5G4LA

Phloroglucinol reductase from clostridium sp. with bound nadph
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
265
structure length
265
Chain Sequence
HMVNVKKEFVDNMFSVKGKVALVTGATGALGCVLSKAYGYAGAKVFMTGRNEKKLQALEAEFKAEGIDCAYGVADPADEAQVDAMITACVAQYGEVNILAVTHGFNKPQNILEQSVADWQYIMDADCKSVYVVCKYVAQQMVDQGKGGKIVVVTSQRSKRGMAGYTGYCTSKGGADLMVSSMACDLSAKYGINVNSICPTVFRSDLTEWMFDPESAVYQNFLKREPIGRLAEPEDFVGYALFLSSDASNYITGANCDCSGGYLTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biocatalytic Properties and Structural Analysis of Phloroglucinol Reductases.
pubmed doi rcsb
source organism Clostridium sp.
molecule tags Oxidoreductase
molecule keywords OXIDOREDUCTASE, SHORT CHAIN DEHYDROGENASE/REDUCTASE FAMILY P
total genus 113
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5g4lA00
2CFCA 3ENNA 3GHHA 2O23A 3LC7O 4R54A 5EN4A 2NU6A 3WFJA 4DLBA 2HK7A 4GX0A 3MWEB 1KIFA 3Q0EA 3CKYA 4C4OA 2H9IA 5B4VA 3I9MA 1NXQA 2OHXA 4GX5A 5G0WA 1JAXA 3W6ZA 1RM4A 1SEVA 9LDBA 3DO5A 2BFPA 3SJUA 1M6WA 4NBRA 5ITWA 4BNFA 2HCTA 1ZSNA 3AUUA 2JJYA 1DHTA 3JQGB 4E2XA 4YVFA 1N8KA 3GAFA 4G2NA 3DBRA 1VJ1A 2PD4A 3VPHA 3V1YA 1ZKMA 3PP8A 2NU8A 4PLFA 5KKCA 5KJ1A 3AOEA 2VZ9A 2BD0A 4IQ0A 3OA0A 5KKAA 2IXBA 1I3LA 5H83A 5THKA 2Q3EA 4L4RA 4OQZA 3DBLB 3H2SA 1T2AA 1GD1O 2QYTA 4WNIA 2Q46A 2YV3A 1H5QA 3ZN2A 4WCFC 2Q49A 3I6IA 4MPDA 1VL0A 5FWNA 4GWGA 4R5MA 3GDFA 3WBFA 5CG2A 1T1SA 1HXHA 3FBTA 4CV2A 2JD0A 4YA6A 1VJ0A 3SVTA 1GPDG 4P22A 4XQ9A 5TT1A 5CDGA 1L1FA 1Z6ZA 1Z45A 3PQFA 4CMBA 3HHPA 1O5IA 3WGYA 5CEJA 1PZFA 4Q3BA 4KUHA 3GLQA 5AOVA 1DOHA 5BR7A 1GCOA 4FSHA 1PJ4A 4UVEA 3ZU5A 4LW8A 2QZ9A 4Z0PA 5TGDA 4EYEA 3JQAD 4Y9DA 3QV1A 1UP7A 3N58A 4GMFA 1DIBA 4HV4A 4DXHA 3S8MA 4HNGA 3ZW9A 1ADBA 2BRUA 2QW8A 1M2WA 3AY6A 4GGPA 3WQRA 5IG2A 5L4NA 3GMSA 1PL8A 2PWZA 4CLRB 3DBLA 1C1DA 1E3EA 4JP3A 2QHXA 4IQGA 4BQPA 1L7DA 4Z3DA 3AY3A 4FD3A 2H5LA 3I23A 1O9BA 3GUYA 1O89A 4YJFB 2RHRA 1PS8A 5EINA 4CM9A 2C2YA 1QMGA 2BMAA 4HXYA 4OO3A 3FWNA 3S55A 4NU5A 3JV7A 1NHGA 3ZWNA 1QYXA 2J5QA 1GTMA 1MG5A 2GRAA 1UZMA 1ZMOA 3WYEA 5HA5A 3TL2A 4KWIA 1WMAA 1ORRA 3KYDB 2CNBA 1O94A 1MFPA 1K5HA 5AXDA 3CMCO 3PXXA 4NDNE 3RD5A 1MLDA 1BG6A 1NQOA 3I9LA 1XLTA 2P4QA 4R01A 3Q6IA 3RCBA 1IZ0A 2HKIA 3BAZA 2GZ3A 1UDBA 1HDOA 5IZ4A 1CRWG 4GPD1 1ISFA 4IZHA 1I32A 3A06A 1E6EA 2B37A 3DOOA 4HADA 3QW2A 4YAJA 3U4CA 4OKIA 5A5EA 1ZJYA 1P1JA 5HWSA 1SOWA 2PGDA 4R41A 2FY8A 1Z73A 5BQFA 1PJ2A 2HJRA 1WP4A 1WWKA 3A14A 4IMRA 3U49A 1MXHA 3RUHA 3WTCA 2X0RA 4IS3A 1WW8A 3HN7A 4ALLA 1YJ8A 1Z75A 5IZCA 5JPIA 3OEWA 2FSSA 3ANLA 2NQ8A 3E5RA 3EAGA 3K2EA 3KOUA 4JIGA 4H3VA 4RPKA 3ONDA 2BI8A 2PGLA 3ZWYA 3E9NA 3BMNA 3D5QA 1ZH8A 4OIMA 1UJMA 4CMEC 2VWQA 1GV0A 3Q11A 3FD8A 3L9WA 5JC1A 5JCXA 4DBZA 4RCVA 4CQMD 3LSYA 1JTVA 2DU8A 3DL2A 4W82A 3W8FA 3TNLA 3TZCA 1VSVA 3FRJA 4LMPA 4CM3A 4OMUA 4ZICA 3G17A 5DBFA 1NBOA 3PHJA 4P4NA 4B79A 1I24A 5T8KA 3H5RA 2G82A 2YHUA 2VZ0A 4HP8A 1KETA 2PLAA 3SC4A 1OAAA 5DCWA 5CHEA 4CM7A 4J1TA 5EQFA 2VYVA 4XYLA 5ENDA 4FJ0A 1H9BA 5CP8A 5T6BA 2BHLA 4NU6A 4TKMA 1N9GA 4U7WA 3V5NA 1ZFNA 2VRBA 1HRDA 3PDUA 3WQQA 3HNPA 4BNGA 2J6IA 2XOXA 1HYEA 1LDBA 1LEHA 1KEVA 1NPYA 3RJ9A 3VZSA 5KVCA 4OAQA 1F12A 1TB4A 3BMOA 3WX0A 4GVLA 4WKGA 4BNLA 4KOAA 3AFNA 4NFSA 4NMHA 5G4KB 5GY7A 1JWAB 4KDEA 1PJSA 4LRTB 2AMFA 3I6QA 1SEPA 2VRCA 2C5EA 1LSSA 2QRKA 1LLQA 1ZUD1 4UVIA 2OFPA 4IUYA 1AHIA 3M1LA 2DFVA 4HY3A 4FFRA 2DBVO 3V2GA 4DA9A 1WZEA 2G76A 2X23A 2YV2A 3JQ8B 4KQXA 2VWPA 2C29D 1IHYA 3R6DA 3JQCA 1C0LA 3AUTA 3H2ZA 1HL3A 2IYOA 1QORA 3GFGA 1I2ZA 5L7TA 1NNUA 4RV9A 4XQEA 1TEHA 4OYRA 1E5QA 2EHDA 5G0TA 1GEEA 1PZGA 1DPGA 4L4SA 4KUEA 4E2ZA 5TIIA 3ONFA 4AJ1A 5EPOA 5BNIA 3GEGA 1DIRA 2PD3A 4ZRMA 2GZ2A 3RU9A 4FW8A 5B12A 1RM0A 4GMGA 2OO5A 1ZZEA 2VHZA 5JAQA 5CPFA 4WEOA 3WWYA 1I0ZA 1YB5A 4ROSA 4OOFA 2POQX 4D45A 1LSUA 3C7CB 1ZK2A 2B69A 2D8AA 4E3ZA 2PFGA 4QT0A 2HO5A 5I9MA 4MVJF 1OMOA 3GN1A 4BMNA 3CZMA 4ALKA 1XU7A 1D4FA 2X7HA 3MJCA 1DRVA 1ZSVA 1JVBA 4ND5A 4XIYA 4NK4A 2RH4A 1W8DA 2DBQA 4D0RA 4K26A 1J4AA 3I4FA 1CEQA 5BT9A 1E0DA 5ICSA 4AICA 5HS6A 1LLCA 1DLIA 3PHHA 4RVGA 2YZ7A 3KSDO 4FJ1A 2AQHA 2WD7A 2Y1DA 3FBGA 4MIOA 4ALIA 2FWMX 1IYZA 4L9RA 3TSCA 2ZYAA 4GGOA 1BVRA 4Z9FA 1J0XO 4TRJA 3QLJA 3GVCA 3IJPA 3PWSA 4JBHA 4CMHA 2ET6A 4J43A 3G79A 2HMVA 4WE3A 4R5HA 2RBEA 2BFMA 3AWDA 3LT1A 3ZV3A 5AXCA 2X0NA 3CPSA 3NX4A 4E31A 3RI3A 4BIIA 4A27A 3HFGA 2P9GA 5JDIC 4LRSB 1GV1A 2CVQA 4EEZA 1J5PA 4GAEA 4S1VA 2GERA 3CTMA 4GSLA 1ONPA 1MUUA 1M67A 3DOCA 1KBZA 1ZO8A 2O3QA 4AJNA 4PVCA 4I1IA 4RVSA 4YDRA 3C24A 4WGGA 3QVTA 3DC2A 3VH2A 3OJ0A 1QLHA 4YT8A 4DLLA 3H8VA 1J49A 2EV9A 3QWHA 3PQEA 5IZCC 1MP0A 4HWKA 1X14A 4YQZA 4D7AA 4RJTA 2DQ4A 4DMMA 4KZPA 4IDAA 2VOJA 1LDEA 2B4QA 3C3XA 2GYYA 3Q3CA 4FFMA 4JBIA 3WQSB 2VUUA 5H82A 5JSFA 2DTDA 3GEDA 2V7PA 2W2KB 2DTEA 4PN3A 1IOLA 2IDZA 2WWRA 2E48A 3VH1A 2V6GA 3FCOA 1BXGB 1UUFA 3BMNB 1KYQA 3DZBA 3EVNA 3TL3A 1U3WA 3TRIA 2AQIA 4DIOA 3QP9A 3U3XA 3RUEA 1A7KA 1R4NA 4FS3A 5T5QA 1LRJA 3FR8A 1BDBA 4R1NA 3ZV4A 2X5KO 1PSDA 2OP1A 1DXYA 3ZU3A 3H7AA 3E5MA 3ONEA 2W2LD 3PGXA 4Q3AA 1IPEA 4G5HA 2RIRA 3K30A 4NH4A 2O2YA 4PG7A 3KO8A 4LVCA 4J91A 4J9VA 5F3RA 