5G4KA

Phloroglucinol reductase from clostridium sp. apo-form
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
264
structure length
264
Chain Sequence
MVNVKKEFVDNMFSVKGKVALVTGATGALGCVLSKAYGYAGAKVFMTGRNEKKLQALEAEFKAEGIDCAYGVADPADEAQVDAMITACVAQYGEVNILAVTHGFNKPQNILEQSVADWQYIMDTDCKSVYVVCKYVAQQMVDQGKGGKIVVVTSQRSKRGMAGYTGYCTSKGGADLMVSSMACDLSAKYGINVNSICPTVFRSDLTEWMFDPESAVYQNFLKREPIGRLAEPEDFVGYALFLSSDASNYITGANCDCSGGYLTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OXIDOREDUCTASE, SHORT CHAIN DEHYDROGENASE/REDUCTASE FAMILY P
publication title Biocatalytic Properties and Structural Analysis of Phloroglucinol Reductases.
pubmed doi rcsb
source organism Clostridium sp.
molecule tags Oxidoreductase
total genus 107
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2016-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5g4kA00
1BDBA 2DUWA 3I9OA 2LDXA 4J49A 1KEWA 3SJ7A 4B3IA 5TT1A 4C7JA 4PN3A 4GH5A 3GVIA 1U9JA 2J5KA 5DCYA 5CHEA 5TIIA 2CDCA 4CLDA 2BFAA 4NMHA 3PDJA 2ZJ0A 5ER9A 5JS6A 3E9NA 1EBFA 1CJCA 3HQ4O 4ZD6A 5KVQA 3IQDB 1YB5A 3Q9NA 1MX3A 1T2EA 4J3FA 3UN1A 4CMEC 4MO2A 1NPYA 2FSVA 1GCUA 1PQWA 4YDRA 5GZ1A 1I01A 2VWPA 3FD8A 3GR6A 3I6QA 4GWKA 3RJ5A 4PGFA 1Y9EA 2X5KO 1D1SA 1E3WA 1X7DA 3EUWA 3GH3A 1YS4A 4J6FA 2FN7A 4OSOA 1XGKA 3A1NA 4I9UA 2B5VA 1G1AA 4L4SA 3R3SA 1XG5A 2AQIA 2VTEA 4FDAA 5JLAA 4E3ZA 4IDCA 1E7YA 5IDXA 4DRYA 2AQ8A 4K28A 1XQ1A 3B1JA 3H2ZA 3JQDA 3V1TC 3PJGA 1U3WA 1OOEA 1EVZA 2IEDA 2IODA 1MC5A 2C59A 3HFGA 4KUHA 2DBZA 2HAEA 2E49A 3EVNA 3ZCXA 2GDZA 4KWHA 2C2XA 1K6XA 3ROPA 4HUJA 3RUAA 3EAGA 3RWBA 3H9QA 4YJDA 3NGXA 3ZI0A 4BKRA 3KYCB 3MJTA 3DOCA 4MKRA 5F21A 1I10A 5K6AC 4CL8A 4IBOA 3NDIA 3OH8A 1ZJZA 1IE3A 2J3IA 3PIIA 2FMUA 3AU9A 3RFVA 1ZUD1 4OSPA 1NAHA 3PYLA 4MP8A 1YH3A 2O3JA 4OXNA 1A71A 4J0FA 3TFOA 4P4NA 1U8FO 5JDIC 2HDHA 2ZCUA 2A35A 4CMJA 3RROA 4DLAA 3MTJA 2EP5A 4YXFA 1C0KA 3KEQA 4CM8A 5JCJA 1KVQA 5EJ2A 1K2WA 3FNHA 2GUGA 3IJPA 1ZFNA 3CZRA 4OH1A 3ITDA 1QG6A 3E9QA 4C7KA 3INGA 1P1HA 1DJQA 4IDDA 3IS3A 4XYMA 3BMOB 3PJDA 4FFLA 4DREA 5DF1A 1GPJA 2GN4A 4CR6A 2EJWA 3CH6A 2ZYGA 4LMPA 5DCUA 2IXBA 1N7HA 1EK5A 5G4LA 1MGOA 2CUKA 4WLFA 4ZRNA 3N58A 2X9GA 1PJ4A 4R1SA 3ZU2A 1WAMA 2RH4A 3CE6A 4EW6A 3PWSA 1L7DA 4CLRA 1GUYA 3F3SA 3JD2A 3IOYA 3RUDA 2AE2A 4G2NA 5L45A 1PZFA 4J0EA 4QQRA 2TMGA 4YYZA 5TX7A 1DDOA 3CPSA 4I5FA 4B79A 4AFNA 5JMPA 2QRLA 2VOJA 5ILOA 1A9ZA 1DHTA 4IIVA 3NJ4A 3LF2A 1I32A 3H3FA 5COQA 4E5MA 3GOHA 4E0BA 2Y1FA 5CDSA 3WNVA 4KQXA 2B35A 4B8WA 2NVBA 1B3BA 2DM6A 1J0XO 3C7AA 3E1KA 1PGQA 2RH8A 2WE7A 4WLOA 5LDGA 1NNUA 3UKOA 5BNFA 3DZHA 2B37A 2GZ1A 4WCDA 4CV3A 3TQHA 5KKCA 3ROKA 1NVMB 3DFZA 3L4BA 4PLYA 3I4FA 2B4TO 3FR7A 4UUNA 4LVCA 1M6HA 3DBRA 4MVJM 5CEEA 2JJYA 2E6UX 4YAJA 2DBVO 3CMCO 4NI5A 1QP8A 3MJCA 3K31A 5ENDA 4RVUA 1BVRA 5AXBA 4J9UE 1Y8RB 3MJ4A 3EDMA 4A2CA 4M55A 4ZQEA 4ESOA 3RUCA 1DIBA 1I30A 4DLBA 3QQPA 2EKLA 4UVEA 4RF5A 1E0DA 3VZQA 1CETA 3GZ4A 2E82A 3VAZA 1CQIA 1OC4A 3RCBA 5TSDA 2Q2VA 4O1MA 2NUAA 4RF2A 1DC6A 3KUXA 1OFGA 5HWSA 5GZ3A 5KJEA 3UAGA 3V2HA 4XJSA 3RU7A 5IG2A 4R69A 4AG3A 2VNAA 4IDEA 5CFZA 4IQ0A 3AOGA 1HSOA 3OA2A 1JKIA 2FSSA 3VDRA 3SC4A 2P5YA 1ENZA 4TWRA 4BO1A 4IGEA 4BGEA 4DA9A 2P9EA 3R6DA 4JBGA 1VKNA 1F17A 1B8PA 2GERA 4NJMA 3RASA 1Y9AA 4CLEA 4N5MA 3WWYA 3PHLA 1BVUA 2R2GA 1SEPA 3DHEA 3LF1A 3GQVA 4HX5A 1ZXLA 1SPXA 1LDEA 2IEBA 5CAEA 1LDMA 4H16A 1L1FA 1F8GA 3QVSA 4WNIA 5F3RA 3KYDA 2HLPA 5AQ1A 4YPOA 3IMFA 4L4XA 2C54A 4KP7A 4AL4A 5DZSA 3OM9A 3LC1O 2X1HA 2C5AA 2YV2A 1LC0A 2AG8A 1GEEA 1GUFA 1ZSYA 1WW8A 4HFNA 3O8QA 1Y7TA 2PWZA 4FCCA 4RLSA 4TRRA 2NVWA 1MXHA 3ICCA 1KY4A 3FNEA 4CV2A 4KQWA 1GUZA 4BS9A 4OXYA 5G0TA 4CM5A 1CRWG 3ZU4A 1AXEA 4AJJA 4PZDA 2UUPA 1ISFA 1GCOA 2DT5A 2EJVA 2ZB4A 3VZPA 2FPPA 3CEAA 3JQ7A 1UP6A 3UXYA 1OMOA 3PPIA 5G0UA 2AHRA 1W73A 3FNGA 1H5QA 2VUSA 4WCFB 3IJRA 4UVHA 1VJ0A 1LTHR 2Y1CA 3KB6A 3GVCA 4NBRA 5DBIA 3BTVA 3EY4A 3MWDB 1V9LA 3QW2A 4MVJI 4OQZA 3VHRA 1UXJA 2HK9A 2H63A 3AOEA 1O6ZA 4EJ0A 2E4AA 1PZHA 2Q2QA 4B4OA 5CDGA 1U8XX 3E48A 1XEAA 4IGFA 2Q3EA 3VH3A 4YRAA 1DIRA 1N1GA 1YBVA 3EHEA 1KERA 4DVJA 2ZIZA 5IDWA 4YJHA 8LDHA 2VRBA 2EWMA 4ZQHA 4BNVA 5BNTA 3GAZA 3JQBA 4QFDA 3RC7A 3ONFA 3QIVA 1UXGA 3TN7A 3AY3A 3AUTA 3DHYA 5I9NA 1J49A 2VHZA 5B1YA 7MDHA 5KTKA 1M6WA 5L40A 1XLTA 2HQ1A 2QX7A 3DEYX 1P77A 3V2UA 2WYVA 4XCVA 2FZEA 2YV1A 4J4HA 3DBLB 4RVSA 5B37A 3JQ9A 2Q4EA 3GRPA 3T4EA 5I7FA 4I8XA 3ETGA 1RJWA 2AXQA 1DO8A 1U3TA 3WYEA 3JQFA 3MWEB 2EHDA 2X0NA 3VKVA 3TSCA 4RQUA 1QYXA 4J4BA 3ST7A 1AE1A 1E3IA 3Q6IA 4QX6A 3JV7A 4CUKA 1FDTA 4FC7A 3ZNQA 3DZBA 3SXPA 2R6JA 3ONEA 1VL6A 2PFGA 2NU9A 2O3RA 2A9FA 1PS9A 2D4AA 2J6IA 3ROQA 3PJEA 4NBWA 1GQQA 4XGIA 2AA3A 3CMMA 1ZEJA 3DAPA 3OIFA 3K2EA 5G2OA 1NWHA 3TZ6A 2B69A 3K9QO 2Y68A 3O38A 2I99A 4KDFA 1ZKMA 1BGVA 2HMVA 3F46A 4P4LA 3QSGA 1I0ZA 3VZRA 5JO0A 2VT3A 1C14A 5BSEA 2B36A 3D3WA 1GQYA 3JYPA 3AUSA 4JLWA 2HMTA 3L9XA 4W6ZA 4WLUA 1PGJA 3FR8A 4RPKA 3CTMA 4FFMA 3SX2A 3W1VA 2PGLA 1E7RA 1HE2A 2IYPA 1VJTA 5L3ZA 4CMIA 3LSYA 5HTOA 3FHLA 4R01A 3VTFA 3DL2A 5HA5A 3S55A 4NH4A 1EE9A 4F45A 5A3JA 1ZMOA 2QYTA 3JQBC 1K89A 2D3TA 2W2LA 1C3VA 4YACA 5TJHA 4ALKA 1MG0A 