5G4LA

Phloroglucinol reductase from clostridium sp. with bound nadph
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
265
structure length
265
Chain Sequence
HMVNVKKEFVDNMFSVKGKVALVTGATGALGCVLSKAYGYAGAKVFMTGRNEKKLQALEAEFKAEGIDCAYGVADPADEAQVDAMITACVAQYGEVNILAVTHGFNKPQNILEQSVADWQYIMDADCKSVYVVCKYVAQQMVDQGKGGKIVVVTSQRSKRGMAGYTGYCTSKGGADLMVSSMACDLSAKYGINVNSICPTVFRSDLTEWMFDPESAVYQNFLKREPIGRLAEPEDFVGYALFLSSDASNYITGANCDCSGGYLTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OXIDOREDUCTASE, SHORT CHAIN DEHYDROGENASE/REDUCTASE FAMILY P
publication title Biocatalytic Properties and Structural Analysis of Phloroglucinol Reductases.
pubmed doi rcsb
source organism Clostridium sp.
molecule tags Oxidoreductase
total genus 113
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5g4lA00
4G65A 5HWSA 1XG5A 2TMGA 4CM6A 1Y5MA 3BHJA 4E32A 4JCOA 3RU7A 3VPFA 4D41A 4GAEA 2G76A 2NUAA 3VVCA 3ZWYA 4D3SA 4S3MA 4IJUA 3ZV6A 4JJIA 4G2NA 4J3FA 4XZ3A 3H9GA 2AEJA 3KOUA 3UICA 2FHSA 4IMPA 1E7RA 4RF2A 5GZ3A 4AVYA 1NVGA 2EHDA 2JCVA 3AFNA 4XRRA 3AUTA 3H5RA 1C0LA 3KBOA 3VPXA 1MA0A 5EPOA 2J3HA 3GZNA 4RVDA 3CMCO 2GLXA 3KM0A 4YT8A 4HADA 1Z7EA 3K30A 4IIUA 3TL2A 2DTXA 3PLRA 1GCOA 5KVCA 3H9UA 3FPLA 3S2GA 3JD2A 1KERA 2ZB4A 3EZLA 3RC2A 1BDMA 1N1EA 1Y8RB 3HB5X 1IL0A 4YQYA 1NWHA 1BRMA 5ICMA 2C82A 1MP0A 4NQZA 1C14A 1DSSG 2B4RO 1X7DA 3PI7A 4J4TA 4WLOA 2C07A 1HDXA 4BUCA 4BL5A 5GZ1A 1LX6A 4WCFA 3E18A 2PH3A 3BYZA 2V65A 2DQ4A 2NVUA 3PYLA 1DLJA 1I0ZA 4BNJA 3UH1A 1VJ0A 5I7SA 1UDBA 3E5MA 5AQ1A 4LMRA 1ZMOA 3GY0A 3NYWA 2NNLD 3G17A 3ZWVA 5FYDA 1N7HA 3DBRB 3QV1A 3V5NA 1SB9A 1XLTA 3DBHA 4UVHA 4AJ2A 1LXCA 4KUGA 4DIBA 3EHEA 3G3EA 3H7AA 4MINA 1UDAA 1AHHA 3DZGA 3DONA 2VHZA 1HXHA 5I7EA 1P0CA 1PWXA 1B3RA 4CMKA 4XYMA 4KTVE 4CJXA 2P9CA 4WLNA 4FFLA 3WGZA 3ZU2A 3H9JA 2HJSA 4CM4B 1CDOA 1UXKA 2X23A 3GK3A 3VZRA 2PGJA 1S6YA 3RUFA 3WGHA 4TWRA 4R1SA 4J1TA 1PR9A 1ZEJA 5IF3A 4WLFA 3NDIA 4NMHA 3UCFA 1U3WA 4XR4A 4YAEA 1EZ4A 1NAHA 3LK7A 2XAAA 4YAKA 4DLBA 1EE9A 2OBYA 1RWBA 3HDYA 3ONFA 2O7SA 4D42A 2LDBA 1ARZA 3QIVA 3D5QA 1K5HA 4UUMA 2XF8A 4KQXA 1M6WA 4IMRA 1ISJA 3KSZO 4DIOA 1GPDG 1QV7A 1A7AA 1IZ9A 2JCXA 3RBZA 1DHTA 1TT5B 3DL2A 2W2KA 4OQZA 2Y0CA 5JE8A 4BNYA 2AG5A 4AG3A 4OOEA 1U28A 1X7GA 4P8RA 2D3TA 5C3MA 3E5RA 3B1JA 1K6JA 3IP3A 5FFFA 5KOIA 2X4GA 1BXKA 1ISHA 4ND2A 3O26A 3LDHA 2JD2A 3VHRA 3OJOA 3RUAA 1GFSA 4Z0PA 4L74A 4BO2A 3PLNA 4P4LA 4BO7A 3MWDB 4ROSA 5G4KA 2AEFA 2I9PA 2PZJA 3D3WB 2V7PA 4WNIA 4Q3NA 2A4KA 2OGUA 4OAQA 2ET6A 1S7CA 3F46A 2NM0A 5KJCA 4FJ0A 1TLTA 3TZCA 1ADGA 1GDHA 2W4QA 3G49A 2A94A 1SB8A 4NU5A 1GV1A 2X9NA 2ZJ0A 4JQCA 4FR5A 3M1LA 3H4VA 5T8KA 3K96A 1LDEA 3WOHA 3AUUA 4WJZA 5BT9A 2DVMA 2ZTVA 1W4ZA 3TSCA 5LC1A 1YBVA 2Q4BA 4OHUA 2YZ7A 1LRJA 4U0JA 2WD8A 3WGYA 4TSKA 4R4JA 4BO5A 1E6WA 1H2BA 4CM5A 2B36A 2FR0A 4QEDA 5G4LA 2DAPA 3GMDA 3L77A 1P1FA 3ETGA 4FC6A 1WZEA 2Y1GA 1PZGA 3QP9A 3ULKA 3MEQA 1LEHA 1ISGA 3LT2A 4F45A 3AU8A 4YJGA 4EYEA 3BMNA 3JSAA 4AJPA 4QFCA 4JNKA 2GNAA 5CEEA 3ZU3A 1U1IA 1XDWA 3KEOA 2VTEA 1E1NA 1HDGO 2Q1WA 4KP7A 4Z9YA 1MX3A 4E5KA 3PFWO 2C2YA 1R0SA 2ZTMA 1P74A 1HZZA 4CMIB 2VWGA 4FW8A 3KZVA 4UEJA 2GR9A 4CUKA 3ZWWA 3TFQA 3CZMA 2PKRA 4E31A 3M2PA 4BNZA 2ZYAA 2GN9A 5JYEA 4GL4A 4YJHA 4YACA 2B0JA 3ZH2A 2O3JA 4PZEA 4PZDA 1RYEA 3CH6A 1LLDA 5A9SA 2D8AA 4FFRA 1RYDA 3AK4A 1XQ1A 5BSHA 2DBQA 2X9VA 2HU2A 2CF6A 2VT2A 4IDCA 4YRDA 3GG2A 2Z1NA 4NFHA 1DO8A 2GZ3A 4P22A 4YWJA 5JAIA 4MPDA 1R4MA 3RFXA 2VRBA 5IJZA 1ENZA 2JD0A 2BD0A 4HBGA 3CTMA 4CLDA 1GYRA 2W2LD 1DPGA 3HADA 1EUZA 5L7WA 3O38A 2X0JA 3GGPA 5JO0A 2G17A 3EYWA 1HLPA 3OETA 1B3BA 5C7OO 4IPTA 3MCVA 3NTOA 1PQUA 2VWHA 1P3DA 3JD1A 3FNHA 3LC2O 1SO8A 2P5UA 5EN4A 4A27A 4CM8B 2EP7A 4ND1A 2D5CA 1DC4A 1NASA 1O89A 3SJUA 1I30A 1QSGA 1NR7A 2IXAA 4MVJE 3QLJA 4XWYA 4Z3DA 3U62A 2YW9A 4A73A 3VH4A 4FS3A 1H0KA 2VUUA 4YBZA 3JQ9C 3HQ4O 2GRAA 2OZPA 4B3IA 3NGXA 2CVOA 3LZ6A 3Q11A 2HMWA 3AY3A 2IEBA 1WMBA 3B20A 1HSZA 5JMPA 1I2CA 3V1UA 3RJ9A 3QW2A 3D1LA 4BMNA 3ZGYA 2GSDA 4IS3A 2Q49A 7MDHA 3KXDA 3FWZA 3QQPA 4Z9XA 3CEAA 1NXQA 2RHCA 3U9LA 2XOXA 2PTGA 1X14A 4QO7A 5T5QA 4EBFA 5JFOA 3LT0A 2DBVO 2Y68A 3B6ZA 5U1PA 2H9IA 5JBIA 2XXBA 1P1HA 1UP6A 4R54A 4RPKA 4DBZA 3L9WA 2ZATA 3MJEA 2P4HX 1U3TA 4OXKA 5JC1A 4EDFA 2P68A 3AOEA 3QA9A 1NVMB 5TLSA 3AWDA 4HFRA 4RLHA 1WDLA 3W6UA 3WLFA 4E21A 3CUKA 4WKGA 2F1KA 4B3HA 2GN6A 1GZ3A 3QVSA 4IY1A 5KKCA 3IUPA 1HF3A 1YQXA 5G0VA 4D0RA 1CRWG 4NHEA 4QO8A 2ZQYA 4EUHA 2NU7A 3UGKA 1R66A 1R37A 4PLFA 2O48X 1JQBA 4BO6A 4IGEA 1DEHA 4AJ1A 3DQPA 1DIRA 2CD9A 4DPMA 5JS6A 4XJSA 4YB8A 1E77A 1V6AA 4FJ1A 3BAZA 4J49A 4XIYA 3QSGA 3U4CA 2PNFA 4N7RA 4Y6SA 5MGBA 5KJ6A 3WGTA 1YB5A 3UHAA 1VL0A 3HE3A 2EKPA 3LLVA 5CDTA 5J23A 1IPEA 1B8PA 4BNMA 1Q0LA 3SJ7A 3TDKA 4E2XA 2BMAA 5AVOA 4BMVA 1Y81A 1PJBA 1SNYA 4CM1A 1I33A 1PQPA 3L0DA 1B8UA 2HK8A 3GT0A 4GVLA 1UZMA 3OM9A 3FR8A 4O63O 4B4OA 1ADCA 1PJ4A 4GLOA 5KJEA 2I3AA 4A5OA 1XQ6A 3NJ4A 4AJKA 1HEUA 1YQGA 4EUEA 1A7KA 1DHRA 5AXCA 1ONNA 4CMJA 3JD0A 2OFPA 2SCUA 4MJLA 1N92A 4RPGA 5AXAA 4KWIA 2CVZA 4YT4A 3RUIA 1UR5A 3C7AA 2OL4A 3ZU5A 4RGBA 1U9JA 3R6DA 4R3NA 1ZSNA 1LDYA 3CZRA 2JFFA 1UZNA 