1MGOA 3VTFA 1ADFA 1H6DA 3HB4X 1ULUA 2X9VA 5CFZA 4UVDA 3F46A 1BW9B 4DPKA 5MGBA 2ILTA 3GG9A 3JQBC 2FPGA 3GNSA 5KIAA 1HDGO 5A9RA 2Q4EA 4ESOA 1C3VA 1Q7BA 2OL4A 3HDJA 5JAMA 4BNZA 5DBGA 4NG5A 1X15A 2Y1EA 3JQ9C 1DC4A 4RQTA 3ZHXA 3K73O 4IDBA 2AHRA 4BNTA 1DIHA 4CM5A 3BHMA 1BGVA 3P19A 2HMUA 3V1TC 2D5AA 1E1MA 4RDHA 1PZHA 1U8XX 2DAPA 4WJZA 4Y6PA 1T2FA 4O6VA 4ALNA 3BA1A 1EE2A 7MDHA 5FF9A 2GSDA 2C54A 3D3WA 4AVYA 4DIBA 4XIJA 1R16A 1LDNA 4PG4A 2FHSA 1TI7A 4CLOA 5U4QA 4XX0A 2GCGA 1T24A 1BDMA 2BH9A 1P1IA 2NTNA 2WTBA 2GO1A 2E6UX 3H3JA 4BNVA 2OMEA 4XGNA 3DONA 5K0ZA 3NRCA 1G0NA 3QWIA 3COSA 5JYDA 4UEKA 4QFDA 1U7HA 2CDBA 3PLNA 3L4SO 3JTMA 1NFQA 1D1SA 1WDMA 1XCBA 2EP5A 1KVTA 7ADHA 1HYGA 1K6JA 4WECA 4J4BA 4AFNA 4XGIA 3DAFA 4NBUA 3TZHA 1NX6A 3A28A 1B7GO 3E6AA 4G81A 1E7RA 3A9WA 2O2SA 2PKQP 4CR8A 2IZZA 3MZ0A 4DQVA 4NFHA 3KETA 4XR9A 5JFOA 1HLDA 1XGKA 4R9RA 4CL3A 1AN9A 5T64A 1A4IA 2WD7B 4IPTA 1QLJA 3MEQA 3H6KA 3BTUA 2GN9A 1UXGA 1H9AA 4O1MA 4YJHB 3P5SA 1B26A 3CMMA 4WLVA 1E3IA 2B83A 5A04A 4XKJA 2IZ0A 3EMKA 3UXYA 2EXXA 3OA2A 4OL9A 1U7TA 3DFZA 5EMHA 3VOSA 1KVQA 1ISIA 4OOEA 4J4TA 2DPGA 4U6QA 3HE3A 4LSWA 1NWHA 2JL1A 1I3KA 3AUSA 4MVJE 5FEUA 3WNVA 4BO7A 1N7HA 4IJVA 2PZLA 3AFMA 5DZSA 1A9YA 1MX3A 4B4OA 5JDCA 3D3EA 3BMOB 5F5LA 3FN4A 2UUOA 4E32A 1LTHR 5I7SA 3JQEA 3PIDA 4EUFA 2XXJA 2W90A 2C2XA 2VZ8A 1XQ6A 3PIIA 1F8GA 1YBAA 4UUOA 2OBYA 4XA8A 4ZHSA 2W8ZA 4DWVA 1R15A 3BTSA 4R1UA 5LC1A 1XU9A 3WOHA 1NFRA 1Y8QB 3UCXA 3ITKA 3OH8A 3PK0A 1H6CA 1DIGA 3FF4A 2VNAA 1HDZA 1H93A 3CSDA 4CODB 3DZHA 1IZ9A 1ZW1A 5DCYA 1RM3A 4P38A 3C7AA 1FDWA 4X54A 5U9CA 3IC5A 3OM9A 4S3MA 2YUTA 3SJ7A 4UVHA 4PRLA 4OM8A 2I67A 1VJTA 1EDZA 3EHEA 4XB2A 2E49A 3OJLA 1DLJA 3UKOA 3QHAA 4OSOA 1WDKA 4OXYA 2CDCA 3WG9A 3ZWAA 4B8ZA 1YQDA 3R3SA 2PD6A 2UDPA 2YW9A 2Y68A 3JQGA 2O3RA 3SXPA 3LVFO 4YAGA 4N18A 3UH1A 4J1NA 5LDHA 1PZEA 4GBJA 4E12A 5L4SA 1NAIA 4IJWA 4R1TA 1GCUA 3NJ8A 2D3TA 1IY8A 1YRLA 5CEFA 4LK3A 4UULA 4DQUA 3CEAA 4BO1A 3OEYA 3K9QO 1XIVA 1FDTA 2YDXA 1BXKA 3I9NA 4NBVA 1K2WA 1N1GA 1JKJA 1NQTA 3K92A 5CG1A 4JK3A 1JKFA 3IIEA 4FJ2A 4DL9A 4EBFA 3OJEA 2E4AA 5BNFA 5I7VA 1PWXA 2Y1FA 3OQ1A 1E3WA 2Z5LA 1U3VA 1O95A 1UAYA 3RU7A 1PQWA 2BKAA 1AHHA 2UAGA 2V65A 2VN8A 3HADA 3ROMA 4CM1A 4CLEA 3HN2A 1LBEA 4I9HA 4NI5A 2B5WA 2JFHA 4CM6A 4F46A 2HJSA 2GDZA 3MWDB 3ETDA 4XD2A 4BO8A 1CWUA 1YE3A 5G0UA 4W4TA 2C0CA 1EFLA 4GX1A 4BO6A 5L7WA 3WGGA 1VL6A 2PA3A 3HFSA 1R66A 2WDZA 4MVJG 3FR7A 3L4BA 4MP8A 3PFWO 5KJ6A 3DHNA 3SEFA 3PPIA 3VHRA 2BFOA 2O48X 4NBTA 4TRNA 1FK8A 2NVBA 4BNJA 3OJOA 1C1DB 4UAGA 2DBRA 1PL7A 3CINA 4TSKA 3QVXA 2CF6A 4D46A 2AQ8A 4XYEA 3QWAA 3EC7A 1KOLA 3PHIA 2J3KA 4WLFA 1T2CA 3UF0A 4Z6KA 8ADHA 3BHIA 2FOIA 4AG3A 1SOVA 3ZWCA 3AY7A 1PS9A 2OP0A 3GQVA 2GR9A 3WICA 2PZJA 4WLNA 5IDWA 1NPDA 1XQ1A 1P0FA 3OIGA 1YH3A 3S1LA 3DAGA 1VRWA 2W2KA 5KVQA 2Q2QA 5JAIA 2B5VA 4MVJP 3CIFA 1VC2A 1ZK0A 1VKNA 4ND4A 2IEBA 4EJ6A 4A2CA 4ND3A 3DTTA 3HB5X 4LCJA 3WR5A 4BNNA 1RYDA 1AGNA 4YJHA 3LT0A 4NIMA 1JA9A 5TC4A 3VC7A 3MOIA 2J5KA 3HDHA 4CPDA 1OOEA 2AG5A 3CUKA 4R9SA 1EVZA 4DGSA 2FPPA 3OHSX 4A0SA 3D0OA 3NGLA 4J3FA 4B7UA 4CM9D 2Q99A 4IIUA 3JQ8A 3HZZA 4U5QA 1RJWA 4J49A 5U1PA 3WLEA 2NU9A 5T67A 3VKUA 2PGJA 4YWJA 1VI2A 4LMRA 5JBIA 3LU1A 4GLOA 4YJGA 3IDSA 4U8GA 5DF1A 1CDOA 2HK9A 3G1TA 3GMDA 1E1LA 3L6EA 2JFGA 4OHUA 2ZJ0A 3JD0A 3JD2A 5IXYA 2VWGA 4NZ9A 4K28A 1Q2XA 4A03A 3OIDA 1ADCA 4CMIA 4B4VA 4YRBA 1XEAA 1HE4A 3GGPA 4PZCA 3L07A 3W1VA 4P8RA 5CAEA 2LDBA 3WLFA 4O59O 3ZV5A 3STHA 1MG0A 2EGGA 1XKQA 2ZKLA 3ETGA 3LDHA 1SCUA 3WBBA 1U2DA 1SZJG 3DBVO 1A71A 4CM8A 1Q7CA 4QTZA 1TXGA 3IP3A 4LN1A 3B6ZA 3JQBA 1ISJA 1P1HA 3LYLA 5JDIA 2WJPA 1B3RA 1YOVA 2A92A 5JDCC 2P4HX 3DZFA 3IP1A 4DYVA 4HFNA 1PJLA 4BO5A 3F1KA 2WEKA 3IUPA 3W4IA 4PRKA 4J16A 2X0IA 4XDYA 2D0IA 4EDFA 2X9NA 4E5PA 2ZB3A 3D4OA 4XCVA 3MTJA 4E30A 3WGIA 2SCUA 4BUCA 5IF3A 1DRWA 1YQGA 2I3GA 3D7LA 1S6YA 4BNXA 1PGJA 1E6WA 3LQFA 3GZNA 5TF4A 5I9NA 4TZTA 5G4KA 1YO6A 4R3NA 5DNAA 3GA0A 4KP7A 1I36A 4KDFA 2Z1MA 1C0PA 1QSGA 4J1SA 3UOGA 3NT5A 1KVRA 3F9IA 1YONA 3F47A 1CYDA 3WGOA 4YBZA 4F3YA 5JCJD 1C0IA 4W9NC 1ISHA 4B7XA 1U3TA 1UR5A 4A10A 4D3FA 3WJ7A 4DTIA 2EERA 5A3JA 1A27A 1K3TA 1LLDA 4EITA 1T4DA 4FPXA 4EJMA 3NTQA 1R0SA 2O50A 4AJOA 1PTJA 4B3JA 1WLYA 3JYNA 5JAZA 4JGBA 3O8QA 5IN4A 2PTGA 4IGFA 4N7RA 1EE9A 3C85A 5AVOA 1P1FA 3IAHA 3GVPA 2PKQO 1R6DA 4ZRNA 3L0DA 2XAAA 2C7GA 1NQAO 3RBXA 1R4MA 1LU9A 2XPCA 3LC1O 1DC6A 1H6BA 1LDMA 1ZXBA 1Z7BA 3PFFA 4O63O 3NV9A 3DZKA 3JYQA 4BO2A 1ZNQO 3DEYX 3JQAB 3INTA 3OICA 5A9TA 4JCOA 1QYVA 3GVIA 2AEMA 4FN4A 2EP7A 1PQUA 2HMTA 1WMBA 4URFA 3JYLA 4E0BA 2HRZA 1IULA 3KLPX 4AJIA 1M75A 4BKOA 2F1KA 2X0JA 3RVDA 4D3SA 3C7DB 1ZK1A 5I9LA 1SB8A 2QQ5A 3ZWMA 2C82A 4TRRA 5BSGA 1F0YA 2O4UX 4J4HA 5ER9A 3VTZA 5F1PA 1PR3A 1CERA 2WD8A 4J6FA 3S2GA 1HETA 4YB8A 5L9AA 4C7JA 3RSHA 1P0CA 1WNTA 1J6UA 5JXWA 5IDYA 1E6UA 5THQA 4CL8A 2EGHA 3D4NA 4WK6A 4WCFA 4PLHA 3G3EA 2ZCUA 2NVWA 1AUPA 2ZQYA 3RC9A 3IKTA 4I8XA 4CV3A 3K2BA 3DDNA 2Y0CA 3QY9A 2FR8A 2X6TA 1ONNA 3PJFA 4YJFA 2ZTVA 3EDMA 2OGUA 1QKIA 3EYWA 3H5NA 2DPHA 1O8CA 3ZWWA 3OIFA 4TRMA 3T7CA 2W98A 1HE5A 1TVEA 4IS2A 1Q0HA 4RLHA 3GK3A 1O0SA 