2CMDA 1X7GA 3LDHA 5C3MA 4Y6PA 4WPGA 3AW9A 4TKLA 2P68A 2VHWA 1HDYA 3K5PA 4ND5A 3WXBA 5MGBA 3JQ9C 3ULKA 3L0DA 4QT0A 3VH2A 4ZICA 1NBOA 1NHWA 2PKRA 3JQFC 5KOIA 3WDSA 1EBUA 3DOJA 3JQ8A 5JPIA 1RKXA 3JQCA 1XR3A 4L75A 1FF9A 3U0BA 3WFJA 1WNTA 3JTMA 1ISMA 3GEGA 5IN4A 2ZJ1A 4Q3NA 2XF8A 5COBA 3P19A 1MFZA 4D7AA 2Z1MA 4IPTA 4XYEA 1ZZEA 2I67A 2VYNA 3FTPA 1I2BA 2Y0EA 4B4UA 3OJEA 4R54A 1LBEA 3IL2A 2RAFA 4H15A 1FJHA 3AFMA 4MJLA 4D42A 5A9SA 2DBRA 3JQAB 3OA0A 2WYWA 1VM6A 4IDBA 4Y98A 3RFXA 3RIHA 3DOOA 2P9GA 4ZHSA 1ZIDA 1XA0A 5T57A 3PQFA 2PZMA 2FR1A 5U4QA 1H6AA 1NVGA 2G5CA 3OMLA 2NVUB 4B3HA 3A4VA 4D41A 1SNYA 1UDCA 4DWVA 2YHUA 2DBQA 4ND3A 1TT5A 5EL0A 5KIAA 1R0LA 1WMAA 3HSKA 2YDYA 1E1MA 3GZNA 2JKVA 2H6EA 3Q1LA 3V5NA 3IC5A 4IMPA 3RI3A 3VPGA 2B4QA 3EYWA 4CMGA 5B4UA 4TROA 1JAYA 4TZKA 2PK3A 4WLVA 4TQGA 1XU9A 3H9EO 3G17A 4QXMA 3ZHXA 3E5MA 4I9HA 4NPCA 3D3EA 2GRAA 2FWMX 2EGHA 5MDHA 1PSDA 1HDGO 3ZNNA 4OQYA 4O59O 1P1RA 2DU8A 3ZHZA 3QWAA 1R6DA 2DFVA 3HNPA 1R16A 5AXCA 2OO5A 3C1TA 3GRKA 1U3VA 3BTSA 3M1AA 4AJHA 3NT5A 2Q99A 3H5RA 3QVOA 5DNAA 3LLSA 2PY6A 3K6JA 1UXKA 4PZEA 4CM1A 4NBUA 4PLPA 2HUNA 4RPLA 4XQCA 2PLAA 5T8KA 4XQEA 2QZZA 3BMNA 2UAGA 1VL0A 5T67A 1QV6A 2C7VA 3ANNA 2DLDA 4TZTA 2BFOA 5JBIA 2EERA 3KEOA 3WG9A 1ID1A 1MUUA 1A4IA 3E6AA 1QYWA 4BMSA 1EVYA 3V1YA 1YQXA 1YQGA 2R00A 2X86A 3BMQA 3GNQA 1AXGA 2PD3A 1Y5RA 4A5OA 2VYVA 1PGOA 3ZH2A 3KBOA 5B12A 1WP4A 2HMSA 4HKTA 3F9IA 2Z95A 5ADHA 1N7GA 1ZO8A 4YJFA 4JQCA 3G1TA 1GV0A 3ZWOA 2GR9A 3DO5A 2RHCA 2GN8A 4RDHA 4BQPA 4LK3A 1KC3A 4KUGA 3C1OA 1XKQA 3LQFA 4O6VA 4AJPA 3VZSA 3OJOA 5A05A 1IZ0A 5B4VA 2GN9A 4L4RA 5F1KA 1SO8A 3ZWVA 4HV4A 3PWKA 1V0JA 4ROSA 1V3VA 5KJ1A 5DOZA 3JQGB 1D1TA 2G76A 1LLDA 4IXWA 4Q3BA 1LRKA 3TFQA 3KRTA 3E03A 4XWYA 3PGJA 4E5PA 1E77A 1K6IA 3SLKA 3EMKA 5HBRA 2VRCA 2OFPA 3AUUA 4QUKA 2AW5A 1DRUA 3NX4A 1AGNA 5DCWA 3PIDA 3QWBA 1D3AA 1Y8QA 1MC4A 1BXGB 5T8KC 4YT8A 3QA9A 1NPDA 3DZFA 3N7UA 1P44A 3ROMA 2C0CA 3RKRA 3KYCA 4O63O 3BTOA 4TRNA 1GYQA 3E8XA 1Q0QA 2PGDA 4MOWA 3VTZA 4HADA 3L9WA 4EZBA 3OQ6A 3ENNA 1F14A 3UF0A 4R68A 2VZ9A 4TVOA 4UEKA 2R00C 2G82A 4ZVVA 1E7MA 2PD4A 1C0IA 4JJFA 1R37A 1N2SA 3H2SA 4QO8A 4WNCA 5T6BA 3OQBA 4L0QA 4DQUA 4R1UA 1DFGA 2QRKA 3PHGA 5AXDA 2J3KA 3FWZA 4YWJA 4R9SA 1ISJA 1H2HA 3H8VA 2CD9A 4IJKA 2AEMA 4HNHA 4R3WA 4YEDA 3K30A 4B4WA 1VPDA 2HK8A 3W4IA 1PTJA 3FRJA 4E4YA 2AMFA 4CM9A 4CR7A 4E6PA 1P9LA 1FMCA 3BMOA 1QMGA 4W99A 4J1SA 1EFKA 3H9JA 2ZTMA 2SCUA 4PZCA 1ZEMA 1MV8A 3ZHBA 1GL3A 1XWFA 4J7UA 4R5HA 4MVJH 1KY5A 1YL5A 2C20A 2GGSA 2C82A 5DDIP 3V8BA 4BKQA 5L51A 3BMCB 2HCTA 2X5OA 4TKMA 4EYEA 3MJEA 1KEUA 1JAXA 1YB4A 4RZIA 5AXAA 2E37A 5CDUA 1F8FA 1LX6A 4XKJA 1DAPA 2Q1UA 3OIDA 4J1QA 4CPDA 1AHIA 3O4RA 3R1IA 2AEFA 3WWZA 2V6GA 3ASVA 4NFHA 3S8MA 3DFUA 1DHRA 3D4OA 4CM4B 3PDUA 3V1UA 3WICA 3PFWO 4RGBA 4UVDA 4IZHA 3DMTA 1C1XA 3I9NA 4DXHA 4AJ1A 2XOXA 4B4VA 2EW2A 4AJLA 1RM5A 2HJRA 3I4CA 3TJRA 1XU7A 4PLTA 5LCXA 3F47A 1TI7A 2ET6A 3ZWCA 1I2CA 1IPEA 4FGWA 4OL9A 3W4KA 3PZBA 3H6KA 4FN4A 4OM8A 3WBBA 3M1LA 4OMUA 1QKIA 4AJ4A 5A04A 3RBZA 2EIHA 1HETA 4XD2A 5TRTA 4D79A 1KETA 1WXDA 4YQZA 1A7KA 1T2FA 2AG5A 3K73O 3C7DB 1QYVA 4A7PA 1TB4A 1GD1O 4PG5A 3D1LA 4IUYA 4CL3A 4W7HA 4ZU3A 1JVBA 1Y8RA 4FOSA 4FJ0A 3PLNA 3DAFA 2Z5LA 2WMDA 3GDFA 1WZEA 2ILTA 5JAQA 5I7SA 4M54A 2NADA 4N18A 2Y1GA 3GEDA 5L7YA 3L6OO 3HFSA 5CEFA 3L6DA 1DJNA 1N9GA 5T5QA 1G0NA 1GFSA 5JE8A 5JCXA 1YXMA 1LSJA 3WLFA 4MDHA 3OFSA 1KOLA 3LK7A 4R1TA 3I5MA 2Y93A 4IDFA 4JGBA 4D3FA 4CQLB 1EE2A 4IY1A 3WYBA 1ONOA 4U6SA 3QRWA 2ZYDA 2B5WA 4WECA 4BNMA 1PS8A 3HHPA 1LQUA 3PEFA 3ONDA 4CODB 3NT2A 1W4ZA 4JIGA 3F5QA 2OZPA 4MVJD 4G65A 3RUHA 3SEFA 3ZV5A 5B4TA 5L53A 3PQDA 5EESA 1NR1A 2GYYA 2O23A 4YAIA 1JDJA 1FXSA 2VQ3A 1NAIA 1RM3A 2FY8A 1PZEA 1D8AA 1SOWA 1CWUA 3DMTC 4BNIA 3NRCA 1H9AA 2RHRA 3IP3A 1U1IA 4GQAA 1XELA 3NDRA 3ZU3A 3IKTA 3C24A 3DAGA 4TVBA 4BL5A 5L9AA 3JD1A 4UUMA 2HJSA 4LMRA 2NTVA 2PKQP 4ONEA 5LDHA 4J43A 4GSLA 5BT9A 4OJNA 4OYRA 3GVPA 4XR4A 2JHFA 4GLOA 3AI1A 4TSKA 4YT4A 2JAHA 5DP2A 4GI2A 5KVVA 4NDNE 4G5HA 4K6CA 5COAA 1DFHA 3BIOA 4BGIA 4LSWA 1EZ4A 3RKUA 2WEKA 1SEVA 3M2PA 4P8RA 1H6CA 3JYOA 3W6ZA 5EIOA 1P45A 3GDGA 3ZWPA 4FQ8A 3W4JA 2EKQA 3OECA 1PWZA 3TDKA 3WS7A 1M66A 3DBVO 3Q3CA 2YHIB 4M87A 5TLSA 1KVTA 5C37A 2I6TA 3GNTA 3H7AA 1DIAA 4E5NA 4HP8A 4DBZA 2VWGA 4NJOA 4B8ZA 3G1UA 4BNHA 3UCXA 1J6UA 4BMNA 4GLLA 1U4SA 1PJBA 3G79A 4YRDA 4Y67A 1H2BA 1E7WA 3QWHA 2X0RA 4NU6A 5HS6A 3F1KA 2A94A 3JQEA 3GAFA 1LC3A 5BSFA 4RVHA 1FDSA 3JYLA 4K26A 1GY8A 3HDYA 3DWFA 5G0SA 2HRZA 1CEQA 4CUJA 1H93A 1SCUA 1HT0A 1JA9A 1PL6A 4GAEA 5F1OA 3U49A 1JTVA 1HF3A 1DRVA 3H4VA 1LDBA 2WD7B 5JC1A 3NEPX 1NM5A 1SAYA 3ANLA 3Q9UA 3C8MA 2JFGA 4ND4A 3OEYA 3TL2A 3UW3A 1YKFA 2DKNA 4YR9A 1E6EA 1HZZA 2HSDA 1B15A 3WGQA 1NR7A 4UREA 1Q0HA 4RJTA 3GEMA 4OOFA 4NK5A 1HYGA 2O3SA 4CR8A 4QFCA 5JSFA 4PLWA 2PZKA 4QECA 1LA2A 1U28A 4D0RA 4FFOA 4RVGA 5KKAA 1LXCA 4E2ZA 2RCYA 4JP3A 3GHYA 4BB6A 1GYPA 2NV6A 1Z82A 4BVAA 2GSDA 4ID9A 2O2SA 5GMOA 3S1LA 3QVXA 2VNSA 3IDSA 4FGSA 1Q2XA 3I9LA 2GZ3A 1HRDA 2NTJA 5JO9A 3G49A 3EGOA 1PGNA 3UGKA 3U09A 2QZ9A 1GZ3A 1I3NA 4NBTA 3GY0A 2J5QA 3KETA 2BFMA 2RIRA 3HDHA 1T2CA 6ADHA 