5G4KA

Phloroglucinol reductase from clostridium sp. apo-form
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
264
structure length
264
Chain Sequence
b'MVNVKKEFVDNMFSVKGKVALVTGATGALGCVLSKAYGYAGAKVFMTGRNEKKLQALEAEFKAEGIDCAYGVADPADEAQVDAMITACVAQYGEVNILAVTHGFNKPQNILEQSVADWQYIMDTDCKSVYVVCKYVAQQMVDQGKGGKIVVVTSQRSKRGMAGYTGYCTSKGGADLMVSSMACDLSAKYGINVNSICPTVFRSDLTEWMFDPESAVYQNFLKREPIGRLAEPEDFVGYALFLSSDASNYITGANCDCSGGYLTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OXIDOREDUCTASE, SHORT CHAIN DEHYDROGENASE/REDUCTASE FAMILY P
molecule tags Oxidoreductase
source organism Clostridium sp.
publication title Biocatalytic Properties and Structural Analysis of Phloroglucinol Reductases.
pubmed doi rcsb
total genus 107
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2016-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5g4kA00
1DFIA 2FPPA 3WGQA 4E5KA 2I6TA 4UUMA 4GVXA 2JHFA 3SLKA 4CM5A 4IMRA 1LC0A 4O5OA 4KQXA 1ISGA 1DOHA 1PJCA 3OJ0A 3UUWA 2HMUA 4L4XA 3ICCA 4RF4A 3E48A 4BVAA 4NFYA 2F00A 3H9UA 2B69A 4YJDA 5CPBA 1XGKA 4TRJA 5AXAA 5KOIA 1FK8A 2HCTA 2Y05A 1JWBB 4TKMA 2EGGA 3K8ZA 3WJ7A 2YHIB 4XDYA 1O6ZA 3E9QA 2NQ8A 3UW3A 3I6QA 3ZWXA 2DBRA 2HMWA 4R69A 2RH8A 3PQFA 1M67A 4Y6SA 1E1MA 1ZNQO 3HFGA 4MP8A 1E3LA 1QRRA 1ZK1A 2FSSA 5H82A 3NT2A 5ITWA 1Q1NA 3OJLA 3DBVO 1YVEI 1L7EA 3HZZA 1I3LA 4UVDA 1ZSNA 4BOYA 1YDWA 2BGKA 5ICMA 2PGLA 1U7TA 4J6FA 4RPGA 4TSKA 5TT1A 4LN1A 3BMNB 1IPEA 4FS3A 4XGIA 2O7SA 3HWRA 3ITDA 3PZBA 5COBA 1HLPA 3U4IA 2CZCA 4GX5A 4F3YA 2YFQA 1GCUA 5H83A 4HX5A 4I5GA 4A10A 3HHPA 1YBAA 3LLSA 4E21A 1NFFA 4YJGA 1EQUA 3ZHBA 4HFMA 2P5UA 1T24A 2CNBA 4O1MA 1WMAA 1LRJA 3KO8A 2WYWA 1JA9A 2X8LA 1HZJA 3COSA 2QYTA 1LLQA 3BMQB 4ND2A 4TVBA 1OOEA 3PFWO 3QQPA 2YUTA 5AQ1A 3LC7O 1ZK4A 1DC3A 4M55A 4BNKA 4WNCA 1YKFA 1AXEA 3A28A 3FCOA 3GHHA 3RC1A 1DIRA 4CQLA 4L76A 4D42A 4F45A 4GWGA 3ANLA 1DJNA 5A9TA 4EJ0A 3CSDA 2ZYDA 3H9EO 2YDXA 4B4WA 1JU9A 1E7RA 3QWAA 2P4HX 1SCUA 2B5VA 3B1KA 3CMMA 5THQA 4J43A 4PG8A 1DO8A 2UYYA 3NJ4A 4R9RA 1TT5B 2VQ3A 2B37A 2O3UA 2FMUA 4K1LA 4WLUA 2IZZA 1DIGA 2W98A 2TMDA 4I9HA 1SC6A 2OORA 3JD1A 3ASVA 3OEYA 1EE2A 1PQPA 3ROPA 1H5QA 1X14A 1RM3A 1S7CA 4JIGA 3VPGA 2PZLA 3FNGA 1Z74A 5JCJA 1DIHA 4R01A 1U4SA 3PHJA 3RUDA 4BNFA 4YJHB 1WVGA 3FWZA 5F1OA 2Z95A 3PYMA 3JQGA 3CMCO 4IZHA 4BGIA 1HLDA 4PZEA 4D46A 4EGFA 1ZFNA 4YJHA 1C0PA 2C7GA 3RKUA 5F21A 3WXBA 2C5EA 2PK3A 1YOVA 2WTBA 4X54A 4WOKA 3QWHA 3PGXA 2SCUA 4B4OA 4KUGA 2FRDA 3ZWVA 2FN7A 1NTOA 2UDPA 1H6AA 3VPSA 1E7QA 1OC4A 5EJ2A 1U2DA 5KJFA 2W2LD 4XCVA 1DLIA 2J5KA 3HE3A 2JFFA 1ZBQA 3C7AA 2CF5A 2PTGA 2VWHA 4L4RA 4DGSA 5COQA 3B70A 4LMPA 5T64A 4CUJA 1WPQA 2OGUA 1UUFA 5DNAA 3BTVA 3V1YA 1U3UA 2CUKA 1OC2A 2VZ9A 1M66A 4M54A 4CM1A 4L75A 2TMGA 1O0SA 3PVZA 1CQJA 4DLLA 1MFPA 3GUYA 4CQLB 4HBGA 4K26A 2NTNA 4PVCA 3GDGA 3TNLA 4BB6A 3DDNA 4GMFA 2CD9A 4HP8A 4IUYA 3H4VA 3GR6A 4AJIA 1PIWA 3EW7A 1PJ4A 1VL6A 4BS9A 2I99A 5B4TA 3FR7A 4R1SA 4JCOA 5IDYA 2GYYA 1DEHA 3BZUA 3P5SA 4GWKA 4Y98A 1GL3A 2OXIA 1B8UA 3GAZA 1PGQA 3AK4A 4IIUA 1Y9AA 2VWQA 1K2WA 3QE3A 4J9UE 1I3NA 5ADHA 4J3FA 3W6ZA 1NPDA 3LYLA 3H9GA 1C3VA 4BGVA 5LC1A 5KKCA 3SLGA 3PJDA 3OH8A 4EZBA 1F8FA 3DONA 2FR0A 3GHYA 3HDJA 1U4OA 2ZCUA 1RYEA 1YO6A 4DTIA 5K0ZA 3DFUA 2AMFA 3GK3A 2IEBA 2A4KA 2ILTA 1OAAA 4J1TA 5JY1A 4IY1A 3ST7A 3H65A 4NZ9A 4RZIA 1BDMA 3H9JA 4II3A 4OM8A 4QSMA 2C2XA 2EW8A 4JK3A 2NACA 4CMEA 1R12A 2YHIA 4BL5A 5J23A 3EMKA 4L74A 1KC1A 1T2EA 1NXQA 3OIDA 5JAZA 4DPLA 1J4AA 3GGGA 3TN7A 3RVDA 1EVYA 4UEJA 1TT5A 1GAEO 2UV8A 2HK7A 2JHGA 2Y1OA 1ADFA 2WWRA 1QYDA 2WE8A 3ZWYA 3DHNA 1NQTA 3D1LA 2AHRA 4A73A 5BSFA 5CP8A 3IJRA 3JQ9A 5DBGA 4DQVA 1X7GA 2EERA 3IOYA 4IPTA 2ZTMA 1BGVA 2G1UA 1CWUA 3GVHA 4J49A 2X58A 1PGOA 4R1NA 4WEQA 3ULKA 4E13A 2AE2A 1HT0A 3BAZA 3MWEB 4QECA 4CMGA 4DQXA 3ROQA 1MA0A 5CDUA 3PQDA 1WDLA 3GPDG 3ZV3A 2XOXA 1Z45A 1WWKA 3LT4A 4D0RA 4U6SA 1VC2A 4LISA 3GUCA 5G0VA 1GQQA 1Y8QA 2FHSA 3P7MA 4HWKA 2LDXA 1E3SA 2EEZA 2VOJA 3VKUA 1YE3A 4CL8A 3SC6A 1VKOA 1Q0LA 4PZCA 5C7OO 5TJHA 2BMAA 3IUSA 4YJGB 3PRJA 1D4FA 4MO2A 4NJMA 2D0IA 2BH9A 3ZNPA 1X1EA 4IMPA 2HRBA 1V6AA 4XJSA 3EZLA 4WLEA 2GUGA 5DP1A 2NU8A 4E30A 3O9ZA 1DC5A 1HWYA 4BO7A 2EJVA 4BMVA 1H6DA 3GMDA 3W8FA 4UVGA 1P1JA 3F5QA 4AJ1A 1XG5A 3K30A 2X5KO 5C7IO 4QO7A 4MKZA 4W99A 1XHLA 1AE1A 3I83A 3WGOA 3PJGA 3DZGA 5EMHA 1YL5A 1C1DA 1EFKA 3DZKA 5DN9A 3A4VA 2VZ0A 1D1SA 1XU9A 3P2YA 4BKRA 3JQBC 4OXKA 3S55A 4OHUA 4RO0A 4PLVA 5IXSA 3AUAA 4MP3A 1GY8A 1Q0HA 3OQBA 3GZNB 1CEQA 2AEMA 2Q1WA 4UEKA 1UH5A 4RVSA 4DYVA 1E3JA 3T7EA 3KHUA 1N1EA 1OZAA 2VHYA 4CM9A 1HRDA 3V5NA 3KETA 3PHGA 1P9LA 2R6JA 3JYQA 2NNLD 3LU1A 3PEFA 4OAQA 2VRBA 2D2IA 4XRRA 3A9WA 4B3JA 1KETA 3GEDA 6LDHA 1NAIA 1T25A 4Q3DA 3I9JA 4R3NA 1HYHA 1U2GA 3CIFA 3WMXA 1CYDA 1H6BA 2C5AA 2DUUA 4DBVO 4BNIA 1UDAA 4RQUA 4WOJA 1G1AA 2IDZA 5BSEA 4FBGA 4KQWA 4ONEA 2DPGA 4PIVA 5I7EA 2O3JA 4CLHA 3S1LA 3D4OA 1E1KA 3HB4X 2EV9A 3PHHA 1H2BA 2OL4A 1NVMB 2PKRA 4M49A 4YWJA 4CV0A 1EBFA 4EYEA 1UZMA 2X22A 3PPIA 4MKRA 1ADGA 1G0NA 4D3SA 4CLOA 3JD4A 4WK6A 2ZKLA 2HDHA 2H6EA 1YH3A 4W4TA 2QW8A 1E7MA 3QVWA 4XYBA 4E31A 1W0CA 5IDQA 5CG2A 4JX8A 4F6LA 4J7UA 