5G4NA

Crystal structure of the p53 cancer mutant y220c in complex with a difluorinated derivative of the small molecule stabilizer phikan083
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
196
structure length
196
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Harnessing Fluorine-Sulfur Contacts and Multipolar Interactions for the Design of P53 Mutant Y220C Rescue Drugs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 50
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5g4nA00
3TS8A 2OCJA 1UOLA 2J1WA 4IBQA 1YCSA 4AGMA 3IGKA 3WTSA 1HJBC 1HJCA 3D09A 1IO4C 5G4MA 2H1LM 3EXJA 1T4WA 3D06A 4AGOA 2GEQA 4MZIA 2BIQA 3WTYA 1GZHA 3US1A 5ECGA 2XWRA 3KZ8A 1TUPA 4G83A 2XWCA 5G4NA 2RMNA 3QYNA 4GUOA 3EXLA 4QO1B 2IOIA 5BUAA 3WTUA 5LGYA 2J1YA 4LOFA 5ABAA 4L0ZA 4LOEA 1KZYA 2AC0A 4IJTA 4A63A 3ZMEA 2P52A 2BIPA 4IBSA 2J6WA 4AGNA 3US0A 5AOLA 4IBWA 3Q06A 2J1ZA 1LJMA 5AOKA 5AOJA 5AOIA 5AOMA 3IGLA 4AGQA 3WU1A 3WTVA 4GUQA 1EAQA 1CO1A 4G82A 3VD0A 2X0UA 2BINA 2PCXA 4IBUA 5G4OA 5KBDA 4LO9A 4IBZA 5LAPA 4MZRA 2ATAA 4L18A 2BIMA 1E50A 4XR8C 2FEJA 3Q05A 4HJEA 4IBVA 3QYMA 3D05A 2BIOA 3KMDA 1TSRA 2IOMA 1HU8A 3D08A 4IBYA 3WTTA 3VD1A 2X0VA 3WTWA 3WTXA 1EAOA 2X0WA 4KVPA 1H9DA 4IBTA 2J1XA 1CMOA 1EANA 2ADYA 3Q01A 1GZHC 3VD2A 5AB9A 2AHIA 3D0AA 2J21A 4L0YA 2YBGA 5A7BA 2VUKA 3D07A 2WGXA 2J20A 2MEJB 2IOOA 4AGPA 4AGLA
chains in the Genus database with same CATH superfamily
4MKMA 1SXNA 5F7UA 2CG9X 2W80C 3QEQE 1CQYA 2I60H 3WEBA 4JN2A 4MDJB 1JWMB 1I4FB 3VGAB 1GW0A 4O2EA 1OAXH 4S1DC 1NBQA 5FM5M 2N3JA 1WZKA 4ILDA 2V5RA 5FKPA 1TEGA 5CILH 4HAGA 2AQ3A 2GEQA 1I1YA 4V1DA 3VD3A 1S7UA 1UJ3A 2D3JA 2LLNA 3SE9H 4HZAA 2UXTA 3MGTB 1IGYB 3CZNA 3NESA 5TK2A 4OZGE 5T1MB 1R3LB 1ODAA 1ADQH 3IJ8A 4LPTA 1DVQA 1OHQA 2F1BA 3AS1A 1GIGL 2X6AA 1A7NH 2BRRL 4Q56A 1RHHA 3Q2NA 5I30L 2HG5B 3FB6A 3RQ3A 5HBBA 3RVXD 4Q6IA 4YPGA 