5I9LA 2BGMA 4GMFA 4A0SA 3PI7A 3K8ZA 1ADBA 4Y8VA 3U4DA 3PRJA 3L4BC 3V2GA 4PVCA 5FYDA 4BNFA 3ICPA 4KWIA 1Q1NA 1JN0A 3BXXA 4TRMA 4F3YA 1EMDA 2JCVA 2QHXA 1PEDA 2PKQO 5JNLA 3GT0A 3F4LA 2IXAA 1K6JA 1LSSA 1R12A 5BNIA 1H6DA 4PG6A 3TOXA 3MEQA 4DYVA 3NTQA 2Q46A 3U4CA 1ZVMA 5F1PA 1HTBA 3BHJA 3VOSA 5HM8A 1E6WA 4BGUA 4YAKA 4NK4A 3T7EA 5K9ZA 1R4MA 2WE8A 3WGHA 3WNQA 3AUAA 2J5RA 1FDWA 3DONA 4DPMA 4LW8A 4BIIA 3KV3O 3ZV6A 4ALIA 3NAQA 4BNUA 4UULA 3AK4A 3ETEA 3HE3A 5KCZA 2C07A 1HLDA 4II2A 2HKIA 4S3MA 3NJ8A 1IHXA 2OGUA 4GGPA 1KVRA 1DC4A 3R0IA 3OJ0A 1YBAA 4JN6B 4DLLA 4LGVA 5A5EA 5JXWA 4JP2A 2XXBA 3W6UA 2WM3A 3JQAA 1EDZA 4AJOA 3OJFA 2OP0A 9LDBA 4HWKA 4RDIA 2P4HX 3F5SA 4I5GA 1CQJA 3RJ9A 3HG7A 1PR9A 2BKAA 4KMSA 3HB4X 3GMSA 3KLMX 3MCVA 2Q1TA 3JYQA 4CQMD 4PLZA 2FR0A 2DC1A 4PG7A 4GKVA 1K0UA 4Z0TA 3WQQA 2O3QA 1NASA 2P91A 4UEJA 1AHHA 2IRWA 4DGSA 5L4LA 3BA1A 4XYLA 3RC9A 1HDRA 4E13A 4BUCA 2WWRA 2X6TA 4RF4A 4J2OA 3OQ1A 1DFIA 3DBHA 3DMYA 1SB9A 1IZ9A 3LZ6A 5TJ9A 3RSHA 1F12A 1YB1A 1IOLA 4D3DA 1D4FA 1J5PA 3L07A 3UCFA 1BSVA 4FFNA 3OP4A 1T26A 3GF4A 3GN2A 3WGOA 3DBRB 4L73A 1Y1PA 2D8AA 1YL6A 3ORFA 2YYYA 4MVJF 3WR5A 4ND1A 4J7CA 2BRUA 4B3JA 2Z1NA 5ER6A 4MVJP 2O50A 1LDGA 4IDGA 3RUIA 3VH4A 2CFCA 1EVIA 1CDOA 3NTRA 1RYEA 3E18A 1F06A 2Y1EA 2OL4A 1QLJA 4JBHA 1UDAA 3ZW9A 5C5IA 1JVSA 2O4CA 4PG8A 4PVDA 1QORA 3RC1A 2JL1A 2VN8A 3WTBA 4OIMA 3AOEC 5CG1A 3R3JA 1YVEI 3G3EA 1IPFA 3MZ0A 3RU9A 4MKZA 2FHSA 5I8WA 5ICSA 1UJMA 3D0OA 3GVHA 4EBFA 3L77A 2ZQZA 1QXSA 4D43A 5L95A 3U3XA 3LC7O 4Q3DA 4Z0PA 4E2XA 3ZV4A 2FOIA 3KM0A 2V6BA 4NJMB 3PHJA 3FBTA 4EITA 3OSUA 1P33A 4Q39A 2JAPA 2BF7A 1ENYA 2BI7A 4ZA2A 5BSHA 3D5QA 4DQVA 1SB8A 5A02A 4XJTA 3WX0A 1R0KA 4NFSA 3KTDA 1U7HA 1U7TA 4MKXA 2O48X 4R1NA 4BB5A 1NFFA 1CYDA 1UR5A 5DULA 2JFHA 3KYDB 4PLGA 1NTOA 2X8LA 3ZNPA 4DIFA 2GZ2A 4Z6KA 1E3LA 3CXRA 1M2WA 1O95A 5FF9A 4A03A 1GU7A 4PG4A 3QJ5A 5A9TA 1J4AA 4ZRMA 3WFIA 3ZWMA 4EI2A 4XQGA 1T4BA 1ZK4A 2OHXA 1GYRA 4Y6SA 3RAJA 1UAGA 1HE4A 3GC6A 4JX8A 4BQRA 1Y5MA 3OIGA 4GPD1 4BNNA 1IL0A 3ZWNA 3GG2A 4XQ9A 1TVEA 1GZ6A 1UP4A 4Z9FA 5KJFA 2Y1DA 3COSA 1KC1A 2IDZA 4GKBA 4BNLA 4PLFA 3WBFA 5JCJD 4RV9A 5IZCA 3F4BA 1BXGA 1C1DA 4DL9A 1HLPA 4GVXA 1EK6A 3DC2A 4XIJA 4W7IA 5GZ6A 2W98A 4WK6A 1DPGA 4YQYA 1GZ4A 1OBFO 3DZJA 1DEHA 4FS3A 3AJRA 1UZLA 2P4QA 5CEJA 5L4NA 4RPGA 3BHIA 1X7HA 4WEQA 4WASA 4PCVA 3L6EA 5IXYA 1PX0A 4WE3A 2Y0DA 4YTEA 3D4NA 2YY7A 1KIFA 2G0TA 5BQFA 4EUFA 3EZLA 3FCOA 5CPFA 4MVJE 1ZH8A 2F00A 4YJHB 1YL7A 5DBFA 1JKFA 3UICA 3LT4A 3WGZA 4YB8A 5C7LO 6LDHA 3PJFA 1MLDA 4RO0A 4FJ2A 1E3SA 3ZNOA 4M8SA 5ITVA 4NBVA 2D0IA 4RCVA 3DZGA 3WGTA 1WDMA 3BMCA 3HB5X 1B26A 3JQ6A 5JY6A 1YWGO 1Z6ZA 1I3MA 4PLCA 1CIVA 1XYGA 4BO7A 1LSUA 1EEHA 4IIUA 3WLEA 4NQZA 2BMAA 2EG9A 1I3KA 3ON5A 4P38A 4NFYA 2C5EA 3IAHA 1LLCA 1U2DA 1N1EA 2EEZA 3TL3A 1GAEO 5TQVA 3HN7A 4WOKA 3PFFA 4IMRA 1PJSA 2FPGA 2GO1A 1IY8A 5HRUA 4HY3A 1IUKA 4CM4A 1YOVB 4RL6A 5TNXA 1VE9A 3H5NA 2FRDA 3NGLA 4INAA 3WMWA 5I7VA 3FWNA 3Q11A 3B20A 1Z73A 4A73A 1NP3A 2PD6A 3DQPA 3FBGA 4LISA 1ONNA 1L7EA 4EJ6A 4BV9A 1U5CA 1PL7A 1EUCA 4W4TA 1LQTA 1MG5A 2ZATA 1WWKA 1VL8A 4L8VA 9LDTA 1BDMA 3CSDA 3AM3A 1ZBQA 3ZW8A 3HJAA 4K6FA 1V3TA 2NSDA 1MP0A 5A06A 4AJ2A 2ZB7A 3D4PA 1RWBA 4FFRA 1M76A 5FI3A 2AQKA 4E5KA 1EVJA 4ILKA 4BKOA 1U3UA 2PH3A 1Q7GA 2QYSA 1OZAA 3OHSX 1EQ2A 1JQBA 2HK7A 4R9RA 1GV1A 2OOSA 1GQ2A 3PQEA 4Q3EA 3PZRA 3B1KA 3QWIA 3DR3A 2DVMA 3M6IA 4UUPA 1DOHA 3I9MA 3MJSA 1ONPA 4MP6A 2X5JO 1NWCA 2CDBA 3KO8A 3RQSA 1LNQA 3S2EA 3P2YA 3DTTA 2H1SA 1DIHA 5CDYA 4GX5A 3GG9A 1IHYA 2NM0A 5TC4A 3G0OA 3I83A 3P5SA 4H7PA 3VPXA 1K3TA 1A7AA 5IF3A 1M75A 4LCJA 1WDLA 2GCGA 5EQFA 1R0SA 1X15A 1NQTA 2BH9A 2HRBA 2WTBA 3WJ7A 2OUIA 3WTCA 3KSDO 2GNAA 3GK3A 3JD3A 1PQPA 2ZTVA 1YGYA 1H6BA 5U9CA 1W6UA 3STHA 1LDNA 1QLHA 1F0YA 1DLJA 2VT2A 3DXFA 5CDTA 4KOAA 2RBEA 3GDOA 4CLOB 2NU6A 5CG2A 4JNKA 3ZGYA 2VZ8A 1B0AA 1I3LA 3DB2A 5JC8A 3QE3A 3TNLA 4MVJG 8ADHA 1XDWA 1E92A 5DN9A 4FOOA 3WSWA 1ISGA 1ZK1A 2POQX 2F1KA 2W4QA 2GASA 3FSRA 4GMGA 1YQDA 2PZJA 1X1EA 3UVEA 1YJQA 3VPFA 3ADOA 1T25A 4EDFA 1WDKA 2W2KB 3KSUA 1B2LA 2CVOA 5DT9A 2NQ8A 1LSOA 1LJ8A 1A72A 4Y9DA 1X0XA 3PYMA 1PJ2A 1R15A 1X0VA 4E2WA 2EXXA 1A5ZA 2CVQA 2GLXA 4FIZA 1B3RA 4AJNA 4IJUA 4RF3A 2Q49A 4D0SA 5BSGA 4PLHA 2O4UX 4Z3KA 2IZ0A 3IP1A 2E48A 4NR0A 4MIYA 1KYQA 1O89A 5AYVA 1T24A 5JAZA 5EINA 5IXSA 3BMNB 3K92A 4IQ8A 2B0JA 2PZLA 3MOIA 2VHVA 3MOGA 4O5OA 3VVBA 4BNKA 3H65A 2OMEA 1UZMA 4IJWA 1LUAA 5IFLA 3FF4A 3GMDA 3ENKA 1DC3A 3SJUA 1XHLA 4PFJA 5JDIA 5L7WA 1LU9A 3FTNA 3BTUA 2X23A 4JROA 3H9UA 1DRWA 1JWBB 4YJFB 2X0JA 2IYOA 2Y1OA 2JCYA 5JY1A 4J4TA 2YFQA 3E9MA 3AFNA 1ZNQO 5KNLA 4FD3A 3WB9A 2WJPA 3HN2A 3SC6A 3BYZA 2O7QA 1DAOA 2HMUA 3F6YA 1C0PA 3BZUA 3PP8A 4XA8A 1I5RA 2VWHA 5K0ZA 4I5EA 5KJ6A 2BLLA 3X2EA 1HYEA 4CLXA 4IQGA 2W2LD 2NQTA 4CV1A 2EKPA 3I6IA 4HFRA 1E1NA 3GFBA 3AM5A 1LDYA 4CMCA 2VWQA 5AOVA 4R16A 4YAEA 3PTZA 4EJMA 1HYHA 2PGJA 4CMKA 1Q7CA 1O5IA 1ULUA 1X13A 2I5PO 4P4GA 3NT4A 2O7SA 3HADA 4XRRA 4BNYA 1RPNA 1Y8QB 2I3AA 3BHMA 1S6YA 1LRJA 2J3JA 1VKOA 4NNJA 3D7LA 3X2FA 5EMHA 1U4OA 1PU2A 4XDZA 3DZIA 3I9JA 4ZQFA 3NUGA 2JHGA 4DC0A 5IZ4A 1BW9B 1ADGA 4HNGA 3WOHA 