2BFOA 5TJHA 1NYTA 4XR9A 4NBUA 1YQDA 4TKLA 2DBRA 3VH1A 3TF5A 4B7XA 1N2SA 1WMAA 1UUFA 2C7VA 3ICCA 2O3TA 4Q3AA 3DAGA 4PLZA 2VTDA 5A03A 5A04A 2RH4A 3PQDA 1ADFA 4GKBA 4Z3KA 3W4JA 4D79A 4Z6KA 1ZMTA 1NQAO 4BO8A 2PD3A 2CMDA 2VYVA 3QWBA 3PP8A 1V3VA 1BW9B 1C1DB 1QXSA 4LGVA 4MVJP 5L40A 4OSOA 3ZU4A 3H9QA 4CMBA 3LVFO 4BKUA 5HS4A 5IDXA 3GVHA 3JQGA 5IN4A 1EVZA 1PU2A 4JIGA 4BKOA 1OFGA 2X0NA 1HT0A 1OAAA 4J1NA 2UVDA 3OA2A 5U9CA 1OMOA 2X7HA 4O5OA 3LSYA 4LCJA 4CMCA 3WJAA 2Z1MA 4EEZA 1JA9A 2BLLA 1ZFNA 3PYMA 4J2HA 4TMFA 3PXXA 1IPFA 3Q6IA 4RO0A 3JQBC 1Z6ZA 1YOVA 2PKQP 3RC1A 1GQ2A 1EK5A 3K6JA 2WDZA 3W1VA 3QRWA 4BB5A 1TVEA 1BXGB 4YJFB 3TOZA 4BIIA 4ZGWA 1NFQA 4DPKA 2J8ZA 3U0BA 2ZYDA 3I9LA 3PDJA 5L95A 3OICA 4LW8A 4GMFA 1K6XA 2EP5A 2HMUA 3GVIA 1ZCJA 2UDPA 3K2BA 4K1LA 3VVBA 4BNXA 5JSFA 5JYDA 3B1FA 3KETA 3D7LA 1QP8A 5JO9A 5DT9A 1X7HA 2C7GA 4XQ9A 3ZWOA 1P9LA 4EJ6A 4EI2A 3HFSA 4L76A 4AJEA 2W2LA 1PJTA 1O94A 4FPXA 3GN2A 5A3JA 1RM0A 1D7OA 3E6AA 4II3A 1EDOA 4GPD1 1HKUA 3JQAD 1PS9A 2WTBA 3X2EA 1IYZA 1Q0QA 1ZO8A 2PGDA 3PRJA 3IKTA 3ST7A 1D1TA 1F12A 3OECA 4XYLA 4NJOA 1N9GB 1P45A 1QYWA 1YO6A 3DFZA 2ILTA 2JAPA 2GPTA 4PRLA 3WXBA 4D0SA 1P33A 4EGFA 1ZK4A 3PVZA 2QHXA 2PY6A 1NNUA 3L6EA 2FY8A 5AOVA 5TS3A 3VZQA 4BNNA 8LDHA 1DRVA 4FB5A 1R6DA 1P1JA 1U8FO 2C20A 1E3LA 4BGIA 4MVJM 1R15A 5JY1A 2VCYA 2CDAA 1IUKA 3VKUA 2V6MA 4I1IA 4B4UA 2DUWA 4R01A 1XYGA 1QORA 2HMSA 5ER6A 2P9GA 2WD7A 4CMGA 3INGA 2NU6A 3DAPA 3OBBA 4J7XA 2X86A 4YRBA 5L51A 1V8BA 4DWVA 1ONOA 3S2FA 4DYDA 1PJ3A 3W8DA 4FDAA 2GCGA 4JBHA 4XGIA 3LC7O 1DC5A 4U6QA 1K6IA 1M6HA 2VWPA 3H6KA 4CV1A 3IP1A 4GX0A 3GZ4A 4NU6A 4E5MA 5DCYA 4CV3A 4I5DA 1AUPA 1YJ8A 5A9TA 1F8GA 4F6CA 5A5EA 1UXHA 3JQ8A 4MVJG 4CR6A 1WWKA 2FZEA 3QY9A 5MDHA 2Q2VA 3T7CA 2Z95A 4DVJA 3AOGA 3C1OA 5K6AC 4L4SA 1GZ6A 2DU8A 3Q9NA 3ANLA 4PG5A 4JJGA 4IQ8A 4XD2A 4NBTA 1H6DA 2AE2A 2Q1TA 3DZKA 3HDQA 3EGOA 1LA2A 4XB2A 2AQKA 2Y0EA 3P2OA 1P1KA 2A92A 3NTRA 3FF4A 1QYXA 2GUGA 1E1LA 3PHGA 2EGGA 4DQUA 3K31A 3L6OO 1SZJG 1RM5A 3GMSA 4J91A 1SOVA 3MJCA 3GEMA 3NT2A 1HDYA 3GZNB 3BHIA 4MVJA 3K9QO 1LDGA 3VDQA 2Q46A 4XCVA 3W6ZA 4RZHA 1SEPA 1HLDA 1UXJA 3EY4A 1W8DA 4UEOA 1ZH8A 4L75A 2GN8A 4OO3A 4D7AA 1DC6A 2VRCA 3UUWA 2NQTA 4BHTA 4RV9A 2NVBA 4IZIA 2YHIA 3KSUA 2QX7A 4JXKA 1NQOA 3LLSA 4ID9A 1Y9AA 2V6FA 1MGOA 2IEDA 3C1TA 4MVJH 4UEKA 2EKLA 4HWKA 4YXFA 4NJMA 1EVIA 4J1SA 2HRBA 4ONEA 3WBBA 3FWNA 4WCFB 1HTBA 4PG7A 1LI4A 4CUZA 4I08A 3KB6A 2UV8A 1JVSA 2CDCA 4FD3A 4C4OA 2QYTA 1W73A 1XSEA 3DBHB 3OJFA 1K89A 1JWBB 2CUKA 1NR1A 5G0WA 1VRWA 4IQ0A 3FRJA 2QRJA 1B2LA 2O3RA 3EUWA 3FTPA 3A14A 4YAJA 5I9MA 3RBVA 1B7GO 1SOWA 4MDHA 2ZB8A 1XIVA 1ZK0A 1ORRA 3FI9A 5ADHA 1ID1A 3QWFA 5EINA 2DTDA 3LYLA 5JMWA 1H2HA 2J5QA 3KHUA 3TZHA 3ZV5A 5ILOA 3Q2KA 4K9DA 4HP8A 1YE3A 2I99A 4EUFA 4DQVA 1QLHA 2DTEA 4EITA 1V9LA 2NQ8A 3HN2A 4YRAA 4O1MA 5F1OA 2PR2A 4CR8A 2X58A 3DEYX 4W9NC 2I65A 4ZHSA 3I1JA 4YR9A 3AU9A 4W4TA 4BNHA 5JDIC 3JD4A 2J3KA 4JJFA 1PSDA 4TZKA 1LDNA 3TL3A 1YH3A 3O4RA 4WOKA 1X13A 3F4BA 4EZBA 3WFJA 3HJAA 4R16A 2W2KB 1U3VA 2GYYA 3CXRA 1VKNA 4R1NA 1UP4A 3D64A 3FR7A 4UULA 5GMOA 2P4QA 1G0NA 1VKOA 2PFGA 4L4XA 2NSDA 2OHXA 5IAAA 4NZ9A 3FHLA 3EMKA 3I3OA 4OM8A 3RI3A 1YVEI 3ZN2A 3PJFA 4GX2A 1PZFA 1Y7TA 3UF0A 3HB4X 4WOJA 1EVYA 1GV0A 3D3EA 1LSJA 3U3XA 3O8QA 4BVAA 1CQIA 4NR0A 3GRPA 5G4KB 5CDUA 3X2FA 1Q1NA 1MUUA 2R00C 1ZKMA 2JFHA 4PG4A 1IE3A 1ZZEA 1MC5A 1N8KA 1OI7A 5BNTA 1Z82A 2O7QA 4WCDA 1ZUD1 1YDEA 3WYCA 1DRWA 3K8ZA 3WQQA 5TX7A 1E7WA 5IXYA 3DZHA 1CYDA 5JY6A 1J4AA 5JXWA 4R1UA 3PQEA 4I8XA 3Q3CA 2Y05A 2PH5A 1O8CA 5IZCC 5JNLA 2J5KA 4A03A 4RF5A 1A9ZA 2IYPA 3DFUA 4F46A 1ZK2A 2VZ9A 5DCWA 4O0LA 4QUKA 1LDMA 4CODB 2YQ5A 1WZIA 1H6CA 3A1NA 4P4NA 4YYZA 3H3FA 2ZCUA 1MG5A 1RM4A 4HV4A 2EEZA 3BTUA 3JQAA 2X0IA 2ZJ1A 1JN0A 3STHA 5TF4A 3AM5A 3UCEA 4BS9A 4YJGB 4AICA 4IS2A 3BMNB 3VDRA 3IIEA 1J49A 4RVHA 4R41A 4F6LA 4DC1A 5I7FA 3OJ0A 2ZB7A 3IL2A 1BMDA 1GQQA 3L4BC 2X0RA 1NAIA 4KMSA 1A4IA 4MKZA 3E9MA 2W8ZA 4OKNA 2ZKLA 2X5OA 3BZUA 5EQDA 4XB1A 3JTMA 2GZ2A 4IBOA 5BNFA 1DJNA 3SLKA 1Q2XA 4RQTA 1EQUA 3JQ7A 3IDSA 3WGGA 1E0DA 1FDSA 1M66A 2YV1A 2D0IA 4KDFA 2OOSA 1U5CA 4PIVA 4MVJI 1E3EA 3GRKA 4ND4A 4UREA 1F17A 1HE2A 3C24A 3JQFA 5DBGA 2NACA 2NTJA 3PZBA 1ZJZA 3PJEA 4CMAA 1BHSA 4YJHB 4WLEA 4XQGA 3DWFA 4AJJA 3H2SA 5A9SB 5JDCC 2OBNA 3DMTA 1L7DA 4BGEA 4M86A 5A4DA 5CFZA 3ZHYA 3GLQA 2FSSA 1KOLA 2VQ3A 3ANMA 4PLYA 1LLCA 1R4MB 3NRCA 3RBXA 3TZKA 2OMEA 3BMQA 3WGOA 4A2CA 2QRLA 4IDFA 1NPYA 2PZKA 1ZJYA 1LNQA 2UYYA 4JK3A 5JLAA 4BV8A 1KC3A 5KIAA 1JTVA 2Q4EA 1C3VA 4MVJF 5JCJD 5JAMA 4RORA 4YQZA 1PGJA 1IHXA 3AY7A 2JJYA 3C3XA 4ZQEA 3DZIA 2R6JA 2W90A 1HE5A 1T1RA 3QVXA 4R69A 2X5JO 1QLJA 1V3UA 2VZ0A 1AGNA 2JAHA 1G0OA 3OA0A 1OOEA 4FFNA 4B4WA 3ZHBA 1B26A 1E5QA 2J3IA 5KJ1A 3DOCA 3WWZA 1ZSYA 4WK6A 4BMSA 3G0OA 4ILKA 5COQA 3R0IA 1E5LA 4RLSA 2HMVA 4Q3CA 4XYEA 4BO4A 5CP8A 2EIHA 3GFBA 4BO3A 3WYEA 3T4EA 2EXXA 2BGMA 3EAGA 1TB4A 2YDYA 3DC2A 3IQDB 3V2HA 4E3ZA 1QYVA 2OP1A 2JCYA 2WSBA 3GAZA 2A35A 4OQYA 4OSPA 4W7HA 1I01A 3VC7A 4FFOA 4NNJA 3WS7A 2W98A 1BVUA 5K0ZA 1CQJA 2EWMA 1ULUA 3I9NA 4AJHA 1I2BA 2FMUA 1SC6A 4M54A 5TSDA 1DDOA 3SBOA 4UUPA 4AJIA 