4MVJA 2G5CA 3K8ZA 2NLOA 1XSEA 2BFAA 3Q2IA 4I5DA 5TX7A 3R1IA 4N54A 4E13A 4WNCA 1OZAA 1I2CA 1Q1NA 4CMEA 4XB1A 1IPFA 3PWZA 4BO0A 2BGKA 3T4XA 1NFFA 3INGA 3E1KA 1Z82A 3OSUA 1ZBQA 5EQDA 1EVJA 3V1UA 3E9MA 3Q9NA 2O3JA 4OH1A 4D44A 1IL0A 3GZ4A 2IZ1A 2WYWA 4JXKA 3TFOA 3BMCB 1T2DA 1PGNA 1DSSG 1YJQA 1ZSYA 1Y9AA 2EF1A 3O26A 1JWBB 3V2HA 1V8BA 2FN7A 4OXNA 3ZW8A 4XWYA 3ORFA 2JHGA 1WPQA 4M89A 2E82A 2FR1A 2XF8A 1I3NA 4BO4A 1PGOA 4AJPA 4TMFA 3SLKA 1T4BA 2GNAA 3PZBA 4CUKA 5C3MA 2JFFA 1FDSA 1X7DA 1YGYA 2I76A 4WCDA 5TSDA 2PR2A 3UN1A 4QFCA 1NAHA 3VKVA 1M76A 3DBRB 3C1AA 1PGQA 1Q0LA 1W0CA 1A4UA 4CR7A 2AA3A 4BKPA 1FJHA 4BS9A 3JQ9A 4G65A 5AQ1A 3AM5A 3V8BA 2GD1O 3GRPA 2HUNA 2VYNA 5FI5A 3PJDA 5GZ1A 2X86A 4GLLA 3DWFA 3DHYA 4BKRA 1R0KA 3GVXA 1B14A 2PV7A 3BIOA 3KV3O 2HDHA 4CLDA 4WLUA 4GVXA 4AJJA 2VWHA 3PDJA 1ENZA 4RPJA 1JLLA 4ALMA 3WTBA 1WXDA 4RGBA 4AJEA 2RH8A 4XRRA 5L4LA 3S2EA 4BMVA 2NV6A 2VNSA 3RWBA 4MP6A 1LQUA 4IM7A 3M6IA 4E4YA 4PG6A 2ZCVA 1C14A 4JJIA 3MOGA 1ZK4A 5KVVA 3F4LA 3B1KA 4MINA 3DZJA 2ZYGA 4Q3DA 4FR5A 3RROA 3FHLA 5ILGA 1Q7GA 3GVHA 5TQVA 1NR1A 3OMLA 4Y6SA 4ZU3A 1E7MA 1FXSA 4FGSA 2FPIA 1HF3A 1KVSA 1EBUA 1ISGA 2P91A 4RF4A 3H4VA 5LDGA 1D7OA 1HYHA 1MC4A 4CLOB 1N2SA 3WGZA 3RIHA 4CUJA 2IXAA 1NWCA 1R4MB 1YL7A 4Y98A 2B0JA 1O6ZA 3PQDA 4W99A 3C8MA 1ADGA 3P2OA 4J7XA 2CDAA 5FI3A 1P77A 2O7QA 3I9JA 4J9UE 4NK5A 5TNXA 5IDXA 3I3OA 2DBZA 1JN0A 2ZATA 1OC4A 3WWZA 1HSOA 2GPTA 1G1AA 5A4DA 2NADA 3PYLA 1SNYA 1E77A 2TMDA 5G2OA 2J3IA 3G0OA 2WSBA 4BOYA 4CMGA 4Q3EA 4XGKA 1HDCA 3GR6A 1H94A 1DC5A 2YYYA 3UVEA 1NR7A 1N92A 5KJCA 2BI7A 3JQAA 4BNMA 1N1EA 4RVUA 1MA0A 1ZEJA 1HDYA 3WGQA 3WGHA 3GAZA 4RF5A 1EQUA 3S2IA 1EMDA 1Q0QA 2H6EA 4RF3A 1V3TA 1XELA 1XG5A 5L7YA 4TQGA 2JCXA 3WS7A 5A06A 8LDHA 4PG8A 1ENYA 1F06A 1OFGA 1ARZA 3LLSA 2WYUA 4B8WA 3AI2A 4FBGA 1QYCA 2ZJ1A 3IJRA 5IDQA 2V6BA 2YFQA 5B4TA 2VRCD 5H81A 1SPXA 4UEJA 3FTNA 1K89A 4LVUA 3TN7A 5BSFA 3AK4A 5K6AC 2P9EA 4M1QA 4QX6A 3KYCB 4IIVA 1KEPA 2CZCA 5COAA 5DULA 3ROPA 1BVUA 2OZPA 3ZI0A 1W73A 5K6AA 1DEHA 2I6TA 4E2WA 1LA2A 4ZN6A 1YB1A 3RUCA 3QRWA 5AYVA 3AUAA 5JE8A 3NT2A 4XR4A 1DFGA 2P5YA 1F17A 9LDTA 4W7HA 4N5MA 4Z0TA 3KSZO 4BKQA 2Y05A 4E33A 2YQ4A 3U4DA 4OJNA 5ICMA 4BKUA 4JLWA 1E3LA 4QO8A 1OBFO 1P1RA 1GQYA 4AJKA 5DT9A 3BMQB 1C0KA 1HE2A 4II2A 1GZ4A 3ADPA 5JC8A 3UCEA 5DCUA 2Q2WA 2W4QA 3RFVA 4H16A 4CQMB 3ZDFA 2I66A 3NJ4A 4YTEA 3ZWBA 5DP1A 1LSOA 5IXSA 2GLXA 4M49A 1JAYA 3E18A 2LDXA 4D41A 2O4CA 3DHEA 4OKNA 1QG6A 1PS0A 3EY4A 3RUFA 3UHAA 3ZGYA 2ZTUA 2AW5A 3H9UA 2QRLA 1X13A 3KYCA 2B35A 2CF5A 2NWQA 2OBNA 2HAEA 1Z7EA 4IINA 5EESA 3GNTA 5C37A 4DIFA 5DN9A 4NQZA 3KTDA 1VL8A 3DBHA 3WSWA 1NHWA 3FNEA 1UP6A 1UP4A 4XJSA 3LLVA 3OJFA 4BV9A 1BXGA 4D79A 4GWKA 3EGOA 5HTOA 4BNUA 3NYWA 1RM5A 4PG5A 1NTOA 2HSDA 4UUPA 5IAAA 4FB5A 1UXJA 4DLAA 4GH5A 4IXWA 1HZZA 1YBMA 2GGSA 3PYMA 1AXGA 1KS9A 3AM3A 4MIEA 4WOKA 4XYMA 1R37A 2V6FA 4BGEA 1W6UA 3QVWA 4NR0A 1HDRA 3BZUA 4BL5A 4BV8A 4M55A 3QWFA 4XDZA 1L7EA 4R1SA 1C1XA 2JKVA 2C7VA 2VTEA 2JHFA 3RUAA 3QWBA 4BB5A 6LDHA 3ICPA 2C07A 2VHYA 2Q50A 4JP2A 4MDHA 1H6AA 1ISMA 1HDXA 3JCZA 5GZ6A 1U5AA 1SBYA 5F5NA 2WYVA 3VZPA 4A26A 4AL4A 3GNQA 1KC3A 1GQ2A 4YR9A 3RUIA 2JAPA 3L9XA 3IMFA 1ZVMA 2B36A 1U3UA 5JMWA 1QYWA 3KVOA 3UW3A 1GR0A 1U28A 4WASA 1FDVA 4PCVA 4QUKA 4DUPA 1UZLA 3GHYA 1V3VA 3M2PA 4CLHA 2I65A 1I2BA 3GRKA 1BWSA 1UXKA 4XJTA 3G49A 3VAZA 2EKLA 4ITUA 2OXIA 3KXDA 4I5FA 3BXXA 4IY1A 5I8WA 5EJ2A 3ITDA 3ENKA 1E7QA 3EZYA 1HWYA 3HG7A 3AJRA 4PGFA 4FDAA 3H3FA 1LSJA 4GKVA 1V3UA 3ASVA 3JQ7A 4PLYA 3WNQA 5B4UA 1ZEMA 5C7OO 3GGGA 4QSMA 1NQ5A 3NTRA 4YJGB 1DBVO 1VKOA 2A9FA 2NACA 3F4BA 4IDEA 4E5NA 2NNLD 2AEJA 3FPLA 4DC0A 3W8EA 1LDYA 3KM0A 1N9GB 1TT7A 4K6FA 3GH3A 1GUZA 2X5OA 1KEUA 3L77A 4YJDA 1MB4A 2F00A 3KRTA 1JQBA 3W4KA 1NYTA 4BNIA 1YWGO 4CQLA 5J23A 3WMWA 1GUYA 1XWFA 2Q1TA 5FFFA 4B4UA 4PLZA 3DFUA 3OECA 1YVEI 2PK3A 4K6CA 5I7FA 4CM4A 1U9JA 2EJVA 3PHLA 4CM8B 1D8AA 3TPCA 1LI4A 5G0SA 4ALJA 4HUJA 5A03A 3F1LA 2Y93A 2HU2A 3PJEA 4INAA 3I4CA 1GZ6A 3HUDA 2A4KA 4O0LA 4IGEA 3DXFA 3EVTA 3H9EO 3VPXA 2ZQZA 3RBVA 4IDCA 2VYVD 5JNLA 2BGLA 5A3VA 1DAPA 3KEOA 4R68A 4UUNA 4NJOA 1PWZA 1EDOA 4TZKA 1PR9A 4JJGA 3HDYA 4J2HA 4F6LA 3ANNA 4U0KA 3WMXA 3ICCA 1EVYA 4U6SA 5JMPA 1E3WB 5EL0A 4L4XA 1PU2A 1PJ3A 4J7UA 4WPGA 5DBIA 3X2FA 4BVAA 3LT4A 4CQMA 3A4VA 4ZA2A 5TS3A 4JNKA 1BMDA 1KVUA 2I5PO 2EJWA 3T4EA 2J5RA 1LC3A 2IODA 3KBOA 3FNHA 2RAFA 3GY0A 3NKLA 4ZQBA 1LLUA 3WDSA 4LGVA 1EEHA 3GG2A 1QYDA 5C7LO 2C20A 1BRMA 2IEDA 4NNJA 4ZQFA 1HEUA 3RBZA 2EG9A 2X1HA 3GFBA 5T8KC 4Q3NA 5CEEA 2JCYA 1YS4A 3AI1A 4J2OA 1WDLA 4MOWA 1BW9A 5ADHA 3U4IA 5HRUA 3UCFA 4YAKA 2CSUA 1CF2O 1P1KA 1E3SA 4LSMA 1PQPA 4UREA 1DHRA 1PIWA 4PLWA 2FMUA 4FFOA 1XDWA 1P9LA 2PZMA 2QZZA 2DVMA 3FNFA 4JROA 4ZVVA 4AJ4A 1EUZA 3H9JA 4CLRA 1QRRA 1VM6A 1EZ4A 2P2SA 3F5SA 2V6MA 4ZQEA 4EGFA 4M8SA 1NM5A 3ZV6A 2O3TA 3D4PA 4YAIA 4PLCA 4FQ8A 4LISA 4QEDA 3VVBA 2CY0A 2Y99A 5TLSA 5A05A 3H65A 2Y1GA 4DMLA 3K96A 3ROQA 3JQ6A 4B7CA 1XA0A 3UICA 2X4GA 1LX6A 2PH5A 4YQYA 4IDGA 2RHCA 3PWKA 3SX2A 3ZHZA 1XR3A 3R0IA 5AXAA 3Q2KA 3QVOA 1GZ3A 1P74A 2R00C 4DREA 5IJZA 1H0KA 2OUIA 4IDDA 4PLTA 4RORA 4YT4A 1I01A 