2VYND 3KZVA 1BRMA 1LLUA 5DP1A 1HE5A 3AM4A 2NU8A 4MPDA 2X9VA 3CIFA 3GHHA 2Q45A 3I1JA 2Y66A 4A27A 1B7GO 4CQMB 2OORA 1A4UA 1BWSA 1E6UA 2BI8A 1WZIA 2VTDA 2H5LA 1ADCA 4C4OA 5LC1A 4ALNA 1KS9A 5ES3A 3GNSA 4BNJA 3EW7A 4J9VA 1KVUA 3ABIA 2G1UA 1BG6A 1UDBA 1ZMTA 2QG4A 1HDOA 3JCZA 4WCFA 4FFPA 3ZWYA 4K9DA 5JYDA 1E3JA 1JLLA 4N5LA 4KDEA 1O9BA 3GVXA 4RPHA 1PJCA 3CUKA 3ZZNA 4YJGB 4OAQA 4GGOA 1IULA 1HZJA 5I9MA 3LC2O 1U5AA 4BO8A 4DC1A 4Q3CA 4DUPA 2XPCA 3QVTA 1KVSA 2Q1SA 4JJGA 4R4JA 3NV9A 1BMDA 5KWEA 1LI4A 3I9KA 4Z9XA 4WGGA 1YRLA 3MJVA 1V35A 2B4RO 2LDBA 3AU8A 3HWRA 1AN9A 3IKVA 5G4KB 5ITWA 2FP4A 1N8KA 4ZQGA 3NDJA 4XYGA 3O9ZA 4F46A 5EQDA 3WYCA 3EC7A 1TT7A 3ZN2A 2C7GA 1R4NB 2GF2A 1RYDA 4XYBA 1GPDG 1E3EA 4YVFA 3OBBA 4PRKA 1N5DA 2CY0A 1C1XB 2TMDA 2WDZA 3ZWBA 1UXHA 4BO6A 3DBLA 3WGIA 4Q9NA 1FDUA 4LVUA 3SLGA 2Q1WA 3WIDA 3PK0A 1PJTA 1NPTO 2A4KA 2C29D 4CUZA 3BAZA 3CKYA 2PV7A 3TWOA 4CM7A 2EP7A 3KYBA 2NNLD 4JJIA 1ZK0A 1SBYA 1VLLA 4DIBA 2EW8A 1G6KA 1SZJG 4A26A 1ZW1A 3S2GA 3W8FA 1EDOA 1X1TA 3WJAA 5C7IO 3JYNA 1NFQA 4FR5A 5A5FA 4NZ9A 5FWNA 4H3VA 2HO5A 3ZWAA 2J8ZA 1OAAA 3U4IA 3O26A 2CZCA 3QV1A 2X9NA 2ZB3A 4WCFC 5G0WA 5JAIA 1E3WB 1R66A 4LN1A 2VYVD 2NWQA 1UZNA 1I36A 2X0IA 1PS0A 3AI2A 1N9GB 4IXTA 1P1FA 1NYTA 3D64A 5TF4A 4U7WA 3PHIA 1Z7BA 2QRJA 1PR3A 1KEPA 4DMLA 4L74A 3AWDA 1E5LA 3VDQA 2J3HA 2BGKA 2VHYA 2OBYA 1EUZA 3TOZA 3H9GA 1PIWA 1ENPA 5KVSA 4JXKA 4WJZA 4DQXA 3HDQA 2W90A 5THKA 4UAGA 2QW8A 4DBVO 5EN4A 4GX0A 5KJCA 4KZPA 4OKIA 5U1PA 4D3SA 4DPKA 3RUFA 2NLOA 1HDZA 1NVTA 3OETA 3GLQA 4BKPA 3LVFO 4BNXA 3NTOA 4E2YA 3VC7A 3CINA 4WOJA 3TZQA 4R5MA 1PJLA 2O3UA 4E5YA 3QP9A 2Q2WA 3H3JA 4B7XA 2VRCD 3EK2A 4MINA 5I8ZA 4CM8B 2X7HA 4ITUA 1FK8A 1Q7BA 4GL4A 1ISIA 1BXKA 2HMWA 4PIVA 3W8DA 2ZYAA 2CNBA 3ADPA 1O8CA 1ZK3A 3ZWXA 4EUEA 2YFHA 1NQ5A 1PGPA 1A27A 1ORRA 3UH1A 2I65A 1P0CA 2CF6A 1NQAO 3UUWA 3U9LA 1I8TA 2UDPA 4W82A 1A9YA 1NQOA 2JCXA 3AI3A 3I23A 4AVYA 4FW8A 3ZWWA 4MP3A 3TPCA 1GTMA 1ZCJA 1T2AA 3ANMA 3WQSB 1I33A 4W9NA 1P1JA 4CLRB 4O0LA 1B14A 4L9RA 4QSMA 4QTZA 4J90A 2PTGA 1JKJA 4XB2A 1EQUA 1E7SA 1Z7EA 1WMBA 1LEHA 3ZHYA 3EVTA 2FZWA 5IAAA 1Q0LA 2B83A 3FPLA 2NVUA 4CM9D 3VH1A 5I7EA 4IJVA 4E31A 1ML3A 3ETDA 4NHEA 2W8ZA 5GY7A 5JDCA 3CZMA 5DBGA 3GFGA 1GR0A 1HEUA 3S2IA 4F6LA 3IUSA 5BR7A 1XSEA 3OJLA 4M49A 4OOEA 1QV7A 2UV8A 5TT0A 4FBGA 4PRLA 3AY6A 3C1AA 1XCBA 3C85A 4Z0HO 2GD1O 3C7CB 3A06A 3RD5A 2BHLA 4BO9A 1T1RA 4I5DA 2DTXA 4DYDA 4KTVE 1QR6A 5H82A 5L7TA 2VOEA 5JYEA 5J23A 3LYLA 1IB6A 1HSZA 2VUUA 1ZK2A 2NU7A 1HE3A 5TGDA 2A92A 4OO3A 1QRRA 1DB3A 1GDHA 2ZTUA 1JW9B 3WGGA 2VCYA 4OKNA 4RVDA 4BO3A 4B7UA 2ZQYA 3EZYA 5JAMA 1E1LA 1UUFA 2YDXA 3N74A 2BD0A 2C2YA 5ILGA 1S7CA 3GPIA 3O03A 1HXHA 4EUHA 4ALLA 1E1KA 3PGXA 4QO7A 2I76A 3B70A 3LU1A 4XEHA 3RVDA 5A1TA 5IJZA 3D5TA 4WKGA 1DBVO 5FFFA 4CMBA 4BO4A 4WLNA 1KEVA 3W8EA 4BMVA 4UEOA 3GA0A 4W9NC 2X22A 4I1IA 4K1LA 1ULSA 4XGKA 2ZB8A 1ARZA 3VPSA 3FN4A 1YOVA 1ZJYA 5FEUA 2CDAA 2ZCVA 1P31A 1TXGA 5IDYA 1I2ZA 1BHSA 3NYWA 4TMFA 4GBJA 3Q2IA 4XDYA 3LT2A 4II3A 5A4DA 4UUOA 5JDCC 1MB4A 2DAPA 4U0KA 3OEWA 4DIOA 2EGGA 4D46A 3QY9A 3DZKA 1P1IA 1GADO 5A03A 2ZKLA 5IDQA 1RM4A 3AY7A 5L4SA 1UH5A 4RPJA 1DXYA 2D59A 4JK3A 4N7RA 3T4XA 2BGLA 2DUUA 1YE3A 4PLVA 2NTNA 5AVOA 1JWAB 4NIMA 3GN1A 1DSSG 4U6QA 4I08A 1YBMA 2XXJA 4IM7A 2Y99A 4MVJA 2VZ0A 1DIGA 2O3TA 2P2SA 2H9IA 3HDJA 1EUDA 2YZ7A 3O8QB 1P74A 3JQGA 1HWYA 3Q0EA 4J7XA 4J1TA 2PA3A 3A28A 3GGOA 3IUPA 1WPQA 3LT1A 4E30A 1VSVA 3KLPX 4KUEA 4P22A 1UXIA 1R4MB 1VI2A 4OHUA 4G81A 4MIEA 3FNFA 3JQ7B 4CMAA 2YQ4A 1PZGA 4BNGA 5JMWA 2CSUA 3UFXA 3RFTA 4HFJA 1ZSVA 4Q3AA 1OI7A 3U5TA 1KBZA 4EEXA 4KTTE 2CVZA 1TEHA 1W0CA 1T4DA 2PR2A 2Q4BA 4JBIA 4DMMA 4M86A 5EPOA 1OC2A 2OXIA 1WLYA 4OXKA 4GWGA 3VVCA 2I9PA 4YT5A 4LCEA 4E12A 4R41A 4LSMA 4F6CA 2EF1A 3I3OA 5ICMA 2NACA 2ZTLA 4HFMA 2GPTA 4AJIA 3PXXA 2YW9A 2I66A 2JFFA 3MTGA 3GGGA 1AUPA 3KOUA 3TRIA 1NX6A 4IS3A 2XAAA 3INTA 1TA4A 4U8GA 1O94A 1O0SA 2IZZA 4CLOA 3OF2A 4BKUA 5H83A 4AICA 3TZKA 3KSZO 4DPLA 4CMHA 1NFRA 2YQ5A 1EFLA 1TLTA 1E5QA 2FR8A 3U62A 3M2TA 3QWFA 3UOGA 1PL8A 1SMKA 4YT2A 3DBHB 1BXZA 4AJEA 1LLQA 3A14A 3GUCA 5JFOA 1PJQA 3OICA 2X58A 5KVCA 1Z74A 4CJXA 1H94A 1P3DA 2W2KA 4U5QA 3B6ZA 4ZGWA 1C0LA 1WVGA 2P5UA 1CF2O 4J2HA 1V8BA 4BO0A 3INRA 2FPIA 4FC6A 3WSVA 1M67A 1IYZA 4XGNA 5IZCC 4TRJA 4BO2A 5JW6A 4CM3A 5FI5A 1MXFA 3ZDFA 3QLJA 1Y6JA 4CLHA 2BELA 3WIEA 1W8DA 1Z45A 1YONA 1HL3A 3PWZA 4L76A 3UCEA 1E7QA 3RBXA 4ALMA 1QYCA 1CERA 2OBNA 2GN6A 2Q50A 4EGFA 1QYDA 4LRTB 4UVGA 4BNWA 1PJ3A 3DHNA 3D3WB 1ZSNA 5ENVA 5CPBA 3TZCA 2QQ5A 1HDCA 4WUVA 1GEGA 1ENOA 1VRWA 4CM6A 4CV0A 1ADFA 4HXYA 4X54A 4IZIA 4XR9A 2UUOA 4CMIB 3K2BA 3QVWA 3T7CA 2DPGA 4XRGA 4XIYA 3E82A 4WEOA 3HZZA 3S2FA 4ZN6A 2CF5A 2JD0A 1P1KA 5T64A 2DQ4A 5F5NA 1SOVA 2D1YA 2DPHA 4ZQBA 4AJKA 3VPHA 4XZ3A 4N5NA 4YRBA 1FDVA 1V3UA 1XQ6A 2O2YA 3SBOA 5IN5A 4J1NA 3QHAA 3HUDA 3DDNA 2PH5A 5A3VA 3Q2KA 1D7OA 2AEJA 4ND2A 4FB5A 2YJZA 4A10A 5C7OO 1G0OA 1HDXA 3TF5A 4BHTA 4GX2A 1MA0A 1ZXBA 5HS4A 2YV3A 4CQLA 4BNZA 4E33A 4GVLA 1UAYA 1VSUA 3DTYA 2UVDA 3SVTA 2P9CA 3GUYA 2ZK7A 3JQ8B 4GSKA 1YO6A 4FPXA 4URFA 1YDEA 3NKLA 4YAGA 4MIOA 4BO5A 3JSAA 2OP1A 3C3XA 4QEDA 