7ADHA 4LSWA 2Q2WA 1QRRA 3Q2IA 4M89A 1L7EA 1U7HA 1GD1O 3RC7A 3GPIA 2I67A 4D44A 1C0PA 5H82A 4CV2A 1VM6A 3A28A 3Q9UA 3N58A 1UP7A 4R9RA 4XDYA 1FK8A 3OQ6A 4NIMA 2IRWA 3LT1A 1SCUA 2GZ1A 5CEFA 2IE0A 1BVRA 4GLLA 4CM9D 2Q50A 4QTZA 3ZCXA 2E4AA 2WE7A 4NI5A 3KLMX 4G5HA 1ENOA 2EJWA 4NBVA 5EL0A 1KY4A 5KCZA 4J7CA 3U4IA 4MOWA 3PWSA 2AMFA 1KEWA 3PIDA 3RFTA 3KUXA 4QX6A 4ALNA 1H6AA 4CLOA 1QR6A 3U5TA 1MFPA 4IDDA 4LMPA 3FBGA 3RFVA 2C59A 3E1KA 4U8GA 5HRUA 1LTHR 1NPTO 1E3IA 3NKLA 1B16A 4E0BA 4QECA 1C1XB 3OMLA 4Y6RA 3E9NA 2VNAA 3WNQA 4CQMD 1GZ4A 4DUPA 1NP3A 1YJQA 1GQYA 3PZRA 3MJTA 4TQGA 2DPHA 3LF1A 4AL4A 4ZICA 5CDGA 4O6VA 1H9BA 1GUZA 2AHRA 4FOSA 3BMCA 1U7TA 2E37A 3IKVA 4NH4A 3SC6A 1PS8A 3ZWMA 1J0XO 4TVOA 4UVGA 2PZMA 4RDHA 3S2IA 1EBUA 3IJPA 4JN6B 1B15A 2EW8A 4J16A 2HUNA 3WQSB 1JAYA 2GGSA 3HWRA 3MOIA 3TRIA 3ZI0A 1T2DA 5C37A 1E1KA 1LC3A 1DFHA 3I4CA 3I4FA 1OZAA 4GX1A 4HFNA 2ZYGA 3EVNA 2B83A 4BNIA 1WPQA 5HBRA 3DTTA 1I3KA 4W7IA 2WWRA 3RCBA 2V6GA 4I9NA 1Z7BA 5IZ4A 1ML3A 3CMMA 4II2A 2NLOA 4TKMA 5H81A 3ZNPA 4E5YA 2Y66A 3EK2A 3QVOA 4NPCA 5A1TA 4YJDA 4K26A 3OP4A 2JL1A 2Y93A 3QHAA 1PX0A 2BGLA 2BGKA 3SLGA 2H6EA 5A5FA 4R1TA 2OUIA 2FP4A 3OJLA 1DIAA 1GY8A 1Y8QA 3HFGA 5KVQA 1E7SA 3V1YA 2O23A 4CLXA 1D3AA 4IJWA 4INAA 3H3JA 3DDNA 2WYUA 3TNLA 3VPHA 1SAYA 3GVCA 3WDSA 3PEFA 3S8MA 3UN1A 1O6ZA 1LLUA 2J5RA 3JQGB 1P31A 4ZJUA 2C29D 3E03A 1C1XA 3NDJA 1JWAB 4GQAA 3PJGA 4J90A 4R5HA 3ROPA 4JLWA 3WJ7A 2CF5A 1H94A 3F1LA 4BO0A 4WECA 4J6FA 4FN4A 4IXTA 5JC8A 5F1PA 3UW3A 1VE9A 4U6SA 5A9RA 2O4UX 4BNLA 4CMHA 2PD6A 1MXFA 3KO8A 1PQWA 1GCUA 2C2XA 1NQTA 2H1SA 4FGSA 4NK4A 4FC7A 3KVOA 1BDBA 1FDWA 1XA0A 1T4BA 1FF9A 3TQHA 4E6PA 1LSUA 1YOVB 1MLDA 1T1SA 2BI8A 2DUUA 2QG4A 3RUEA 1AXGA 1PZHA 1EMDA 3GUCA 1BGVA 5KNLA 3HZZA 4DA9A 2QQ5A 3A4VA 3ADOA 2E82A 1JKJA 4ALLA 2YY7A 3FPCA 1X0XA 2VT3A 2O2SA 3GGOA 2YFQA 3MJ4A 3AI3A 2PWZA 3PWKA 4LRTB 3NX4A 4OGWA 1LSOA 1PL6A 1GUFA 3AUSA 2VYND 3M6IA 3CINA 1GYQA 1GTMA 5G2OA 4B8ZA 4RVSA 4IJVA 4WUVA 3JQCA 1U4OA 3RAJA 1X15A 2WYWA 3D4PA 1QYCA 4UUNA 1R0KA 4NK5A 1GU7A 1HWYA 5B4VA 2DC1A 1G1AA 5BNIA 1IB6A 2GO1A 3C1AA 2D2IA 2YHUA 5TNXA 2VN8A 2FOIA 1WDKA 4HNGA 2EG9A 3W4KA 5FEUA 5C7IO 3LT4A 5A3VA 4DRYA 1PL8A 8ADHA 3ORFA 4TRMA 1YBMA 2Y1DA 1LC0A 3U4DA 1FDTA 5COAA 3JQ9A 3GHHA 5TIIA 5B37A 3KYDB 3R3JA 3WMXA 4KUHA 4NG5A 2P5YA 2GDZA 2NADA 1A72A 4AJNA 1E3JA 2DLDA 3IOYA 4KWHA 3D0OA 4WEQA 1Q0HA 1T26A 3KYCA 2WD7B 1Z45A 4DIFA 1YB1A 1E6EA 1SMKA 1Y1PA 1RKXA 5G0TA 5B4TA 3FNFA 1DOHA 1NTOA 4CMEC 1P77A 5KVVA 4PZCA 4ND5A 1YDWA 4A0SA 2Q3EA 4XGNA 4EJ0A 2ZB3A 1HRDA 4GSKA 1U2DA 1A9YA 1EQ2A 3DBLB 4YT2A 3F1KA 1A71A 1XWFA 2JFGA 4FIZA 2VUSA 2JHFA 3JQ8B 4GWGA 3CPSA 3DTYA 3OQ1A 1BG6A 3MOGA 2HK7A 1R4NA 3WIDA 5IG2A 3DZFA 4M1QA 4FFPA 1QKIA 9LDTA 3ZWPA 3GAFA 3FNGA 3H5NA 3F47A 1DRUA 2YQ4A 4W99A 5EJ2A 5TC4A 1W6UA 4S1VA 4B4VA 5L9AA 4BB6A 2ZIZA 3A9WA 4J7UA 4RPHA 4EJMA 1F0YA 2G5CA 3JYQA 4WE3A 4B8WA 2D4AA 3KYDA 3RSHA 5F5LA 3HNPA 4NBWA 4YAIA 4ITUA 3WWYA 5BSEA 4BNKA 1KVTA 1VI2A 2RCYA 4MP3A 4BNUA 2AG8A 3IC5A 3NTQA 4IJKA 2YHIB 1LDBA 5ITWA 3PJDA 3ETDA 1DBVO 1HE3A 4ZVVA 5T67A 4ZQHA 3WMWA 1ZK3A 3RU9A 4L4RA 1I3LA 2AQIA 1H5QA 2Q1SA 4LVCA 4PVDA 4RVGA 2EGHA 3SEFA 4XX0A 4C7JA 4CQMA 4NJMB 2B5VA 1JDJA 1ZIDA 2C0CA 4CL8A 1CETA 1LQUA 4WCFC 2VZ8A 4I5FA 1U8XX 5F21A 4BQPA 2E48A 2HDHA 3DBLA 4FGWA 3K5PA 3PFFA 3WLEA 2Y0DA 1Y5RA 1DC3A 4Y6PA 2JKVA 4WPGA 4YA6A 5IN5A 4BNGA 1UXIA 3ZV3A 4CLHA 3ZW8A 3MZ0A 1CJCA 2CFCA 3P7MA 4J4HA 3GDOA 4E30A 3H5AA 1ZNQO 3G79A 3FTNA 5B12A 4FFMA 2LDXA 1EVJA 3E8XA 1E7YA 1VLLA 1PGPA 4IQGA 3I23A 3EC7A 5DULA 5A06A 1GYPA 1BSVA 1OC2A 3DOOA 5AYVA 1O5IA 3I9KA 1J5PA 3ROMA 5CDSA 4PLWA 5DP1A 1E7QA 1Q7BA 3JYOA 2V6BA 3QWAA 4E5PA 3FSRA 4MKXA 4CM3A 2HO5A 3I6QA 4JX8A 3B70A 2QRKA 2PK3A 3ABIA 4Q3EA 3NJ8A 3H8VA 3HDJA 1ZK1A 1JAXA 3JV7A 3PTZA 3BMOA 4HX5A 3V2UA 3IJRA 3JYNA 3BHMA 3O9ZA 5TJ9A 3QE3A 2FN7A 2O2YA 3U09A 3DBVO 1DAPA 3I52A 5T64A 2XXJA 1HYEA 1PTJA 2VHVA 1T2FA 2R2GA 4R9SA 3DZBA 1U2GA 5HTOA 3D5TA 2IYOA 4DXHA 1TXGA 5A05A 3IUSA 1I8TA 4RVFA 4UAGA 3L4SO 1X1TA 3JQBA 3TPCA 3GF4A 3PIIA 1H93A 3BA1A 3ASUA 3O8QB 3RD5A 3FNEA 3Q0EA 4QXMA 2NU8A 5THKA 3GNTA 4QQRA 1YGYA 1YRLA 3PHHA 3ROQA 2RBEA 3ZWAA 3GNSA 3JQEA 4FBGA 4U0KA 4EW6A 2Q45A 1GEGA 2CSUA 4CPDA 1JKFA 1PEDA 1V3TA 2P91A 1ZW1A 2J3JA 3DZJA 2JD1A 1NM5A 1Z74A 3F5QA 3VAZA 3AJRA 2AQ8A 5I8WA 1LUAA 1T2AA 1K3TA 4ZQFA 4P38A 5TQVA 2HKIA 1A27A 1XR3A 4WLUA 3L07A 5JAQA 3KTDA 6ADHA 2VYNA 4BO1A 5JAZA 5T8KC 4M87A 3P2YA 1HYHA 4CQLA 3OIDA 2VOEA 1E3WB 3ZNNA 3VZSA 3ZHXA 4WNCA 2E6UX 4RF3A 3T4XA 2YV2A 3WNVA 4ALIA 4E33A 5L53A 3JQAB 4RPJA 4XKJA 1O95A 1ZXBA 3F9IA 1PS0A 5F3RA 4N5MA 1PZEA 1P1IA 3JYLA 4WASA 2P9EA 2PGLA 3SX2A 4I5EA 3M1AA 4DL9A 3MWEB 2O4CA 1G6KA 4GH5A 5LCXA 4N18A 4CL3A 4K6CA 3V8BA 1TT7A 3KV3O 4Y9DA 5IDYA 3UXYA 3K2EA 2AE1A 4BNFA 2VHYA 2H5LA 4LCEA 3W8EA 2HSDA 4LRSB 4Q3BA 4A26A 1VSVA 3JQ7B 2RAFA 2ZTLA 5DBFA 3DHYA 3COSA 1D1SA 1EUCA 4DMMA 3P19A 3ANNA 3ZW9A 4IXWA 5G0SA 4Z0TA 1YS4A 2Q2QA 1YKFA 2I6TA 3UVEA 1WAMA 3KRTA 1JKIA 2FWMX 3PDUA 3NDRA 3TOXA 3QVTA 3RC9A 1WVGA 4PGFA 5U4QA 1KEPA 3GNQA 1HSOA 4OYRA 1PWZA 3V1TC 3H2ZA 4RCVA 3S1LA 4QFDA 5CPBA 1YWGO 