2YDYA 3L4BA 5U4QA 2GF2A 2E6UX 4HNGA 2Q1SA 4G65A 1MUUA 1ZH8A 5FYDA 1NHWA 4GMGA 5JYEA 1B2LA 3GFGA 3B1JA 2I66A 4R1UA 2EW2A 4ITUA 3X2EA 3GFBA 1E5QA 4QQRA 1B14A 2P4QA 1J5PA 4DL9A 1EE9A 3RAJA 4EBFA 1WLYA 4NK5A 3WGIA 4NFSA 4KWHA 3WBBA 4A7PA 1XYGA 2UUPA 3DAPA 1Z7EA 4JP2A 4UVEA 3DO5A 3KYBA 3VOSA 1E3WB 2AXQA 3F47A 1MV8A 1NFRA 3HJAA 1GEEA 3OSUA 1DIAA 3HSKA 4ZA2A 5CEEA 3RWBA 2UAGA 3RJ9A 5JSFA 4OOFA 3EVTA 3AY7A 3H3JA 4KTVE 1OI7A 1YGYA 3ZI0A 4O59O 1WZIA 4U6QA 4YRAA 3OECA 1Y7TA 3Q9NA 1DFHA 2I3GA 1YS4A 4NFHA 3ONEA 4JJGA 4P4GA 3RU7A 5JDCC 1PJTA 1SAYA 2OBNA 1KS9A 4PLHA 4R5MA 4PLYA 4GX1A 3KEOA 4WCFB 3HQ4O 1LJ8A 4ZQHA 4CMKA 2WD7A 3D3EA 1HL3A 3TRIA 2A9FA 4NQZA 3RASA 2H63A 1I8TA 3EUWA 1NNUA 4FPXA 4O63O 4O6VA 3SJUA 4NU5A 1NP3A 3OF2A 4BO1A 2Y0CA 3KYCA 3E18A 2D4AA 4DIBA 4CMBA 2BGLA 2W8ZA 2X1HA 3VDQA 2RIRA 3D3WB 1VE9A 3L6EA 4NJOA 5C37A 3U0BA 4N5LA 4UREA 4ZRNA 3KLPX 1ADBA 5I7SA 3FI9A 1JQBA 1PJSA 3MOIA 2ZB3A 3E6AA 1A27A 2WJPA 1J6UA 1AN9A 3KSUA 2V6GA 4HKTA 3WGGA 2VRCA 5DZSA 4LMRA 4PFJA 1R4MB 3SVTA 1PQUA 2O50A 1N2SA 4RLSA 5K6AC 1GR0A 1GQYA 3AI2A 3UKOA 3ZU3A 1M76A 4OO3A 1QYXA 2Y1EA 4MVJD 1O5IA 3U4CA 4EEZA 2Z1NA 3O4RA 2QQ5A 3LVFO 3R0IA 4YB8A 1XDWA 3RUIA 1RM5A 4Q3NA 5A1TA 5TSDA 1IULA 3HADA 2B5WA 5CDGA 1ZUD1 4UUPA 1FMCA 1N7GA 2FWMX 2X0JA 1GADO 2FPIA 1JVSA 2Q50A 4GBJA 4RF2A 5TF4A 5F1KA 2VHWA 4YAJA 2DFVA 1R15A 2AEFA 2GZ1A 2CVOA 4BNGA 4MOWA 2P68A 3AI3A 2JAPA 3LZ6A 5GZ1A 3RUCA 1SNYA 4HFJA 1PR3A 4CR6A 3X2FA 1D8AA 3ONFA 4XQEA 4A26A 3Q2IA 2DU8A 2A94A 4JN6B 1BVRA 2VUTA 3ADOA 4BNVA 2Y1DA 1Y8RB 3D64A 1RYDA 2O23A 4FFRA 5B4VA 3WYBA 4E0BA 3DC2A 1DIBA 4E5YA 4LSMA 3IL2A 2GZ3A 3QRWA 1I32A 2CFCA 2BFPA 1P0FA 5CHEA 1WW8A 2ZB8A 3K31A 3GEMA 4NPCA 3EZYA 1NWCA 3ROMA 5HWSA 5JDCA 2OZPA 1ZJZA 3V8BA 1U5CA 4EUEA 4GAEA 1PS8A 3GOHA 2E49A 4RCVA 3QA9A 3QVSA 4LVUA 3JQDA 4AJNA 3LDHA 3WFJA 3EAGA 3WNVA 4MVJE 2B83A 1CF2O 5I9NA 1ONOA 4IS3A 4D3DA 4B8WA 3MTGA 4CR7A 3F1LA 1DC6A 3RFVA 1K6JA 4R4JA 4XB1A 1EUDA 1E1NA 3JV7A 4IBOA 4CLDA 4FFNA 4E4YA 4JQCA 2UUOA 3PLRA 2RBEA 1EQ2A 4TZKA 4CPDA 3I9NA 4GSKA 4JJIA 3SX2A 4IDGA 5JBIA 2NU7A 3W8EA 1OMOA 4MVJM 3BHIA 5K9ZA 3Q0EA 4W9NC 3FF4A 1UZLA 2YV1A 4XGKA 3OA2A 3KVOA 1YWGO 5JC8A 2H5LA 4Z9FA 4CUKA 4AJEA 2NQTA 4RQTA 3G49A 4MVJH 3WICA 1N5DA 2V6MA 3M2TA 4ZN6A 3R1IA 4NDNE 4YAEA 1HE3A 3WDSA 2EWMA 1KVQA 1T4DA 2O3TA 5HA5A 1B16A 2O3RA 3KLMX 3UXYA 3N58A 4YDRA 1U9JA 3JQGB 4WEOA 1VJ1A 5MDHA 4GH5A 4AJLA 3C7DB 4EI2A 2ZJ0A 4MVJP 1DAOA 4URFA 4R51A 3VH3A 2BGMA 3IKTA 5CEJA 2CVZA 4W7IA 1PZGA 2GGSA 5DBIA 4N18A 5KWEA 4F6CA 2DTEA 1HKUA 4BNXA 5JDIA 2PY6A 3JQAA 3U09A 4CM8A 1YQXA 2BHLA 4B7UA 4Z0PA 4RL6A 1L1FA 3GY0A 1VPDA 1LRKA 3GVXA 4PLCA 3RUHA 4L9RA 2W90A 4LW8A 3H2ZA 5TJ9A 1KOLA 4IJKA 3L0DA 1B0AA 3FNHA 3NYWA 1TEHA 4DPMA 4Z0TA 2OMEA 1Y9EA 1E7YA 1ULUA 4QFDA 4XQGA 1E3WA 3L4BC 1Y1PA 2R00C 4L0QA 2VHXA 3M1LA 4Q9NA 1B7GO 3EVNA 3ZWWA 3C8MA 1GZ4A 1LSOA 2V6BA 1P31A 3ZWBA 1N8KA 1PR9A 1C1DB 1K6XA 1K5HA 1Y5MA 3FNFA 3PXXA 4J16A 5KJ6A 2YV2A 1R16A 2D5AA 3NRCA 2BFAA 2EKQA 4DVJA 3PIIA 2GASA 2FSVA 3ETGA 2EP7A 1X0XA 2Y0EA 5FWNA 3TL2A 4E5NA 5L3ZA 2AA3A 4FD3A 4J4TA 5T67A 1EVJA 3UN1A 2Q1TA 2DBQA 1PZEA 2YHUA 1QYWA 3DZJA 4TRRA 4NU6A 3S2GA 4JGBA 3R3JA 4N7RA 4J2HA 4ND4A 4PRKA 2VNAA 2WDZA 3DBLA 3DQPA 3H5RA 3QVTA 3B6ZA 4NJMB 4XA8A 5KJEA 5CAEA 4M1QA 3H8VA 3GG2A 4AL4A 2QZ9A 3ANMA 3MCVA 2Q4EA 3Q3CA 4E5MA 4RVGA 3WTCA 5ER6A 2X9GA 4J0FA 4TRNA 4XJTA 3MJVA 4NR0A 3EY4A 3RI3A 4M89A 1NHGA 2BKAA 3U4HA 2B4TO 2VYNA 3IKVA 4DC0A 1SB8A 3PWKA 3OEWA 2PGJA 4BNTA 1ISJA 1MXFA 1I30A 2EHDA 2GPTA 4H3VA 3PQEA 1P77A 2B36A 1MP0A 1Q7GA 1NPTO 2NM0A 3LT2A 3U3XA 3ZWCA 4CQMB 3FR8A 2ZTLA 1DRUA 3WG9A 3ZDFA 1Z82A 2POQX 4M8SA 3GQVA 3GA0A 3JQ8B 5A9SA 5IDXA 5JY6A 4OMUA 1E3IA 2HMSA 3IDSA 3T4XA 1V8BA 4TROA 3RBVA 5I7FA 4DLAA 1PJ2A 3NJ8A 1JW9B 5L53A 2GERA 4E2WA 4I9UA 1DLJA 1QORA 1RM0A 4K28A 3TJRA 4CV2A 5JDIC 5BNTA 2OFPA 3VPXA 1DSSG 4J9VA 1V3VA 5DULA 3DFZA 1HEUA 4KDFA 5JYDA 1HDRA 4KP7A 5HRUA 2QRLA 2ZJ1A 5GMOA 3KSZO 1JVBA 3OQ6A 4XRGA 1CQIA 1FDSA 4U0JA 1VI2A 4IIVA 1H94A 2E4AA 2RHRA 1U5AA 2NV6A 2ZYGA 3I23A 3PLNA 4CMEC 3VKVA 2XAAA 2WYUA 5L4NA 5IJZA 2JD2A 4RVHA 3HFSA 4IZIA 4O0LA 4LCJA 3AM4A 4ALNA 1UDBA 2BLLA 3O03A 5TX7A 3JQBA 2ZTVA 3MJTA 4WCDA 2Y1CA 1PWXA 4RGBA 1AHHA 3JQ7A 3GNTA 2JL1A 4IJVA 2C07A 3Q11A 1KVRA 3QWIA 4FFMA 3G1TA 2JCYA 3V2GA 4CM4A 1EZ4A 3LLVA 1XLTA 3UGKA 1KEPA 2OO5A 1EEHA 4QFCA 1HTBA 2X5OA 1IZ9A 1PU2A 3OICA 3GC6A 4DWVA 1Y5RA 1BSVA 1DJQA 2OBYA 3QWFA 3KM0A 1DFGA 2E48A 5KVSA 1GTMA 4NI5A 1DHRA 3BHMA 3JQAD 1TXGA 3WWZA 5B4UA 3OIFA 3M2PA 1D3AA 3KB6A 4GGPA 1E0DA 1LUAA 3AFNA 3CE6A 3QSGA 5KVQA 4G81A 1P33A 4PG4A 2O4UX 1EK5A 2NU9A 5I8ZA 2EKLA 1R0LA 1EVIA 2GO1A 3JQ9C 3I5MA 1KEWA 2VYVD 3IP1A 5F1PA 2PGDA 2FR1A 2Y66A 3GNQA 5L4LA 2GN9A 4LVCA 2FY8A 3WJAA 3ETDA 1OBFO 1WZEA 3MJ4A 3RBZA 3KUXA 4D7AA 3DBHB 3WR5A 4RVUA 4GKVA 3VTZA 5JAIA 3O38A 2Q2QA 3JQAB 5G0SA 1LBEA 5G4KB 1YQDA 3FBTA 1SEVA 3DL2A 2J3KA 4D3FA 3C1AA 1I3MA 3I9OA 4FSHA 2Q2VA 4BMNA 5DF1A 1NR1A 4G5HA 1JN0A 5EQDA 1G6KA 4D43A 2YZ7A 2HK8A 4CMJA 3GPIA 1O94A 1YJQA 5L40A 3T4EA 3CZRA 2C0CA 4ALLA 2ZCVA 2NADA 5U1PA 1PJ3A 2RHCA 4GPD1 5JMPA 4BQRA 1FJHA 2XPCA 3NV9A 