1ONOA 3FPCA 4TWRA 1GY8A 2UYYA 3INRA 2CMDA 1SB9A 2JAHA 2D5CA 3VH4A 2H63A 4QXMA 3X2EA 3E82A 2AXQA 2WE8A 4I5GA 2FZEA 4XQCA 4Z9YA 1GYPA 2VCYA 5JY6A 3WIDA 1U4SA 1R4NB 2AE2A 3ZH2A 4PLVA 2IYPA 4ZD6A 1B15A 4H15A 3KYDA 1EVIA 4RQUA 3RC7A 4D42A 5KCZA 4EI2A 2R00A 1LRKA 5G4LA 3H5AA 3RC2A 4CMJA 4L73A 2ZTMA 2DKNA 3DB2A 3NUGA 3GN2A 1WZIA 3FWZA 2CD9A 1PJTA 2TMGA 3TOXA 3WYBA 4I08A 4KMSA 5B1YA 1LNQA 1Y7TA 3U9LA 2J8ZA 3GGOA 4R16A 2VUTA 1QR6A 3DMYA 4RL6A 2FP4A 3OQBA 5COBA 5JO9A 3KLMX 3TZKA 3KZVA 2EEZA 1MC5A 4HNHA 1YL6A 4WLEA 4CV0A 1B16A 3OF2A 3CXRA 2C5AA 1UZNA 1RYEA 1UXHA 1JU9A 1VLLA 4FIZA 1GL3A 1EFKA 3VVCA 2EKPA 2Q2VA 3BMCA 4JJFA 2VOEA 1BSVA 3GOHA 4R4JA 2Z95A 3H9GA 1GADO 3N74A 1YL5A 3UFXA 3MTGA 1JDJA 1YKFA 2X8LA 3TDKA 4RPGA 4RVFA 4AJ2A 2HK8A 4BO3A 3VH3A 4HX5A 4RVDA 1C1XB 1GU7A 1LUAA 1RKXA 3PLRA 4NHEA 1DRUA 5ES3A 1E1NA 4PLGA 3HJAA 1OC2A 3LC2O 5JCJA 1FDUA 4I9NA 3U62A 1X1TA 2ZB7A 1I8TA 2FSVA 5GZ3A 4MJLA 2C59A 2WE7A 3U4HA 4MKZA 1IB6A 1E7SA 1H2BA 3H9QA 2P5UA 4FFLA 4CQLB 3FNGA 5JYEA 4E6PA 1R12A 3VDQA 3IS3A 3NGXA 2YY7A 2I3AA 4UUMA 2NSDA 2VTDA 3LZ6A 1HZJA 5AXBA 5I7EA 1UAGA 4K1LA 1EUDA 3O8QB 4R51A 3T7EA 5C5IA 1QV7A 1MV8A 2EWMA 3WXBA 1X1EA 4EW6A 3I9OA 1Y5MA 1P3DA 4Y6RA 4KTTE 4EUEA 4DC1A 1X0VA 4W9NA 3QSGA 2O3SA 2D1YA 2X58A 3GUCA 3VZQA 1KC1A 4GL4A 4K9DA 3TZQA 1I33A 2R2GA 4HFMA 4OXKA 3RQSA 1NVGA 4MIYA 3M1AA 4HFRA 3HQ4O 3NDIA 3JD3A 2PZKA 3NTOA 4MKRA 2Y66A 5GMOA 1Y6JA 4W7IA 3AOGA 3MJVA 2VHVA 2ZK7A 3A1NA 4NPCA 3UGKA 5KVSA 3GDGA 3AU8A 1CJCA 3RAJA 1LRLA 5BSEA 3ST7A 4A5OA 3FI9A 2VQ3A 3MJTA 3W6UA 1ZXLA 4ONEA 4D0SA 3GPIA 3IL2A 1HE3A 2DT5A 3CH6A 4RF2A 3RJ5A 1Y5RA 2YJZA 1NP3A 1DFHA 3L4BC 4MO2A 4DPLA 4BNWA 1TA4A 1ZIDA 2EIHA 1Y8RA 3DQPA 4CUZA 3TFQA 1DAOA 1E7WA 3B1JA 3DMTC 1UXIA 1E3JA 4YXFA 2QX7A 3O9ZA 2QYSA 3JQ7B 4AJLA 1ZCJA 1MFZA 1ZJZA 2YHIA 3GT0A 3LK7A 4M54A 3WB9A 3ZNPA 5CPBA 1SAYA 2HQ1A 3VPSA 2DFDA 3ZWPA 5HM8A 5L95A 1B8PA 2VT3A 3KUXA 3E03A 1I10A 1GYQA 1KERA 1PJBA 4PZDA 2GN8A 1DJQA 2QG4A 4WUVA 4Y8VA 4HFJA 4YCAA 2GF2A 1HKUA 1P44A 1K6XA 2QIOA 3DAPA 4PIVA 4L8VA 4DRYA 2E37A 4NJMB 4RPLA 1DO8A 1B3BA 2G17A 4XQGA 1A5ZA 2CVOA 3QQPA 4QECA 2IRWA 2DLDA 3PVZA 2ZB8A 3RFTA 3ZU2A 4YT2A 3E8XA 2X9GA 4AJHA 3C1TA 1UH5A 1I30A 2YHIB 1E1KA 1P45A 3BTOA 1MXFA 2VHWA 2NTJA 3NDRA 5F1KA 5KOIA 3F6YA 2R6JA 1EK6A 2Q1WA 3AOEC 3KSUA 2X22A 2YDYA 4WOJA 4BGUA 4GSKA 2Q1UA 2WM3A 4I9UA 4MVJI 5A5FA 1YBVA 3QE3A 3ON5A 3RKUA 1AE1A 4L76A 1A9ZA 3DMTA 4TVBA 4N5NA 1YDWA 4ZQGA 1QXSA 3AU9A 5KJFA 5L45A 2FR0A 3ADOA 4FOOA 4IZIA 1DDOA 3FTPA 3JQDA 3R3JA 4ILKA 4OGWA 5A1TA 4QQRA 4FFNA 4L75A 4RDIA 3VPFA 2Z1NA 4IQ8A 4MVJM 4E5KA 1EUCA 2PH3A 4TVOA 1YB4A 4J7CA 4KQWA 1PL6A 4IJKA 4MKXA 5EERA 3SLGA 3W4JA 3WYCA 2YFHA 4BNHA 5L3ZA 3ULKA 1GQQA 2J3JA 2Q1SA 1ENOA 1PJCA 2DC1A 3B20A 3K6JA 4JN6B 2O7SA 4P4GA 5CDUA 2W2LA 4FC6A 4BMSA 5A9SA 1B0AA 4JX8A 4WEQA 2H1SA 2NTVA 1ML3A 2G1UA 1EBFA 2A94A 5JS6A 2P9CA 3MJSA 1YXMA 3PGJA 3ZNQA 1ZMTA 4DVJA 4BQRA 5L53A 3U09A 5BNTA 1DB3A 4PVDA 2VUSA 4RZHA 1BXZA 2ZTLA 3D3WB 4WCFB 1LJ8A 2DTXA 4DPMA 5BSHA 2OOSA 2QRJA 4CR6A 4F6CA 3JD4A 2DUWA 3D1LA 2VT2A 3F5QA 5JLAA 4J1QA 1AXEA 3NDJA 5TT0A 4ZQHA 3ASUA 3P2YA 5C7IO 1T1RA 1JW9B 1E92A 1WAMA 5MDHA 2Q45A 1M66A 2Q4BA 1U2GA 3GC6A 5JY1A 4J90A 3ZWOA 1GDHA 1ENPA 4CMIB 1EK5A 3Q9UA 3GEMA 3MJ4A 1X7HA 1EQ2A 2ZIZA 4Q3CA 5ITVA 2EW2A 1HSZA 1BHSA 4FGWA 4F45A 5DP2A 2VYND 3LT2A 3Q1LA 4CMCA 3WFIA 3C1OA 3MJEA 3ETEA 3OFSA 4B4WA 1F8FA 3WIEA 3D5TA 4UVGA 3U0BA 3G1UA 4Z9XA 5IN5A 4ID9A 2CUKA 2GN6A 2NU7A 2OORA 4KWHA 2UV8A 1B2LA 3UUWA 3JQFC 1I5RA 3RASA 4E5MA 3MCVA 1HTBA 1X7GA 3ZHYA 3HSKA 5FYDA 4YEDA 5ENVA 4BO9A 3RC1A 2NVUB 1LDGA 3WSVA 1M6HA 1PJQA 1W4ZA 4CM4B 3QA9A 3IQDB 1OI7A 1D1TA 4M87A 4QO7A 4J0EA 1SO8A 5JW6A 5DOZA 4Y67A 2WMDA 1Y8QA 2A35A 4YT5A 4Q9NA 3KYBA 3DR3A 4I5EA 4KTVE 1NASA 1K0UA 1F14A 3OQ6A 4L74A 4A7PA 2ZB4A 4KUGA 1VE9A 1I3MA 4Q39A 2JD2A 1N7GA 3OBBA 4YRAA 4FOSA 3L6OO 4YRDA 3K5PA 4CMAA 3V2UA 5JO0A 1G6KA 1U4OA 2BF7A 2D59A 3VPGA 4EUHA 4WLOA 5CDTA 5KTKA 2RCYA 1IUKA 4MVJD 1UDCA 5EIOA 3TJRA 1Y81A 4O5OA 3S2FA 4DYDA 2EW8A 4EZBA 3HWRA 3I83A 3I52A 3IKVA 3CZRA 2GUGA 1SMKA 1V35A 1LQTA 2Y0DA 5L40A 2NQTA 1YDEA 4MP3A 3ZHBA 3IOYA 4N5LA 4NFYA 1TT5A 1JKIA 4RO0A 4H7PA 3ZCXA 4BNYA 4CLXA 5A02A 1CETA 1WVGA 4FCCA 2NVUA 3QIVA 5ILOA 3GDOA 4IJUA 4J0FA 4II3A 4MVJH 3I5MA 5F21A 4YACA 1KY5A 1JVSA 2I99A 1XHLA 3WJAA 2PY6A 4BGVA 2Y1CA 1E5LA 1S7CA 4FC7A 3W8DA 4EEXA 3L6DA 1LC0A 4CJXA 5TJHA 1NVTA 1YQXA 4XYBA 4NJMA 4PLPA 4B3IA 1KY4A 1DC3A 4FFPA 3VDRA 2FRDA 3BTVA 3QJ5A 2YV1A 4U0JA 1RPNA 1TT5B 2PNFA 3F3SA 3GF4A 3SC6A 1CQIA 5TJ9A 4GI2A 3K31A 4XRGA 2HMSA 5K9ZA 4UEOA 4ZGWA 1H2HA 4YAEA 4NBWA 1YOVB 2FZWA 1NVMB 1U8FO 4YYZA 3LF1A 5HS4A 1FMCA 2NM0A 5TRTA 3JYPA 1QP8A 3DZIA 5CDSA 1Y9EA 3JSAA 4LCEA 4OSPA 3ANMA 3EK2A 1Y8RB 2Y67A 3VZRA 2NUAA 5KJEA 3GZNB 4A73A 4ND2A 5DDIP 4E5YA 1U1IA 1VPDA 1T2EA 2HMWA 4RPHA 3TOZA 1ID1A 3KEQA 4D43A 1FF9A 3AW9A 4R3WA 4XYGA 2B4RO 3ABIA 3NAQA 2GZ1A 2JCVA 4W6ZA 4Z0HO 1GFSA 4GKBA 1A7AA 2D2IA 5A9SB 5ER6A 3AM4A 4M86A 3O03A 4BNKA 4XEHA 1T25A 4IDFA 1DJNA 3PEFA 1KEWA 2JD1A 1QV6A 2AE1A 3DOJA 1Y1PA 1HLPA 4CV1A 2Y1OA 3NT4A 3IUSA 4BB6A 3KB6A 1TLTA 3TZ6A 3DBHB 