2B37A 2CNBA 2WM3A 1LRLA 3JCZA 3AUAA 2POQX 3BMQB 4OJNA 4DLLA 2GERA 5KKAA 4K6FA 4DMLA 2J6IA 5DF1A 5C7LO 5K6AA 1E3WA 2WYVA 1IULA 1EUDA 1AN9A 1CEQA 1VL8A 2EV9A 3M2TA 3C8MA 3AM4A 4PLPA 2BHLA 3RKRA 5DZSA 4IZHA 3I83A 2DM6A 1A4UA 2Y1FA 2HAEA 1DFIA 1WXDA 3RIHA 5KVSA 2EKQA 3RUCA 3TFOA 1PJQA 2H63A 3BXXA 1AE1A 1DLIA 4H3VA 1DIGA 4IDAA 4ALJA 4BNVA 5T57A 1KC1A 4BKQA 5CHEA 3C7DB 1I24A 4TVBA 5G0UA 5LDGA 3CE6A 3MTJA 4DC0A 4RQUA 2Y99A 5L45A 3JQ6A 3MJVA 5I7VA 2PA3A 2BFMA 2NTNA 1D8AA 1MXHA 3E48A 2B69A 3DAFA 4IUYA 4KDEA 2NV6A 2AA3A 2FRDA 1ISMA 3PWZA 1EFKA 4OXNA 4TRRA 1Q7GA 4ZRNA 2X6TA 1VC2A 3PHIA 1Y8RA 1GEEA 3SVTA 4P4GA 1VPDA 2IZZA 1VJTA 1ZVMA 3AM3A 4IGFA 4ZQGA 3ZNQA 1DIHA 4C7KA 4GSLA 2FSVA 4H15A 4JBIA 2B5WA 1N5DA 4ZN6A 4Z9FA 4PFJA 5ILGA 3VZPA 4UUOA 1YBAA 1V35A 5BQFA 2PD4A 3UKOA 3ZZNA 3LF2A 2OXIA 3DXFA 3NV9A 4DTIA 3KSDO 5EMHA 4QT0A 1GAEO 3EDMA 3AY6A 3DBRA 1HE4A 5F1KA 4J9VA 1I2ZA 4ZQBA 1KVQA 2DBZA 6LDHA 5TT0A 2EF1A 2WE8A 3GHYA 1EEHA 1YONA 3AOEC 4GI2A 5IXSA 3L6DA 1RM3A 5AXDA 3ZWCA 3I5MA 4LSMA 1IY8A 4CR7A 1T2EA 5BR7A 1WW8A 1BXZA 1LU9A 1HDOA 1UDCA 2Y1CA 2IODA 3W4IA 1B0AA 2D59A 4CM4A 4U5QA 1QYDA 5IDQA 3TZQA 1Z73A 2IXBA 3RUHA 4M49A 1P0FA 3ZHZA 3CSDA 2CY0A 1ZBQA 5KJFA 1B8VA 1N1GA 4IDEA 3GEDA 2IZ1A 4CLRB 4W9NA 1WDMA 5IFLA 4XRGA 3RKUA 3U49A 1FJHA 2VYVD 4IDGA 5JDIA 2FR1A 4GWKA 3AFMA 4CLOB 1PGNA 3R3SA 2G0TA 3OEWA 1EBFA 5BSGA 1YXMA 1PJSA 2I3GA 3ONEA 3GUYA 1JLLA 1KS9A 1XEAA 3PHJA 4PLTA 3NUGA 1LLQA 1AXEA 1VSUA 1NHGA 4B7CA 5KWEA 1K0UA 1XU7A 4WEOA 1DJQA 4XQCA 1TT5A 3TN7A 3RROA 4FOOA 4N5LA 4ND3A 5FF9A 1T24A 5B4UA 4MIOA 4XEHA 5T6BA 3BMCB 5DCUA 3GDFA 3RUDA 3S2EA 3FN4A 3OF2A 1K2WA 4YPOA 3PHLA 3HSKA 2Y67A 1TI7A 1GR0A 4HKTA 1CWUA 4NDNE 2VNSA 2R00A 1I36A 1PIWA 3FCOA 4XIJA 1FMCA 3GN1A 5HM8A 2C54A 2O3SA 4NFYA 2OORA 3ADPA 2FPPA 3NEPX 3D3WA 3WR5A 5ICSA 4OL9A 4FJ2A 3TJRA 4D3DA 3WG9A 4E2WA 4E12A 3DMYA 5FWNA 3EW7A 4DGSA 1I3NA 2HLPA 2G1UA 1T25A 3QWHA 5IZCA 1PGQA 1DIBA 4B3JA 2BFAA 1A5ZA 1DFGA 1U4SA 4PLHA 2X1HA 4RF4A 3I6IA 3PK0A 3F4LA 3GDGA 1E1MA 2BELA 4J4BA 4AJOA 1Y8QB 4YTEA 2CDBA 4Q39A 4CLRA 3OJEA 1NX6A 2X22A 4BO9A 4XQEA 3D4NA 4W82A 3JQDA 3WBFA 3RWBA 4BKRA 2DFVA 2PV7A 3DHNA 4KZPA 1OC4A 5I9NA 4UVEA 3HN7A 1QV6A 4ZU3A 4J9UE 5TT1A 4R5MA 3N74A 1CF2O 1PJCA 5FI3A 1ENPA 3K73O 4M55A 4MP8A 1R16A 5EESA 1L1FA 4YDRA 3L4BA 4KUEA 4ALKA 5EIOA 1BTOA 3INRA 3LU1A 4BOYA 4F3YA 3GPDG 4AJLA 3HUDA 3QJ5A 4D3FA 2UUOA 1HL3A 2HCTA 1SPXA 1PJLA 2FR8A 2QZZA 5FI5A 4MIEA 1KVSA 4RDIA 2RH8A 2O3QA 3FD8A 1NWCA 1BWSA 3C85A 3BIOA 4A7PA 3ITDA 4KTTE 3WTBA 3K92A 3OIFA 4CMIA 4BV9A 2YUTA 3OIGA 3DOJA 1UXGA 3MTGA 1NQ5A 4LISA 4I9HA 2DPGA 1NFRA 2CZCA 5JDCA 4HY3A 1QG6A 2NU9A 1E7MA 5CDYA 1I3MA 3RVDA 1NFFA 3ASVA 1UAYA 4GGPA 1XKQA 4JBGA 2X9GA 2Z5LA 3VTZA 3N7UA 1KY5A 4HXYA 4ZD6A 1KBZA 3UFXA 3GOHA 4KQWA 1SEVA 2X5KO 1TEHA 4PLGA 3VKVA 2FZWA 3WYBA 3OQBA 4RJTA 1GPJA 3SXPA 1KEVA 4J1QA 1ISFA 3WFIA 3OEYA 1Q7CA 3VH3A 3TZ6A 2EW2A 5L4LA 4L73A 4OXYA 4LN1A 3I9MA 3AI2A 2FPGA 3ONDA 2FPIA 5CG1A 3ZWNA 5BSFA 3GQVA 2C5AA 5JW6A 1YL7A 2QW8A 5DOZA 4UVIA 3ZWBA 4NBRA 3A06A 3ENKA 1Y6JA 5DP2A 4CM8A 1ZEMA 5L7TA 5H83A 1HDRA 1IOLA 1HDZA 4FQ8A 3NT5A 1EK6A 1ADBA 3R1IA 4MVJD 3KEQA 1KIFA 3I9OA 5ENDA 3P5SA 4R3WA 3ZV4A 4EEXA 3B1KA 3ZDFA 3IMFA 4IDBA 2AW5A 4XYBA 2BRUA 1JU9A 3QVWA 2AXQA 3F3SA 5GY7A 1XELA 2UUPA 1U3UA 4XDZA 2VRCD 4M8SA 1RJWA 2O3UA 3UAGA 2B4QA 2D5AA 4GGOA 3KYCB 5IDWA 3F5SA 3GFGA 5L3ZA 1XGKA 1ONPA 4Y67A 4PVCA 3OH8A 4DLAA 1F14A 3BTVA 1QMGA 1E6UA 3RQSA 4NFSA 5AXBA 3PPIA 3ITKA 1GADO 1RPNA 2TMDA 4D46A 2GF2A 2BI7A 2WMDA 5EQFA 3G1UA 4DPLA 3E82A 2YJZA 1NVTA 4OH1A 1DB3A 4PRKA 2YYYA 2Y1EA 2GASA 1VL6A 2PZLA 3DR3A 4GBJA 4E2ZA 4PG8A 1LQTA 2GD1O 3GGGA 3OSUA 3PYXA 1CIVA 3BTSA 3PQFA 3DO5A 4DREA 1J6UA 1R0LA 4B7UA 5A02A 4L0QA 1R4NB 3HG7A 3JD3A 5CEJA 4MO2A 3VPSA 5JCJA 3VOSA 1EE2A 4WGGA 3SC4A 1HZJA 1HDCA 3FBTA 1KEUA 1T2CA 4UVDA 3GG9A 5C5IA 4B79A 4TRNA 4OIMA 4H7PA 5F5NA 5CG2A 5CAEA 1I10A 2Q1UA 3EZYA 4HFJA 4JROA 3W8FA 9LDBA 3NT4A 2JHGA 2P2SA 3V2GA 4BKPA 4D43A 1F06A 1NPDA 1X0VA 2PKQO 4J0FA 4HUJA 4XGKA 2YV3A 5L4NA 1O9BA 4HFMA 4XA8A 1KVRA 1JW9B 2I76A 4URFA 1E92A 1GUYA 2CVQA 2C5EA 3GEGA 5TGDA 4MP6A 4R68A 1YL6A 2AQHA 2YFHA 3WGIA 5THQA 4YEDA 3C7CB 4K28A 5I8ZA 3H9EO 2OP0A 4PG6A 3ON5A 3T7EA 3RASA 1UZLA 4OKIA 3GVXA 4CQMB 2XPCA 2QZ9A 5I9LA 3HHPA 3WB9A 2BH9A 3WICA 1TA4A 1E3SA 1XU9A 1H6BA 3RJ5A 1LRKA 1EDZA 4GKVA 4BNWA 4JGBA 4E2YA 1B14A 1Z75A 3I9JA 5JCXA 2VWQA 1H9AA 2NVWA 5EERA 5ITVA 2QYSA 4WLVA 3PGXA 1YB4A 1DXYA 1KVUA 1PGOA 2WEKA 1MC4A 4G81A 2WJPA 5DOVA 3GC6A 4OMUA 1AHIA 2BFPA 3AI1A 4TZTA 2VHXA 2ZK7A 3OFSA 4W6ZA 4Y8VA 4CM9A 4RPLA 4ESOA 1R12A 5ENVA 1M76A 1VJ1A 1V0JA 1M75A 2NWQA 4BGUA 1M67A 3S55A 4YAGA 2OO5A 5JPIA 4LVUA 1MB4A 1ULSA 1F8FA 1UAGA 3IS3A 1KYQA 4JP3A 3KLPX 4L9RA 5DBIA 4Z0HO 2VUTA 1DAOA 2DT5A 3CKYA 4BNTA 4IIVA 1D4FA 3EVTA 4XJTA 3BMOB 1BW9A 1C1DA 3WTCA 3CIFA 4FSHA 3VPGA 4DBVO 1ISIA 4YVFA 4MKRA 1CERA 4TROA 4E5NA 3UOGA 4N54A 5K9ZA 2IDZA 1IZ0A 1LSSA 3H65A 4IM7A 5LDHA 5HS6A 1HYGA 5TRTA 3BTOA 3LQFA 4AJ4A 2HQ1A 1FDUA 2NTVA 1O0SA 2F00A 4PCVA 1KETA 4DYVA 1ZXLA 4ZA2A 1I5RA 4ZRMA 4AFNA 3GA0A 3HDHA 2AEMA 1XCBA 2I5PO 4MIYA 