4P4NA 3GNSA 2VYND 5EESA 2H9IA 4NH4A 1A71A 3DAGA 4KTTE 5BT9A 2FOIA 4W82A 1Q7BA 3K73O 4U5QA 3STHA 1MB4A 3KYDB 3DBLB 4R3WA 4OJNA 1I33A 2NTJA 5AVOA 5FI3A 2GSDA 4K9DA 2PH5A 4YVFA 4XYLA 3DHYA 3VPHA 5JMWA 3VPFA 1JLLA 3ETEA 3DEYX 3HDHA 1CJCA 1N9GB 5TS3A 3RC9A 1A4IA 2FR8A 5AOVA 1F12A 1M6HA 3E8XA 3OJFA 1ENOA 2OUIA 4DA9A 3ZWPA 2O3SA 4UVHA 3KTDA 3JSAA 4YRDA 1VSUA 4WASA 4U7WA 4FFPA 2W2KB 2WMDA 2X23A 4CL3A 4Z3KA 1HSOA 5EINA 3TOXA 4J91A 1BTOA 1GPJA 3F4BA 3G0OA 1O95A 4OH1A 1GYRA 3RSHA 3V1UA 1SOVA 1ZK0A 3A06A 3I9KA 1PJBA 1DC4A 3B1FA 2FP4A 1BHSA 3E9MA 1UP6A 1AUPA 4J7XA 3U4DA 3LC1O 1D7OA 1NBOA 4PN3A 1FF9A 4ID9A 1HETA 3QV1A 1GUFA 5H81A 5L4SA 4FQ8A 4YACA 3GEGA 3GVCA 3WX0A 4Z6KA 3N74A 4B4UA 4RV9A 1ID1A 3KYDA 4ZD6A 3WBFA 4UUNA 4NBRA 2VRCD 3SXPA 2X4GA 1MLDA 1Q0QA 5IDWA 2W4QA 4AJ2A 3L6OO 1UZNA 1ORRA 1PS0A 4NMHA 1R0SA 2EKPA 1ZO8A 4IDBA 4PG6A 4RJTA 2DTDA 5ITVA 4RPJA 4KUHA 3IUPA 1PZHA 1YL7A 4N5NA 4XYGA 2GRAA 5T5QA 3PHIA 3N7UA 1LTHR 4YR9A 3UCEA 1X0VA 4KUEA 4IJUA 2D1YA 2WE7A 1XQ6A 3OQ1A 4XDZA 9LDBA 3CUKA 1LDMA 5TGDA 1H9BA 1UXIA 1UXHA 4B3HA 5HTOA 1ARZA 3DBHA 2HO5A 3NTQA 3DZHA 4KOAA 1Z73A 2Q4BA 3PJFA 5DCYA 1XR3A 1MC5A 4XX0A 1PTJA 2ZQZA 3PYXA 1NR7A 4GI2A 5KJCA 1UJMA 1WNTA 1QV6A 3VZQA 3VH4A 2X6TA 4EUHA 2QG4A 4JBGA 4J4BA 1HE2A 1V9LA 5FF9A 4EDFA 4DMMA 2WEKA 5T8KC 1HF3A 1LQUA 3HN7A 3NTRA 4ZQGA 1UXGA 4MDHA 5DOVA 3LK7A 4B3IA 1NQ5A 1ZKMA 2V6FA 5DBFA 3ZWAA 5IAAA 5B1YA 1NVTA 1VJ0A 3G3EA 1TI7A 2VN8A 4BUCA 1KBZA 3QHAA 4W9NA 3WWYA 4WUVA 3SEFA 5I7VA 1A7AA 2Q1UA 2RAFA 3INGA 3BTUA 4DRYA 5CG1A 4ND5A 3O8QA 4MINA 2PR2A 4XR9A 2WD7B 1H2HA 3WIEA 3FPLA 3QP9A 1GPDG 5HS4A 3JCZA 2QHXA 1BVUA 2I5PO 5KVCA 1EDZA 3R3SA 4D0SA 3B20A 5JFOA 4JP3A 2P2SA 1IHYA 2PKQO 3F5SA 3G1UA 3I6IA 3WLFA 3GN2A 5BSHA 2DT5A 2G82A 4ILKA 4I8XA 5HBRA 3H6KA 4PLWA 1QP8A 3QW2A 4WCFC 4ZQEA 2PH3A 3RKRA 3GZ4A 3FRJA 4YCAA 3WQSB 3AOEC 3EDMA 1YL6A 3IIEA 8LDHA 3ZNNA 2XF8A 5FEUA 4IXTA 4E3ZA 4OIMA 1UXJA 3TZHA 4CMIA 3AY3A 3AWDA 3MZ0A 4IQ8A 4R41A 1GUYA 1EBUA 3E5RA 1CERA 1QLHA 1VJTA 4YAKA 5IFLA 2NVUA 3I3OA 4FN4A 4I5FA 3DXFA 2ZYAA 5CDSA 4TMFA 3D4PA 2YV3A 4HFRA 5JXWA 2JD0A 5KTKA 4K6FA 5AYVA 5HS6A 2PZMA 3RQSA 1J49A 2O7QA 5CDTA 1B26A 3OM9A 4FFOA 2JCXA 4E2ZA 1QSGA 4GX2A 4C7KA 4I5DA 4OXNA 2ZIZA 4ZQBA 3D3WA 1A4UA 3VAZA 3GRPA 4DUPA 1XEAA 5C5IA 1TT7A 1ENPA 1YJ8A 3CZMA 1ONNA 1RM4A 1X7DA 3DBRA 3KXDA 5DCWA 3UFXA 3KYCB 3T7CA 1Z75A 3NX4A 1HDCA 4RF3A 2VHVA 1H93A 1F06A 1KVTA 3PIDA 4P38A 2OP0A 4DREA 5EPOA 1W6UA 4YYZA 2D8AA 3UCXA 4Y9DA 2C59A 3KSDO 5EN4A 4PG7A 1C0LA 2X0NA 3JD3A 2G0TA 3NTOA 1YDEA 4DPKA 2AG8A 4Z9XA 1BXKA 3RUFA 1WDKA 3W1VA 4ZQFA 1B3RA 4PGFA 4CMCA 2BFMA 2NLOA 2VTDA 5T57A 3WGTA 4CLXA 1YQGA 3NT5A 3IS3A 2GLXA 5EQFA 3Q9UA 3OJOA 4GQAA 3KEQA 4BKOA 3CKYA 1HDXA 1MG5A 1R66A 1S6YA 4FJ1A 4RF5A 1LLUA 4WKGA 4BGUA 1ML3A 4MP6A 4BNLA 5TT0A 4AJJA 4RZHA 4D45A 3NDIA 4LSWA 2J3HA 3C3XA 2HAEA 4Q3EA 4AICA 5JE8A 3TZKA 1HDGO 1I5RA 2GN4A 2RH4A 1LDNA 4QO8A 2NVUB 4A27A 2AW5A 2R2GA 5A06A 1GFSA 3BXXA 2HK9A 3LF2A 3GMSA 5ER9A 5DOZA 5JLAA 3WMWA 2C7VA 4CMIB 3PGJA 3AY6A 5TLSA 1U7HA 3UF0A 1GQ2A 2VT3A 1FDWA 1P3DA 2PV7A 2FPGA 4M87A 1R4NB 4JJFA 1PJLA 1UP4A 3I4FA 5THKA 3DTYA 1ZEJA 4Y8VA 4BQPA 3ZV6A 5JS6A 4ALIA 3RFTA 1KVSA 4IM7A 4CV1A 3HNPA 5I9MA 2Q3EA 4QXMA 1JDJA 3DMTA 3GLQA 3OBBA 4IS2A 4QUKA 1QG6A 2PZKA 1F0YA 4WLVA 5A9RA 3E82A 1GYQA 1XU7A 1BRMA 3ZWNA 4FR5A 1MGOA 2Y1FA 4MVJA 2Y0DA 1EDOA 3DMYA 4QT0A 2LDBA 1SOWA 1K6IA 1NM5A 1XKQA 2WM3A 3QLJA 1QKIA 2OOSA 4CLOB 1IPFA 3TL3A 2YJZA 1CIVA 5G0UA 4BMSA 1IYZA 5JO0A 5L7TA 5G0WA 2PLAA 4BKUA 2HSDA 4Q3AA 2BI8A 2VTEA 4MIOA 9LDTA 1VKNA 3OHSX 1FXSA 1TA4A 3MJSA 2YFHA 5AXBA 4HV4A 1GZ6A 1WMBA 3ABIA 4R9SA 3ZN2A 4UUOA 3WYEA 3PWZA 1I2CA 3EYWA 5ES3A 4YJFB 2FZEA 1JKFA 2J3JA 3VVBA 2PD4A 4DIFA 3DZFA 3TFQA 3GVPA 3U9LA 4EEXA 4OSPA 1GCOA 4YQYA 1DXYA 1C14A 1ENZA 5IN4A 2IE0A 4BO6A 4BNMA 2IEDA 3K6JA 4IGFA 3V2HA 3DB2A 1UDCA 1FDUA 3GG9A 3PHLA 2O4CA 1Z6ZA 1Y6JA 4JXKA 4R16A 2IXBA 3ORFA 4JBHA 1W4ZA 3K9QO 3U49A 3C85A 1LX6A 2I3AA 4PLPA 4FFLA 2EIHA 4B8ZA 4KDEA 2I76A 1SO8A 2AG5A 1BG6A 1U3TA 2O2YA 3RCBA 2EXXA 4A2CA 3F9IA 4TQGA 4AVYA 3MWDB 4NIMA 4YT8A 5JC1A 3UAGA 3ZHXA 3EHEA 3KZVA 3VHRA 1KC3A 4WECA 1YB5A 5BQFA 2GNAA 1NQOA 4J0EA 1IB6A 4HXYA 4TZTA 2V7PA 2P9CA 5BR7A 3NEPX 4W7HA 4OQYA 4P8RA 1Y8RA 4YPOA 1UR5A 3WB9A 1LNQA 5A5EA 3CTMA 1TLTA 1ZMOA 3DTTA 4AJOA 4DQUA 5HM8A 4JBIA 4ALMA 1I3KA 3EK2A 1T26A 1E1LA 4NBWA 4RORA 2HKIA 1O9BA 3O8QB 4E12A 4XQCA 2GD1O 3E9NA 3H5NA 5JNLA 2CF6A 4FJ0A 2NU6A 4MIEA 4PLTA 1U3WA 4B4VA 4DMLA 3GDFA 3BYZA 1ZIDA 3PYLA 2J5RA 3PK0A 3JQFC 4S3MA 1VM6A 1ONPA 2OP1A 4ZRMA 1MC4A 4ROSA 5IF3A 5CPFA 4J1NA 4BO4A 2O2SA 3FWNA 3HDQA 3HDYA 1BXGA 3UOGA 3BMOB 4E5PA 3E5MA 4FC6A 4MJLA 2VWPA 1LA2A 3FTNA 3LT1A 4FJ2A 4Y6RA 2NSDA 5B12A 4KWIA 2VZ8A 3L07A 1JKJA 5LDGA 3TOZA 3HG7A 1UXKA 3V2UA 1R4MA 1ZW1A 1Q2XA 2CVQA 4EITA 2NVBA 1DRVA 5A04A 2O3QA 3OIGA 2JAHA 4PCVA 2PFGA 4DC1A 2HRZA 2YY7A 3SJ7A 2DQ4A 1T2CA 2C2YA 1O89A 2J6IA 1U28A 3ONDA 1NAHA 3ZZNA 2VT2A 4BNNA 3P2OA 2AQIA 4RPKA 1E6EA 2BELA 5EIOA 1I2BA 2VHZA 4OL9A 5BNFA 5FI5A 1FDTA 3EGOA 3AUUA 1XIVA 4FDAA 3VZRA 6ADHA 1HE5A 3C1TA 3IQDB 2E37A 3ZU5A 2PKQP 1YB4A 4CMAA 3LC2O 3NKLA 