3IDIA 3HMWH 4ELMF 1B0RB 3HAEB 3L9BA 4GRLD 4XVOA 3UBHA 5DTFA 3RILA 3KJ6L 3GQFA 4I88A 3DO4A 4V1DD 1TYJA 5L0QC 4JFVA 3FOMB 5FUCC 1A1OA 4AJYV 3DX8B 5LDUA 4OTXH 2W1NA 4P5TD 3K6NA 3GHBH 2DIAA 3MLYH 2QHRL 2J8UA 4XPBL 4ZSOE 2HTKD 1CL7I 3VXTB 1HXMA 1UH4A 4YHLH 3FB5B 4IRJC 2EC8A 3K4ZA 3V4VB 3T65B 2Q6WA 2PKDA 1CBJA 4AT6A 3VXSE 4DK3A 3UBXB 1TTBA 3OMZA 5D1XD 2B08A 5GGUB 5ANHA 4XCCL 3RIAF 4ONFH 1A9EA 2YMXH 1P1ZA 3D9AL 2GI7A 2B3IA 1ZHKB 5HYQA 2BVPB 5F1NB 4YOKA 1KV7A 1P5UB 2P3YA 1A4AA 1NFIB 1U8QB 1YYCA 2AABL 2Z92B 2AF2A 1MFBL 3FSAA 2MOVA 4JZJC 1UA6H 5T3XL 3IDGA 3MGOB 4PGDB 1MHPL 2YXVA 3RX5A 1I8KA 3B2XA 4GKOA 3HHMA 4HK3J 1HEZA 4KPHH 3A6CH 3M86A 4HT1L 1CFQA 4LP5A 1ZEAL 5AVYB 1MCLA 12E8L 1CU4L 2COQA 3ARVA 3FL7A 5HYJA 5EUOE 3KWXA 1IBBA 3QWOA 4RDQF 3AABA 2WN2A 5KVFL 3VCLB 3QWQB 2EH8H 4CDHA 1QPKA 3PGCB 5D9SB 3V4VL 3MFFB 1EERB 1HHGA 2BZ7A 2E3VA 4KO7A 4ADIA 5JQHC 4TNVF 5AQ0A 4BQBA 2C3XA 3O2WH 1RUQL 4L4TA 3KAAA 3VX1A 3S37X 3WJMA 1MW3A 2W95A 4XAKD 5BS0E 4GKZB 4F57L 4Y4FA 3FQRA 4LRNL 4MCZB 1S7RA 4ZX6A 1WFTA 1S5HA 3BP4B 2YD9A 3A6BL 4JFOA 4TM9A 3W9EA 2R2BA 4AG4L 1CFSB 1UD4A 3P11H 1U93B 2F7QA 4Q9CA 3TFKC 5I1CL 4GXVL 3VWKC 3WN5C 4X4ME 5FAAA 4L8DB 3RVWC 4TVSa 3LIZA 5F7EH 3T2NH 1QLFA 3CIQA 1TUPA 2Z7UA 3OJDB 5HHPB 3MRRA 4XPAL 3VWJB 1ZSDB 2P5PA 1KTKE 2CPCA 4L37B 5BUAA 5ACZB 3V4PH 4X6BA 1WDAA 5GRJL 1UM6L 4LSSL 5LGYA 3MV9E 4UM9B 3ZRFC 5MENB 2DLFL 1A5FH 1MWAA 3WKPA 1A6ZB 1FVCA 2OPCA 1K72A 1P6FA 4MB1A 5IMOA 5D7LB 3FT3A 4WUKH 3MCKA 5LAXB 2CXGA 3U4EB 2A9CA 2BOCA 3JYCA 1QHQA 4K3HA 3OF6A 1G9ML 1EJOL 3NZUA 5IIEB 4LF3A 4E41A 3RTQA 2AK1H 1MJ8H 2HX7A 2P5WA 4JPKH 2AXFB 1PJWA 1BG9A 1FRGH 1G0YR 1N10A 5L4MA 1BVNP 2DQJL 5J6GB 4XHJD 1R5VA 4JFUA 5DXWA 1CDJA 1UENA 4R0LB 1ZANH 2XWTB 3NCMA 3PWVB 5DO2D 3ESUF 3HE7A 1HCVA 2DQMA 3QUML 3VVVA 1JPTH 1NZRA 4QGYA 4PVBA 3GKWH 3OF6D 4ZS6D 1E2WA 1EXUA 4JHAH 4IYKA 5JOEA 3UDWC 3QDMB 