4S1VA 1I24A 2BFPA 1QSGA 2UYYA 3I52A 3JD4A 2WYUA 3ASUA 1NHGA 3KVOA 4I9NA 3TZHA 3B1FA 7ADHA 1ISHA 4YBZA 3P7MA 4Z9YA 4RORA 5A9SB 2AQHA 4UVIA 4OGWA 1T2DA 4NU5A 3RC2A 1YDWA 2WSBA 3ZV3A 1VJ1A 3PVZA 4J91A 4EEZA 1LRLA 1Z75A 1SC6A 2HU2A 3E5RA 4RVFA 1PWXA 1B16A 1C1DB 4E32A 5H81A 4ZJUA 1BTOA 3WGYA 3WMXA 1MFPA 1N92A 1H9BA 1X14A 3LT0A 1NXQA 4RLHA 3F1LA 3RUEA 4U0JA 1BW9A 5F5LA 5TS3A 2V6MA 1XIVA 2AE1A 4RZHA 1TT5B 2X4GA 1T1SA 2V6FA 2WD8A 1P0FA 3PHHA 3JQAD 1U2GA 3A9WA 2Y0CA 2JD1A 4YCAA 4XX0A 3P2OA 3GZNB 2DTDA 4BV8A 4N54A 5THQA 4CQMA 1B8UA 3KXDA 3LLVA 4DTIA 3RBVA 2YUTA 4R3NA 4CMEA 3FPCA 4J16A 1Y81A 2VUTA 3ITKA 4IS2A 4BGVA 2IE0A 4Y6RA 3GGPA 2YHIA 3L4SO 1V6AA 2I3GA 3IIEA 5DOVA 4BNTA 3ZU5A 1PQUA 3K96A 4HBGA 4YA6A 3KHUA 4JCOA 4YJGA 4D44A 4XB1A 2DFDA 2EV9A 4FSHA 2JD2A 2G17A 4RQTA 1RM0A 2V7PA 5EERA 1B8VA 4WLEA 2QIOA 2Y67A 4B7CA 3VKUA 4IINA 4E21A 2PNFA 2Y05A 3PYXA 3WQRA 1K5HA 5G0VA 3JD0A 5G4KA 2D5CA 3GPDG 4GX1A 4R51A 4M89A 3UHAA 1UP7A 3PLRA 2D5AA 1H0KA 4D45A 3FI9A 5CP8A 1VC2A 1R4NA 4BOYA 2DTEA 5A9RA 5K6AA 4FJ1A 2VHXA 3H5AA 4LRSB 2WD7A 4M1QA 4IDAA 1HKUA 1YJ8A 4ALJA 1DC5A 1DLIA 4Z3DA 3U4HA 2V65A 4NG5A 3BMQB 2IZ1A 1JU9A 2D2IA
chains in the Genus database with same CATH superfamily
1BDBA 4J49A 1Y6GA 1UOPA 2OY0A 1D2HA 1XTZA 5J59A 1EJ6A 3I42A 3IH5A 4NBLA 5D5PA 1DCFA 1L4FA 1U2GC 2EX4A 2Z09A 5ALIA 3ZHOA 1SGWA 1ZY2A 5CHEA 2C9OA 4Y0AA 5KYGA 4NMHA 2VTBB 3N8GA 4FYPA 3ICEA 2ZJ0A 2J9ZB 1EBFA 1CJCA 4ZD6A 721PA 3WGJA 3QEBZ 1KYWA 3EZ2A 1DQSA 4KR3A 2ECQA 4OF4A 3Q9NA 1MX3A 1T2EA 3CJRA 4PTLA 4COKA 1R18A 1CJBA 2MYTA 1EDDA 4DEVA 4P31A 5HP4A 2VWPA 3I6QA 3AHDA 3UENA 1YRYE 1ZKDA 3IVAA 4NF2A 3RJ5A 3ANYB 1RAFA 5LQRA 2XOKD 4I9UA 1FVFA 2FPRA 1MDFA 4BQFA 1P5RA 1XG5A 4F5DA 3ZZ0A 4E3ZA 1BMTA 2P8SA 4QUHA 5F2KA 4IDCA 1E7YA 4JB3A 1K68A 1VI6A 2AQ8A 2J6CA 4QQ8A 4QYXA 3S3TA 1CZNA 2XCQA 4L57A 4WZZA 3V1TC 2QRNA 1CLUA 1K7EB 3BL5A 3L6RA 4ER3A 5K4HA 1IONA 2QSZA 5JI2E 3GLGA 1E1CA 1R5JA 1H5NA 1MC5A 2BR4A 3EOBI 3FLEA 1CRQA 1TJ4A 1C7EA 1X2EA 1KI2A 2DBZA 2PZ8A 2WSYB 3EVNA 3IP6A 1ODTC 3B8EA 2C2XA 1JHUA 2IIPA 3I9FA 4YXWA 3ROPA 3U3MA 1VYVA 3RWBA 2MWMA 2H48A 1V47A 2K2WA 1M34B 2XKBA 3ZI0A 2IYVA 3KYCB 5F21A 3FUWA 1U9ZA 1GAXA 4CL8A 5CYPA 4H1WA 4IBOA 2JJQA 2XKKA 3ZUGA 3CRZA 3C7KA 4A6XA 3AP2A 3AU9A 1R0WA 3RFVA 4B31A 4C4RA 1NAHA 3PYLA 4DDTA 1HH4A 2O7NA 4OQQA 3BQNB 4OXNA 4ECAA 1ESMA 2AI1A 3JALB 1M6NA 4RTRA 1C5KA 5AW9A 4P4NA 1W36D 1JLKA 1U8FO 2HWUA 1PO7A 4AMYA 5JDIC 221PA 1T2NA 2EP5A 5EMLA 3OFJA 4WADA 3LI2A 2YQZA 1G66A 4HYEA 1K2WA 3T3DA 4BMXA 3OFKA 5ESDA 1ZFNA 2I4NA 2P7HA 3ITDA 4EA6A 3FVWA 4GOND 3IERA 4IDDA 4YWHA 2CNKA 2VBCA 1JFLA 3BMOB 4WXEA 4DREA 4X8MA 5DF1A 1C7JA 4CR6A 1GQFA 1S8AA 1BEZA 1YS1X 1EE1A 1MGOA 4WLFA 1C3JA 4IIJF 4ZRNA 2X9GA 5A62A 5K3CA 3S5JA 1WAMA 4EW6A 1CUDA 3PWSA 5FOWA 3MB5A 4BJ3A 1J0CA 4N3NA 3KXLA 4CLRA 1UOOA 1V6CA 1LVUA 3EY9A 3RUDA 4G2NA 4PAWA 4Y2GA 4A8JC 4S1OA 1Y8CA 5BMOA 1NU8A 5AJZA 5AKYA 1JDSA 1T8YA 3JVIA 3L82B 3CLSC 3T38A 5TX7A 3CPSA 1TLLA 4YYZA 5K0GA 8MHTA 3A6JA 3N8IA 5JMPA 3EGEA 3DPSA 4K8RB 4AFNA 4B79A 4F2WA 1W75A 2XGSA 1DHTA 1I3CA 3KT8A 2OV3A 4IIVA 2WFZA 1CUCA 2JGAA 1I32A 3HYTA 2QT9A 1TADA 4E5MA 2BKUA 1P17A 1NVBA 3WNVA 1WMEA 1TCBA 1WHTB 2NVBA 3BFJA 3QTLA 4OJMX 3L1UA 2GCPA 4EB8A 2QM7A 3KKMA 3E1KA 4WLOA 4M2LA 3R5JA 1UIMA 4U3JB 4ZYWA 4DQLA 3UKOA 2Q8QA 1EDBA 3QFSA 5BNFA 3Q7RA 2GZ1A 4WCDA 4ZT7A 1UBUS 1RAIA 4RSMA 4ZVQA 3DFZA 5CA1A 4PLYA 4L6CA 4U9HS 1E94E 2C2MA 4F5YA 3D8SA 3FR7A 2FF7A 1RXEA 3H4IA 4D8TA 4H4EA 3QUAA 3E9YA 3OCWA 1VHQA 2XJ4A 3AY0A 3EQ7A 2AG0A 1ZPDA 3AF0A 3T3EA 2DBVO 1TTTA 1IQ0A 1JIQA 3FIUA 4ISBA 2EKBA 3GLHE 3MJCA 4B48A 3K31A 3R9WA 1KZ6A 1NMQA 4OYYA 2IZ6A 1UBKS 3NBZC 1T6XA 2YNMA 1V8DA 1Y8RB 3HKCA 5AXBA 5DMHA 4EVQA 1X7XB 4ZARA 3X3HA 4R1PA 3TB6A 1ULBA 2LKCA 2D7JA 1GU1A 2R1ZA 3WGUA 3BXFA 3RYHB 3R7WA 3GAMA 4X8OA 1N7JA 4BE7B 3QQPA 3A1VA 4YLYA 4RF5A 2PKCA 2OSVA 4IIJA 4UNSA 2E82A 5DIFA 1MENA 4K2AA 5K2MA 5KPJA 2QNIA 1OC4A 3C7TA 4HWOA 1JHYA 2Q2VA 3I6BA 2FEKA 2IGTA 2NUAA 4Z54A 5JD6A 3KUXA 2PMEA 4ZOBA 3WLTA 4FHGA 2HDWA 1PX2A 1DRJA 2VBGA 5JXJA 1EXDA 4O3MA 4RELA 2GZAA 4XASA 3AQ4A 2P9YA 4OQ4A 1UAAA 1KAOA 4TTIA 2QMYA 4R69A 1GFIA 3OUZA 2FTKE 2XMRA 3CUEF 1AG9A 4TSFA 4BQSA 3CZ9A 3AOGA 2ADMA 1K3UB 1ENZA 4BO1A 4IGEA 2A5JA 3R0XA 2O9JA 2P1RA 2P9EA 1G5TA 1DX4A 1VKNA 1B8PA 1YD7A 2DPLA 3R6DA 4JBGA 1Y9AA 2P62A 1KFKB 3H2IA 4N5MA 5ALLA 1KQNA 4TKUA 2M6KA 5CITA 5LN1A 4C4SA 4DV4B 1BFKA 1OCEA 2BHTA 3R5SA 2GF0A 1QK5A 5E7IA 1CYEA 3DHEA 3LTEA 2JEZA 2GAJA 3U19A 3P2MA 2CDNA 3FNRA 4MQ5A 3FOZA 4DLTA 5IT0A 1LDMA 5D1HA 3SQMA 4ZT2A 3HCBA 5B1IA 5K0LA 3ER6A 5BSRA 2C54A 3OTOB 3LJKA 4AL4A 5DZSA 4DUGD 2PPLA 2YV2A 2ATCA 4JDUA 3KTAB 4JEIA 2IITA 1JTFA 3T9FA 2BGTA 3UMRA 2M1ZA 3WHIA 2WBLC 2WT4A 4E70A 3AEQB 2EX1A 3ORHA 5AW3A 5CXUA 2RD2A 1FDIA 5J5CA 2QLBA 3FSGA 3DF7A 1MXHA 4QJBA 3EJ6A 3HBFA 1QHHA 4OSEA 1KF0A 4OXYA 5G0TA 2YWXA 3BD9A 2QE7D 4IVRA 1CRWG 1KP3A 1A04A 1AXEA 1TNDA 1TU3A 4AJJA 2FSUA 4P4SB 1ISFA 3WLOA 4RA9A 2DT5A 2UZ1B 3W5SA 4QBIA 4ETNA 2QX4A 2WG1A 4PPNA 4MS3B 2FPPA 2VJYA 4CDGA 4PZLA 3FGNA 3UXYA 1IUPA 1M5TA 4EHNA 2J5XA 5JRDS 1GSIA 3RDPA 3TQRA 3W2TA 4UDYX 1RVV1 2PGXA 