3TSCA 4YEDA 3AOGA 3LF1A 4I9NA 4LGVA 2GCGA 2JCVA 4XYMA 1H6CA 3W4JA 5L95A 3S2FA 4ZVVA 3VH2A 1WP4A 2C29D 1V0JA 4CLRB 4BNZA 1KVUA 1ENYA 1ZEMA 2DKNA 3ENNA 1CRWG 4HADA 4E32A 1BMDA 1B8VA 1E5LA 1LSJA 5F5LA 3CINA 4IQ0A 5KKAA 1MFZA 1P1IA 2QZZA 4YT4A 3WNQA 4A0SA 5C7LO 3RUEA 2Q45A 4B7XA 3W4KA 4YRBA 4F46A 4FGSA 2Y93A 5T6BA 4FOSA 4AJPA 1HXHA 1KEUA 2WD8A 1PJQA 1YBVA 1LDGA 3FPCA 3GGPA 1GV0A 5L7YA 5I9LA 1GEGA 1GUZA 1NX6A 3PJEA 4LRSB 4M86A 3TF5A 4P22A 3BMOA 2HLPA 1QXSA 3DR3A 2ZQYA 4R5HA 3PWSA 3BA1A 4BV8A 3AU8A 4GLOA 3VDRA 2ZB4A 3SBOA 5IZ4A 4IXWA 3INTA 4J2OA 1N1GA 2HU2A 4S1VA 3I9LA 1ZK2A 3K2EA 2UVDA 1LRLA 4Q39A 2Y1GA 4D41A 1ZZEA 5L51A 1LLDA 4QEDA 1NASA 5GZ6A 1BXZA 3UVEA 5JPIA 1N9GA 3TDKA 1ZK3A 4OGWA 4XB2A 4N5MA 4UAGA 4HUJA 3MTJA 4MKXA 1GZ3A 1VL8A 2W2LA 3L4SO 4YQZA 1LDYA 1IOLA 2EP5A 4CM4B 5CDYA 3JD0A 4BHTA 3IC5A 4FGWA 4INAA 1NFQA 3JQ7B 2A35A 3CXRA 1E7SA 3FHLA 3ZGYA 3H5AA 4Z0HO 3WFIA 1X1TA 1ZXLA 3BMNA 4FIZA 1YOVB 2JJYA 1F8GA 3NDJA 4J90A 1K3TA 4JNKA 1E7WA 4XQ9A 3OETA 1ZMTA 2HMTA 3JD2A 4ZGWA 5K6AA 5COAA 3VH1A 4B7CA 4YAIA 3GF4A 2X5JO 2CMDA 3IJPA 3VVCA 3AUTA 4LK3A 3MOGA 2P9GA 4A5OA 2VUSA 3GH3A 3MJEA 1SMKA 4H7PA 1LDEA 1IHXA 1ZSYA 5ILGA 1ULSA 2IXAA 4ALJA 4IDAA 2Z5LA 3EC7A 3ZU4A 2IRWA 4TWRA 3RC7A 5TIIA 3G79A 2JFGA 4JLWA 2IZ1A 1NPYA 3AM5A 1PL7A 2HMVA 5IG2A 1TB4A 1KY4A 1LXCA 1P44A 2I65A 3RBXA 4CJXA 5GZ3A 1HSZA 1LSUA 4D79A 1A9YA 4XIJA 2Y99A 4FW8A 3NUGA 1IE3A 3DOOA 1G0OA 3TZCA 1A9ZA 1P45A 1OFGA 3F3SA 1IZ0A 1P1KA 3AUSA 1PWZA 4H16A 4DXHA 3F46A 1F17A 1KYQA 1SPXA 1I01A 4OKIA 1EVZA 2NTVA 2X0RA 4XWYA 2PWZA 2OHXA 4PG5A 5F3RA 5A9SB 1XELA 3ZNQA 2G17A 5A4DA 4YA6A 2DLDA 1IL0A 3WLEA 4E2XA 3DOJA 2CY0A 2QRJA 3PTZA 3K5PA 2X9VA 1NWHA 3PFFA 3ASUA 4H15A 3ZV5A 2HJSA 4RVFA 1A7KA 3FN4A 3FNEA 3F4LA 2XXJA 4QTZA 4PRLA 4Q3CA 2PD6A 1CETA 4KMSA 4BNHA 3QIVA 1LDBA 3IP3A 4YBZA 2E82A 3QWBA 2BD0A 3QVXA 2Q46A 3OFSA 4FOOA 1M2WA 1PL8A 2QIOA 4ZU3A 1QV7A 5I8WA 1LU9A 1NVGA 1ZXBA 1B3BA 3FBGA 1Y8QB 3ZW8A 4IINA 4BV9A 4N54A 8ADHA 3ZV4A 5BNIA 4Z3DA 3UICA 1N92A 2NVWA 1UAGA 4TKLA 3WSWA 2EG9A 1V3UA 1DBVO 1C0KA 5JO9A 3L9WA 4CM6A 5A5FA 2Y67A 1JWAB 2GN6A 4CQMD 3DAFA 2QX7A 2XXBA 4C7JA 3I4CA 2GZ2A 5DDIP 1EUZA 3Q2KA 2IYPA 1DHTA 4OSOA 3BTSA 1LQTA 3DMTC 3A1NA 3WIDA 4IDEA 4BO0A 3FTPA 3I1JA 1E6WA 4NG5A 5KCZA 2X86A 3D5QA 1KY5A 2G76A 1PGPA 4PVDA 2Q99A 4EJ6A 4D44A 1HYGA 4HY3A 4BKQA 5A3JA 4OQZA 1IUKA 2DVMA 1QR6A 3KV3O 1AGNA 4NK4A 3TFOA 3ZW9A 3ZHZA 2G5CA 3JQ8A 2IODA 5DP2A 1U3VA 1R0KA 2WSBA 3PZRA 4LRTB 2HUNA 3JYLA 4IDFA 1NYTA 5IXYA 4CQMA 1W73A 3MEQA 3NT4A 5EERA 3GN1A 1U1IA 4Y67A 5IN5A 3ZH2A 2C54A 4ALKA 5MGBA 1AXGA 1U8XX 2ET6A 1YRLA 2X7HA 1JAYA 1KEVA 2AQHA 3ITKA 4MPDA 4DBZA 3HUDA 3QVOA 4BO5A 3RD5A 4BKPA 3WGZA 5KIAA 1V35A 3ZNOA 2NWQA 3ZCXA 3L77A 4P4LA 3L6DA 5ENDA 4GL4A 5L45A 4WLOA 1DDOA 1GU7A 1YXMA 4II2A 5ENVA 3C1OA 5G2OA 1EFLA 4CR8A 4EJMA 1C1XA 2D59A 4LCEA 4GKBA 3RU9A 1D1TA 1QYCA 2CDBA 4RLHA 3W6UA 1E3EA 4RVDA 5IZCA 4GVLA 2D5CA 3UHAA 1E6UA 2EJWA 3TZ6A 4XKJA 1BWSA 4I5EA 2PD3A 3ZU2A 4BO2A 4GGOA 4BNYA 2ZB7A 4FCCA 3FD8A 1EMDA 2CDAA 4ZICA 3BMCB 3Q1LA 3JQ6A 4L4SA 3W8DA 1B8PA 2VCYA 4MVJI 3D4NA 1SZJG 1I24A 4XIYA 5JCXA 1ZVMA 4YT2A 1A5ZA 3DZIA 2QRKA 2YYYA 4J4HA 4OXYA 4WLNA 1JAXA 3ZWMA 5A03A 2I9PA 1T2DA 1HYEA 3GT0A 1T4BA 3JTMA 2DPHA 1QMGA 1RWBA 1TVEA 5IZCC 5CFZA 3GAFA 4WGGA 1ISHA 3RJ5A 3O26A 1QYVA 1H0KA 3LSYA 4BO3A 1P1HA 1B15A 1I36A 1XSEA 3D5TA 2IZ0A 1GD1O 4PZDA 3ON5A 3AU9A 4C4OA 3HB5X 2JKVA 3ANNA 2DC1A 3A14A 2WYVA 3F6YA 3PDUA 5ICSA 4BIIA 3U5TA 5G0TA 4CM8B 1XQ1A 4WPGA 4IGEA 2JD1A 2J5QA 3MJCA 4CLRA 2D3TA 3WSVA 2IYOA 1U8FO 3BTOA 3H3FA 3AW9A 4YXFA 3DHEA 3BHJA 1I10A 1SEPA 2VWGA 3TQHA 4BO8A 3W4IA 4IQGA 4MIYA 1PQWA 4GSLA 4BO9A 2ZATA 3JYPA 1M75A 5B37A 2QYSA 1N7HA 4MVJG 2P9EA 4U0KA 3S8MA 4W6ZA 2DBZA 1H9AA 4WE3A 2EF1A 3VZSA 1BW9B 4R68A 1NQAO 1VRWA 3AFMA 1PZFA 4BNUA 2BRUA 5C3MA 4UULA 7ADHA 1T2AA 4CM7A 1FDVA 4CM3A 1DB3A 4NBUA 1V3TA 1R37A 2BI7A 2X9NA 2AQ8A 3IMFA 3K96A 3QY9A 4YAGA 3LT0A 1LEHA 1DAPA 5G4LA 4FB5A 2GN8A 2FZWA 3JYNA 1RJWA 3G17A 4AFNA 3GGOA 4NBVA 2I67A 4DYDA 3KRTA 1ISIA 1HDYA 3AI1A 2C20A 3C24A 1A72A 5U9CA 3GRKA 4YJFA 2ZTUA 3ICPA 1BXGB 3AJRA 4L8VA 1LC3A 1K89A 1BW9A 4J1QA 3RIHA 3VTFA 1RKXA 1GDHA 1ISMA 3PI7A 1J0XO 2EGHA 4CODB 5FFFA 4RDIA 3I52A 4XEHA 5BSGA 4DLBA 1P1RA 1XWFA 5TQVA 1LLCA 3UH1A 5L7WA 1X7HA 3JQFA 3E03A 3BMQA 4OOEA 4J1SA 5TRTA 3NGXA 2ZK7A 2DBVO 5LDHA 2NUAA 1MXHA 3JYOA 1GYPA 1QLJA 3PDJA 5TNXA 1YBMA 1P0CA 1M6WA 5JW6A 5LCXA 1WAMA 2Q2WA 3GDOA 3PP8A 4WCFA 4IJWA 1JTVA 1YONA 2VYVA 3L9XA 3UCFA 5JCJD 4HNHA 3RUAA 1ZCJA 4HFNA 1PS9A 1T2FA 3QJ5A 2AQKA 3ZWOA 3H7AA 4MVJF 4J7CA 1WDMA 3CEAA 1VSVA 1O8CA 1VL0A 1LSSA 1HDOA 3D0OA 4GX0A 4E2YA 2H1SA 4G2NA 1PX0A 2DM6A 4I08A 3S2EA 3WGHA 1ISFA 3K92A 1Q7CA 3BIOA 1I2ZA 3C7CB 4TRMA 5EL0A 5TC4A 3V1TC 3U62A 1T1RA 1Z7BA 2RCYA 1DPGA 1EK6A 1X15A 4RPLA 3I9MA 4WNIA 3RROA 7MDHA 1HDZA 2W2KA 2YQ5A 2B35A 3IAHA 1SB9A 4CMHA 4NBTA 3VC7A 3WOHA 1XCBA 4YTEA 1ZJYA 1UAYA 3WGYA 3OA0A 1AHIA 4YT5A 4OKNA 3Q6IA 3HN2A 3CH6A 4I1IA 1KIFA 2DTXA 3KOUA 5KJ1A 1ADCA 1P74A 2C82A 2CSUA 4NHEA 3SC4A 5ILOA 3E1KA 2YW9A 4QX6A 3F1KA 1EUCA 3JQCA 3KBOA 3RFXA 4AG3A 1E92A 4XR4A 1XA0A 