2ZYDA 1PGPA 4E2YA 1ZK3A 2EKQA 3FSRA 4ZJUA 2D4AA 3O38A 2B4TO 2UVDA 2Y0EA 4C7KA 3ZNNA 5F1OA 3PHGA 4GX2A 3PYXA 3DTYA 1LXCA 1GPJA 1HT0A 3RFXA 3PI7A 4GQAA 2IE0A 2GN4A 4P4LA 1V6AA 2BGMA 4L0QA 3TWOA 1SC6A 4RZIA 1B8VA 2J3HA 1P33A 3EW7A 5HBRA 3GPDG 4EJ0A 4RVHA 3BMQA 4RLSA 3NEPX 3OP4A 3HDQA 1DIAA 5CDYA 3D64A 4BHTA 1GEGA 3EUWA 4XZ3A 1K6IA 3E48A 4IBOA 1ULSA 2P68A 5KNLA 1IHXA 2XXBA 3CE6A 1BTOA 3EZLA 3RKRA 3ZU4A 4BGIA 3P7MA 4B3HA 4ND1A 5T57A 3B1FA 1D3AA 4Z3KA 2O3UA 1PX0A 1V9LA 3TQHA 5KWEA 1GAEO 1G0OA 1VSUA 5L51A 3WGTA 1DFIA 4R69A 2HLPA 4IMPA 5IFLA 3ZWXA 1CIVA 2DM6A 3OETA 2PKRA 4HKTA 3ZZNA 3PTZA 4YPOA 4TKLA 4E21A 3BHJA 2CVZA 5DOVA 1B8UA 1GYRA 5LCXA 2YQ5A 1X0XA 4TROA 3SBOA 6ADHA 3JQFA 1A72A 2DUUA 4D3DA 5I8ZA 2VHXA 5B37A 5G0VA 3N7UA 4CMKA 3JD1A 1V0JA 3DZGA 3LF2A 4HBGA 3PRJA 4OQYA 1Z74A 1R0LA 1N5DA 3B70A 2UUPA 3KHUA 2AEFA 3O4RA 3PZRA 4IXTA 2I9PA 1NPTO 4PZEA 3BYZA 4JQCA 4PFJA 1P31A 3UAGA 1RWBA 5COQA 2AG8A 3ZNOA 3U5TA 1PEDA 1T26A 1XYGA 2AQKA 3I1JA 2BELA 1CQJA 1U5CA 2HRBA 3RUDA 4DQXA 3ROKA 2GASA 1GUFA 4JBGA 3ZWVA 1IE3A 2G0TA 3E9QA 4DBVO 3QVSA 3I9KA 3JYOA 1UDAA 2X5JO 3AI3A 3M2TA 3TF5A 3PJGA 1E7YA 2BLLA
chains in the Genus database with same CATH superfamily
2JAQA 2H4JA 3ZPXA 1PL0A 1Z0FA 2C92A 4CCYB 5CA1A 5EN4A 2NU6A 5E3JA 3T12A 4DLBA 2GXSA 2KE5A 4GX0A 5FT9A 1CY2A 2GCIA 3MWEB 4LPSA 5DH9A 2H9IA 4LDJA 1XMVA 5DHFA 5EMNA 5B4VA 1M5UA 4K81B 2OR3A 3O95A 3DLPX 3BWVA 5G0WA 3W6ZA 1SEVA 4I2VA 5EXSA 1AKQA 5ITWA 4EL0A 4HQRA 4BNFA 4NNOA 2VHQA 1U0FA 1U8TA 1X7ZA 3GLIE 4RX1A 1Y1RA 5DIZA 1PAUA 1EAMA 1YCGA 4PYIA 2HSZA 1T8TA 2I6FA 4LRYA 2ZRDA 3DD5A 5GJCA 4KXFB 4HAWA 3CW2A 1GDTA 3ZK9A 3CR8A 3W5HA 1P91A 3ZDXB 5KJ1A 5KKCA 5K0SA 2BD0A 4EJSA 2PSFA 2ODTX 3KHKA 2H06A 4I1VA 2VDKB 1KE2A 3T0FA 3U37A 4DCMA 1ABBA 4AECA 4TWZA 4AULA 4OQZA 4ZC1A 3DBLB 1DCMA 3H2SA 1ZNYA 1WM1A 1VCNA 1VL2A 1JHQA 2GF9A 2PRIA 2ZDHA 4G4SP 4RVOA 4FEAA 4WKOA 1N2OA 3R9WA 1UK6A 4WDQA 4OLAA 4BU1A 1KGSA 4B3BA 2Q49A 2XTZA 1GNPA 1VL0A 3OOHA 1I7QB 1QUEA 3AUXA 1W0KD 3G0CA 3RSFA 5CG2A 4CV2A 3AEKA 2V54A 4YA6A 3IQXA 1JG6A 4JYBA 3SVTA 4LTMA 2C9BA 2PO5A 2WVGA 3C8DA 1M2GA 3GX1A 3VR3D 1XTQA 3L8GA 4NJEA 1V7QA 4XTRA 5EJGA 4HLDA 4QGHA 1L1FA 1Z45A 5LZ9A 2RHDA 4AS1A 2BBTA 3SEQA 5CEJA 1PZFA 1B0ZA 1F2VA 4CKBA 3BFPA 1E98A 1SUIA 1TF2A 3DLIA 1XLTC 3MSCA 4MWSA 3TSWA 1WZUA 3ZVKA 5BMVA 2BN4A 1B6TA 1GT91 2R66A 1W8IA 1DOHA 4LJSA 5KX5B 2W6PA 2F3UA 2N3ZA 2A0KA 4B5KA 4EA8A 4TVKA 3MQ4A 1FQJA 3CR3C 4OGKA 4V0NA 3THWB 2V3CC 3N2LA 3P9SA 5B7GA 3JQAD 4UDNA 1XTSA 3AKYA 3N05A 4N7MA 4AJ9A 5AUNB 4D6XA 1U7DA 3OE4A 4Y6LA 1IVYA 5CLGA 4F96A 4GMFA 2WYOA 1A4XA 1G5PA 3HDVA 3TRDA 1MOSA 3RFCA 2ETVA 4ERNA 2DR2A 5HE8A 2BRUA 2QW8A 1A5SB 1XLWA 4GGPA 5A6VA 2QL6A 2PWZA 1VP9A 1AKMA 3BIWA 3L93A 4CLRB 3DBLA 4JP3A 1E3EA 1SD5A 3A27A 3DPIA 1XZCA 4XSGA 2C78A 2H5LA 3I23A 1YJXA 1O9BA 4UTXA 3ZLJA 3D6MA 3CH4B 3LJKA 3UG7A 3TR6A 3MYRA 5KAMA 2C0QA 1W5AA 2P6PA 3CLRD 3HKBA 3VX4A 3U4MA 1F0NA 2WC1A 4JODA 3DEZA 2A1TS 4CM9A 4IP0A 4EPVA 1E5TA 4JCCA 3HA2A 3FWNA 3DLBA 4HRYA 1WTAA 3H7IA 1QYXA 4GBMA 5JYBA 1X1CA 1UZMA 2VHTA 5AI5A 3TL2A 5EAIA 5LBTA 1QIMA 4QQKA 3SZOA 4TSRA 2VDUE 4KPGA 3D0RA 5KBYA 4N3AA 4TV8B 3K0FB 1MFPA 5AXDA 1J8YF 3CUEF 3L7NA 3S27A 1BG6A 2X1LA 2P4QA 1CDEA 2FWJA 1A2QA 1IZ0A 5TGZA 1CUGA 3AM1A 1J99A 3DBIA 5LQUA 1UDBA 1E64A 3IE0A 2RARA 5IZ4A 2ILVA 4NU8X 1W87A 4GPD1 1I32A 1D2GA 5CJPA 3G8AA 4LRQA 1I7DA 3QE0A 3PJRA 3U4CA 2NO9A 3NI2A 4OKIA 1ZJYA 3O47A 1SOWA 4R41A 1UBUS 3QNWA 3SQXA 1Z73A 2YQZA 2VJMB 3GRRA 1YZHA 4RH0A 2HJRA 4W8OA 4ZVMA 3TLAA 1WWKA 3S0JA 4IF6A 3A14A 4CQJA 1DJLA 1YAJA 3FNIA 5JCOA 3WGLA 1MXHA 3U3JA 3WTCA 2FWBA 3O1LA 3PQ6A 5BQXA 2UZ1B 3T1YB 3EZ2A 3ZY5A 3Q15C 5KNBD 1GWNA 2G63A 1JT9A 4ALLA 4BRZA 2IYRA 4PNEA 3P2EA 2F9FA 4G9EA 4RJJA 3N6VA 4Q00A 3M5DA 3ANLA 3KHSA 3KOUA 4H4DA 4MQUA 4H3VA 3SEAA 3QU5A 1O03A 2HNKA 5JQWA 3OIUA 1YZGA 3AL0C 2BI8A 5GP1A 3T3EA 4NPHA 4RFSB 1JDZA 4FYPA 2HX1A 1QV9A 2J4DA 4KX3A 4KV7A 3DAHA 2OXTA 1XNGA 1ZP6A 2VF8A 3B6IA 3TLKA 3ZQKA 4B3TB 3FD8A 2AKEA 1ACMA 1PFQA 5AKIA 4CQMD 1VGVA 4YI3A 1JTVA 2DU8A 2BWJA 5FPTA 2ZSJA 2XW6A 3TNLA 1Y48E 1I0IA 3GUVA 2XECA 1G60A 2X5NA 1YS2X 2N42A 3G17A 3LWBA 4DLWA 4B79A 1LX7A 4ARVA 5CBPB 1I24A 2G82A 4N39A 1SCDA 4HP8A 2QDXA 3U19A 1KETA 3AZQA 4KE8A 3VYSB 3UGJA 3U7QA 3A11A 1GFIA 3TCXB 3V8MA 2DT8A 4HNSA 3ZCRA 4YV7A 3CNLA 3BD9A 4CM7A 2R25B 5EQFA 1P0PA 4WXMA 4ZO7A 3GD5A 3IVCA 2L82A 4LRXA 3EH1A 3E7FA 1N9GA 4ZCMA 2ZJ2A 4NCNA 3MGBA 4FYXA 4HI0E 1TZJA 4ABTA 2J6IA 2XADA 2XOXA 1LDBA 1V5IA 2V7BA 3ENWA 4UDYX 3TEJA 3VZSA 5JD3A 1U3CA 3MGGA 1YE8A 3CISA 3FFAA 3BMOA 1NF8A 4HDNA 1OXBB 4M2LA 4WKGA 2CLMB 3RSSA 4ZKDA 3FMPB 3OZFA 4PC3A 2IQ5A 4IKOA 4P3XA 3N7TA 3J81A 3JALA 1BVHA 4I6EA 5EHQA 3IODA 4NFSA 3L2OB 4G1CA 4JA2A 4NMHA 1T3TA 2E4UA 2J5XA 1ZW6A 2OQ2A 3GLGA 5JYCA 1Z5PA 4J0GA 3DV0A 2JLAA 1SEPA 3DE5X 4ARAA 3UT5A 1BD3A 3I8OA 2APJA 2XDWA 4MUYA 4U7GA 4RTLA 2GF0A 2OXEA 2QRKA 1ZUD1 4UVIA 3ET5A 4IUYA 3C3MA 3CO5A 4X5OA 3LMKA 4KZKA 4NXMB 4WA8A 2DFVA 1Z12A 2XZTA 2Q3FA 4HQNA 4Z7JA 2NNWB 1S3FA 1T1IA 1VRCA 2XRMA 4YUWA 2O8BA 1Z2DA 1EWVA 3IHTA 1X1DA 1CJBA 3MCUA 5I7RA 1IHYA 4WFIA 3TXXA 3R6DA 3MWGA 