1QR1B 4KZEH 4R7DB 4E41D 1RD6A 3DVNB 1E27B 1W0VA 3QG6A 2VAJA 3QZWG 3UBXI 4O58L 4QJ5B 5LLIC 2J88H 2ROYA 1JN6B 2ZYIA 3NCJL 4MJJA 4IS6A 2JKIS 4WRLA 2ENYA 1H5BB 1YMMB 4PWEA 4B9YA 5C6TH 1FORL 3C6LA 3LD8B 2CO6B 4A66A 4U0RC 4ELME 1NC4B 3JTSA 3ECBB 2PYEE 4CW1A 1CLZH 1FG9C 1SEBB 4LFHG 2XKSA 5DZNA 5CN1A 3D07A 4AKPA 3ALPA 4Y1SA 2V7HB 4X5XB 1AY1H 1KT2A 2IOOA 3NA9L 3V52H 3P2BA 2Z8RA 2X4NA 1OSZA 3DX9A 3DX6A 2XQBL 3CN2A 5I8KH 1E5CA 3FCSB 4JM2F 1FNSL 2DYPB 4FQJH 1OCWL 1TQBC 5EF1A 1IO4C 4WQOA 3FC8A 2CO7B 1UZ6E 3K6DA 4NDMB 1LMIA 1IARB 3Q2VA 4KK5C 5K1VA 1OAXL 3FTGA 1RJZA 2HN7B 2PPAA 3NFNB 4JX0A 1F1DA 2BIQA 3GMRA 2ZG3A 3KDMA 4K71B 4X5WA 1NIDA 1C7SA 3SE9L 3COOA 3AADB 1Y6NR 3GGWA 1DBML 2KKQA 5FYJE 2ZWLT 1UVQB 1ADQL 2GFBA 4IMKA 2HLEB 1FO0A 1CYXA 1A7NL 1B3JA 3M45A 4I77L 4XNQA 5JORB 2COVD 4R96B 3NIDB 2IC2A 1SUHA 3MNWA 5ACLA 3FT2A 3JVGA 3MJ7A 1TSHA 1WZ1H 2D31A 1I7RB 4LU5L 4YO0A 1IGIH 3G5YB 4TTGA 1SVBA 3BDXA 4U6YB 2RTTA 2YQ2A 5HI4D 3R1GH 3JQOB 4RNRA 1IBDA 4YHMH 4OTXL 4PY7A 3QJFB 3HG1E 1DBBH 3CDGA 2YD2A 3SBWA 4W4OA 2VLKB 5I1KL 2FIRT 4YHLL 5J9PB 5KW9H 1Z0NA 3W56A 3RA7H 4L3AA 1C12B 2QQKH 5IQ9B 2PN5A 3QPXH 1XGYL 1NL0H 3LXAA 4Y5XB 3MV8B 1JTPA 5EU6B 3SYQA 3WIHA 4Z7VA 5CEXB 4KNUA 5DZAA 1BIIB 1ZHLB 2BOBB 5B8CC 4ONFL 1CZ8H 5E6ID 2BK8A 1ZV2A 4GKNA 4IM8A 4O4YL 1LEGB 1ZDSA 3JWDL 3C9NB 1AE6H 3QIWD 3JWNG 1ZV5A 1RMFH 3HC0B 3TM6A 2X0VA 1G7HA 1UA6L 4PI0A 1Q0XH 3ECQA 5BVJA 1IBHA 1NCIA 3UTPD 4KPHL 3A6CL 1FF5A 1EFQA 5GZNA 4LARH 4FYSA 5MENE 5FO2A 3X14B 3BGMA 4P2AA 2TSBA 1HHJA 1HDMB 2H3XC 2IPTH 2NY1C 2W60A 4CN4A 2V37A 2EYTB 1D5IH 4UB0L 3TO4A 1I8IA 4FXGB 5F1IB 4HS3A 5IBLC 4JRXD 3TF4A 2OYMA 2W8CA 1VACA 1XGQA 4GAAA 5I8OL 3RVWD 4I3SH 4ZYKA 4NKQB 2LU3A 4NBZB 5MEPB 4M4RB 5T1DH 7TAAA 4DTGL 2LQRA 4C47A 4JVWA 4R90H 3VFMB 2WIMA 1X5JA 3KNBA 2Y22A 1F6FB 1I7UA 1A02N 2H6PB 3VFSB 4AQ8C 1CICC 1JK9A 4MXVF 2LLLA 2CDFA 1ZSHA 3TWYA 