3NGLA 4Q3DA 4RL6A 4YCAA 4BGVA 3G1TA 2GN4A 2Q99A 2HJRA 5GZ6A 3IAHA 1NBOA 3WSWA 2UAGA 2HK9A 4GX5A 4X54A 4QSMA 3MJSA 4PLCA 1P44A 1BXGA 3OHSX 4RVUA 1GL3A 2RHRA 1WP4A 4RZIA 4YJFA 5B1YA 5ES3A 1C0KA 3ICPA 3JYPA 2ZQZA 1X1EA 4TRJA 3TWOA 4J2OA 4YT5A 2B35A 3GH3A 2DKNA 5ER9A 4I9UA 2ZTUA 4CLEA 3WQRA 2Y1OA 1U5AA 3NAQA 1WLYA 2HMTA 4GMGA 1ZSVA 1P1RA 1W0CA 3QWIA 4CQLB 1PR3A 4D45A 2VHWA 3ROKA 1C0IA 3F6YA 2PLAA 4R51A 3U4HA 3VTFA 1T4DA 3ZNOA 4KOAA 3DB2A 1EFLA 1WNTA 4U7WA 4E4YA 2B4TO 3GVPA 1N9GA 1HETA 2BF7A 2YDXA 3E9QA 5COBA 2DFDA 4LK3A 5DDIP 3D4OA 5KTKA 3PGJA 1FDVA 1SBYA 2BKAA 3O03A 3GR6A 3AW9A 4CUJA 1PL7A 4JP2A 1MV8A 1OBFO 3ZWXA 4CV0A 1N7GA 1Y9EA 1YL5A 4H16A 4BQRA 2G82A 5CPFA 4O59O 1ENYA 4HNHA 4J43A 1FXSA 4Y98A 3WX0A 1UH5A 5HA5A 3Q1LA 5L4SA 1XHLA 3L9XA 5L7YA 1JVBA 2E49A 1PJ2A 2QIOA 3VH2A 2O50A 3ETEA 2EJVA 5DN9A 5DNAA 4CMEA 4GVXA 2VOJA 3INTA 1MFZA 4N5NA 2I66A 4A10A 1M2WA 4PN3A 4IINA 3UCXA 3LC1O 4L8VA 2ZCVA 3JQFC 3KYBA 3ENNA 1LJ8A 2A9FA 2IZ0A 1I32A 2NVUB 2X8LA 2RIRA 4XYGA 4I5GA 1IHYA 1NHWA 1MG0A 3DMTC 3WSVA 1UJMA 2D1YA 4ALMA 4Q9NA 4OOFA 4PLVA 2HRZA 4DQXA 3DHEA 4CM7A 2EERA 3WIEA 4E13A 3WGQA 4FCCA 4J0EA 1LBEA
chains in the Genus database with same CATH superfamily
3FCUB 1W9MA 2TMGA 4Q01A 1SG0A 1Z83A 3BHJA 3KWJA 4WZ6A 4E32A 1KYYA 1VLMA 1UBEA 2IGTA 4JCOA 1IG3A 4A8HA 2QLLA 2BGWA 1BHJA 4GAEA 3PXEA 1RHUA 1Q16A 4D3SA 2Q4DA 4IG4A 1X6VA 4NBNA 3ZV6A 1OBCA 4WX2B 5C52B 1G17A 2OK7A 4XZ3A 5EHQA 4MVJE 3EIHA 3FSGD 4IMPA 4LKRA 5GZ3A 2EHDA 2JCVA 2NGRA 1LPOA 1Z4IA 3AFNA 4DMFA 5TQ0A 3GPBA 3KBOA 5IEBA 1N3IA 4QHYA 4PWZA 3BH6A 1A77A 3SFVA 4BEVA 2CEAA 1Z7EA 2PSJA 1EX1A 5A5VA 1G9XA 2ZSDA 4XUDA 3OQPA 4N6GA 2K6GA 3GBPA 5GWXA 3LUJA 4HJRA 1SHLA 5LOVB 4A36A 4Q9LA 2AVNA 1L7AA 1NW8A 2R25B 3FPLA 4JLNA 3T9CA 3Q7PA 3T9BA 3EZLA 3TG2A 1N1EA 2B6NA 3KQUA 1IL0A 2EFHB 4YQYA 1WP9A 4B76A 2CLKB 2V7QA 5EP2A 2VSNA 4D9FA 3NC1C 1OILA 5FWAA 3IOEA 1MIOB 1QWOA 3W79A 3IODA 4BUCA 4PYJA 1HDXA 3GUZA 4BL5A 4YMUA 4QICA 4CEIB 3I32A 4C6TB 2IHJA 1Y1QA 2RGNC 5EWMB 4EKIA 5J58A 5LJIA 2NVUA 1EFDN 3O6VA 1VJ0A 4ENVA 5AQ1A 3KUCA 5C8YF 1LWOA 5JNVA 4F9GA 3WGJA 2WV9A 1L5ZA 3NYWA 3SZGA 4MB0A 2PKXA 3NIFB 4QVKA 3DBRB 4DNOA 5CK4A 3T5GA 4U1RA 1CLEA 3ZVRA 1XDZA 1DINA 2HDWA 3I2KA 1PEKE 1C81A 1GGFA 4KO2S 1LXCA 1GPWB 4MINA 3H7AA 3NBQA 1UDAA 1AHHA 4IP0A 3L7DA 4OU5A 4S35A 4U02A 2VHZA 4RE6A 2ZSHA 4YJ3B 1VFPA 4O02B 2PNJA 4DDWA 1HXHA 1E99A 1PWXA 1NYQA 2ISCA 4CMKA 1KZHA 4KTVE 4JA0A 4JXXA 4HQFA 3CURA 2QGNA 3CEMA 1MC1A 4CG3A 3OLZA 3WGHA 5K0LA 3EZNA 1QK4A 1GXSB 5E7QA 5MFPA 3A9CA 1G5PA 1MOPA 3X1DA 5IF3A 5JJKA 4WLFA 3NDIA 2PX4A 4C0XA 1J00A 2UYCA 5KQMA 5F2EA 1GSHA 4R7TA 2OT3B 3L0CA 2AOWA 2VUHB 2IBSA 2I7TA 3QIVA 3ZV7A 3FYUC 1LK5A 1QO9A 2H29A 3O5AA 3S2SA 1TU3A 4LYJA 3KPUA 4B6GA 1R6VA 4IJ6A 1G2QA 1JLLB 2CLMB 4KQXA 3AL2A 4IMRA 1ISJA 5DXAA 3WGUA 3MINB 4YV7A 2OO7A 5KC9A 2Z8YM 1NE7A 2AJDA 4YDHB 5T4FA 3BS4A 3KCQA 2A2ZA 2COKA 3Q98A 4G37A 4F60A 3UB4A 1IZ9A 2V0GA 1KORA 4A92A 2QG9A 2WVHA 2W2KA 3DL2A 2Y0CA 5FOWA 4DMHA 3UMYA 1YCHA 1B43A 3FPFA 1WLSA 3D54D 4FEAA 5C3MA 2B4YA 1FUIA 1R6BX 3ZY2A 1JDUA 2GAAA 3IKMB 4IFEA 2X4GA 4DZTA 4M9XA 4GKAA 1E2BA 3BL8A 4PSDA 5JCOC 4KHPB 1U7ZA 4OMFG 3UMRA 3VBCA 3WWDA 2QQ0A 4Z0PA 4KW7A 3V1KA 4BO2A 2ZDQA 3HXTA 3THWA 2MHCA 1Z68A 1DOAA 2HA5A 1REQB 1IEWA 3MT0A 1NKVA 3D8BA 2PZJA 1A2QA 1L7MA 1ZUNB 4WNIA 4DRXA 2WOOA 2YVAA 2A4KA 3L18A 1HE1C 1GL9B 4DB4A 1UPAA 2I4OA 2ZRLA 3P20A 2GRUA 2XY4A 3W5UA 4LBZA 1X7ZB 2QVLA 4Z2YA 4FJ0A 1TLTA 3TZCA 2A1TS 1A5TA 3IYLW 4TXJA 3VV3A 2P3OA 4JMLA 2DMRA 2NYVA 2BJHA 3AESA 3INNA 2VQFB 1AJEA 4JQCA 3PEUA 1WXIA 2OZEA 3M1LA 1ISSA 4HHEA 3TQCA 1G19A 4JT4A 5BP7A 3Q8LA 3WOHA 3H0EA 1NW7A 4JBXA 4OGKA 4B3BA 4WJZA 3GRZA 1SC9A 4YFVA 1T9ZA 4F3NA 5LC1A 3KQNA 2A8YA 3IERA 3HSYA 5BR1A 1QH1B 5IU6A 4U0JA 3UJ9A 1A82A 2HJHA 4GNKA 4TM8A 3E35A 4R1OA 4BO5A 1E6WA 1L5HB 3OFKA 4FYIA 3CPHA 4AZ3B 2ZVQX 4CM5A 2FR0A 3N87A 5A7HA 2YOGA 3HB7A 1WZEA 1A7JA 1RVV1 2Y1GA 3QP9A 3PPXA 4YO7A 4DSUA 3GLHE 3FRHA 4HRXA 3T95A 3K6RA 4YRMA 1ISGA 5ALIA 1LPPA 3ND5A 2O5VA 2KWIA 2FI1A 4JNKA 2ZJYA 1IRIA 3ORRA 2XNKA 2GNAA 3TXAA 4B9EA 5FWXB 4D26A 2PAAA 1U1IA 1INLA 1C9MA 3J7AC 3D4IA 2VTEA 1K27A 4DJFC 5IUJC 1NZFA 3PD1A 1GGKA 1HDGO 3GFTA 3CX4A 1SCKA 3MD0A 4IR7A 5JALA 4IH1A 1G3RA 4Z9YA 3BXFA 4U2CA 1EFUA 4EGAA 4ES6A 1AV7A 1ZLXA 1G2PA 4D9JA 3PFWO 4BMYA 4F1JA 4ZVSA 1FB5A 2AJ8A 2GZSA 2ZTMA 4RXUA 4U3JA 1UWCA 3WB1A 4RTQA 4CMIB 2VWGA 4CT4B 3KZVA 4ITVA 3EYAA 3LL4A 3FCXA 3TFQA 3MS7A 2ZIUB 1BJRE 4IEFB 3COZA 2PKRA 4LF5B 3EOZA 4BNZA 1ZU5A 3DVQX 5T41A 1QE3A 2RKBA 3HR4A 2O0JA 2GN9A 2EQ5A 4GL4A 3ZH2A 1GFIA 4PZDA 1RYEA 2J41A 2QTVB 3CH6A 3K0EA 4KGZA 4QQNA 3TNYA 3CF4A 1K7FB 1RYDA 1YBFA 3AK4A 3EG9B 4P82A 4E51A 4GT1A 4R2IA 2FDCA 3LP5A 3ZS8A 4EUNA 1JPNA 2QF7A 3DVAB 2MWMA 3GG2A 3HXKA 2GZ3A 1U7DA 4GDMA 1AX9A 2P9YA 2XDWA 3SIXA 2A14A 3LQ4A 4JC4A 4ZYZA 2ECKA 1TL7C 3KE9A 4JELA 2ONCA 1XTPA 4ZDJA 4MW0A 4UHHA 3ID6C 4MUNA 4B7AA 3TG8A 5IM4A 2X0JA 4HDQB 3I76A 1A5SB 3QYAA 1Y3HA 2Q62A 1FFAA 2EHJA 2FPGB 2WJJA 3KQWA 5EXDA 1B3BA 2ZYVX 4F4HA 3RKSA 5EUQB 4W9RA 2GPWA 1NXOA 2PL5A 2OGWA 1JEEA 1R8QA 4F8JA 1JAZA 2BZ0A 2HHAA 2V7GA 3SZUA 2UZ1B 