2VUSA 2OGZA 3B3GA 4KC0A 5EKDA 1J42A 2DWOA 4LRWA 5IAKA 5AIBA 4QC2A 3R8CA 1OASA 4BFVA 3DW1X 3VJKA 3ML1A 2OVFA 3ET4A 5F9FA 1QRDA 1ZUWA 1QYIA 1XJ5A 2C99A 3OLQA 5FA5A 3QITA 2JLCA 4WXPA 3T9BA 1O6ZA 3UJBA 2E4AA 2B8NA 2EL9A 1MB9A 3EIEA 4B4OA 3L0SA 5CDGA 2QXTA 3KQSA 2YV5A 4IGFA 3KP1A 1A5AB 1YBVA 4KVZA 2Q5LA 4YJHA 8LDHA 3VVLA 1T3HA 5HCUA 1P2VA 4JUDX 2GOYA 3CCBA 2D1QA 4NE7A 4BNVA 5BNTA 2HN9A 1GP2A 3GRFA 3K53A 5C81A 1DXHA 3AY3A 1HT1E 2VJOA 4B0OA 5CB4F 1H2RS 2VHZA 1SIOA 3NWEA 5F73A 3HYLA 2KBEA 2QX7A 4IEIA 3LXMA 3ZOKA 1MX9A 4KQ6A 1QHGA 2BFCA 2Q5JA 2V55B 1B1AA 2J5BA 4WSOA 1K0FA 1Z5UA 1XRLA 2YV1A 1GL7A 3IUMA 3JARB 2CJXA 1PQ4A 2O5RA 3QENA 1WXIA 1ZN9A 2PGAA 4JYCA 4QOHA 4RVSA 5B37A 4J0IA 3SSAA 5I7FA 5I7HA 4RWEA 2X41A 2WAYA 2AXQA 3CUUA 3H83A 4BYMA 3WYEA 2NPIA 3F6BX 5DYWA 3LL7A 4IJ6A 2A0YA 4J4BA 4MIKA 1SXPA 1HFJA 5ELXA 3R77A 1AE1A 1E3IA 2VSQA 4FR0A 4EW3A 3DWEX 4CG1A 5T4FA 3VX3A 4FC7A 4MVWA 3DZBA 1U9CA 1FQKA 1AN0A 3GMTA 4TT8A 3IAFA 2NU9A 1E2KA 2C4TA 2R44A 4ERNA 1I7LA 1U0SY 1W46A 1GPYA 1WQ3A 4QUBA 4WKPA 1Z0SA 1ZJWA 3FCYA 4XGIA 2P2ZA 3AR6A 5KCMA 2YIDA 3RRFA 2EJBA 3I2GA 3SVZA 1E64A 1CZRA 2NG1A 1GPUA 1O6CA 1OLXB 2Y68A 2QI9C 2BR5A 4A9AA 3NZEA 1QE3A 3D3KA 3W90A 2OB2A 2ZRCA 3SJCA 2HMVA 3TSZA 3QSGA 5JVDF 1XU4A 2FJUA 2AC2A 4X7BA 4E5UA 5BSEA 5IT5A 4M6WB 2FSPA 3AUSA 2QD2A 3M5CA 4K05A 3Q9LA 1DOZA 5CT4A 5EWLA 1EG2A 1FTGA 3HJGA 1N3BA 3L9XA 1SWWA 1G2IA 3QKWA 1W4RA 4M36A 1E2HA 1L1RA 3FB1A 4RPKA 3SX2A 2ENUA 2NUTB 1FFXA 4FFMA 4HLNA 4C03A 1N3YA 1SU4A 4MLCA 4A0QA 4C3VA 1QG4A 1OH8A 2ZIUB 2X77A 3IPLA 1CG6A 2AXPA 2NTEA 4LDPA 4CMIA 1RQ7A 5M34A 1QS0B 2ZWAA 3LSYA 3FHLA 3VTFA 3UMMA 1UDWA 1UJBA 5HTOA 2QTFA 4CKCB 5EKXA 4YRMA 1EE9A 3AIMA 1ZMOA 2QYTA 4YCMA 5CB4A 1K89A 2K87A 4NQRA 3TJZA 1M2GA 2D3TA 3D7SA 2BDEA 3VNUA 4DG9A 3KU4A 2XUPA 1E1RD 4YACA 5TJHA 3QFFA 3SC3A 1SOUA 1R4AA 2Z2IA 2FQQA 4RIFA 3NHYA 4HNTA 4OX9B 4ZALA 4RE5A 2H4FA 4DR6B 3CLSD 5DHQA 2O59A 3WXBA 3BK7A 4HDKB 1Q2UA 2UXDB 1L4LA 1WPXA 3Q72A 4NXNB 4IGAA 3ZNPA 4DRZA 2F43A 2C2WA 4ZICA 4MPTA 1NBOA 4MHOA 2QBYA 1JI3A 3JQFC 4GG1A 5KOIA 4OATA 4EG7A 3G0IA 3WDSA 1EBUA 2JAXA 4FEAA 2XA1A 2G0AA 1NBHA 1W4LA 3R23A 3TZEA 3E61A 3NNDA 1ZDMA 3E22B 3H5OA 2AH5A 3JVEA 4Q3NA 4PTYA 1BQEA 3A4LA 1Y8AA 3P19A 5JRJA 1C4XA 2VPXA 2Q5EA 2UVPA 4HRXA 5EMMA 1I2BA 2Y0EA 2ZI9A 3OJEA 5ITZB 2ZUBA 3IL2A 4ERXA 3RRMA 3QPCA 4H7KA 1TW2A 4D42A 1ZOLA 2PWBA 1SQGA 3N0WA 1BEUB 3EPLA 2IH4A 4IDBA 1NULA 1NURA 2X4LA 3ZDDA 3AR4A 3K1AB 3QJGA 3GCZA 3BE8A 3A05A 5JVDA 1EFAA 4FR2A 5DLDA 4ZHSA 2XLBA 2WA2A 3BCSA 4C29A 4FFBA 2PJUA 1ZD1A 2Q07A 3MFYA 2KB0A 1M1YB 3MAAC 3PQFA 3BK2A 4G4IA 2FR1A 3K0AB 5TE9A 5K05A 1GTRA 1BAPA 1FP1D 2VJPA 1NVGA 2WU1A 2ROQA 4LHZA 4XM1A 2NVUB 4ENUA 3A4VA 4EFKA 3QIAA 3PNMA 2CHFA 3II6X 1UFRA 1K06A 4QOGA 5KYTA 5EL0A 2MTBA 1ONSA 1G2OA 3KB8A 4ZKDA 4RXTA 1WMAA 2NSJA 3O8BA 1N6RA 1QE0A 4UD6A 4EM6A 5PNTA 4DWOA 1E1MA 1TMOA 2FZLA 2JGMA 4J0JA 4RH1A 3L8EA 4EI9A 4JVSB 2VDWA 4QODA 4KIUA 5HPYB 1QH8B 4A91A 5I7WA 1FRFS 4CTNA 2H6EA 2MYNA 3ZJ5A 1EBBA 1QTIA 5EIFA 3URKA 4IMPA 3V7WA 3VPGA 3C3CA 2MSLA 1QFMA 4J1TC 2ZWIA 5DNVA 5KTOA 1DX6A 4IIEA 3PX7A 4LECA 2F3UA 5A7FA 2PK3A 5DM4A 2I7TA 3G17A 2N9UA 2QTRA 1U8UA 1NT2A 3W79A 4RKFA 4US2R 1QP7A 4L2IA 3GPBA 2VPQA 3E5MA 4A0RA 1Z29A 5ICGA 3KBBA 1B23P 3LWZA 3AF1A 4K9OA 2VDRB 4JOQA 2VDJA 1PSDA 1LGYA 1X8XA 1HDGO 1ZXXA 2RCNA 4O59O 2DU8A 2XDQB 2DE0X 3LY7A 3O3NB 2DFVA 4R8MA 1NVKA 2R62A 4Q21A 1SVUA 3Q3IA 1NXOA 2OO5A 2SKEA 4G23A 1USGA 5ALZA 3V3KA 1K7FB 3H5RA 3LLSA 2PY6A 4PZEA 3VO1A 4MKHA 2VI5A 3T1TA 2W6CX 4MW4A 4BLVA 3B1XA 1UQUA 5KDOA 1M2OA 3BMNA 5EIAA 3VU9A 5T67A 2OYSA 2C7VA 3ANNA 3OZIA 2TECE 4XXHA 2IHUA 1CR4A 3IXLA 4TZTA 5T4BA 2Q8NA 3A2NA 3VR4H 4DB4A 4FM9A 2XYRA 3WG9A 4QDTA 5CLGA 3WRXA 1ID1A 4I8IA 3E6AA 4IFTA 4IVPA 1VG1A 2PMDA 1YQXA 4S2EA 4E88A 4GP7A 5BW8A 3NONA 1AO0A 3LOQA 3GNQA 5TQ2B 4QLBA 2PD3A 5C51B 3F7NA 2WKWA 1RHMA 3RHZA 1PZXA 5HRAA 2PAAA 3VHXB 3NKVA 1TD1A 2GI4A 3LAWA 1UKAA 2HMSA 4HKTA 4QDUA 2Z95A 1JF8A 1N7GA 3BWEA 5BQPA 2YZMA 4IV5A 4NXMB 4LJLA 2AOUB 1WM1A 3O3MB 3ETJA 1BXRB 4OQNA 3ZWOA 1G6OA 2WJZB 2GN1A 2RHCA 2ZAGA 2H2WA 3HBMA 5BSUA 3C1OA 1XKQA 4O6VA 1GPMA 3BS4A 4AJPA 4DHWA 5BVHA 3N7AA 4M98A 4RZXA 1JNYA 5KOHB 3FCAA 5LYJF 3QE0A 4RKWA 5ELMA 3A3OA 3HL4A 1M7BA 1RJ9A 3ZWVA 1W2HA 3PWKA 1XXHA 4F97A 3B2EA 3Q1KA 1UJ5A 1V3VA 2P3QA 2WJ4A 1D1TA 1KMQA 2G76A 3JQGB 1HDIA 2H1CA 2ZYVX 1QB7A 5B30A 3BRQA 3QW4B 3LQ4A 5H0IA 4W5QA 4XWYA 3HXLA 2BMDA 3OC6A 4DM4A 2XCTB 3PGJA 1NXWA 1E77A 4NCAA 1PEAA 2CV2A 5CM9C 3JR7A 3LY8A 5FJJA 1WF3A 1X7WA 2IHZA 1HGXA 4L1KA 2JAQA 1OB2A 3FYUB 1AGNA 4G0YA 4P34A 3F9RA 1P2DA 4JNCA 1CVRA 1MC4A 5HEKA 1BXGB 5JCOA 5TQ0B 1SBTA 2HA2A 1MRSA 4QGAA 1P44A 1DKLA 5K0EA 1OJ7A 3KZOA 3VA7A 5HE9A 2QRQA 3RKRA 2IXDA 5F4ZA 3H2BA 4DOMA 2CC2A 1KDPA 2QN2A 1X7ZB 4MWDA 3R7DA 2NXNA 4TLLB 4X92A 5ABPA 5CBPB 1F0NA 2BL4A 1F14A 3ENNA 2N0SA 3CWZA 3OQ6A 1PNVA 1RI3A 3L7JA 3GLUA 4UMFA 1PHPA 4MR7B 4DUZB 4FD2A 4L50A 2DHCA 2R00C 1JXQA 3N05A 1LBTA 1E60A 2G82A 4ZVVA 1CEYA 4JJFA 1O97C 2WUEA 3IHTA 3OZRA 1GPNA 1JHPA 1W4CA 5GJBA 3JATB 3ZUPA 5EJEA 3C8HA 4DQUA 3MF4A 1CU1A 3EVBA 4LZOA 5LB4A 3VBCA 1IVYA 4B4KA 3V4LA 3PHGA 