1GPMA 1YQQA 3F90A 1X2BA 3M5PA 3PU6A 2PGAA 2PRYA 3EMVA 3NYIA 4DG5A 4BCBA 3H2ZA 2I62A 1E1QD 1QORA 2FFRA 4O2LA 1L5WA 3U13A 4KLZA 4YIKA 5L7TA 1TK2A 1WVMA 4W9MC 3DZCA 4RV9A 5BN5B 1J0EA 2FWPA 3OFJA 1EX9A 3P9KA 1G8PA 3VR4A 1ZVVA 4IFEA 1GEEA 4E2ZA 4Q7JB 4KUEA 2PMFA 3UK6A 1FFYA 3EGIA 4UATA 5ECWA 4AWAA 3EH2A 5JHGB 1DIRA 4DR6B 5JWOA 4ZRMA 3C3JA 1ZCBA 2GM3A 3LUGA 1I7LA 4FW8A 1AGRA 2OCLA 3NHZA 2LPMA 2ZRHA 3H84A 4GMGA 2G88A 1MQAA 2VJBA 4QU5A 5SY4A 3TW8B 3GYGA 4B75A 3RVSA 4EAAA 5EXDA 1U0BB 1I0ZA 3ZS9A 4M8NE 5AVRA 3U3RA 5T4EA 5EYPB 3M8KA 3M0EA 4C1NA 3C7CB 5IMBA 4BASA 1ZK2A 2D8AA 4E3ZA 1FQWA 1WXEA 4DNOA 2PFGA 1VYHA 3CHYA 3M9WA 3OC6A 3QXSA 4A91A 1M2FA 3Q3IA 2HO5A 4RWEA 3QKIA 4MVJF 1OMOA 3IUBA 2XZPA 3CZMA 5K09A 1DG9A 2X7HA 3EAFA 4LWQA 1DO2A 2YN4A 4UHKA 1V1JA 3KT8A 2PQ0A 1E3DA 2RGAA 2F3SA 4LWZA 1VI6A 4MV7A 3JR7A 3COPA 2PS0A 2XE7A 3WK9A 3WV4A 1QFJA 2BEJA 3HN6A 2XGJA 4BP9A 3NAZA 5EMJA 1LLCA 4ZMSA 4H6XA 1DLIA 3BA6A 3LVQE 3C6XA 2QP9X 2R1UA 4CRWB 4C76A 4Y2GA 5DEIA 4MIOA 1QCZA 4LSGA 4OK3A 3TSCA 3K1TA 2ZYAA 1YI8A 1FMFA 1J0XO 1IBLB 2BTQA 1F4PA 3G88A 4JUAA 4CGZA 2HMVA 2IH5A 2JDID 3MMZA 1QO7A 3CPSA 4MLZA 4KOEC 4RTOA 2VNHA 5DASA 3RI3A 3HFGA 1WMDA 1KI4A 1YT5A 3A58B 3DD1A 4LRSB 4MJXA 2QNRA 4E11A 5LXTB 4S1VA 5IUJC 2PX8A 1E3MA 5AVYA 521PA 4GSLA 2GNOA 4JOSA 2JLSA 4H7HA 1MUUA 1M67A 2RGUA 3OC0A 2OY0A 3EA4A 4EFKA 3HKDB 3W2TA 2BFDA 2UYHA 2H1LA 1N32B 5HIJA 4HVCA 1IXYA 3N2ZB 4PVCA 3QFCA 4DHEA 3N0RA 2IYFA 2NO7A 1Q91A 4WGGA 5JXJA 3QVTA 3UPDA 4FSDA 3LHIA 1CU1A 4KHZA 3VH2A 2DULA 4X00A 2R8BA 4IZ6A 2XKAA 5ALEA 5K99A 3RU3A 4DLLA 1UEIA 1H5UA 1OFUX 1YULA 2O0JA 1J49A 4KYUA 5DM60 3EPPA 3QWHA 3TQTA 1KPGA 4NMMA 2GCNA 3M83A 5DTIA 1M0TA 3ANTA 4FMDF 3W05A 3COYA 3A3OA 4LTDA 4MA4A 4U8HA 4EW3A 1VB5A 2X15A 4CIDA 3B2EA 3F78A 4XJVA 3I01A 1L4MA 2B4QA 4AM8A 2W83A 4JBIA 3CF6R 5JSFA 4PAGA 5CUQA 3H4MA 3S99A 3FPAA 3KQOA 5A4FS 5DHRA 2HEGA 1O5TA 2DTEA 3CYFA 3ORHA 3IKLA 4NYMQ 2WWRA 3C70A 3DPUA 5K8UA 1Z36A 2B21A 5L3VA 1PKEA 2FYTA 4XH9B 1L5OA 4CEHB 4L57A 1RLUA 2PR7A 4EFNA 1C3OA 2WHPB 3RNLA 4D8VA 4YMVA 2PM8A 3TRIA 3TL3A 2LE0A 1U3WA 3RVBA 2GBLA 2WOJA 4DIOA 5CXUA 3ORSA 4FYKA 4UHJA 4X20A 3JAMA 4X7PA 2BMFA 3RUEA 1R4NA 1T3HA 4ZEWA 5JCOC 3QVVA 3WWEA 5J43A 2ORVA 1E3TA 1Z0UA 4C6TA 1BDBA 1LW7A 3THYA 2VQDA 2WF7A 1DXYA 3ZU3A 5CDHA 3PGXA 4UHDA 3F0TA 4C14A 4WX2B 2RIRA 5BN3B 1PQ4A 1XCJA 4KMMA 3ETHA 4X64B 2O2YA 1PNQA 3NIBA 4O4LA 3ZVLA 5KQGA 4BN5A 1NJSA 4MCAA 1MGOA 3LBHA 4JBXA 3GLIA 1ADFA 3W79A 1ICEA 3ZE9A 4KXWA 5FL7A 5TGTA 3DMPA 1O6CA 2ZAMA 2ZRAA 4ON9A 2MOKA 3IPYA 3GNSA 5H5JA 3LP8A 3VNQA 4G5YA 4N8EA 5A9RA 4XSVA 2AR9A 3M5WA 3RHZA 3DV9A 1C3VA 2OL4A 3EBLA 1OLXB 4MRPA 3DVAA 1KI6B 1S5PA 4BVJA 4DW8A 3IEMA 1EM6A 1X15A 1K5PA 2Y1EA 3JQ9C 3E3AA 2IS6A 2B8WA 3AFGA 4RQTA 1L4GA 1Y3FE 3DLAA 4ZVPA 3GL9A 3P19A 2HMUA 2WJJA 4LYDA 1E1MA 1PZHA 2WP8J 2RG1A 5KYUA 4DABA 4ER3A 3HBFA 4O6VA 4ALNA 1DXOA 4ZDWA 5BYJA 3VR2A 2ECOA 3NTUA 2C4MA 4FE4A 2GSDA 1G64A 2EAUA 3WAKA 4DIBA 2GZAA 2O05A 4BCCA 3HM2A 2K7ZA 1OBOA 2LCFA 2FHSA 2IF2A 3M4XA 2Y1LA 1PFGA 3R41A 4TZ6A 5U4QA 2G70A 2GCGA 4MJ3A 5DNVA 4EQ6A 3HNOA 1P1IA 1Q16A 2NTNA 3JQPA 2P8JA 4FMBB 4H1UA 2GO1A 1VE5A 3H3JA 3DONA 3GAAA 3SC2A 3C6QA 1XZ8A 1G0NA 2JGJA 4EYKA 5JYDA 1RXWA 1H23A 1AK9A 1OLXA 4QFDA 4JI8B 4Z99A 1Z39A 3V4PB 1PYOA 2FDCA 4B2YA 3LCJA 1E2LA 3NOOA 1NFQA 2I71A 1FNMA 1NOIA 2AFHE 1COWD 4ZOCA 5IWAB 4WECA 2V7TA 3TQFA 1DXHA 1Z34A 4YN3A 1H66A 3NYRA 3P8ZA 2VK1A 1ODLA 1NX6A 1CRQA 1V71A 1Y5NA 4HYEA 5H02A 4MH0R 1BU8A 4D4IA 2NUBA 3A28A 4AKEA 1AHPA 3UYLA 4GI7A 4YUXA 1JQ5A 4KV9A 1KZ6A 3MHTA 2FV8A 4KQKA 3ZYCA 4M0UA 1M2EA 2IZZA 2YMPA 3MZ0A 2IH4A 4DQVA 3FDXA 3V8VA 4BP8A 3KETA 1JIQA 4XR9A 3CLRC 1HLDA 4NOLA 3VV3A 5K3BA 1W48A 4CL3A 2JANA 1NIJA 1P4SA 1ZH2A 3LDGA 1DBQA 4P5PA 5T64A 1A4IA 2UVPA 5FLXA 1RPTA 4HDAA 1TF7A 2NW6A 5K0GA 4JYZA 1GARA 5EMLA 3RYCA 1B26A 4PR3A 4YJ2B 1E3IA 4BZPA 1SZCA 2QTAA 2X2EA 1UFQA 4OL9A 1RC1A 4OV6B 3VOSA 3WLPA 3KWJA 5HKKA 1ISIA 5GIPE 4J4TA 3G7NA 1PR1A 3TAXA 2XD4A 4XCQA 1NWHA 4BWYA 3AIIA 2LXNA 4IJ6A 4KMRA 1JIIA 2JI7A 3AUSA 1DKLA 4BO7A 3S1AB 4KIWA 1KAOA 5DTEA 4GR4A 1A9YA 1JBEA 1R9GA 2C1ZA 1ODCA 5TDHA 3ACCA 3FN4A 5REQA 3U3MA 1LTHR 3MGKA 3G2JA 5LP6F 3Q1KA 4FYVA 4B3RB 1BFKA 6GPBA 2ZR0A 3TECE 5CT6A 1UIMA 5E6SB 1WR8A 4YAUA 4XDGA 4F5WA 3QUAA 4RK6A 3ROXA 3PIIA 2E55A 1QVVA 4UUOA 4JB3A 4M6WB 1R15A 4G2TA 3BTSA 1Y8AA 2CB9A 5AK6A 3WOHA 1XU9A 1H5NA 3DE1X 1Y8QB 5E2BA 1H6CA 3KJEA 3FF4A 2AN3A 3PUKA 5D5PA 5K3FB 1IZ9A 4OX9B 5DCYA 5CYPA 4DCGA 4DRXB 3FFTA 1IG0A 4PPQA 5FX2A 5F9MA 3QA3E 3A6EA 4X54A 4HLQB 5DEOA 3IC5A 2D0DA 4C30A 4FBLA 2ID4A 1ORWA 4I99A 4U02A 3T5GA 1J2EA 3FSEA 4UVHA 3K05A 4BMZA 4MCHA 3EG9B 1SBHA 1FTYA 1PTJC 2VHEA 3EHEA 3N5CA 2E49A 3M4ZA 4KHPB 1ND5A 4ZVUA 1WDKA 3RRJA 4BVFA 4JJKA 2P35A 2P7HA 3H6GA 4G0OA 3QF7A 4W5QA 1ZICA 3EXEB 3KTOA 2UDPA 5JIBA 1HBJA 4JSRA 3VBEA 1JPVA 3VR3A 5AM4A 1U0LA 5AM1A 1QFXA 4P4SA 1DX4A 3A4NA 1SQGA 3LVRE 1RWNA 3ZE0B 5AHOA 4PQRA 5EZSA 1ADYA 2LBPA 3UH1A 5JU6A 1ZGJA 5LDHA 1Z68A 1W581 4DIEA 1EZZA 3NJ8A 4X94A 1KQGA 3NBZC 4LK3A 4I1PA 4DQUA 1E4EA 3CEAA 1E5VA 4NEHB 1NNSA 1HRKA 1JDBC 2F64A 3G7SA 2ISQA 5KOHB 1WV1A 1DBPA 2BOVA 