1YI1A 5EN4A 2P5UA 4KO3S 4CM8B 1TJ3A 3L3BA 2PKCA 4AROA 3UK2A 4J03A 3IO3A 2QUZA 4OB6A 2ODTX 2PXAA 4PINA 4EYQA 5DNCA 3T3GA 2IXAA 1NR7A 1GCIA 1BU8A 1ZLYA 2AX4A 3CEPB 1Y9DA 2QE6A 4M1WA 4XWYA 1RCTE 1QGYA 4YH1A 3NB0A 1J9ZA 5DLPA 1H0KA 2YC4C 2D2VA 3FOAA 4KFTA 2OZPA 1ZN2A 4B3IA 4LYDA 3F3YA 1JHDA 3CY6A 2NTEA 3C5CA 3HJUA 3LZ6A 3MGCA 3LQKA 2CVPA 1YZUA 2HMWA 2IEBA 3AY3A 5ESWA 3B20A 3L5KA 2ST1A 1G7CA 4WXEA 3RJ9A 3HSSA 1WPRA 1NMQA 4QODA 4B4KA 4MGEA 3OIWA 2I9KA 3GFOA 3H2JA 2HNKA 3A6HA 3NXKA 3H87A 4IS3A 3LPCA 5CGQB 3QQPA 5HIMA 2WF8A 3SSNA 1NXQA 3SS7X 3UUEA 1WUJS 2RHCA 2XOXA 3IUEA 3ZUPA 1L7RA 2FSHA 2HPAA 2CLOB 4GQBA 4A8TA 2ORYA 2H9IA 3T4PA 4D4IA 1Z2CA 3X1XA 4R54A 2VBGA 1DGQA 5BV1A 4QUIA 1ORTA 3AF5A 4PAGA 2DPLA 4RPKA 2IIQA 1FYVA 2F2TA 3K0BA 1A5AB 2P4HX 4NYIQ 4OXKA 1D09A 4WUTA 4EDFA 4I1PA 4GICA 4FZ3A 3QA9A 4DDTA 4PICA 5T3UA 4LXGA 1NVMB 4IIGA 1OT5A 1PG2A 4L4ZA 4N82A 2REQA 3U39A 2BVNA 1IK6A 2AN1A 2C4WA 1NJ2A 2F1KA 2AOVA 2ZBRA 4WKGA 3J81k 1V9CA 4HDNB 4IY1A 1A69A 3IUPA 3LUCA 1HF3A 5CLJA 3I62A 1LF0A 2D62A 4AKEA 1TVCA 3WK7A 2ZQYA 1AH2A 2QGFA 1OYOA 1OLUA 3C8UA 3UGKA 5K0TA 2CB0A 1VYHA 3ME5A 3IBCA 4LXIA 4RW0A 3HACA 4QJ3A 1JQBA 1E4YA 4H0FA 2H17A 3ESXA 3L43A 1CJBA 3L7CA 1B6RA 1DEHA 3C2QA 4IGEA 1NP6A 1FIUA 4AJ1A 2QX8A 4LRWA 3NNDA 5IKEA 1WB5A 3IO5A 3HVIA 3UKDA 5EG5A 3B9RA 4XJSA 1J8YF 1DQPA 3E3LA 2JGLA 2ZQ5A 1CVRA 2VRWA 3EDRA 5AW0A 1ACMA 4HB3A 4QEZA 3QSGA 3NWBA 2X42A 3H1FA 4Y6SA 2WTUA 5TPZD 3WGTA 3F96A 1N3YA 2CHEA 1V71A 3OBIA 1VL0A 4UCQA 3G8BA 3RTGA 5B6JA 2DEUA 3HE3A 3I5XA 2EKPA 1ESEA 1ICIA 1IPEA 4KSYA 1Q0LA 4ZOAA 1E2KA 3MFQA 1R5BA 3OCXA 3TDKA 2P65A 4GR9A 3IUYA 4M9CA 2C1EA 1JBQA 1GA1A 3NBFA 2R79A 1OR8A 2XSZD 5EZSA 1PJBA 2WNIA 5IBQA 2Q6KA 4QUGA 1Y1SA 3TQFA 1VYVA 2VCEA 4CM1A 4RSGA 4F7WA 3TOCA 4G2TA 3EG5A 4RANA 4TKVA 3CRZA 3SHTA 1GAWA 2OCKA 3H5LA 3GUHA 1P9RA 3OM9A 5A1JA 4DSZA 3E9DA 4O63O 5EZQA 5FPPA 1KYIA 3U19A 3ACBA 2A7XA 3ZR4B 3HUEA 4KFCA 1XEFA 4M0LA 1TLLA 4RIFA 4WL0A 4AP5A 2JGMA 3QEOA 4B71A 4EUEA 1PNRA 2VAMA 1VGRA 2BP7A 4FYXA 1GUBA 5B1EA 4NCNA 4CMJA 1RI5A 2Q8PA 2WPNA 4Y1EA 2H1LA 3ND7A 1MH1A 3C8HA 2W6NA 2ZLBA 1RTTA 3RHZA 3C7AA 5AKHA 1SHZA 3DLAA 1H1TA 2OO3A 1EAYA 3HCBA 1I4WA 4HUTA 4F12A 2JFFA 1UZNA 3CX8A 4TT8A 4YDSA 5TJHA 1TD9A 1EJ6A 4NBSA 1IN4A 2BDUA 1EX7A 2FX3A 4JKIA 4NENB 4UU1A 4EPWA 3VH1A 4G4JA 4B7XA 3H13A 3I72A 2C7VA 4H35A 4U6NA 2H4WA 4TSFA 4PLZA 1H22A 2I2XB 1V1JA 5E1MA 2RH4A 2PZFA 1ADFA 4GKBA 4Z3KA 3W4JA 1WW3A 1X2EA 4L5IA 4PHHA 1PHRA 3ZD9A 4FE4A 4D79A 1ZMTA 3GD7A 4I19A 4KRYA 4YCSA 4Z6KA 5E9JA 5EJIA 2Q7XA 3KYJB 2PLFA 4BO8A 5FOQA 4BJ3A 2HIAA 1E61A 2VSOA 3GJ6A 3ZDXB 1AT1A 3QLUC 2CMDA 4K9QA 5AVKA 3PP8A 1V3VA 2HA3A 5JMOA 5BQ3A 1SIOA 4BVBA 3Q3GE 4LXHA 4BFYA 5HKKD 3U80A 2ZAIA 6REQB 3LVFO 4MNTA 1XLVA 3TO5A 2ZUTA 3EEQA 4PW0A 1AA6A 1NMSA 2JIQA 4JIGA 3AG6A 1YQTA 1UM9A 5JDCA 1HT0A 1YVRA 2OESA 2DX7A 4DA4A 4QSHA 2EQAA 1NI4A 1OMOA 1VHTA 4O5OA 4ZREA 1KXZA 3WJAA 2CGEA 2ZWAA 3QUSA 5E3JA 5ADVA 2VA8A 4MW2A 5H7XA 1Z47A 2SKEA 3C1UA 3OIYA 2BLLA 3O2NA 3HO6A 5K20A 1ZFNA 3TLEA 3DMRA 4C0WA 1VZ2A 3OHMA 2QN2A 5DI3A 5AVTA 4JXZA 3Q6IA 4RO0A 3JQBC 1JMYA 3LTNC 1YOVA 3WAGA 1EK5A 1Z5UA 2DE0X 2QI9F 3K6JA 2A57A 4HGRA 4HL6A 2CXSA 3E7FA 3LG2A 4FE3A 4NWIA 4XVUA 3TOZA 1K5GA 3HCAA 1FVHA 3LBIA 5MGNA 2GCPA 5DM2A 4TLLB 4ZU6X 1OQAA 3AP3A 5ECGC 1E64A 2OKGA 3AQ4A 5JNRA 2SKDA 4QWWA 3IAAA 5C18A 1O0CA 4N49A 1RMQA 1ZRHA 1QCDA 2ORVA 4MYSA 3D8TA 4YAFA 3CH7A 1R00A 2B0CA 3IR7A 4A6XA 4BNXA 2AKEA 3TVYA 4TV8F 3N7AA 2AJBA 5JO9A 1Z29A 4AG6A 1X7HA 1DI0A 3TRJA 5F77A 4ZCMA 4LI3X 1GTRA 1U0LA 5JSHA 4EJ6A 2VJPA 2HWXA 3HKEB 5FI1B 1S2MA 1SRRA 2JGEA 3R0QA 3CTPA 4OXIA 2Y27A 3L1JA 3C6MA 4UTOA 4AWAA 4L76A 4ARBA 3D6JA 2C7BA 1ITZA 1PQ4A 2WSLA 4YRFA 1PJTA 3UJCA 4IXNA 5K6TA 5IC5A 5A3JA 2P7HA 1D7OA 3AUFA 3E6AA 5AKKA 1KZGB 4II3A 4UHKA 1AMOA 4EB0A 1EDOA 3VHQA 2WUEA 3JQAD 4EY3A 1PS9A 1ZM2A 5LXTA 1NBHA 1IYZA 1IQRA 1CP3A 1H0RA 1A3CA 4QHTA 4RDCA 3LW7A 3X2SA 2HHCA 3SF8B 3DJFA 1N9GB 3QLVA 1AKWA 1T1GA 3VOTA 1P45A 4UHFA 1YO6A 5LKAA 2OQIA 2VQDA 4YMIA 4UBMA 4A8JA 5CVDA 3PFHA 2VK2A 2AEEA 1VBMA 3PVZA 1RWQA 3COVA 3LLUA 3G9QA 3L6EA 4RK1A 3BT7A 1MPTA 2GLUA 1R10A 3GRAA 4FB5A 2EVWX 3FAKA 3M9LA 1NQWA 3OCVA 4NVRA 3K0HA 3JAKB 4BGIA 4L4UA 4KWCA 1ZOPA 2R6CA 1O7JA 1R15A 2WKPA 2CXTA 2VCYA 1T3LA 3LZCA 1FP2A 4HRAA 4H60A 2G7MC 2X7XA 2YW2A 2VHQA 3VKUA 2MYNA 4B4UA 5TS2A 3GLUA 3OZFA 5DHQA 1XTZA 5ER6A 4Q7JB 2P9GA 2Z2XA 4JYBA 2CZGA 2BBWA 3R7NA 2OYSA 5DHAA 1PT9A 5AI9A 1RYNA 2C9CA 4ZK6A 4IUCS 2PKYX 4GIBA 2ZT8A 2X86A 1SVWA 3NHZA 5L51A 4XDHA 2WNHA 1ONOA 4DYDA 2JZNA 1BDJA 4NX2A 3W8DA 1E3DA 2GCGA 3NALA 4AULA 2QX9A 1BEZA 4UTPA 4QGFA 4U6QA 5EUMA 1K6IA 5H9WA 5IUNC 1FRZA 2Y71A 2E55A 2I2WA 3IP1A 4UHEA 4BZPA 1FU8A 3MCWA 3M6XA 4GX0A 3V7WA 4MGZR 5HF5A 3ILHA 3BEOA 7MHTA 3WLSA 1Q3HA 3GEHA 1AUPA 5KB3A 4G5RA 4M8NE 3G2HA 5A5EA 2NZWA 2OM6A 5D7BA 1UXHA 1W4AA 4K9OA 3TTUA 4EA8A 2R1TB 2LE0A 1P7CA 1FTGA 3QY9A 4QDJA 3KQPA 4KO4S 5HJEA 2DLNA 4KH1A 4BVKA 4ZT3A 2V4MA 1Z25A 1GAQA 1SC4A 4PG5A 2H2GA 5FTWA 1WQ4A 2LPMA 2MSLA 2Q41A 4NBTA 4BJ5A 1H6DA 1WUTA 2H11A 2F48A 2NPIA 2QSYA 4KWTA 4MMZB 5F76A 5SZIA 4HRVA 4PZLA 2ZIXB 2YC2C 5D8DA 