1NF2A 4YWJA 3BREA 3H8VA 2B8EA 4IJKA 4XWAA 4PEVA 1O6FA 3CO5A 5LA6A 3FPFA 2WIAA 3RFFA 2AMFA 4E6PA 1P9LA 5DM0A 4UAVA 5LYJA 1QMGA 2WF5A 4J1SA 2E5LB 3LBNA 1V4VA 1RE0A 2ZTMA 1XZDA 2SCUA 1MV8A 3E3OA 1GL3A 4H6VA 2GUWA 4I14A 1ECFA 4MVJH 1MR3F 4R5HA 4Q9IA 4C5BA 1G7SA 2HD4A 2QR3A 4FYHA 2YVQA 2HCTA 4V39A 1JDZA 3MJEA 1CJUC 3M70A 4FLEA 5JASA 1FQWA 2RHBA 1ODFA 2ZJBA 4WESA 2ASEA 4PICA 3CVWA 5AKIA 2XT9A 3GUUA 4YRIA 1DAPA 1P6QA 2A5LA 3CNOA 3OIDA 1SCJA 4FGJA 1Z6QA 4LZLA 3AR5A 2JEYA 5JJBA 4XOUA 3AM1A 1T3ZA 4JV5B 4Z4EA 1NZDA 1YJAA 1M2HA 2VBFA 1RCUA 1DHRA 2JDID 5AK6A 1KSGA 1S3GA 4RGBA 4TTVA 4OHWA 4TVKA 4DIKA 3KT3A 3CPJB 1C1XA 3RTCA 3UK1A 4RUKA 1G3RA 2EQ5A 3I9NA 1TQ2A 1P81A 3WWOA 1B6SA 2JCGA 4AJLA 4I4CA 3TJRA 3JTEA 1XU7A 4PLTA 2ODEA 4K81B 2G7ZA 5B6PA 1FA9A 1CZHA 1DUIA 2ZXUA 1TI7A 4IUDS 1I0LA 2AN1A 1I2CA 2IHTA 4R7TA 1RRKA 3NBXX 2I7VA 1ORTA 2I1LA 3EUEA 3H6KA 1MH9A 3WBBA 1P4GA 4AJ4A 2BFBB 2WSSA 4OB8A 1HX7A 5A5DA 3O82A 1DDIA 5IBPA 3W06A 1WXDA 3UJNA 1A7KA 1T2FA 1WTAA 3IPAA 2RI6A 1D6JA 3GQBB 5BOSA 4A7PA 2ZRNA 4FKMA 5C52B 1YZKA 2O8EA 3QX8A 4IUYA 2I1WA 4W7HA 1JVBA 1UKZA 2JGFA 4FJ0A 1KJNA 2XVZA 3KT0A 3DAFA 4X9XA 2Z5LA 2WMDA 4WBXC 3WYNA 1WZEA 2JA2A 2Y0BA 3EFOA 5JAQA 3HXOA 5F2EA 4MJ7A 4WK0B 2NADA 1W0KA 2ACVA 5L7YA 3SGLA 5CEFA 4YP0A 2F3RA 2V97A 4ZK6A 1AVTA 3UA3A 1SIBE 1GFSA 3D54D 5JE8A 5AFSA 1YXMA 3F9CA 1JKXA 4R7GA 3FBWA 3WL4A 5JCXA 3QH4A 4QLOA 4DA7A 4EO4A 3F6SA 1U8EA 2R4UA 2H9AA 4KLAA 3AI7A 3QKUA 2IYEA 3I5MA 4Q4DA 4R1TA 2J07A 4FFSA 5BNZA 4HB3A 2OQRA 4CQLB 5E7JA 4X3PA 1NVUQ 1TL7C 1NVAA 2XGGA 5DBHX 1W0JA 1MO2A 4G25A 2P9QA 3KJGA 2ZYDA 3QRWA 4U6SA 4WECA 4AMVA 5K0JA 3PFCA 3MMSA 1G63A 3ONDA 3PEFA 1SUEA 2JKZA 4JT9A 4JI5B 5BSKA 1UK8A 2V45A 2B7LA 1Q0SA 1XEXB 3IMGA 3LBAA 1OU4A 4G0ZA 5EJMA 3RUHA 3EEOA 5AJXA 3NBMA 1W1UA 1EM6A 1KQPA 3K5IA 5JALA 2L42A 4BEBA 1JA0A 4GOMD 2VQ3A 3IEPA 5AVTA 1NAIA 1T4MA 5LVAA 1RM3A 1GPH1 2FY8A 4M0KA 1PZEA 1SOWA 2W9XA 5KTRA 3DMTC 3SC2A 1AZTA 2HWKA 3GRVA 2O8BB 2E9SA 3NRCA 5JBNA 2ZS7A 3U4QB 3LXRA 1H9AA 1UJ6A 4MVYA 1AT1A 1Y7HA 3CLVA 4GQAA 4ZO7A 4Q6BA 5EE9A 3C24A 2BJVA 3RJMA 1XDBA 2A9VA 1JS1X 3LCCA 2PHZA 1R3DA 2CXOA 4LMRA 1R00A 2YC2C 4GI5A 1QONA 4WZAB 4O4IF 5IVPA 3ZYCA 2KYRA 3IESA 1L7OA 3QMVA 1TVKB 2Z2YA 1SURA 2QUKA 1ZRSA 2QRHA 4J43A 1QCCA 4GSLA 4EG0A 4F9EA 4OLAA 2O8FA 2C95A 2JHFA 2Z6AA 5BW5A 4IXMA 1QJCA 2G9NA 1HQDA 1KR5A 1LK7A 2QJTA 1LTQA 5DP2A 3GRAA 1DWUA 2EEPA 4F5ZA 4N65A 4NDNE 4K6CA 1IJEA 3EJWA 4G09A 1DFHA 2JH9A 3BIOA 4KMOA 2NUPB 1P7YA 4NOJA 2FEAA 4E03A 1GNLA 2ENWA 3R09A 3OCZA 3ZXYA 4F1KA 3RKUA 3DDWA 3M2PA 4HAVA 1K6MA 1PVVA 1OBVA 3DYIA 5EIOA 2XUJA 3ESDA 5FIUA 3ZWPA 5BT8A 1HFWA 1L1EA 2J9RA 2QYOA 3P9NA 4GKKB 1TYBE 4IIDA 3VNQA 1XN1A 4C06A 4KQIA 3QOFA 5IRCD 4ND6A 1G8MA 3PD1A 3Q3CA 4PTZA 4F12A 3MGBA 2FKAA 4KXUA 1E2NA 1XDDA 1PR2A 9MHTA 2FU5C 3GNTA 1E5VA 4BVJA 3H7AA 1DIAA 1VCNA 3HA3A 2Z4RA 3KJFA 4H1UA 4HP8A 3THYA 2VWGA 3HU5A 4MO9A 3G1UA 1SC9A 5H68A 4CN9A 1U4SA 1PJBA 2IWHA 2CL7X 4AO8A 4Y67A 2IYZA 5EUBA 1P7ZA 5ALHA 4GNKA 3OPYB 1Q16A 1AV6A 1Z26A 4TTPA 3GAFA 2DXIA 1XDSA 1LC3A 1H65A 2C8JA 2MR6A 3ICOA 5AUNB 3GFRA 4RVHA 1D0VA 1OIVA 1GZSA 4IHJA 3HDYA 1X1DA 3EARA 4JSYA 3FFWA 4FONA 2IH5A 4GAEA 4DNQA 4AECA 3AP3A 4KE9A 1F38A 1X9HA 3TTUA 1Z8FA 1FYFA 1NRIA 3EH2A 1RFGE 1DRVA 1B00A 2R9VA 5A6SA 1LDBA 4O4IA 2I7CA 3ANLA 3LECA 2IHKA 3LSTA 5BV1A 3C8MA 1SIUA 3G0BA 1KK3A 5FH9A 4UTRA 3I05A 4O4LB 2P9BA 3PPXA 2Z8YM 1HZZA 3WGQA 1PBNA 1B15A 2IH2A 3JW8A 2Z3ZA 2O8NA 3S40A 3MWEA 4JLAA 4CDNA 3TBFA 4AKGA 3BCHA 4CR8A 4ZI3A 3M4JA 1T6NA 2WWFA 4RANA 4CKBA 4AY5A 2WUWE 3OX1A 5E1OA 3QELA 3L02A 1G9SA 1KPHA 4RH0A 2G70A 1U28A 2PSHA 1EJBA 1W88B 1PYGA 2HPHA 2Q9UA 3L46A 4D0RA 1AURA 4E1AA 1QQAA 4W6QA 1MQ9A 1JQDA 1SC1A 3GHYA 3N2NA 4IZ6A 4X64B 4BB6A 3FUUA 4JL6A 1GSHA 5DI9A 2GPNA 1GLVA 3GNLA 3C5CA 2BGJA 2LIVA 2BSAA 3QVXA 3FCEA 4DQ0A 5KNBD 2DKOA 1TK9A 4QBFA 1V37A 3MA0A 2GZ3A 4QFMA 1TCUA 3EULA 1ELOA 1A1VA 1WU8A 4DZZA 1R4ZA 4B1FA 1XMQB 2QZ9A 3IUJA 4XPIA 2I3DA 4JI4B 1J2TA 1MZVA 5JJKA 4BZPA 1G2PA 3F78A 1XTJA 2FMHA 5BNWA 1YFKA 2AR0A 2OCYC 4O08A 4TKVA 2AG6A 5FEMA 4U9UA 5TVGA 3TXYA 2VQFB 3K8ZA 1ADBA 3R9KA 2ZCJA 2PU7A 4B33A 4YCLA 4P0PB 4QUEA 3SZLA 3CCFA 1ODCA 3GB9A 4O2AB 4D4LA 5JJIA 1M1NB 3UB2A 3BWVA 4UW9A 5E1MA 4ZOEA 1QF7A 1R7RA 1PE0A 1DPFA 5AVYA 2JCVA 3N59A 1CRZA 3ITNA 3JVUA 2I0FA 5JNLA 1ZQ1A 2GBLA 5KHLB 2AN9A 3IPRA 1LPPA 4YIKA 2HREA 3A9TA 16PKA 4RU1A 4YDSA 3UBMA 1ZVMA 2P1DA 2GETA 1E5XA 2C5BA 2YC4C 2PQ0A 3VOSA 1C41A 1E6WA 4BGUA 2FF5A 3TRKA 4YAKA 3T7EA 5IT4A 5K9ZA 5J2TB 1FMTA 5KSWB 3IDAA 1O4VA 4G4SP 1F20A 4HDOB 1FDWA 2QQ0A 1OI3A 2R7MA 1E4YA 4D8XA 2PKEA 1IN5A 2AOTB 2F3TA 1TM2A 3HCCA 4MKIA 2CVHA 2AVDA 2JIDA 4KN9S 3VSBA 3HE3A 3PQ8A 3LCRA 3T5BA 1VSTA 2WI8A 3GXBA 4II2A 2HKIA 4ZHQA 3S1SA 4BQEA 1FW8A 2F1OA 4X6LA 4X20B 4DG8A 5A5EA 1EX7A 3V2IA 3LCVB 2C94A 3IOMA 5ISMA 2XQKA 2GEDA 4KQHA 5HJEA 2O1WA 3QXJA 4URZR 4YX9A 9LDBA 4UCQA 1MTZA 4QOJA 1J0AA 3IMCA 4PQFA 1D0SA 5BQ3A 2XA9A 4LE2A 5LMUB 1KZ7B 4J0DA 3GIDA 3HG7A 1PR9A 4Y6QA 3SZGA 1DTSA 2ORYA 3ZJYA 4HLCA 4D3ZA 1JILA 2H9YA 3RR2A 4CQMD 3HWWA 2IELA 2ILVA 2JIZD 2OHFA 1M3SA 3B36A 3KR9A 2DC1A 3NTVA 3OZUA 4GKVA 4HYQA 4PG7A 