1XIVA 4B4DA 7GPBA 5H9WA 1BXKA 4NBVA 1K2WA 2YWHA 3MT0A 4N8SA 4EBFA 3O1HB 3BGSA 2XITA 4UHEA 2F3PA 3QUSA 4MW0A 4AY2A 5ED4A 3EQ9A 1PR2A 5A5VA 1J2JA 1U3VA 1O95A 1PQWA 3HADA 3ROMA 2ZT6A 2P2CA 1FFCA 3BJZA 5JH7F 3CUVA 2HCBA 3ILSA 3OZCA 5FH9A 3EDYA 2C4VA 5ICEA 4CG0A 3NS7A 3N8GA 4JP8A 5IAKA 3SNKA 4QUBA 2F1HA 1J7JA 5F2NA 1FY2A 2GDZA 2AN4A 4G07A 3ETDA 3T9AA 1CWUA 5K2OA 2OMKA 4W5OA 3L3BA 1XALA 1V3QE 3ABZA 3CRW1 4DEVA 5CB0A 1RZVA 3KIPA 5HJEA 4W8GA 3RV4A 5DNCA 3TQOA 4BO6A 4OAOA 4QOGA 5L7WA 1JH9A 5C9ZA 2PA3A 1OD6A 1R66A 2WDZA 5BXYA 2NSJA 4XFDA 5IU6A 2CFIA 2R6R1 3L4BA 4MP8A 1UBOS 1IJKA 4GNRA 3SEFA 3PPIA 2JVKA 3VHRA 2BFOA 5CLIA 3VR6H 1MN6A 1MIHA 4KK3A 2EATA 2VS1A 2GHIA 1GRQA 2HSEA 1FK8A 1XZBA 1AKUA 1MB0A 1ZUIA 2JKYA 4KVFA 4C01A 3RSLA 4DUGD 3PRKE 3Q7PA 5I7OA 1K5GA 5BMOA 1HG0A 1QDLB 1ZKDA 4UAGA 3BK1A 2Y9MB 3OT1B 4LHZA 2V6JA 3CINA 5T4HA 4INJA 1K4YA 1TMOA 2JGDB 1XA4A 5KCMA 4LF7B 3QVXA 1IJEA 4PQGA 4XIFA 1Q7RA 1C81A 2GHTA 2M1ZA 4G5OA 2R62A 2AOUB 4V24A 2AJTA 3Q10A 3CLUD 4KSYA 1KOLA 1LNZA 1L5HB 2HF9A 1I13A 1T2CA 2C5HA 2PX6A 3I28A 4TT3A 4WLFA 1FU7A 5DNWA 3RGWS 3UF0A 4ER0A 4BAUA 3NC0C 4G24A 3F2IA 5ERYA 5EEGA 2X3YA 1G16A 1KYIA 4HDRA 4MYCA 3WICA 3SWWA 4B2PA 2XY4A 1BKDR 1E9EA 3WK6A 5BVGB 1V8OA 1P0FA 1RR6A 1KK2A 4MRNA 1IY9A 1QRDA 4JLNA 4WADA 2CNLA 5JZSA 1ZRMA 4ANFA 2FMIA 3O92A 4ZRDA 1FXUA 3PC2A 1PLJA 3NEAA 4MVJP 3CIFA 1IDOA 4H27A 1VC2A 1ZN2A 3U60B 5FUBA 4S0XA 4A2CA 3HB5X 4BNNA 3W7AA 3WLKX 4KPUA 5CB4B 1HR0B 1MD9A 1BHQ1 1N5RA 1WW2A 2ZJ4A 1PBNA 3QVLA 4TMYA 4BJ6A 2DF8A 1NY6A 1IBRA 3VC2A 2GZRA 2Z56A 4R40A 5ALNA 3WGKA 2A1TR 4LFCB 3ZWKA 2VA9A 3A4LA 2AD1A 3CONA 3KP1A 4XFKA 3NGLA 4J3FA 4FEGA 2FE4A 1ODTC 4JEIA 4IIGA 2Q99A 4P5EA 3ZCTA 1QJCA 2EFHB 5BVGA 3L0ZA 1N78A 2FI1A 3QPUA 4L51A 3X1WA 2OD7A 3ZH9B 2IYXA 4XOIA 4AMBA 5KX5F 1Z47A 4NBLA 1HQDA 2PGJA 4YWJA 3PEUA 4F3TA 2JJ2D 4CL0A 1JAHA 5G3ZA 3LU1A 4GLOA 1QF7A 2CVFA 2HU8A 5A3RA 2EX4A 3C87A 3IDSA 3SYTA 2ZIEA 3DP7A 3V9PA 3DE7X 1CDOA 3MYYA 3RIMA 3TPZA 5DM2A 4DZTA 2QZJA 4MA5A 1E1LA 4F4UA 4JJEA 2ZJ0A 5THXA 5DGIA 5JADA 4K28A 3FOAA 1L5NA 1B6SA 2EKBA 4A03A 3OIDA 1IWPB 1ADCA 1JEDA 1ZM9A 3BXOA 2AC7A 5GINE 2P7IA 2YXDA 4EQ6B 3KJZA 2R5FA 1SK9A 2PL1A 3TEMA 1XEAA 1HE4A 1O96A 3FDFA 2FJUA 2ONZA 4FMCB 5KPDA 1BCSB 3CX7A 3W1VA 4UHBA 2GVDC 1ZR2A 4O4JB 1NQUA 3IJEB 2WW8A 3TI9A 1MG0A 3ETGA 1XKQA 5AP9A 4OHPA 3LW7A 4NEQA 5IAEA 3TW4A 4QRHA 1SZJG 3DBVO 1A71A 1CY7A 3ABOB 4CM8A 2NSHA 3OZEA 4UBMA 2EEPA 1V45E 1XCOA 2VBCA 1TXGA 4G56A 4QTZA 1BFUA 4LN1A 3B6ZA 5FFNA 1ZHOA 1ISJA 1P1HA 2ZWMA 2BMEA 5EE3A 2A92A 2YWGA 1M2VA 4EY7A 4DYVA 3DZFA 4DF3A 3AQIA 4HFNA 5IJWA 2PLWA 4G09A 3WY9A 1XJCA 4V03A 1P2DA 5ITZB 4XDYA 2JJQA 3D4OA 3WGIA 1PT6A 3MTJA 3R40A 4QBKA 4B7AA 1SQSA 3MQ2A 5IF3A 4UVEA 4D97A 3A3PA 4DS3A 4JB2A 2BBSA 1Q1GA 4IFBA 1N57A 3ZCPA 4EGJA 2H1FA 1KDYA 4R3NA 2IYEA 5J47A 5AKLA 4OJKA 5LQKA 3AXSA 1M1YE 2V5VA 4LZZA 4E08A 3PTAA 3NT5A 3HUTA 4X3PA 3B9QA 3F47A 2C2WA 1UOOA 5JCJD 1K75A 1ISHA 2E4YA 3LCUA 1R8YA 3MBOA 1XVAA 3Q3VA 4HGZA 4KRGA 4OMDA 4TXNA 5AK5A 4A10A 4BE7B 2BM1A 3D7SA 4FR0A 2OAEA 5JZMA 1QP0A 4C43A 1DTWB 2DSNA 1LLDA 2FCAA 3G6WA 2G71A 4AMVA 3NTQA 4OI4A 4EHKA 4AJOA 2HRCA 1PTJA 3EVGA 4IKEA 3W5DA 4G5RA 3OM0A 1A04A 5JAZA 3B78A 1Y5LA 4MR7A 4KVAA 3O8QA 5IN4A 4UFOA 1LPOA 4IGFA 3HJGA 4BQNA 1ZLXA 3I45A 3IIIA 4E5VA 1DC8A 4L6IA 4X0EA 5FEMA 1BXRB 1XTJA 2PKQO 1R6DA 1FUUA 4LX8A 4R81A 1TO1E 4EEKA 1YVRA 1NQAO 3B38A 3IUEA 1MO3A 3M6FA 4ND7A 5TQ0A 2X8BA 4C0WA 1CF9A 2QV0A 1K8RA 2B82A 4L6CA 2KJQA 3NOXA 3Q0IA 2AFVA 2X0FA 3EQ2A 4YV1A 4P98A 4TL7A 1ZGGA 2O57A 3JYQA 4HEA6 5DLQC 4BO2A 5A0VA 4ZV7A 3INTA 3OICA 5A9TA 1QYVA 1XMOB 5EKUA 3GVIA 1EYZA 3AVXA 4RSHA 2XZDA 3GJQA 2EZUA 5JJBA 2FN4A 3ULKA 1AS0A 1H0HA 2R60A 3MXOA 1Q7TA 2PT5A 4URFA 5I45A 2CV2A 5DN6A 3MF4A 1S89A 3PDWA 3MOSA 3P9ZA 1AO0A 1NKTA 2ONYA 4IWYA 1FJXA 3GFTA 2IUTA 2XHZA 3KB1A 3X1DA 4HUTA 5BV2P 2ENUA 2WK1A 4KBYA 2WZDA 4DLKA 5DVZA 2QVLA 4BVLA 4HAIA 2C82A 4YJ2F 1BE0A 1YRHA 5EHNA 3PUJA 3ZWMA 4C5BA 1DO0A 1XLVA 4J4HA 4EJSC 4UFPA 1UOEA 1GL9B 5F9FA 1Z4NA 1JAZA 5F1PA 4ISCA 1CERA 1G5IA 4BFZA 2R97A 4WGFA 3ZI7A 3FDJA 3MS2A 3PRHA 4O4LB 2JGEA 3DL7A 1NVAA 2A9VA 2ZKIA 5THQA 1L5LA 4CL8A 1VBNA 4S12A 3FZNA 1WZCA 2AOXA 3D7NA 4O3FA 1OW3B 3F67A 4EENA 4B31A 2D1RA 1E58A 4X6YA 1FX1A 4JJ4A 1K7XB 1U0TA 2CHEA 3L8MA 2WSIA 5H0IA 3RC9A 4PC6A 3Q87B 3N8DA 3DDNA 2I9KA 2ASVA 2PBFA 2O8FB 3FCAA 4K7JA 2GEJA 2XNDD 3UWDA 2ZTVA 1V8FA 3RNOA 5DTJA 3H5NA 2XVYA 4R0MA 4GMKA 3W6OA 5EJ4A 4YMSA 3SZGA 2JJ1D 1K6EA 1V2HE 2B9VA 3FX2A 3WC4A 2AXPA 1V6CA 1QGUB 3ER9A 4IS2A 4MVJA 4HTAA 1D2NA 1NE7A 3A1DA 1L3CA 1L8XA 3TM5A 821PA 3U26A 3KJQA 4CNBA 1FRNA 3FKQA 1RTKA 3JW8A 3NHLA 4N54A 3GMIA 1P2VA 4WNCA 5FNZA 5FPYA 2V59A 4JGGA 2D2FA 2IV2X 4KR2A 1Z5VA 4IGKA 1IPFA 1BA2A 1R00A 4MRRA 5EE1A 1COZA 1Q3KA 1AU9A 4JKOA 3T4XA 3E1KA 2XNKA 1T3LA 3GA7A 3IOMA 4MRMB 4B3SB 5AI0A 4K0KB 2HM7A 4MV1A 2GEFA 3D59A 1T5TA 1Q1BA 4D44A 2ZWIA 4LXGA 4MJ7A 1TM3E 2D0OB 2WYWA 1MC1A 1RKVA 3P9PA 4LOIA 4BX3A 1URPA 1PGNA 3DKVA 1ZSYA 2EF1A 2EKDA 3O26A 2VIIA 1LPAB 1SPBS 2V9CA 4ED9A 1I51A 2P2YA 1ZAYA 1JF8A 5D1HA 2FR1A 4PZ0A 4DV4B 5CVDA 1I3NA 5BWOA 1PGOA 3I6BA 4IIJA 