1PGNA 3H2SA 2A92A 4BGEA 2PA3A 1WXDA 4WJZA 5A3VA 1C0IA 4EUFA 2DAPA 4IDCA 2P91A 3ADPA 5GY7A 5JAQA 1UP7A 4ND1A 3INRA 5T8KA 3M1AA 5F5NA 3ZHYA 4KZPA 3M6IA 4PLZA 4ND3A 4ZHSA 1X13A 4PLFA 1W8DA 4E33A 4TVOA 1IY8A 3ROKA 2P5YA 2YQ4A 4UVIA 2J3IA 4E6PA 3NAQA 2CDCA 4XGNA 4R1TA 3TZQA 3D7LA 3DOCA 1ZSVA 2B4RO 2PNFA 5G4KA 4AJKA 4FC7A 3AM3A 2HJRA 3K2BA 4CV3A 4ZJUA 3LQFA 4CM9D 5KVVA 2AE1A 3WQRA 1PEDA 2BF7A 2Q49A 3P19A 2VUUA 1BDBA 1R6DA 1VLLA 3TPCA 4Z9YA 2DUWA 1R4NA 2J8ZA 4JROA 4EW6A 1SBYA 1HE4A 1PGJA 3GZNA 3WQQA 3GVIA 1P1FA 4XD2A 4AJ4A 5JAMA 4XZ3A 1HZZA 2BFOA 5L9AA 3AOEA 5A05A 4CLEA 1DRWA 4RDHA 2B0JA 3DZBA 2B4QA 3VZPA 2V65A 1YB1A 2VOEA 3BMCA 4NNJA 4XYEA 1GV1A 3OMLA 4OYRA 4ESOA 2GDZA 1Y81A 5AXCA 5A02A 4A03A 5AXDA 4CUZA 5DCUA 2VNSA 4L73A 5CEFA 5KNLA 3WS7A 2DFDA 4DIOA 3JQEA 4WLFA 1F14A 2PZJA 3RC2A 1KERA 4RPHA 3S2IA 2O48X 2Y68A 3WYCA 1LI4A 2JFHA 4BB5A 3TWOA 4AJHA 3H9QA 3ENKA 1C1XB 1K0UA 1E77A 3FSRA 4B79A 3NDRA 1MX3A 3R6DA 3OP4A 3CPSA 1RPNA 4PLGA 1L7DA 3NGLA 1T1SA 4R54A 4UEOA 2HQ1A 2GR9A 4BNWA 4K6CA 4Q3BA 1I0ZA 4Y6PA 2F1KA 3OJEA 2AEJA 1PSDA 1MG0A 1PL6A 4U8GA 4GLLA 1CDOA 2R00A 3WTBA 4IDDA 4BNJA 3DBRB 2X0IA 5DT9A 3DWFA 2Z1MA 1JKIA
chains in the Genus database with same CATH superfamily
4R8MA 3JU3A 2WKRA 4HAVA 4IGIA 2I6TA 2OK7A 5BMVA 4UUMA 2JAWA 4UOZA 2O9JA 3K0SA 4BRSA 3CE9A 3B82A 4IMRA 4P7BA 1LC0A 3EF0A 1KQOA 1PJ8A 4MICA 3K70B 1ZU4A 2XVZA 5DM4A 3GEIA 2FN8A 3OU7A 4HQ0A 1SIBE 1QIEA 1KEKA 1X92A 3DCNA 4AS3A 5SZJA 2PRJA 3E48A 5HZHA 2F00A 3HCOA 3REOA 1XTZA 2ZYUX 2B69A 5JWHA 1F7VA 5IAEA 2A0XA 4YJDA 5CPBA 1U90A 4TRJA 3EFOA 1QIKA 5KOIA 1DUVG 1JWBB 1B74A 2EGGA 2GEUA 2KWIA 3K8ZA 4KB5A 4ARVA 4JOSA 4B80A 2NQ8A 3CUEF 3UW3A 3I6QA 2JLCA 2VDVE 3TD2A 3WLAA 1QHHA 2HMWA 3W9UA 2KX7A 1X8JA 3PQFA 2O59A 2ARKA 3EDQA 1OH8A 4M8IA 1T9AA 1JEOA 3W78A 1QYRA 4MP8A 2HO4A 2IXTA 3T9FA 2PMEA 1G2IA 3TQFA 3NT2A 4JC5A 3CUTA 2WILA 5I7RA 4I50A 3I64A 1RQ2A 1L7EA 1YVEI 1ZNZA 3IKJA 4QUGA 1QDUA 1ZSNA 3PR3A 2PJRA 2O8CB 4PZPA 4ZT4A 4XEUA 1DTEA 2FZLA 4L3WA 3KQOA 4OLFA 3T1NA 4HS4A 2B8NA 1U7TA 2EEPA 4J6FA 4KLRA 4ZK6A 2LE0A 4LN1A 2GM9A 2R62A 4FYKA 2JGAA 3BMNB 4EKEA 5LDDC 2ZRFA 4XGIA 1AV6A 3NTUA 1PWYE 1TJ4A 2QQFA 4GX5A 4ZOBA 1BCRA 3C3MA 3SDSA 3RYHA 4F3YA 1KK1A 5E6UA 1QG4A 4H0CA 4B2PA 6REQB 1QE3A 1QVRA 2PS0A 3MB8A 4LC0A 4ARZB 3ZHBA 4HFMA 4KE8A 3ZCTA 4GNRA 2RHBA 3HP1A 2Q6VA 4GQIA 1XCPA 3VVMA 4LNAA 2AJDA 1L7VC 1LRJA 2Q28A 3FMOB 4UPDA 5E1BA 1L4HA 2CGEA 1UBOS 3MB5A 1K97A 3KO8A 1JA9A 2BF4A 1HZJA 2JI4A 1YNOA 2QYTA 5ALQA 2QTLA 1LLQA 5EJ7A 1RWVA 4TVBA 4KPEC 4XPIB 3QQPA 1RLUA 2C5LA 2WSSD 4HQNA 5AQ1A 2GARA 4M55A 4DADA 4PM4A 4EG8A 1JSLA 5E8RA 3HDGA 4BNKA 2Y2VA 3FCOA 3DVAB 3PRKE 3K1AA 4CQLA 5E1OA 5A9TA 2XYHA 3SM9A 3K72B 2HA3A 2HSEA 4AO7A 3IAS6 3MBIA 5IVPA 2O8DA 4N48A 3CSDA 3HDTA 4EDHA 1XCJA 4P5PA 2CJYA 2HRRA 2IW1A 4M21A 4IL5A 4KNWA 1CY0A 2CDRA 1SCUA 1BH2A 2P4HX 1O6BA 2QJRA 4GOXA 4J43A 3KUKA 4PG8A 1DO8A 2PQ6A 1ZQ1A 3N53A 3ZPXA 4ER3A 4DQDA 3VGJA 1VKHA 3OC6A 3U9TA 1G8JA 5B6PA 2CLFB 3A1FA 3HCRA 3IVRA 3MTBA 4QT4A 1OXXK 1IY0A 2M6RA 5KMGB 3EULA 5I4IA 2TMDA 2ZAOA 4TXLA 1II0A 2HGSA 3IAAA 1RR6A 1L5HB 1UC5B 4ZP1A 1EE2A 1FFDA 3MLAA 3OTQA 3HBLA 3R6WA 4DA6A 4MROA 3ROPA 2HF7A 4I5IA 4UCQA 2WWYA 5SY4A 1S7CA 4JKOA 1NLMA 5P21A 3SZLA 3VPGA 1H1LA 5EIHA 2PZLA 3ZWQA 5BUZA 5IKPA 3CLRD 5FLYA 1JQLB 1KGDA 4F12A 1RW4A 4UKDA 1K68A 4YJHB 3E8MA 4JSTA 1Z6YA 5F1OA 3AT1A 3C5HA 3PYMA 3JQGA 3CMCO 5ALLA 4D46A 1HLDA 1U7UA 1AV7A 3O2SB 1C0PA 1WE2A 4PQRA 4GYYA 4WI1A 3C3DA 5AIBA 3AMVA 2OK8A 3EPHA 4DA8A 1NVBA 2VF4X 1E6LA 2I29A 4FDTA 5JATA 3QU4A 4WOKA 4ENRA 1LV8A 4R0MA 3O8DA 5FNVA 1H1TA 2FRDA 2IEGA 4I8IA 4GOLD 3DLAA 3TSZA 4QYTA 3ZWVA 4AIIA 2PSFA 2XVMA 3OVMA 5BN1A 4P0PB 1E7QA 1OC4A 1L7RA 3E1GA 2E4WA 2ISSD 2P2DA 1V8DA 1N57A 2HNAA 3PUIA 2PE5A 4XCVA 5BUSA 1SHTX 2WWGA 3O94A 1ZBQA 4HDKB 4QA9A 2PTGA 4UAVA 4EGCB 1R3UA 2BSQA 1REQA 4GW3A 1RJGA 1U5BA 1E4EA 1OROA 1UUFA 1JYSA 1G41A 3CNEA 1XRLA 2CUKA 3RODA 3K6SA 2R6AA 3KQPA 2VP2A 3JARA 5F64A 2NPFA 1CY8A 2AOTA 1IEQA 1J8YF 2C4KA 2TMGA 3T7JA 4CM1A 4EM6A 5JADA 2O0MA 1O0SA 1WXQA 1ZW6A 3MGGA 4JGIA 1G5PA 1CQJA 1FTWA 1MFPA 1QFJA 3OE4A 2VK1A 3DFMA 1GPH1 2TRSB 4F4HA 3GFOA 2NTNA 5LZ4A 3TNLA 4RAOA 1D6SA 1MDBA 2QTBA 4IDNA 1N2OA 5DWVA 2AYZA 2O0HA 2XUAA 4CIWA 2FGKA 3EH2A 1ZL0A 3SQMA 1X19A 3LKBA 4L7VA 5FPQA 3T4UA 2XT6A 1P9RA 2XQGA 2NU6B 4BXOA 2I99A 1SRRA 5AKIA 3ZQ6A 1Z2EA 4YXWD 1X8KA 3A11A 4RAQA 5LJLA 4GLJA 3BZUA 5B57C 2BP7B 1B8UA 2PMCA 3NIFB 1NKVA 1PGQA 1OLUB 3AK4A 5CNKA 1JS1X 1QIHA 4W1QA 3G0HA 3UK7A 4R71A 4UHFA 2VWQA 1K2WA 1UFRA 3QE3A 1QH1B 2IUTA 2OHGA 2BEUA 4ZPXA 5G1OA 4MMZB 1KFEB 2P35A 3H9GA 1C3VA 2XSZD 4BC0A 1UJ6A 4RU1A 2AWNA 1BVHA 3G5UA 2QNIA 2J9FA 3Q8KA 3SS9X 2XECA 3IAM1 3PJDA 1HKHA 4A1FA 2WOOA 2Z30A 4MA4A 1KAOA 3EN0A 3OH8A 3BC1A 1LBHA 2F3UA 4RACA 3TH5A 3HDJA 3LQYA 2AN9A 4M0UA 4BV3A 2QU8A 1X7YA 1YO6A 2R48A 1Z0DA 2JA2A 3RWOA 1PFQA 4DTIA 1KHHA 3STXA 5K0ZA 2FPIB 2IEBA 2A4KA 1S3SA 3G8CA 5AJXA 1CR4A 5FP0A 4M98A 4KITB 1OPRA 3R3HA 3SX4A 2G7ZA 3LW8A 3VR6A 3OLVA 3TCKA 3JPYA 5SZIA 1OBVA 3ES9A 4RZIA 2R5FA 2C2XA 2FDXA 3MRTA 4JR2A 5EAIA 3N2ZB 2ATEA 3BCUA 4LRWA 4JQYA 3DL0A 4M7PA 3A4YA 