2FP4B 4EPYA 3RH0A 2VTVA 4Y9RA 1AHHA 4R0MA 2DH5A 2VSFA 4UBIA 4XUGB 1AOXA 3SEAA 4OBWA 3BICA 3RC8A 4KI7A 1D1PA 1IH8A 2YJ3A 1L3IA 4J2OA 3O2JA 5EP4A 3CWCA 2QV7A 1REQB 2O5CA 1O5TA 3QEJA 5LZ4A 3V55A 3VUFA 4JY7A 2G28A 1IZ9A 1GNRA 3RANA 4JFAA 5GADl 3SKXA 1OH7A 4IHKA 2GK4A 1CQPA 2IP4A 4XWKA 4JUAA 3UCFA 1RLTA 1BSVA 1KKUA 1ZONA 3JWEA 2CLCX 4ZAYA 1Z4NA 3TLAA 3LNTA 4RIEA 4ZU1X 3GN2A 2C3YA 2A86A 2AUNA 3MXTA 2TYSB 4JA2A 4BUJA 1C2TA 3WGOA 1T0BA 1Y1PA 2D8AA 2B34A 1Y9JA 2OCGA 3B1YA 4AF6A 1J5EB 3HABA 4BLUA 4EKNB 5GIPE 1I1NA 3WR5A 2YICA 1L8XA 3PG5A 2FAXA 1NC1A 1T5BA 3O8RA 1AC5A 2ODNA 3WLSA 2XI4A 2VHJA 1XB2A 2Z1NA 3OX4A 5ER6A 4MVJP 3JU3A 3OKPA 1PK8A 4PZZA 2CFCA 1EVIA 3LBHA 3WKAA 2GQ0A 4JYZA 1RYEA 3AJ9A 4O4HA 2X0KA 1JT9A 3ZX4A 2XKAA 2OL4A 1OT3A 1USUA 3EVGA 4PYRA 3RADC 1YT5A 4HB0A 4PG8A 4PSVA 1YJCA 1JYEA 3RC1A 1CP2A 2JL1A 3O4FA 2VN8A 4XGRA 1CQZA 3UQZA 3VC3A 3WRYC 1JFFA 4IO0A 2CBGA 1AUXA 4K0RA 2F9FA 4KMMA 3W5CA 1IPFA 3I5YA 4PYJA 1JEYB 1IG0A 3IPXA 4LAFA 5MHTA 2A58A 3RU9A 3UJ8A 1FXUA 1NF9A 3QU5A 4GRIA 3OCJA 5AKHA 2YXEA 4EBFA 3Q3JB 1YDGA 4Y7DA 5CTJA 4I2VA 1NXTA 3ABOB 3U3XA 4MPRA 4FYIA 1JIJA 2FHPA 4E2XA 4CF6A 3T3IA 3ZV4A 2FOIA 3LPCA 2WJ3A 5IVIA 3PHJA 3FBTA 2YR0A 5CX1B 1P33A 4Q39A 1RIIA 2JAPA 2BF7A 4KAAA 2PX5A 1ENYA 2BI7A 3B6JA 4LBVA 4X85A 5ALDA 2A57A 1PKEA 3HI6A 3RGWS 3ZY6A 4DQVA 4ZK2A 3H4TA 5EVCA 4LWOA 3OF5A 1CBUA 4K9KA 1U7HA 1GA6A 2F1RA 4R1NA 5AI4A 3P2EA 4OA8A 4BB5A 2PUBA 1CYDA 3GLIA 3KYDB 4L51A 1IQPA 1T4CB 2ZIGA 4OFBA 2O0LA 4AG6A 1PJRA 2HCRA 1JIXA 2YXPX 4GLBA 4IIHA 2OSBA 4A03A 1RR6A 4EP1A 5C9ZA 4MGHA 2QLMA 4G4SO 1RABA 3TTSA 2GEFA 4YXWD 3ZGXA 4RK5A 4U02A 4XQGA 3R9XA 3TQIA 2DFNA 2OHXA 5DGTA 1HL7A 4C43A 1W30A 5I47A 1WCV1 1U6JA 3CF4G 2J09A 2PFKA 4GPD1 3GG2A 4X7MA 4XQ9A 3LDFA 1GCGA 3OT1A 4EHHA 2W83A 4AU1A 3AZQA 4C78A 1UP4A 1USKA 1BU8A 2RONA 3D7MA 4ROTA 2Y1DA 2IDZA 2ST1A 1PAUA 5LP6B 2IGBA 5BN1A 3QU2A 4R8VA 4PLFA 4BNLA 4WY5A 2AXEA 3UIEA 1A82A 1RWMA 1VYUA 1HLPA 4V2IA 2IPLA 4W7IA 1AQJA 1JIKA 2HTFA 3F0TA 3O3CA 1MDBA 1GZ4A 5HF6A 4MHTA 2PRKA 3HI4A 2GYWA 4J75A 3MRSA 5JYBA 2ZJOA 3AJRA 3KB2A 1USVA 1QVVA 4NOLA 4ZU6X 2M6LA 5L4NA 2HW8A 2WWIA 3CA8A 1IATA 3OKAA 4MYCA 3PNVA 5BY2A 5IMBA 2P6NA 1RDFA 2VHQA 3B7GA 3F74A 4NYMR 4WE3A 5BORA 5LOVA 1E69A 3AEKB 3BF7A 3D4NA 2F8LA 3GA7A 1KIFA 4FMBB 2IX3A 1TO2E 1GAJA 2AJTA 2RGEA 3IP7A 5DXFA 4EUFA 1VCMA 1BWPA 4FBMA 4F8YA 3JASB 2KI5A 3FCOA 2J1LA 1ZW6A 4MVJE 2H1RA 2F00A 1ZN7A 5F78A 1YL7A 2X3YA 3SWWA 2GFQA 2OD7A 4TTSA 5DBFA 5IBQA 4RSHA 4EG1A 2BCEA 3UICA 3LT4A 1SUPA 3GLKA 4LIPD 5ALEA 3IKJA 4HUQB 4FHEA 4HWPA 4RHYA 1TAHA 4BB9A 4G86A 3HXTA 6LDHA 3N28A 3PJFA 2PKXA 2ZSAA 3IXQA 3RRZA 4BVLA 5FXMA 5I4CA 1MLDA 2NU7B 2I34A 1NNEA 3D1VA 1CUWA 5HNKA 1JEEA 4JITA 3E7XA 3UTDA 4JROA 1XZHA 5F52A 1OZ0A 3PR2B 5EKTA 4Y2HA 3FPAA 1G3IA 3WGTA 2I1VB 4N03A 4RKEA 1TGYA 4AN0A 3DD1A 2G7MC 1BU5A 3ANTA 1JE0A 1MIOB 1I3MA 4PLCA 2JHAA 5K3FB 4CKZA 4B5KA 5LZ7A 1LSUA 2J48A 2ZYSA 4JWTA 4NS4A 4IIUA 3WISA 3WOVA 2EG9A 1I3KA 1VLJA 3ON5A 4P38A 4P3KA 3SYRA 4NFYA 3HYCA 5HXAA 4FZ3A 4TT3A 4CW7A 2G09A 2AMVA 4GC9A 2FRXA 3FX2A 5TQVA 4C0WA 3C39A 4IMRA 1L3CA 2GO1A 2FPGA 2P2GA 4N0MA 1BGXT 4BVFA 2ZW9A 4FW9A 1E6MA 1C3LA 3EIQA 2V0GA 4GDFA 3MBKA 3TLEA 4FXOA 4AKHA 4AUNA 3WK7A 4AO7A 1JJFA 2F17A 2FRDA 2YNMD 1BCSB 2B2XA 3RS0A 4RXUA 4D4JA 3DVAA 3STXA 4MUFA 1VSQA 4BX2A 5JTUA 3VJRA 1DARA 1I7NA 3FBGA 4I6JA 1QOZA 1Q17A 4EJ6A 2IUTA 2A3NA 4BV9A 1PL7A 3BDVA 1EUCA 1M0SA 1MG5A 3HJUA 2X4IA 1WWKA 3M3HA 4JKYA 3D7RA 3I2YX 4L8VA 4LYAA 1BDMA 1LCIA 2E4XA 2G67A 2YXDA 1B6GA 1PG2A 4V38A 2VTBA 1WUYA 2X3FA 5C8YB 2R1TB 1ZCFA 2A30A 4G1UC 3GXOA 1UT5A 1JRLA 4JIMA 2ZB7A 3D4PA 1T6BY 3KOOA 5HKBA 4FFRA 3HVUA 2OUKA 5FI3A 2PL9A 3MLEA 1GXSB 2QRVB 4UPEA 4G4GA 4ZZ1A 4EECA 4P86A 1ZI9A 2AYZA 1ND5A 2OD9A 1W76A 2E4UA 4TSFD 1J97A 2ZUTA 1OHHA 5JPDA 1Q7GA 2QYSA 5IABA 2FN9A 3ET5A 2H57A 1N2CB 1YFLA 1U1FA 1EQ2A 2AYYA 4BU0A 1CPYA 1SVKA 2RG7A 4RV5A 4PAOA 3VAYA 4IFIA 4LXGA 3RHSA 1GV1A 3LCUA 5D86A 1SH7A 3B1KA 3O2NA 1YI0A 1TIBA 3E4CA 5THXA 2QL6A 3UJAA 3DR3A 3USZA 3M6AA 5EEHA 4N12A 1H0SA 2JCSA 3SM9A 2I2DA 2X5JO 1V7CA 4N47A 3UJDA 4FHZA 3TFWA 3G8YA 4H4CA 4ZVMA 3UC9A 4X62B 2P3SA 1U2DC 2RK4A 3EXHB 2PM8A 3PSHA 4AZSA 5C8VA 1RQNA 3RS4A 2OAQ1 3OKFA 1N2BA 2ACWA 3SVLA 1RAAA 1M34A 3HJNA 5K4AA 1A7AA 1EFRA 5CTAA 1P5FA 2INGX 4WK2B 5DI3A 5FBQB 3OURA 4XX1A 3OE5A 7REQB 2QP3A 4LCJA 5DBOA 2GCGA 5I48A 3H5TA 2O2XA 1R0SA 3FSGD 2BH9A 2JLQA 4W1PA 1COWA 4GYJA 3KSDO 1B0PA 3KAQA 2G83A 3JALA 3H8JA 2ZTVA 4ZVSA 3TVYA 1H6BA 4WT7A 3K4HA 3STHA 1OB5A 3ETHA 3JQPA 2A5FA 3P9CA 5HCIA 3AVXA 4B4DA 4HCJA 2FPUA 3BC1A 3DXFA 4UUQA 2ZBVA 3VC1A 5HZKA 1AKTA 1DTEA 10MHA 1PUJA 4ZT5A 4A6DA 4E1VA 4Z49A 4N01A 2B8JA 4J3JA 1H69A 2NU6A 2XOEA 1DC7A 5EE3A 2VZ8A 3LX6A 4P92A 1PFWA 3INYA 1RYBA 1B0AA 2Q3BA 5FPQA 3DB2A 3NVKI 3KSRA 1R5OA 1L9KA 2DY0A 1M8KA 2RHDA 5IVDA 5DN9A 3CF0A 4KE6A 3ONVA 1ACMA 4R9VA 3IKMB 1NDUA 4OX9Y 2F1KA 3OJCA 4H35A 1UOQA 2VHCA 1FRVA 3FSRA 4GMGA 1TQ4A 1JB9A 1YQDA 4IYJA 2ZJZA 5BO5A 3VOAA 1MOQA 1W94A 1E6LA 2VQSA 1H0RA 3PEVA 1X1QA 3F90A 5FUWA 2RHWA 1WDKA 4BWYA 3ZH9B 4R6WA 4B3RB 3BDIA 3VR2A 3AHIA 5JTTA 3T7DA 2Q6IA 4ND8A 5JH7A 4G0UA 1