1NKTA 2MYPA 1D6JA 1M34A 4O2BB 3FF4A 1QYXA 2GUGA 2KLHA 3RFFA 1M2NA 5AP9A 4LYYA 2EGGA 3K53A 1NN0A 1SZJG 3H5OA 3GMSA 3Q5DA 4MWDA 5ESRA 5ITZB 2BIFA 2R2AA 2RHGB 5BUSA 4IIJB 1XMIA 3K9QO 4D4JA 5KYYA 3HPQA 4D4HA 1OJLA 3TRKA 1VE5A 3EW9A 1FFCA 4ZKDA 2EATA 2I2DA 3EY4A 2JGRA 3KU1A 1WOYA 3LWZA 5E0KB 2Q6IA 4L75A 1O8BA 4G3XA 5BYKA 2NQTA 3ELWA 2OXCA 4RIHA 4RV9A 1T8UA 4JXKA 2MSEB 3WMEA 1NQOA 3LLSA 4ID9A 1MQSA 1Y9AA 5CVTA 1UEJA 3G9XA 3K2QA 2GK6A 4UEKA 4IXDA 4HWKA 2YRWA 1KSHA 2IOFA 1Z6PA 1YZTA 3WBBA 4C1NA 3SMVA 4WCFB 5HUQA 4W8OA 3BZWA 4MUYA 2VYFA 4F0JA 4PG7A 3W2EA 3K15A 3ZCUA 3K9NA 1JDNA 2WTAA 2H4ZA 1SCIA 1JVSA 1S01A 4CTOA 1XZBA 2C31A 3WHKA 4C4OA 3FA2A 1NATA 3TTTA 1W73A 4OY3A 5KDOA 5JXJA 3EZ2A 5ETJA 5E38A 5AOBA 1RW4A 1VRWA 1X86B 1P2DA 3FRJA 1ZICA 1FDOA 1XCLA 2CHVA 1B2LA 2F9FA 3K1AB 3EUWA 3TLGB 3LQYA 4K8RB 4NYMQ 3DHVA 4TTAA 1CULC 4LXXA 5EMNA 4RTMA 1AHNA 1YR3A 2AKAB 5I9MA 4M9ZA 3OZCA 1SY7A 5IAOA 5CA0B 1SURA 2ZB8A 1XIVA 4HDRB 4JVMA 4JLSA 1ID1A 1D4AA 1FU4A 5EINA 5ADHA 5DV9A 5JMWA 2E5LB 1WHSB 4Y6GB 2J5QA 3Q2KA 4K9DA 4HP8A 1QH8B 2HRDA 3QEMB 4R9UC 3RO7A 3M4XA 4WDRA 4Y2RA 2DTEA 3ZHSA 1V9LA 2R7MA 2Z5FA 3UWKA 2P9QA 3QLTA 5HIKA 2NZXA 5TQ2A 1X1SA 1SPBS 3NJRA 4OBWA 4X1YB 5FL3A 5AIBA 5J4KA 5K3EA 1Y37A 3U6BA 4CR8A 2X58A 3DEYX 4ZHSA 3NOXA 4AY4A 5A4KA 4B3RB 3I1JA 3Q88A 2W22A 4MRPA 4YR9A 4W4TA 3JD4A 3ZY4A 1HT2E 4JJFA 1D9XA 2HRRA 1PSDA 1W85B 4UMDA 5KNBD 1O97C 3TL3A 4GOND 2B3TA 3ISJA 3HJAA 3BORA 4JD5A 4QUAA 1JIXA 4WXHA 1P75A 1I6MA 1R74A 1U3VA 2J09A 1QG0A 3FR7A 3SEQA 3HA2A 3LS2A 2BMEA 5GJWC 1KEKA 2MSKA 4KN6A 1PV4A 2NSDA 2OHXA 3RIMA 1SJ9A 1XMSA 1G8PA 3WK8A 4GP9A 5AVWA 2K2QB 1JFRA 1OASA 3FMFA 3PJFA 4JC5A 3TX6A 3P9XA 4GX2A 4JOSA 3T3DA 3UWDA 4LQCA 3SKVA 2ON6A 2VJAA 4WOJA 2FQQA 4UHDA 1EVQA 5TMEA 4EFDA 1XEWY 1U81A 1WG8A 1Y6QA 1YJXA 1MRSA 2NXJA 3A7DA 3GRPA 4IF4A 5G4KB 3X2FA 1YFJA 5KX5A 2G08A 2P0AA 1XAGA 2ID7A 2BSAA 3H11A 4KO8A 1ZZEA 3RVBA 5DYGA 5BNTA 4X61A 1UBFA 1ZUD1 3BWDD 1DRWA 2PMDA 1TDJA 4XGRA 1Z8FA 4L85A 1Z8DA 1Q19A 2PSEA 2QY9A 3DZHA 1SUSA 5JY6A 1J4AA 4F85A 2GF9A 1NBMD 3PQEA 4GPBA 5JXWA 1QHIA 3ZE8A 1Y7HA 3PB3A 1C9JA 4B6PA 3CH4B 5IZCC 1HE8B 3L01A 3KPJA 5LZ4A 3D02A 5DGTA 4OJKA 3L2OB 1M0SA 2D00A 4B5KA 1VE7A 2WBLC 5G1NA 4G85A 3BFJA 1H6CA 4YYZA 2AMYA 4DIMA 1JR2A 4S1OA 3V8PA 4PQYA 4X64B 1AZLA 2EEZA 1SUDA 1E0KA 2J9GA 4HAIA 4OP1A 4ZQCB 1H1LA 3HVKA 3JQAA 2X0IA 3GAMA 4FXOA 3IHKA 4RV4A 4MLCA 4TV9A 5TF4A 4B43A 1PT6A 3HXQA 3TBFA 5KTOA 4GM0A 3M70A 4BS9A 5ICEA 4AICA 5E6SA 3M5WA 4IS2A 4C01A 4F6LA 5ADUS 4AWXA 4MQMA 2O2IA 1GQQA 1J2EA 3IILA 1Z3IX 1NAIA 2X0RA 4MV4A 1YS2X 4OHPA 5HF9A 2WHXA 1QRDA 1XRSB 1X7WB 2ZKLA 3DLPX 4ZOLF 1QIHA 5KEIA 5EQDA 2O8CA 2B4AA 2P9JA 2O07A 2Q3JA 4KITB 3DDWA 4IBOA 4EFKA 5FPKA 2PX0A 3A25A 3SLKA 3I0ZA 3N0VA 2CL6X 2DCUA 2FR8C 2CUZA 2EL7A 3F7OA 2H2WA 2CMKA 4N8EA 5IANA 2D0IA 3DXZA 1M0WA 1WY7A 1IBMB 1E3EA 1N57A 1XP8A 1P5RA 4D2IA 2F8TA 4YAOA 5H4GA 3MQFA 1BGWA 3BXGA 1GTJ1 4KJXA 4CMAA 4F1WA 5A9SB 5CYGA 1RKVA 1YE8A 4NCXA 2CFRA 4N0QA 1V48A 3DMTA 1I6WA 2Y4OA 4OJMX 4FT2A 2V5AA 4BGEA 4M86A 3AB7A 1I7SB 4GZ3A 1UBKS 3C43A 1FVFA 2IS2A 3EGXB 4C0HA 4FYVA 2EYQA 4XVCA 2OLEA 2FPLA 1IAVA 3NRCA 1XP5A 3RBXA 4V24A 3L0BA 3T1QA 4EKYA 4EELA 4NH0A 4A2CA 5TR9A 2QRLA 4BXOB 3CLRD 4GOOD 5CT5A 2BKVA 1SKBA 3G2KA 5JSZA 1SCUB 4NZYA 3HO8A 5LB4A 5FP0A 1T29A 3II6X 1N33B 3TQSA 4HQKA 2O57A 4YBRA 1IHXA 1VIMA 2C8VA 1DBIA 2JJYA 3GLTA 3HKBB 3T3PB 1IOVA 1Z28A 4GXQA 2BHNA 5LYYA 1HE5A 2P5TB 1MH9A 1RPAA 3A1TA 4M0MA 2J7PD 3N3BC 4BECA 3W7AA 3CF2A 1WVIA 4X6XA 2XUJA 1UBUS 3DP9A 3OA0A 4BE9A 5CFPA 3V8NA 1KXJA 3UC9A 1ZWKA 2PGXA 2P69A 2J3IA 2PH1A 4N0MA 3DOCA 5K0FA 1YIDA 4JB2A 3MBKA 4K9LA 2QN8A 5JRDS 3CF4G 4Q66C 1J20A 2GHTA 4G1FA 3UT0A 2HPVA 1FFYA 4G4GA 1QZUA 2GVNA 1USUA 3CBGA 3RVKA 2BGMA 2HT6A 4K87A 3VNUA 3IA7A 4E3ZA 1I13A 1R6TA 2A88A 3NHJA 4OQYA 1FYEA 1S3FA 1J21A 2X1LA 3FCSB 4FFOA 1HA3A 1EBBA 3GQBA 2Y1XA 3QFCA 3R5TA 4KKXB 3WS7A 4UEWA 5K0ZA 2RGNA 4AJ9A 5KOHA 4LXUA 1TYBE 1S89A 2FXVA 5CB4F 2O0LA 2X5XA 1PNQA 3R7LA 3EFOB 1XD2B 4UUPA 3O8NA 4Q4CA 2YYSA 4AJIA 6ABPA 3CNNA 3Q2IA 1QRRA 2D1RA 2H18A 4M89A 5T4BA 5IABA 2ZM6B 1NMZA 1U7HA 2F1HA 2Q5QA 3TAUA 3BFKA 3C7KA 1GD1O 4JJZA 3ZWKA 4YO8A 1V1MB 3UT5A 4HB2A 4L27A 2BSQA 1VBKA 2YIVX 4B80A 3KG2A 4MI9A 3A28A 4LNUB 4ZIRA 5JCPA 3PEWA 1MU0A 3FHTA 4R9RA 3PEVA 1FK8A 1FQOA 1YQUA 2XZPA 3OQ6A 4NIMA 2X77A 4PPQA 3LUFA 2GEJA 3PKIA 5CEFA 2BYTA 3K70B 3WBKA 4Z53A 2QTAA 1K63A 4RQBA 3Q8XB 4GLLA 4WZBA 4ZVLA 1EXMA 3F7MA 4E4RA 2Q50A 3RYCA 3ZUGA 1NW3A 4JLUA 3KDPA 4QELA 4QTZA 1Y82A 3S29A 1T4CB 4JUDX 5F5XA 2NU7B 2WE7A 3EF0A 4D4KA 4R8LA 4FYYA 5JAOA 1ENOA 3UGTA 1EVKA 3PPVA 4K0RA 3U4IA 1T4MA 3N5KA 3BKXA 3PWSA 1J07A 1MX5A 3JZIA 3UO8B 5BO5A 4EKEA 1RWMA 1U8AA 1SBHA 3N6RA 5IJ0A 1Q7EA 3STTA 3HJGA 4EG6A 1EUYA 5KTNA 3FYUA 4FKBA 5IT5A 1RSZA 3A4IA 4HDSB 2KHZA 2RC6A 1SUIA 3U4AA 1PSZA 4H6WA 3TUJC 3MCZA 4NE9A 4FGZA 1FPMA 4MRRA 5LP1A 3TXXA 4CFZA 3URKA 1XZHA 2HU8A 4LJ6A 3I09A 3E1KA 1GSOA 2DY1A 1U0BB 2PLWA 3L0PA 3M5PA 2GOYA 4DV1B 1VOTA 4E0BA 4QECA 2WWFA 4OQ4A 1U4NA 5KX5F 4DW8A 4OQLA 2VNAA 1FTQA 3GLGA 1JQKA 2JLSA 1J7JA 2XNJA 1WMEA 4P36A 3FOZA 4TQGA 3LF1A 5L3QB 2G72A 