4V2UA 3O6VA 4BL5A 1AQJA 4GP6A 3EMKA 3FSGA 4LBZA 3DWGA 4QYXA 2G5TA 5JAZA 3MWLA 2IF0A 3TN7A 2EFEB 1XTIA 1BU5A 5AR1A 1TT5A 5FOQA 1VE7A 2NZVG 3DE6X 1CSEE 3GJYA 1NVAA 3FZNA 3TQQA 4AZ0A 2E4XA 3DHNA 2YJ6A 3NKFA 3AL0C 5BSFA 1TM5E 821PA 5CP8A 1OU0A 2YWCA 1TW3A 1A97A 1DO0A 1VG1A 2V4MA 2FJPA 3GZJA 2CYAA 5IMSA 3IOYA 4IPTA 2NOAA 3AZPA 2G1UA 3H13A 4CTNA 1GNRA 1QZ3A 4GNKA 4J49A 4EJSA 1RYNA 2J85A 3H05A 4GPBA 4WEQA 3RRJA 3ULKA 2QZPA 2SNIE 4OFBA 3TLBA 4DM7A 2W6NA 4FS8A 1TECE 5KOJA 3GPDG 1UEIA 2FG5A 3E27A 2J7KA 3LT4A 4D0RA 1IOZA 5HQ3A 4BC1A 3N1UA 3GUCA 4URXR 3VKHA 1NE2A 1JX6A 4OM7A 5SZHB 5TMBA 2P30A 2EEZA 2ZRLA 4BFUA 3EZ6A 3RAFC 1VKOA 4YV0A 3VSDA 1LPBB 4PYLA 2Z3ZA 4M8LA 2QVLA 3F90A 2HPHA 3IIIA 3BREA 1W1UA 4K8OA 1EINA 1ZIOA 2D0IA 3DPUA 3PL5A 2BH9A 3FTEA 3K70D 2HRBA 2WKQA 4XJSA 3VX3A 1HH4A 1SU4A 3FZYA 1ZD8A 2PKXA 3HDVA 3NVDA 5ALHA 2NU8A 5ARCA 4E30A 3ND7A 1IBKB 2R5WA 4BMVA 4AJ1A 4BQNA 3IJ5A 4M6WA 3VU9B 4Q4JB 3KKKA 3NHJA 3F96A 1E3MA 3PV0A 4UU7A 2GBGA 3TX6A 3GLFE 3NPMA 2QTCA 1PK7A 4Y1RB 3TZBA 5A6VA 5CIQA 5EMHA 2YBDA 1C1DA 1RHMA 1JIVA 5BSVA 2ECPA 3DZKA 3SJAA 4I9GA 4DV0B 1I1NA 3DT6A 2CK3D 4L8GA 4JYMA 3PQ3A 3C8HA 3R9XA 2DF8A 1P2DA 2CKDA 2W22A 4LNUA 4TTAA 4WA7A 3FRIA 3U3JA 5IXSA 1C7EA 4MP3A 1Q0HA 3OQBA 2VJDA 2O2GA 2AEMA 1KWGA 3EQ7A 4P0QB 3KUUA 3PFNA 4MS4A 3B78A 2F1HA 3NBZC 2ZYRA 4TT8A 4DYVA 2CJPA 3W0LB 2YV4A 1JHRA 2QDXA 3KHUA 4QJ3A 5D86A 4J3JA 3Q4GA 1EVLA 1HRDA 3PD7A 4OMDA 3KETA 4MH0R 4P3OA 5IU6A 3PG5A 3TIXB 2PH1A 4EW3A 1S4QA 2NNLD 3B85A 3EVAA 4EATA 4FM9A 4H2DA 2D2IA 3G8YA 2H52A 1SUIA 3GRUA 4LHVA 4KYTA 1TJ3A 5ALYA 3ROXA 3VM6A 4N9WA 2F1IA 1T25A 6LDHA 2AYXA 3B7GA 3EXEA 4R3NA 5I3ZA 4ASUD 5KDDA 1CG6A 1P2SA 2D74A 4LQ4A 5HCIA 3NHLA 1CYDA 1I7QB 1GTVA 3ABOB 3VGPA 2JHAA 1UDAA 5BSEA 1PK8A 1G1AA 2IDZA 4M2LA 1SHUX 4ZTUB 3KOMA 4ONEA 1F38A 3FAKA 3SXUB 3R6GA 1YZVA 4L8WB 3PKZA 1E1KA 5JXHA 2EV9A 2XCOA 3SG0A 2VTVA 3QGMA 4C7MA 3FMVA 4EARA 1GQRA 1MX9A 2OL4A 1FB5A 1DAHA 4YWJA 4CV0A 3TLCA 1ESEA 3WV5A 5IM4F 2IYEA 3LDFA 621PA 2EJUA 2Y1LA 2HUPA 4IFIA 1ADGA 1G0NA 1U1FA 2JZOA 1E2GA 4CLOA 5SYNA 4YP9A 4F4IA 4WK6A 4W4TA 5AICA 2ZU0C 5CAEB 1M0EA 1XEWX 2MYPA 2GM5A 2H0AA 1W0CA 4E31A 5CG2A 1KKMA 1GWNA 1DI0A 3QOFA 3L4BA 4J7UA 2GF2A 2J0UA 1JNXX 1F2TA 4L15A 4GI5A 5DLEA 2Q1SA 5KYWA 1ODLA 2JLAA 4JBYA 3WMGA 1NHWA 4GMGA 4RGVA 1WCV1 1B2LA 1LV7A 2OORC 3IUBA 3MD0A 2I66A 3USCS 3W5VA 1FRNA 4ITUA 1BZYA 3X2EA 4UU8A 3ROZA 2Y9PB 1J5PA 1EE9A 2YCLA 3LMKA 1IAVA 4NK5A 3WGIA 1KJJA 4AMVA 1I3OA 3QKRA 1CDEA 4JEHA 3CC8A 3COWA 3MINB 1G60A 4JMPA 4EPVA 5KNBH 2WFLA 4RSGA 2O8EB 2ZREA 3VOSA 4QQNA 2BKLA 3WB1A 2ZI7A 4NNPA 3KZ1E 3OPYI 1CUAA 2BRUC 3HCPA 4QGGA 4MCAA 3TTYA 4IWYA 4UDOA 4PSKA 4X8LA 3ZC3A 4C7OB 3NTLA 3BWEA 5CJJA 3RWBA 4EF5A 3RJ9A 2UYOA 3PT5A 3LQKA 4BLOA 3OBIA 1YGYA 1IQUA 2HRQA 3HH8A 2XD9A 3QK7A 3ZI0A 3ZTTA 3MG9A 1AS2A 4KIJA 2H59A 4YRAA 3GW8A 3ELWA 3A3NA 3OECA 4Q03A 4TV8A 2PWPA 1YS4A 4G0VA 4MW0A 4JJGA 3WYNA 3RU7A 5AKXA 3BGWA 3TUZC 5EZ5A 1PJTA 1US8B 4MYCA 1XLWA 4NF2A 4PLYA 3M4ZA 4GX1A 1EDEA 1QFSA 3HU1A 4WCFB 2JGKA 2JIZD 3HQ4O 1KI9A 3HY6A 2IWHA 2C8VA 2ZSUA 4ROTA 3KKLA 4WBXC 4X63A 4ZQHA 1Q6YA 1YC2A 4CCAA 1GTSA 4GU5A 5KYXA 4PQGA 4TM8A 2ZUVA 2DR0A 2IPOA 2D7JA 3MNFA 4NICA 4HGNA 4NQZA 1ZX1A 1TLLA 2BJWA 2YOGA 3DDWA 1DWOA 1NNUA 5C4IA 4A6EA 3JX9A 4O63O 5LL6P 1W0KD 4O6VA 4ZTBA 3OZBA 1DQNA 1NP3A 2QSUA 4TT3D 4BO1A 2OCXA 1NN1A 4RE5A 2Y0CA 3ZGNA 5C4MA 1D0VA 2KLHA 2QU7A 2BGLA 3E0QA 4IWXA 3FPFA 2QUHA 4NJOA 3L6EA 4JUFA 5C37A 4NATA 2GFQA 3E53A 5TPWB 1Y1KE 3EXG2 3U0BA 2ZE7A 2VKTA 1O94C 2H4XA 3RJZA 3RU2A 2OBFA 1OWMA 4UREA 4ZRNA 1ADBA 3KJFA 4KQEA 5ECYA 3FI9A 2P3OA 3EVDA 3WA7A 1BHO1 2NXWA 2B34A 2H4JA 1AXRA 1CR1A 1E3DA 3E6AA 1NGSA 1YC5A 1ZS9A 2FSUA 1BX1A 1YI0A 2V6GA 3KJEA 3KUDA 4Q24A 3RVQA 5DZSA 1LBQA 4LMRA 5LLDA 3GLFA 4PNHA 1XXHE 3SVTA 2ABWA 3IBCA 3SR0A 3TQTA 2O50A 2PUFA 4RLSA 5TB5A 1GQYA 5FPPA 4HRVA 2FMKA 5EKTA 5L3VA 5IJ0B 4MVJD 1FNNA 4KSYA 1O5IA 5PNTA 4CG3A 4EEZA 4DIEA 1ZUNB 3T0IA 1FXUA 4HRAA 1UDXA 4PHHA 3O4RA 1GTG1 2QQ5A 4TWAA 3OUUA 2NP7A 2PIAA 3LQ4A 2XY4A 3OZDA 5EXPA 1XDWA 3OZFA 4Q3NA 1CS4C 2GZRA 2ZKIA 1G20B 1R9MA 1J00A 3HADA 2Q3LA 2VP3A 1CX9B 3B8EA 3RDPA 3VTAA 2X0JA 1CR0A 4H7KA 5EXSA 4BNDA 2MHCA 3MRVA 4QU0A 5J3JA 2ZCJA 3IKLA 2XA1A 1EB9A 2XT9A 5HNKA 3R0JA 4YUAA 5F1KA 5J2TA 1YQEA 5LNK1 2A5DA 5I4CA 5JJBA 2VHWA 4RVNA 5T4HA 1JRLA 5HPYB 1E9AA 4O4LB 2XKAA 2VXBA 3L43A 4MOWA 3AI3A 2GXAA 1E2MA 2AOUB 3A6FA 4JU9A 5F1YA 1WR8A 5LBUA 5GZ1A 3PI6A 4QULA 4BVLA 4FGLA 4N1AA 1UXOA 4XQEA 3A6EA 4NU8X 4NHOA 3NM6B 4HB2A 1VKJA 4X94A 3UWMA 1BVRA 4AUMA 2ZRCA 1KRWA 1RYDA 3D6AA 5B4VA 3L7AA 5HMMA 4IOMA 3TBFA 4TQUS 4LJSA 1DIBA 2CXXA 1V4BA 4YHHB 3T3MB 3IP9A 3FKSD 3IUYA 2VAWA 4JI1B 3QRWA 4GYKA 4HSEA 4NNOA 3QEOA 4U39A 5CHEA 1G2OA 1RQRA 1XK6A 3ELYA 3LUBA 3K31A 2G5PA 2H3HA 4NPCA 5GOTA 4Y6GB 5HWSA 5JDCA 3UY4A 3VJMA 2WK1A 4EX6A 4EUEA 4GAEA 5CBPB 3WLPA 3GOHA 4HSGA 3V4LA 4RCVA 3QVSA 2MTBA 5DTJA 1KPIA 4KRGA 2B83A 3K1JA 3GP3A 4DM4A 5MGNA 1W5SA 1SVUA 4LPKA 2ERYA 4JUIA 3O74A 4IS3A 3ZY5A 4AULA 4D3DA 3TS1A 4YMLA 4NZOA 5C1OA 3ZVLA 1Z22A 3F1LA 4K8RB 4IEIA 2FSPA 3JTEA 4WFIA 4NDZA 3TW6A 3N2GB 4R4JA 5CCBA 2P9YA 3L8CA 4ESEA 