2A9QA 3LWZA 4U2KA 2YWRA 5IBPA 5CFPA 4TX1A 3SLKA 4D9HA 2GNAA 3PZBA 4LZWA 3S68A 2JFFA 4MQMA 4LAFA 3ZY6A 4GOXA 2DY1A 4KLRA 1ZQ1A 5TSDA 2RAUA 3I09A 3T1VA 2JCGA 3DNMA 1DOZA 1M76A 2ONCA 2OVBA 3C1AA 2OQVA 1Q0LA 1W0CA 5DX0A 2H65A 4FLMA 1A4UA 3MWEA 2B4YA 1UADA 3C3WA 5FWDA 5SV2A 3VTKA 5JI3E 1FJHA 1D6JA 3QEKA 3W5JA 3DJYA 1PBTA 5GZ1A 1SN7A 3HCCA 3KFVA 1DAHA 3DWFA 2CMKA 3O90A 4GLLA 4QXRA 3MPOA 3T3PB 3Q6MA 3BIOA 1M6NA 3CSSA 1E2JA 1FFSA 2GPNA 3FCYA 3HCDA 5KI6A 1R8QA 5BV1A 3ADBA 2W7TA 2XI4A 4BX0A 1TQDA 2JH9A 4Q1CA 5FUQA 2PUAA 4KXNA 5AI4A 1F4VA 3PITA 1WXDA 2QEQA 4RGBA 3WTBA 3OOWA 5JXIA 4XRRA 1U1CA 2FSUA 3B82A 4KPFC 1GP2A 4C0QC 4PN7A 3EXG2 4IM7A 1P6QA 3TOVA 1TIPA 4PCUA 4C2TA 2FPPB 3MOGA 5H68A 1RAHA 1A2BA 3A6GA 1SY7A 3F4LA 3LWDA 1H8HA 4GYWA 3EJWA 5DX8A 5KDLA 5E1BA 1RQGA 5E7IA 4LI0A 2H7YA 2NZUG 5TEVA 4RZ2A 2AUNA 1ZD8A 1Z6QA 3WE7A 3GVHA 3ZG6A 2EQAA 4DSAA 4WK0B 5IKPA 5TQVA 3OMLA 1TYCA 1VPVA 3ECSA 4LQCA 3VZBA 1QOQB 4FGSA 5F2OA 5HK8A 2BSQA 2J85A 2P3QA 4IOJA 4RF4A 3RRFA 2GCEA 1QK4A 4X1OA 2N1MA 5LDGA 1BH2A 4CLOB 3HCPA 3G9QA 4XLTA 3ZGXA 3A7EA 3ND6A 3O6VA 3VDXA 2JAUA 1XQXA 1JQJC 5FI3A 5JNSA 2OPBA 1A50B 4F4HA 2YOFA 1R5NA 3W1EA 3I9JA 4C7BA 1KQPA 1ZIOA 4NK5A 5H7XA 3VHXB 3N0TA 1YTLA 4AN1A 2ZATA 2JFQA 3UHPA 3G59A 3AR8A 1ZH0A 1G7RA 2DFKB 4CKEB 3T3OA 3OAAA 3BKWA 4J07A 5A4DA 1RQ2A 1NKSA 2NADA 3B5JA 3PYLA 5EIEA 4MDFA 3MNFA 2AFRA 3SQOA 1M34B 3WKBA 4DLVA 2H29A 3JARB 1M33A 1O97D 1SNYA 1JR3E 1QHXA 1VLHA 2V7EA 1Q11A 3H2IA 2J3IA 3IA7A 3G0OA 2UKDA 2NUPB 3OY2A 1YMUA 4XGKA 1KDRA 1H94A 1DC5A 4OI2A 3P20A 2YYYA 2TMYA 3ELYA 5FBZA 3HI6A 1V2GA 3I92A 1N92A 2ZULA 4MW2A 1HQKA 2QG9A 1DC7A 1U0HC 3H3XA 4HLUA 2DLCX 2CKDA 4FMPA 3C5CA 2Z8XA 3C6BA 3MWYW 1AGPA 2IU4A 2OTCA 2KBEA 2CJPA 1J1ZA 4RF5A 3TINA 4NOJA 3S2IA 4Z4CA 1EMDA 1GPAA 3DT8A 3AEQB 1L4YA 2H6EA 4HS9A 2V8OA 4RF3A 5HILA 1XELA 2BGNA 2ZAGA 1XG5A 3V4LA 3F73A 1CUXA 5CB8A 1WKCA 5L7YA 1X8XA 2A9PA 2G5PA 4JXZA 3WS7A 3QU9A 1ZJ4A 8LDHA 4DB4A 1SBQA 1EX7A 4ITVA 3M82A 4FCVA 1NBWB 1ENYA 1NRXA 5HOEA 5BRNA 2W0SA 2O8FA 4INOA 2VQSA 1OFGA 4ES6A 2I2XB 2WYUA 5B30A 3TIGA 3TVTA 3IJRA 4BJ5A 1U5BB 4B44A 3LT5A 1FNCA 5H81A 4A2PA 1SPXA 3G5TA 3MG9A 5GGXA 3EVCA 2J6CA 2XWJI 1Z26A 2MSEB 2P1DA 1X7XA 3FA2A 4NE9A 4UBNA 1S1MA 5BSFA 1LVUA 4K9RA 3GPLA 5CNIA 2RHGB 4HC4A 2DHCA 4M1QA 3UAWA 3MRVA 2FLKA 2JHPA 4KQJA 5ALIA 5JASA 5COAA 1WBDA 2GYVA 3U81A 1BVUA 3IDQA 3ZI0A 2GA9A 1YAHA 2HCRA 1FVOA 3KAPA 3QHQA 2IWHA 5K6AA 1QJ4A 1SHTX 2V96A 2GSWA 4BVGA 3WNDA 1YB1A 1SBZA 1L5HA 3RUCA 3I04M 5EXEA 1D04A 3STYA 3VGJA 1YCFA 3GRVA 3NT2A 4XR4A 5GJVC 1G5HA 2AXNA 1DQPA 1KTVA 1EP2B 2P5YA 3KXLA 4W7HA 4J0QA 1YRYE 4DMKA 2YQ4A 4CDNA 3U4DA 3BXPA 1XMPA 3FF1A 4G5GA 5C31A 1GSIA 1XPJA 3GWZA 3OJWA 4WZZA 2Y0PA 1TF5A 1E3LA 2R96A 2I2WA 5B6PA 1H2AS 1RRVA 1MPXA 1WHTA 4IHQA 4EHFA 4II2A 1QFZA 1GZ4A 2WA2A 7REQB 5JC8A 3R7DA 3BL8A 3UCEA 4US1R 2FFHA 1H4TA 3DMNA 1P2FA 4XM0A 1CB7A 3BFVA 3EFEA 1Y6GA 2WR8A 1UWKA 2H4HA 3THSA 3OZWA 1OYWA 4TXHA 3R7WB 1KEEB 1Y9ZA 4UM5A 2OHVA 3E18A 1QHYA 2C2MA 4D41A 2FG7C 1T4GA 3D5EA 1PS0A 2Z2XA 4CKCB 1U1EA 2Y4NA 4EMUA 4NICA 3LHKA 2YV4A 3IIJA 1CE8B 4LSZA 2HV9A 3KYCA 1N0VC 1OAOA 3OLVA 5EJ6A 2HAEA 2EHJA 2FMXA 2ZSBA 1N36B 1C80A 1U2SA 1CIPA 1WSAA 4JC4A 2JASA 4DIFA 1PR5A 5JQGF 5CCXA 3MMPA 1NHWA 4G6ZA 1UP6A 1UP4A 1RXCA 2PJDA 1Z0DA 3BH7A 2IU6A 5M2QA 3S7TA 2WJ3A 3T7DA 4BV9A 1C3OB 2WHPA 4LXHA 1QG4A 2B92A 2FHPA 3S5UA 4B80A 4BNUA 4MS4B 2EC5A 3IIKA 3NYWA 5HG0A 1NTOA 4UUPA 1F20A 1X9IA 4FB5A 4Z1MD 1PFVA 2C2HA 2GJ4A 3PUHA 3BSWA 2GGSA 3AM3A 4ISBA 1QDUA 2IHTA 4MIEA 4XYMA 4X44A 1GKKA 1V9CA 3DDSA 3AVWA 1E2KA 3REOA 3T3NA 1W6UA 5EIBD 5AMXA 2CFTA 1HDRA 3ZI4A 4LFBB 2GKOA 3RJTA 5CA0F 2PT9A 1DU4A 4XDZA 1C1XA 5FUVA 2VTEA 2FW0A 3GLGE 4Q01A 1FTQA 2GYUA 2Q41A 3L1UA 2Q50A 2XXAA 1E1YA 1ZIXA 3BBLA 4R05A 1T2UA 1ISMA 3S1SA 4WVLA 1MW9X 3NVDA 2E6KA 4L3VA 1N2CB 2JATA 1T10A 1Z7GA 1N2IA 2PBRA 2XWSA 4OMCA 5CIWA 1BOFA 4PU0A 5F5NA 2LCQA 3VV2A 1IPHA 1QH8A 4KYTA 2XWBF 1GQ2A 4QYWA 3A9UA 4UMDA 3FMVA 2XCUA 2B36A 2D06A 3OCZA 2CLEB 1MQ8B 1U28A 1NMXA 3PNQA 4WASA 1FEZA 4OJMX 3LPCA 4XM2A 2AFIA 4CLHA 2IQIA 5TC4A 4D2IA 4PZUA 4CBVA 1XI2A 2HEIA 4GR5A 1Q95A 1UXKA 4O5AA 1G3IA 2HIHA 3GLFE 2QE7A 4ITUA 2ODBA 3VU8A 3CEPB 1J0BA 1Q14A 2OXIA 2F1RA 2HSGA 3SZ3A 4Z2AA 4AXXA 4AF7A 3BSSA 3DE3X 2W6ID 3ITDA 3AHCA 3GLFA 1GTRA 1A8PA 2H11A 1QHIA 3QI2A 2FEAA 2WUFA 3BMXA 2QTNA 1L1QA 2BGTA 1L4HA 3H04A 3HG7A 3MQFA 2NT4A 2XLBA 4X9XA 4PGFA 1JVNA 2DUMA 1W52X 1GLNA 3HGMA 5AJXA 2DETA 3PUWA 3H1TA 1FCJA 4GKVA 4Z53A 2YX1A 1N3IA 3JQ7A 3CH5A 4PLYA 5AI9A 3SMVA 3WNQA 4LC1A 2PVCA 2DQYA 4F9TA 3OEHA 3F6BX 4Q1EA 1HL7A 2PVSA 2GXUA 3BILA 4ARZB 4L5JA 2ZM6B 4L1KA 4RNDB 3VSBA 3F4BA 4Q7LA 5CX4A 1RQNA 3CZ4A 4L9SA 2YYAA 3UK7A 1OI2A 4G9GA 3RYFA 4FWTA 1N9GB 2ES4A 2RGCA 4XFJA 3GH3A 2W6QA 3CCBA 3F7TA 5E9AA 5IC5A 1P7ZA 3GLFB 3O9VA 4FQ7A 4P54A 2F00A 4D3XA 1BVYF 2RK6A 5CA0A 4EABA 4ARCA 3KRTA 2VDRB 3B5IA 1FXWF 1Z6AA 3W4KA 2JIRA 3MUOA 3F74A 3UTCA 1XL0A 2C03A 1XWFA 1K7SN 3PGKA 1JZSA 3ZQUA 3LOPA 4D92A 3DG9A 3MELA 2RC5A 2PK3A 1EFRD 1JEQA 2PN1A 3D6FA 4GRAA 4PGGA 1YASA 2XOKD 1G8HA 1X80A 2QN8A 3X1MA 2DWPA 3CNEA 3N6RA 3R3YA 3QOWA 1V5GA