP 1OIXA 2D62A 3RVQA 3Q8MA 4B48A 2CVFA 1YIAA 3NYRA 4DJ5X 4BVFA 1BHO1 3NNDA 1Y8RB 1G5QA 3BXOA 5JO9A 4LAFA 3O8OB 1V3QE 1WQ1R 1KP2A 3PHCA 4GGPA 4TT8A 5EIBC 2BRUA 2HF8A 2Z1DA 1YVPA 1U0OC 2JVJA 1I8TA 1JQBA 3T34A 2J6IA 3AU9A 5BMVF 4YNBA 1W44A 2O20A 5GPBA 3C3JA 4IUBS 2EL7A 1E18A 4XI9A 2EFCB 1KL7A 5YASA 1MMFB 3QE2A 5F73A 4YCBA 4F72A 1CIVA 2HSWA 3O90A 4D9BA 3P2MA 4DL9A 2J9FB 1LTQA 3RHTA 2XIJA 5KMGA 2RBKA 1J0EA 3NUQA 1WM1A 5C31A 4IGFA 4I08A 4OI0A 1PR4A 3VYWA 3AGQA 1CB7A 5ALOA 4NNPA 3M5CA 4LYEA 1G8KA 1W73A 3FB4A 4R8LA 1IMOA 2MYUA 5AHOA 3VKWA 1DJQA 2O8FB 1N0VC 3SX0A 1P73A 1GZ7A 1M1YB 1ULAA 3PYXA 4TSRA 4WT7A 4YEDA 4W63A 4C0SA 4EARA 5CB8A 1JR2A 3IO3A 1BGXT 1KJIA 1JR6A 3T0GA 5IXJA 1T29A 3SJAA 3AFIA 3MJDA 4CF3A 3L43A 4LRSB 4E3WA 4Y2JA 4XLTA 3ZVMA 1AK2A 3L0ZA 3QVWA 1GTVA 4PC7A 1Q0PA 4O0LA 4AMUA 3C3KA 3KCNA 3W9BA 5C18A 4WH0A 3TM5A 4UE2A 3SZOA 4CV2A 3PQFA 2HTEA 5K6RA 1GY8A 3C98A 3TD9A 2OCLA 5JWRA 3L07A 3U7EB 3DLIA 2D1QA 5LC1A 4F06A 4GU5A 4WSOA 2P2SA 2PO5A 3BBLA 3WG9A 3KJIA 4ENWA 4IX9A 2NACA 4MVYA 3AF3A 5CLFA 3UKOA 1A88A 2I2XB 3LPNA 3FNGA 3V55A 1EFAA 1I5RA 4TLDA 4HDOB 3G23A 5KKCA 2EERA 2F67A 3KYBA 3G7SA 3RVKA 3AOEA 4M0KA 3DT8A 1QK4A 4M7OA 1CJBA 1UPFA 2QM0A 3ANNA 3GPCA 3OIWA 1Z5GA 3OMXA 4GE0A 3BB3A 4J4TA 1I4LD 4LVUA 2D5IA 4UE3S 3AUAA 3FI9A 3L4BC 1AMOA 4I3FA 2Z6UA 1IYZA 1GNSA 2QUAA 2CXPA 3PG5A 3VZDA 1E2EA 1R16A 1J1IA 1F20A 2CDNA 1KO5A 1P5HA 2IHVA 1JIKA 2IZ5A 3BZUA 3CX8A 3NHLA 4HBGA 5HOEA 3E2PA 4IPTA 1SG6A 5ULLA 1YF3A 1M8FA 2V7UA 4D96A 4S35A 1JKIA 3BSYA 3KKOA 3NOXA 2QN7A 3PXDA 4G0YA 3LMKA 4RUKA 1LU9A 4IKOA 3VR6D 2B1RA 1ORWA 3ODPA 3K6KA 4R8MA 3IDZA 2BF7A 1M2HA 3B6KA 3KZKA 2QDXA 2GEDA 2Q8QA 3GPLA 3KNZA 2GXUA 2ZJ5A 3TH5A 4GMKA 1EFUA 4ZAXA 4WBNB 2JJYA 3TTSA 4AYTA 1LSOA 2ODWA 1RRGA 5H81A 3R6LA 3VHXB 5AVXA 3BJIC 2H9IA 4QOIA 4I9GA 2O3TA 3EEYA 1CVRA 2AA3A 1UXGA 4HWPA 2OFFA 2FZKA 4B71A 5B4VA 1WDWB 4MS3A 3TMYA 1QFZA 1QO9A 2GLUA 4E21A 5LDGA 1ZD5A 3KV1A 4UNRA 2PFGA 2QTRA 2FMIA 3GA5A 4P4SB 2B92A 3DKIA 4RJLA 2LCQA 3SQDA 5I8WA 1J39A 5BUQA 4J0IA 4DSTA 3Q10A 2WJAA 1GL7A 4NRDA 1E9BA 3FDXA 3PFNA 3IPAA 1UT6A 1UPTA 2F48A 2H07A 2PXHA 2V58A 2YXBA 3AQ4A 4RVOA 2QUZA 4CG1A 5A4MS 1P0IA 3HDJA 3NM5A 2WWRA 4AZ3A 2ATEA 1RNLA 3H05A 4TGLA 4CIAA 