3QA3E 4JVNA 1GUZA 1TPZA 3LOUA 4Q34A 1JIQA 3C0KA 4FOSA 5JCOA 4AYWA 2PCJA 3ND9A 1KZ6A 1TLFA 1QH0A 1PS8A 3STUA 2H2IA 4QJ4A 4TVOA 1NA5A 5F3DA 1TTHA 2GM4A 1ZIPA 4MS1B 5CNKA 3ROTA 2EBUA 4HGPA 4F6RA 2FWBA 4QTUB 4RTPA 3WQSB 2DP4E 1W5EA 5EHXA 2OE2A 3B12A 1PEYA 5DX1A 1GKKA 2PZ8A 4JI3B 3ZI0A 1J0BA 2SCUB 3G5AA 1ZZGA 2IYQA 3M4ZA 5C5CA 1G55A 2HNBA 3F6EX 3I4CA 4MWBA 2BDEA 2QLNA 1VMIA 2RG7A 4JI6B 4ASUD 3EVNA 1QVZA 3G2MA 4BNIA 1WPQA 2YXNA 3CRVA 3D2AA 4FCWA 2Q0QA 4TTPA 2DLCX 3ZNPA 4TV9F 3UIEA 3AHDA 2O6HA 2B7BA 4W5TA 1PR1A 4Q0MA 2YIJA 1W88A 1M1YB 4YJDA 5A1TA 2JL1A 5HZGA 1VMEA 2Y93A 2QSJA 2ZSBA 4HUQA 5DTMA 4ECAA 3SLGA 4MUKA 2H6EA 2IDKA 4R1TA 5A5FA 1GDTA 1CRLA 1VHWA 2FP4A 3G0DA 1GCGA 1GY8A 1K6EA 2HEGA 2OUKA 2V8BA 1E58A 4MMXB 1QE0A 1U90A 3RSFA 1IBKB 1BN6A 4CLXA 2FGKA 3R3ZA 3OTOB 4LYGA 2ZI6A 4WESB 2WYUA 3TE6A 3IURA 3WY9A 1JHRA 1ZGGA 3RS0A 1SAYA 1XRMA 3CRW1 4Q1FA 2MR5A 5B1IA 5EMJA 1X7XB 3RARA 3CVUA 1LLUA 2J5RA 2XUOA 3ACCA 4OI0A 4EUSA 3P9IA 3KKEA 4ZJUA 2ZAYA 1DCKA 2PRJA 3UJPA 1JWAB 1S0UA 4J90A 4R5HA 2PVPA 3ROPA 1OYWA 3E53A 3F9CA 2CF5A 2WP0A 3WL6A 3CONA 2D0OB 4HMQA 1P60A 1Z6TA 2ZRCA 3CG0A 3LYUA 3OF3A 4UNPA 3ZDYB 1L1RA 4WZZA 3UW3A 2GPJA 2GTIA 4U6SA 5HOEA 3GMIA 3HVJA 3ZZ1A 4BVEA 4OK5A 3FYCA 1CUIA 3C87A 2C2XA 1NQTA 1QIEA 4FGSA 4NK4A 3HGTA 3KVOA 3BM5A 1BDBA 1FDWA 4ESEA 2DUMA 3NATA 4BBPA 3S2ZA 5KYXB 4PIMA 3D0RA 1L4KA 1NUPA 3G2PA 3KZ1E 4URWR 5HQ3A 4F1KA 3C3MA 2V7UA 3HPRA 1PZHA 1EMDA 1BCSA 3PRYA 4XW2A 1YZKA 1CZLA 3O47A 1X3LA 3GP8A 4YYEA 3HZZA 3AJ9A 3A4VA 3TLBA 5KNLA 3G9ZA 4DV3B 3HUFA 4ALLA 2VTBA 4M1MA 5EE3A 2XGSA 3PWKA 4RY9A 4WRRA 4EWLA 2PWZA 4BZXA 4YMGA 3ESYA 2IZOA 4OGWA 1BXRB 4HLQB 3TLCA 3WRWA 1IBRA 2WI8A 4OMCA 3AUSA 2VYND 4KXQA 2WZQA 2DHQA 2GTPA 4PQFA 3ZZMA 4BQOA 1E1DA 1Q77A 1U4OA 1L5WA 1CBUA 2DHDA 4HN2A 5P8WA 3RAJA 3T5TA 2WYWA 2ZXUA 4DLWA 3KQMA 2CK3D 4UUNA 2H54A 2FW0A 1HWYA 2ZJAA 3MRTA 4ID3A 4NK5A 5I5EA 2VQSA 3PCRB 1SXJE 1VE6A 1IB6A 3OX1A 2D2IA 4RVOA 1KH2A 3Q3VA 5TNXA 2YN0A 2ZUBA 4RZUA 1WDKA 3A58B 1KK2A 4ZTUB 3GLHB 3MYYA 2JATA 3TNFA 2ESRA 5FEUA 2J7PA 2PUFA 3FTEA 3WK9A 3QLEA 4PHFA 5H1YA 2W00A 3MYRA 5ESDA 5BRNA 3LUDA 1NJ6A 1C0EA 1ODIA 2IOHA 3OM8A 8ADHA 1Y1RA 2B4KA 1KZ7B 1CUHA 2JIZA 3AEQB 4FUQA 4Q19A 1VQ1A 4TS9A 3NFYA 1KNQA 2UKDA 1UJ5A 3W9BA 3WP0A 4AS1A 3TIGA 4JUBA 1ZM7A 3KYDB 3VGPA 1JUDA 3FXAA 1LK7A 3CUUA 4YRNA 3G7UA 4NG5A 4E14A 4Q4HB 2GDZA 4NATA 3U7IA 2WU3A 2ZR9A 3GDHA 2DSNA 3VJLA 4AJNA 3QK7A 4KXMA 4KWHA 4WIAA 1G6Q1 2E1RA 3KYCA 3FZGA 4B83A 4W1QA 5ARCA 1Z45A 4DIFA 3GJ4A 1E6EA 2PEZA 2WUGA 2X3UA 1BS9A 3EF1A 4KQFA 2YNMD 4YC7A 3PGLA 1HG0A 4J6EA 1EWVA 2ZSEA 3WKDA 4CMEC 4DN6A 3ZJUA 1V7QA 4GEGA 1KJIA 3A0RB 4G8CA 5K8LA 5SZJA 3A6PC 3QXCA 4NZNA 4EGCB 3I8XA 1I1NA 4RY2A 1N34B 2B8EA 3H17A 4JOCA 4QWMA 4EJ0A 4U39A 2QQFA 1OVMA 3NIDB 1MD9A 1L5SA 1JIIA 3A6JA 2BV3A 4YAUA 2C98A 3K5IA 4FE7A 1JT9A 2IP2A 4N3NA 1MNAA 4A6PA 3DBLB 1MZPA 2PT9A 2FSIA 5EIFA 1LBHA 4TN5A 2JFGA 3JWGA 4FIZA 3OU7A 4ZAYA 4GS5A 2JHFA 5E9AA 1DX9A 4PC3A 1RI4A 4GWGA 4RKYA 3JRNA 4IFIA 2H8KA 4QPZA 4LWOA 5AJXA 3KVNA 3SG0A 5CGZA 5CX1B 3MOGA 1R4NA 4HXGA 3NLLA 3WIDA 3DZFA 4CTJA 1U2SA 4M0KA 2FF5A 4YMLA 3OUZA 4KV7A 3H5NA 2G88A 4C0QC 3K7EA 5INTA 3KKPA 1ABEA 2YQ4A 5EJ2A 1EX6A 4MW1A 1OH7A 4QM6A 1FZQA 3I6YA 4S1VA 1KJNA 5L9AA 1VHLA 2XVYA 2XB2A 4J7UA 1BE8A 1G3IA 2ZSKA 2XKAA 2W6JA 3NHKA 3NPAA 4RPHA 2FWNA 2W37A 5DVZA 1UWLA 3T1VA 4AF8A 4AIRA 1YR1A 3G5MA 2Z9DA 3I6ZA 4ZJYA 4WE3A 3HEMA 4UUQA 1E1RD 1TF5A 2I80A 1XTBA 3VU9B 1QFMA 4GRIA 5F5LA 4RGVA 3D6AA 3RM3A 1TMKA 3IEKA 3NP7A 1OIWA 1RXSA 1F2UB 3MLBA 4BNKA 5C8ZA 3IPYA 1VI2A 2RCYA 2ZUFA 3KZKA 2AG8A 3ESAA 3R0XA 2O2CA 3DO8A 2WJ3A 1QG2A 3ETDA 1HE3A 4MUHA 1RLOA 3WMWA 1MQ9A 3HP7A 3D4LA 4AB1A 3S7TA 3EOBI 5D3MA 4AUEA 1JG6A 2DXIA 4NJMB 2Y1WA 3ZCVA 4YPVA 1JIJA 2W43A 3PICA 1UBLS 4AG5A 5KAMA 2YMMA 2O59A 2K7FA 2C0CA 1TTTA 4Q7MB 3V3TA 1SXGA 4YRKA 4QUDA 3U44B 3DFIA 3OTIA 1JVNA 2VZ8A 3OOJA 4WCFC 5FL7A 2QLFA 2X8AA 1SQ5A 5F21A 4BQPA 2D7CA 2HDHA 2XA2A 4FGWA 4RIIA 4UU7A 1IN6A 3UM9A 3K5PA 3WLEA 2F3RA 2OFXA 1DC3A 1RQ2A 1D0IA 1UPTA 1RXCA 2JKVA 2RGYA 5B57C 5IN5A 3WMFA 1OB2A 1QS0A 1PAUA 2MJLA 1CJCA 2CFCA 4L7QA 1XLTC 3CCBA 3ML1A 3DFFA 3H4TA 4R1QA 2YWHA 3FKQA 3FNRA 1EH5A 4G41A 2H51A 2ZUWA 2X3YA 4TOIA 1PHPA 5B12A 3AR5A 5DLEA 1YFKA 1QZ3A 3DG9A 4ASUA 1EVJA 3E8XA 1PGPA 5A06A 2PHZA 2PO5A 4W1SA 2FPWA 3OZDA 4GOLD 1Y63A 3PT9A 5AYVA 1TF7A 3ROMA 2G80A 2P1RA 1TX4B 1WEHA 1Q7BA 5CVUA 5CJJA 3QLUA 1Q1AA 4J1TC 4MKXA 4RHTA 4E5PA 5A4FS 2WTEA 1JFLA 3I6QA 3NTVA 4Q3EA 3ABIA 4ZXFA 4KAAA 4AWBA 1DQYA 3HDJA 1GT91 3PTZA 1J5XA 2O8DA 2H5EA 1C50A 3GOQA 5AKEA 4YUWA 3O4GA 4R7GA 3R3UA 4QBHA 3O9ZA 4QDUA 3RYFB 2PL1A 1UT5A 3A4TA 3QE3A 5BW8A 4Y1RB 3DBVO 4YUZA 2GN2A 1RT9A 2VDLB 2CD7A 2QW0X 2WA2A 2QW1A 3I52A 1UPXA 5T64A 2Q7OE 5KPDA 1HYEA 1SGWA 1SBCA 5LIPA 1IOZA 4GKJB 1T2FA 3AF1A 4N0PA 4X1IA 2HD4A 2RIPA 3JWEA 4FOTA 5JXHA 1W76A 2E1PA 2BUBA 3AEYA 4KSBA 4KLNA 4OUDB 2FSVC 3R7FA 4ND8A 1JQ5A 1T6YA 2DR3A 2Z3WA 4KQJA 1TXGA 2C5LA 2VLBA 1UKBA 3PEEA 2GCIA 4RVFA 1SUWA 4US0R 3EVFA 3IVRA 1X1TA 3JQBA 3B2QA 3IJEB 2HCJB 4FCVA 2G09A 1LD3A 2WICA 3UJ8A 1A0OA 1BAPA 3O8QB 4TTTS 5C80A 4QXMA 3AHJA 4QQR