3B13B 4E4YA 4JQCA 2VSQA 2QSJA 3PRHA 4IVQA 4UHJA 1XP5A 2MU1A 1S7GA 3BQMB 4YQEA 4ZZ2A 2R6FA 3HI6A 3UAXA 1OW3B 4I4TB 4TM7A 1VXOA 1T8YA 1TEXA 3RRNA 4UBJA 4BQQA 3FETA 3BHIA 3AC0A 2J87A 3FF4A 1UZLA 5DNWA 2NUTA 1SKYE 1WSDA 3IMCA 5HFAA 4DLTA 2H5LA 4JZYA 4Z9FA 3KB8A 4AJEA 2GZDA 4O1IA 4CUKA 3G49A 4INZA 5CMLA 2AB0A 3WICA 1N5DA 4M9ZA 2EFJA 1J1ZA 3B51X 1N8SA 1UMDB 3WDSA 2PSHA 2EWMA 1KVQA 3K0AB 3OIYA 3S3TA 4LF7B 2JJ8A 2ORVA 3KLMX 4YFYA 2V45A 3N58A 4U63A 3KZCA 2REOA 2GK3A 3TM5A 2EBWA 5D5PA 1VJ1A 5MDHA 1W5EA 2C97A 5FA6A 4JLPA 2EG5A 2FSGA 3GLKA 4R51A 1JFSA 4EY4A 1UBHS 4WXHA 1AM4D 4IV0A 1YULA 2O6HA 4LXUA 2RGEA 1M6NA 2DWCA 3H2JA 1N6PA 3DNFA 4JB0A 5EP2A 1R8YA 3IQFA 1P0QA 3JQAA 4DV1B 1MHTA 2G9UA 4QATA 4Y7CA 5CT6A 2J33A 4KQGA 4RY2A 2OMKA 2YMPA 3IULA 2GQ0A 1YQXA 2BHLA 3JASA 2QRHA 3N6RA 4H7HA 1G4AE 1G8KA 2PZAA 2R85A 4J0KA 1KU0A 4LOJA 4Z0PA 3UM9A 4B7UA 4YONB 3WGVA 1A2BA 1F4VA 4NBKA 1XD2B 2IX9A 2W90A 3RUHA 5TJ9A 4MR9B 1FSZA 3A6JA 1M7BA 3ONWA 2CLOB 1TZCA 2EFCB 2FE4A 2VBGA 1W6RA 2R6GA 2WR8A 1Z0ZA 1WF6A 1KOGA 2X15A 1IN7A 3CH5A 2OMEA 1Y9EA 3H7IA 3SQDA 3K8OE 2ESRA 1DV2A 4HWTA 3L4BC 2G25A 2R00C 3O7MA 4L0QA 5IEJA 4E7PA 2L42A 3RTBA 1B7GO 3EVNA 1C7JA 4FLFA 5H3HA 2BKXA 4L3VA 2BEKA 1S2NA 4J16A 3FNFA 3TRKA 1PHPA 2H65A 2YV2A 4ZC1A 5DT2A 1MJGA 2BFAA 1YVDA 4X6LA 2Z6AA 1WKCA 4KQCA 2GJ4A 3ETGA 4PYNA 2JI9A 1YS9A 2EP7A 2Y0EA 2JEZA 4JC8A 3TEJA 1L4MA 5FWNA 1QQAA 1IY2A 5T67A 2GD0A 4FXPA 1V5WA 4YP5A 4BE4A 1EVJA 1EPUA 1MEOA 1EA7A 2EZUA 4MSUA 3CY6A 1W85B 1PZEA 2P1RA 1TJNA 2YHUA 3DZJA 4TRRA 5DRYA 1WU7A 3S2GA 3F5FA 4J2HA 3D54D 4D9MA 4PRKA 2C58A 3BD7A 3DQPA 4Q4DA 2EFDB 4NJMB 2WMNB 3PITA 5B7GA 4GXTA 2QJOA 5CX1B 2PUCA 3BZWA 2C2MA 1JIKA 2FB9A 4GOOD 4UHBA 4JT8A 6Q21A 1P5JA 1YTLA 4HNRA 4G1BA 2ZRKA 1Z6QA 1MOQA 1NBEA 2X8AA 2VO1A 1UJ4A 4D0NA 1SBZA 2VQSA 2G9NA 4TWBA 1J8DA 4A6XA 2A88A 3KTOA 4C0LA 3E9RA 1SB8A 5ALVA 2X2EA 3OEWA 4BNTA 3ICEA 2LCQA 1MXFA 3T3PB 2GPTA 3RF6A 1SKUA 5EVCA 2RFLA 4AYWA 3F7OA 1B42A 1KXZA 1G20E 1Q7GA 4LE1A 5COBA 3ZWCA 4DCUA 3DL7A 1PN3A 1R3DA 1X77A 4F97A 3ILYA 1Z2CA 1Z0SA 2YOFA 3JQ8B 3T41A 1QZZA 3AIIA 3C8ZA 3KJIA 5EP1A 5CLFA 2W2QA 3L7MA 4NAHA 3IDSA 3FFTA 1Q17A 3Q0IA 3R5SA 5AK3A 1P6UA 1UODA 4MJ7A 3ZWKA 13PKA 1TZJA 3RBVA 2OENG 1YFLA 4HDCA 2QP4A 5IJ9A 3NJ8A 4HN4B 3FYUC 5K8LA 2QTVB 1KA9H 1P4GA 5L53A 5K8IA 1PNVA 3D6TB 3OM1A 2GERA 1U1EA 1DQZA 3BOSA 3BORA 3VHXB 4DJEC 1N5LA 1GVHA 1YDFA 4X00A 2NZXA 3L7CA 3WIOA 3ENWA 1JZTA 2Z9BA 4BIMA 1QORA 2V5AA 3VJLA 2AD1A 4UNSA 3QNMA 4CV2A 5BNTA 1JYFA 1VP3A 1ZZGA 3LPAA 2QL6A 4DB4A 2OFPA 3BE6A 4NE9A 5JZMA 2GK4A 4DILA 4MRRA 4J9VA 4AXBA 2HSZA 2IVZA 2R86A 1YRQA 1L7AA 5JD4A 4B0PA 4K9NA 5JYDA 4HATA 1QC5A 3FE2A 1UADA 3LUAA 3RIMA 1KPHA 2OR3A 1O1YA 1YQUA 3SJBA 4DZRA 1LFDB 2ZPTX 3L8GA 5L3RA 1FDSA 3KLNA 4XWTA 3GJ7A 3STUA 1NJ8A 1JQDA 4LF6B 4IHJA 4EHLA 4QUHA 2KB0A 3NG1A 3DTVD 4XH9B 2WYUA 4JENA 5AHRA 4CCSA 3T9CA 1RI3A 4RVHA 1JIUA 5CVTA 4CTMA 4ALNA 3AM4A 4JWTA 5CA1B 2ODNA 3AINA 4HVCA 1RJEA 2BLLA 5TX7A 1NI4A 4EB6B 1J0AA 1JHOA 2BWJA 2CWDA 4AB1A 5B64A 3DR5A 4PANA 3ZDXB 3GNTA 1L6RA 1KVRA 1UKCA 2REBA 5GVRA 3LCUA 5A4JA 5KSWB 1L3CA 3V1KA 3THOA 2P6RA 3TJMA 3TDNA 2JCYA 3KT8A 4KKXB 1Z5UA 4FIDA 1U8CB 2C5FA 4YRTA 3NYQA 2OG1A 2IU0A 2OO5A 4IIFA 4OHKA 4Z2YA 2DULA 1HTBA 3M34A 5F7XA 4JXZA 2NAFA 2YC2C 1IZ9A 2H16A 3OICA 2F8LA 5TMPA 3M9LA 1X39A 2R87A 1BSVA 1XQXA 3KALA 3QWFA 5KYTA 3ABQB 4YR7A 3STWA 2P2GA 3S2SA 3JQAD 1BQ3A 1J24A 3O7WA 3B6MA 4M9UA 1D3AA 1COWA 4IJ5A 3I53A 2HYDA 3LVRE 3F7TA 1RXSA 5BSRA 3QSGA 2X3YA 1Y1RA 4KRXA 5I8ZA 4IIYA 3CSUA 5ALEA 3QLTA 3LYUA 1EVIA 2GO1A 3JQ9C 3NOXA 3S99A 2HJ9A 4PNEA 1W2GA 6ABPA 1Q1QA 3C5WP 5F1PA 3AZQA 2PGDA 1B6SA 2HF2A 3Q7RA 3O8RA 4AZVA 1N1MA 4CNQA 4LVCA 2FQ1A 2H4YA 4BMCA 3MW8A 3ETDA 4FGUA 3H3XA 4WZZA 2GYWA 2XW6A 2WF6A 2QZJA 3MJ4A 4KR6A 3FPSA 3HUTA 1B43A 1G63A 1TPYA 2C3MA 1VB5A 1E4YA 1ORWA 2DRIA 2H2IA 5JNSA 4D7AA 5JFTA 2Q6OA 3DBHB 5T4BA 2RH5A 5LSAA 4RVUA 3VO1A 2ZFUA 5JAIA 3L8ZA 2I7VA 3W5DA 1SIUA 2K6GA 5G0SA 5FD8A 1SEVA 2PIDA 4FDLA 4YRKA 1ODFA 4D3FA 1H0HA 2A0FA 4YLEA 1I3MA 5DF1A 1HOTA 1CP2A 2YRXA 4KQ9A 3BJZA 2YXPX 4HC4A 8OHMA 5MN4A 2PUVA 3HKDB 1IMJA 4JSRA 2YZ7A 3ZWDA 3BD6A 3GPIA 1J20A 2LVBA 4BBPA 4FUTA 4ZVUA 1WXGA 2C0CA 3EZ7A 3LY7A 4N0QA 1ZMBA 3S1AA 4ALLA 1JYEA 4B84A 1H2XA 4CG1A 8ATCA 5U1PA 2NADA 1PJ3A 5AW2A 3CRNA 1KSHA 3NV9A 4G4SO 4ZO4A 1JLRA 3V7YA 1Y4ZA 4DV5B 2V1UA 1MAHA 2J07A 4NV3A 4D8UA 4G9EA 3UNXA 4C89A 3ZLVA 5KDOA 2JFPA 2FOIA 4W82A 3UPUA 1UBEA 1MEEA 2VJPA 4DMHA 2VNHA 3QVLA 3KYDB 3BWBA 4CE6A 2BCGY 2ZM6B 1MJHA 1TVCA 2GMWA 4R3WA 1I33A 5AVXA 5FI3A 4OY3A 1ELOA 2QW0X 3F3MA 3B1VA 1XRQA 1W85A 3RT9A 1U3CA 1GOTA 3RWMB 3COVA 3SHQA 5JMWA 3JZFA 3VPFA 3DEYX 1JPVA 3EXHA 5LQSA 1A4IA 3MLBA 3Q10A 4N7MA 1PDWA 3TCXB 1USIA 3OJFA 1AUOA 1KMCA 2VHQA 4GE3A 4JDPA 4UVHA 4E5UA 1KI4A 1QANA 1U0NA 2DQSA 1M2VA 3PF8A 4IHAA 4OYYA 5AUOB 5AKGA 2YZMA 2GEDA 4LVNA 2X23A 2GVZC 2ZYIA 3N2NA 2FDRA 3CKKA 2A84A 4JLBA 4UMDA 1G2QA 2QMZA 4MV1A 2EAUA 2JIPA 3G0OA 2VIIA 3HCEA 5HILA 2AG1A 3PC6A 4OH1A 4WDQA 2ORYA 1SOVA 1JHDA 3L4JA 4MEJA 4LDRA 2RDMA 1X1BA 4LZNA 1AUPA 4DUGD 3LFTA 3U4DA 4C0BA 3G9XA 4DDTA 1SCJA 4GECA 3EXHC 1NKSA 4BWVA 