4NNJA 4F9GA 2H1VA 4O2BA 1OWOA 4I9UA 4RHFA 4D9NA 1ETUA 1XMPA 2JCYA 3QOYA 5C8XA 1TT5B 3ABQB 5ENZA 3LUGA 3W6UA 1ZVKA 3OEWA 2O1WA 2J7KA 3JZIA 4WZAA 1TZ2A 1UBFA 2RAUA 3WJ2A 4WBNF 1DDOA 2C7OA 3NYIA 4UM8B 2YW9A 2BM1A 5JARA 2ZSFA 2NPIA 2CV0A 4CEIA 1I32A 1N2JA 2VF4X 2FUCA 2WKWA 2X23A 2XUDA 5ESDA 1KEZA 2EBUA 4QLAA 4JV5B 2JARA 4LSMA 2W37A 1SXIA 2HU7A 3AX6A 1OJLA 4JELA 1KY4A 2H2FA 3B52X 3LUKA 3HZRA 4E88A 2OZLB 3TGPA 2PFSA 2W6QA 1II0A 1UKYA 4WCVA 5IK2A 5F7XA 4HQKA 4IIFA 1YCDA 3EEBA 3D02A 1QK5A 4DYHA 1B16A 4HB0A 3UPTA 3OCZA 1WB6A 1KKLA 3DWEX 5HIKA 1EK6A 3FHTA 3PCXA 1C0KA 1HYHA 1D7AA 3TW8A 2DLNA 1J2EA 4HX5A 1P2BA 2Q3FA 1DOZA 3ADOA 3PRJA 2ENUA 5JNTA 1PT5A 3C7DB 4RPJA 3STHA 5LMCA 3FNQA 4HDKB 4PX3A 3O1HB 5EHIA 3VAYA 3M4NA 4HR7A 4ISBA 5KBYA 4CM6A 1KFKB 3HLKA 2B1JA 2GAOA 1X7DA 2IPOA 5HKOA 1NF9A 3RD5A 3GARA 5G0SA 3WGMA 1HZZA 2VQDA 3R7FA 4UCFA 1PHRA 4H2DA 4HDCA 4RQBA 1X39A 3VPAA 2B21A 2AH5A 2I22A 5LQAA 4NQZA 3LS2A 3GJ6A 4ECAA 3QE4A 4M1QA 3R5KA 1PEYA 1DV2A 2WP0A 5J2UB 4OJNA 2NO5A 4GNKA 3N8KA 1O5TA 2R7LA 1XZHA 3ISTA 4YS6A 2P9HA 4CM7A 5K8UA 4NEGA 4KQCA 4C4RA 2GBFA 2HSJA 3NBYC 1UMDA 3IXQA 1T2VA 1CUDA 2QKYA 5TJ9A 3X1MA 4IDFA 5ITWA 3FCEA 3BAFA 3OZXA 3VMFA 4R1MA 1XQWA 2A59A 1DTSA 3LO8A 1C29B 2CHEA 3QYPA 3STWA 4F56A 5LLDA 3SM3A 3QMMA 1KH2A 2POQX 3DBRB 3MSXA 2A5YB 3DFIA 1QGZA 3FMVA 1NOJA 1U8XX 1FMTA 4KKVA 4ZYVA 5BW5A 5CFRA 3PEWA 3TQOA 3DOCA 3CVVA 3B1XA 3M3HA 3O8RA 2H48A 4YMIA 4H18A 4NZYA 1X6VA 3H6HA 3H2YA 1LPOA 2MDTA 1N0UA 2PRJA 1C3OA 4UW9A 4A26A 1OW3B 3UN1A 4WZZA 2O2HA 1C1DA 1SBQA 4ZOLA 3NKVA 1A4UA 2B7CA 2OBMA 2PWPA 1JKMA 2ZUCA 3KYCA 4LFAB 5FTNA 1QCYA 2W9XA 2GERA 1FEZA 3T0FA 4IIBA 4HFMA 1NJ8A 5J2UF 1Y5IA 1I1OA 1PFWA 2CMDA 2XUGA 3QOWA 1VLJA 3R8CA 3HCPA 2XMZA 4RZ3A 4EPXA 3EEOA 3KFVA 2ZRPA 1SMKA 4AUEA 3TMAA 2FOIA 3EXHC 4PYMA 4L7VA 3HYLA 4O4IA 1JLLA 2PZJA 3IPRA 4LE2A 1TU0A 1T6ZA 2B8NA 2HHHB 5HF6A 1KMMA 1J0CA 2GPSA 4X90A 1I6KA 2YW2A 4AQDA 4ZHQA 5JZOA 3STUA 3HKEB 2ESRA 3E9RA 4BLSA 5E4FA 2XE7A 4O4JA 4RF2A 5A4JA 2WZCA 2ZIWB 4GEKA 4AY4A 4DWOA 2P62A 1YFLA 4BHTA 2HIAA 4JUFA 1J22A 2FMKA 2ZR9A 3BILA 2AEMA 3LKBA 1JMKC 2FPUA 3UXEA 3ZIDA 4B47A 4GKKB 5HCIA 2XTNA 4BQSA 1FNDA 1TKCA 3AF6A 2P35A 3O7WA 2FNAA 1MVNA 1GGVA 5FJIA 3NTQA 1AM4D 5EP3A 4