4HNVA 2H1IA 5AW1A 2JIDA 1TIPA 2OCYC 2XDQA 2GPSA 3QV1A 1ZIXA 3EQ6A 5H81A 4FQ8A 4ED9A 2B2CA 2OG2A 4LYHA 3WX0A 1SFRA 3A4TA 1ZGHA 3JASB 2CCKA 4B4UA 1XNQB 3HCWA 1YMQA 3PGMA 3T5TA 2G09A 3T12A 3N8NA 1GRCA 1H8ED 1HL7A 1XB2A 4NBRA 3R7LA 4LYJA 2VRCD 4JGGA 1MLDA 2RBKA 4QU8A 5IDWA 1M1XB 1ORRA 3QOYA 1Z4IA 2EKPA 3H4IA 4NMHA 4RADA 4PG6A 2R97A 4R8SA 2FOXA 3A2MA 3D6HA 5LBTA 4XW2A 2NUAB 2O0JA 3BE8A 1YRAA 1T9GS 2PSJA 2YR0A 2ZI6A 3P20A 2DTDA 1ESNA 4FX2A 1N5JA 5ENZA 1I94B 3U7IA 3G0DA 3N2KA 1YB2A 3RV3A 1GILA 3KZNA 5T5QA 1CQPA 3N7UA 1H0RA 2P11A 3UCEA 4YR9A 2QBYB 1T3LA 4B8YA 1XZ8A 4ZYZA 4H7FA 4A8JC 5D3QA 4HYYA 2D1YA 2DUMA 1XQ6A 4F72A 3OQ1A 4XDZA 2VZEA 1UT5A 3GDWA 4RQAA 1L4GA 1LDMA 9LDBA 5JJLA 4GQBA 2A3RA 2IU3A 5BV0A 3P96A 4NTZA 1AK2A 4A2WA 1K08A 4BFVA 1YQWA 1C7ZA 5F5XA 5HIKA 5JZSA 1Q5PA 3R41A 5JEEA 2NGRA 3L7KA 1ZKDA 3QXSA 4YP7A 2RKOA 4DMKA 1NJ2A 2F64A 1BMFD 3L7LA 5AO9A 4MUKA 3T9EA 2QZ4A 1UJMA 3D02A 2Q7OE 1WNTA 2GD2A 2FW8A 3BG5A 1RAIA 3N2GA 4MWDA 3VPCA 1W47A 3VZQA 5K8UA 4MMXB 2CE2X 3VH4A 5CVCA 4G0OA 1C9YA 2QG4A 3P5BA 2JGFA 3WP1B 4EA7A 4WOCA 2XZDA 2BY4A 5IT0A 4NZPA 4EDFA 4DMMA 2QUZA 2HD4A 2V6JA 2W8BA 4I46A 4LZPA 3VNAA 1LQUA 1VTKA 4WKNA 4ZQGA 5IWAB 3OFND 3UMGA 1TF7A 5DOVA 2ID4A 1SHKA 4DCOA 2CV1A 1YTUA 1YAJA 1ZKMA 2V6FA 3ZWAA 1NVTA 1Z2PX 2P65A 2WY2D 4BUCA 2IEIA 1KBZA 1PD0A 3QHAA 4QEZA 3VU1A 4WUVA 4Q93A 1GZUA 5AJYA 2P9JA 3FGNA 5ALDA 3INGA 2AI3A 1YHNA 1L7OA 1SC9A 2VAPA 3BTUA 3BKWA 4HTAA 4X41A 4IO1A 1YZGA 2PO7A 1T3SA 4Z7QB 1ZGCA 1BMFA 5ECDA 3G23A 4IIDA 4L22A 1GTZA 2AFVA 1LVGA 1SGWA 2Z4SA 4YH1A 4CF7A 3GRYA 3ORQA 4QRHA 1FTNA 2RAUA 2A9OA 3KEGA 4RTQA 3SFVA 3B20A 3BDVA 3K7EA 2X42A 2H1WA 3F5SA 3NOOA 2B94A 4H35A 4ZOAA 4C4RA 3KVNA 2KS6A 2GEKA 4QYSA 3UA4A 4DLYA 1BJKA 1HO3A 1JJBA 1Z5NA 2Q2NA 1E9VA 4PSUA 3MUEA 5KQMA 4Y9RA 1JVNA 1HOXA 1QP8A 3ANTA 1PR6A 4FWTA 3G9ZA 4GD3Q 4LVOA 1J23A 3AHJA 3N87A 2FPGB 4OLHA 3EC2A 1FXWA 3FRJA 5DWQA 1DCFA 3AOEC 3EDMA 4FBMA 1XZEA 4AF7A 1GPLA 2O5RA 2HCFA 4D82A 5FEUA 4D99A 1L5RA 4TS1A 5DW3A 1S0UA 2UVQA 3PXDA 5GGXA 3ZCVA 3UHFA 3H5LA 2VDUE 3T99A 1GUYA 3E5RA 1NQUA 2IY7A 2ONKA 4TMWA 9MHTA 3CRZA 1VJTA 4YAKA 5IFLA 3P2KA 2XE7A 1K7FB 1GQSA 3L8EA 4OMCA 1F9AA 3VSEA 4AWAA 3HO6A 4W5TA 1ZD4A 2GPNA 3QLEA 1AVTA 3EGDA 5IJ0A 3EQ2A 5J58A 4TTSA 3OFNA 2HLDA 2FZ4A 3W8RA 4Y1EA 5C8YA 2JD0A 1C29B 1HNXB 5IUKC 2VDOB 3P0FA 1EM6A 3ND6A 4AMUA 4D8YA 1RI4A 1TK9A 3JWJA 3I2GA 2PZMA 2RGGA 2FPRA 3RQSA 2ZIVB 2VBIA 1GT91 3ADCA 1B26A 3HC7A 3LOUA 2XE8A 4FFOA 2AXNA 5I5GA 4AWBA 1W0JD 4E2ZA 2YINC 4JMLA 2I1QA 5BYAA 5CJPA 1YB7A 2POCA 2VSOA 4MLCA 3N6XA 3DJFA 4GX2A 3U2QA 1J0DA 3DE2X 3GPLA 2Q3HA 3FZEA 4JL8A 3P0EA 3TUJC 3NM4A 4ENPA 1BKYA 4EY7A 5C5IA 3A2LA 3GRPA 3KR2A 1H2EA 2ZJYA 1TT7A 1ENPA 1XRNA 1YJ8A 2XYRA 4M1SA 2HHHB 1X7DA 3T52A 3NATA 1S8AA 4ISCA 1PR2A 5LMZA 3NX4A 4TMXA 1DBPA 1QRTA 1H93A 1KVTA 4TTJA 5EPOA 5KJCA 4BB0A 2F43A 2AHOA 3H86A 4DARA 3AVWA 4TYQA 1P73A 4COOA 3W7AA 5EN4A 1GT6A 3GRVA 4OGFA 2X0NA 1P62B 1XQYA 2G0TA 4V2IA 2IUYA 2XV1A 1BXKA 3RUFA 3W1VA 5C53B 3O8CA 2EJBA 5C51B 2WVJA 3DP7A 4RK4A 2VTDA 3JALA 5CIYA 4L4UA 2IV7A 5T57A 3WGTA 1WXFA 3C98A 1YQGA 1SQFA 3IS3A 1A8QA 3SOPA 4DMFA 4GLBA 1KMHB 3OJOA 2LXNA 2GHTA 3KEQA 1MG5A 4PR3A 2IH4A 2G80A 4LOIA 4RF5A 4CCYB 4D8TA 2XUQA 1ML3A 4PO9A 3I39X 1Y1LA 5TT0A 4AJJA 1XE3A 4OD0A 5EE5B 4LSWA 4PE5B 4IXMA 4AICA 2C8LA 4G0WA 4ZAYA 3F8WA 4A27A 4MJ3A 3QEJA 1K3UB 2X3UA 2XQJA 2ZJ3A 1GFSA 1ZOIA 3BXXA 1JV2B 3I45A 3KTAB 4FGJA 5CYFA 2FPLA 5ER9A 5GP1A 5JLAA 2BGNA 3O3CA 5FFNA 5EWJB 2C7VA 3FM9A 2FFQA 3PGJA 4W5HA 3I58A 3KTAA 8ABPA 1AKVA 5ADVA 3VYSB 5TLSA 2ZETA 1CYEA 3ZD8A 2VT3A 2V7TA 2XGGA 4FWIB 2FWRA 2PV7A 4RKEA 4E1AA 1DAEA 4WFJA 5A4MS 3EEOA 4O2AB 4JJFA 3WLMA 5THKA 2XQKA 1ZEJA 2WJVA 3LZCA 1DWPA 3F2VA 2LCFA 1TA9A 3T5GA 1K8RA 4GI7A 2LKCA 4FNAA 4C29A 3RFTA 1KVSA 4XWWA 3H8JA 3KKNA 1QK3A 5NLLA 5YASA 5JH7F 3RH0A 1JDJA 4H4EA 3OBBA 4QUKA 5KTKA 2OGZA 1L5WA 3E82A 5ITSA 4OQNA 1BRMA 2G8NA 2CL5A 2P0YA 2V4ZA 1HTTA 4QTUB 4X92A 2Y9MB 2Y0DA 3B6KA 1X3SA 1J56A 1RYFA 5IM4A 1IB0A 4QT0A 4WZBE 1SOWA 2PAFA 1K6IA 1NM5A 5D3ZA 3QLJA 4CLOB 5K0BA 1NXXA 1IPFA 2N47A 4PHGA 4DGQA 1YRYE 2C57A 1HQYE 4ESHA 1U7DA 3DLBA 1ZD2P 2G83A 1MORA 3R76A 3S5JA 1DUIA 4KXUA 1X7XB 3H6GA 3X1KA 2C7BA 3LAWA 5JO0A 1KBOA 2NO0A 2D0DA 2JLBA 4RKWA 2YC4C 4BKUA 3PXBA 1GO2A 4Q3AA 3RRFA 2CMKA 3MTDA 4MIOA 4C01A 3NIDB 2AFIA 4GDFA 2CJWB 3VV3A 3W9BA 3KB2A 3LVBA 2YFHA 5AXBA 1G66A 2IDJA 3OLWA 3EEFA 1M1ZA 3OIUA 1KI6A 4ON9A 3W79A 4BFXA 3KPVA 5FIUA 3JAWA 4R9SA 1CUXA 3EXEB 3LKVA 3GEHA 3O5AA 3PWZA 2GAJA 3EPKA 1U2ZA 2Q8PA 1PVDA 1VE6A 2GHIA 4YJFB 3B7WA 4DTCA 3TOVA 3TFQA 3GVPA 5BQ5A 4EEXA 4R1OA 3OESA 4LNHA 1MF7A 2AF3C 2CUNA 4PZAA 4RVCA 1GZVA 1HQCA 1Y6ZA 1APBA 1SD1A 5GV8A 2IE0A 1QRSA 2XRFA 4FYJA 4U2BA 5G1PA 1L1RA 3HEBA 1F48A 4H60A 4DLXA 4B3CA 4D4KA 4RS4A 2IIQA 5AH0A 4YCSA 1IPHA 1Z6ZA 1S3GA 4JXKA 5CNMA 4R16A 2A14A 2UYCA 4QBFA 1HV8A 3P2EA 1DT5A 1VZ2A 2I6SA 3PC8C 2UKDA 1LPPA 1W4ZA 4P80A 4PINA 3DT8A 5F2EA 5A0VA 2CYCA 2RJOA 4YALA 4PLPA 5IYZB 4WA8A 4FFLA 1MEJA 1PP4A 3M8KA 3WQSB 2EIHA 2OOKA 1M74A 2G70A 1XZNA 2PX5A 3NWBA 3LQRA 3QX7A 1SO8A 2XNDA 1BG6A 4S1WA 4TTRA 1TAGA 1HGXA 4FE4A 4N0DA 4RELA