4ZUWA 2YWYA 1J10A 3L3HA 3OM3B 1GHFL 4JN1L 4LPXA 5IVNA 4P5MA 2NY3C 4O2EB 1DFBH 1TZAA 3QDJA 1I9RH 3T2NL 3QDME 5FKPB 5FGSA 1AQMA 2D3VA 1I1YB 4V1DB 5D96C 1VFOA 2AJYL 1UJ3B 2MIZA 4BQ6A 1G7MA 1HN1A 2ITDA 1YSOA 4QIRA 3V4PL 3GUFA 3BMVA 1GGIL 1FGVH 1YMME 1URZA 3H8NA 3B2VL 3E8VA 5FF6A 2QMKA 1Z6JT 1A5FL 1DQDL 2XFXB 1ZPLA 4OGYH 1RHHB 3PNRB 4ANUA 1DJSA 1WF5A 3FB6B 2LABA 3C5SA 4Q6IB 1ND0B 3HG2A 2W59A 3IDIB 1EPFA 2VDMH 3V8CA 4HJIA 5I5IA 2GUOA 5DTFB 5F0JB 3WFEH 2P8MB 1G4MA 4UQ3A 5C0EB 3CHRA 4H8UA 4TNEA 4ODTL 5C0GA 2VKWA 2J8UF 2AANA 2MQ3A 3OHMB 4IBUA 2A74A 1I8LA 3V0VA 1MJ8L 1HXMB 3DI3B 1GA2A 2P46B 4JPKL 3KWUA 1ET7A 2YAMA 3QCVH 1XSIA 1YEEH 4OZIA 2XWXA 2IADA 3H9SA 2Y23A 4BSVB 1QX1A 5C71A 4DP8X 1NFAA 1ZANL 3DO3A 3RYMA 1INEL 3APNA 4ANKA 2ZCKL 1ZLEA 4EN3C 2W9DL 2WXPA 5EZJA 4N6RA 3U7WL 5IW1A 5EFIA 4IRSC 3GKWL 3KLAB 1PEWA 1F90H 1A9EB 3D0VA 4JHAL 4PJFA 1P1ZB 2IGTA 4KZEL 1E40A 3B9AA 4FFTA 3Q5YA 2VXVL 2MWCA 1ET8A 3A21A 3M1BB 5HYQB 2WSKA 3HNTH 3LHPH 4PJ7F 5A2FA 5E7FA 2IGLA 5D7EA 3QEGH 1OM9A 1T5WA 5JOPE 1DQLH 2ED7A 5J3HC 3JT2A 4FFYH 4MA1B 1KF9B 3GPSA 3VTAA 1I1CA 3VJ6A 3FRUA 1F5WA 3TVMC 1I8KB 3DIDA 3UMTA 1HEZB 1EJ8A 4C4BA 1X4XA 2Y7LA 5EU5A 1OKEA 5T3ZH 1J1PL 5JIQA 1GGBH 4F33A 2Y36H 3LEYL 5HYJB 2WYZA 3RWJA 1I9EA 4DK6A 2I85A 2Y1AA 4XH2A 5LCVA 1AY1L 2K1MA 5F7DA 1CXEA 2J8HA 1QG3A 4A2LA 1S7XB 3BPNB 4DESA 1OAQH 1CYGA 1E9QA 1YN7A 5I8KL 1K6QH 3KWVA 2Y0SA 1QKZL 5EU6E 1T0OA 3EJYD 1HHGB 1PBYA 1G7LA 2C8NA 1ASPA 1YAIA 3O11A 4L4TB 4UQ9A 2R0LH 3WJMB 2ADJA 3FZUC 1BXAA 2JMRA 5CAYB 1S7RB 3RY4A 1S5HB 2JQAA 4GS7C 3W9EB 2A9DA 2R2BB 4AX3A 1EQWA 3DPBA 3BP5A 3MRKB 4OH2A 1EXHA 1ZT1A 3OKLA 1W8NA 5JXAH 2FH6A 4N28A 2CK2A 4BK5C 1QLFB 3MLZL 3VMNA 1WZ1L 1QSED 2JCWA 1IGIL 3MRRB 2WZ6A 2WTOA 3ML9A 3QIBC 3JWOC 4PGZA 2A77L 5FM8A 1L9QA 3EJCA 3IB4A 3MCLH 4LCUA 3EF7A 1Y07A 3FSWA 1UQSA 4JFQA 4P4RA 1MWAB 1SJVA 1DBBL 4HWBA 1FVCB 3DHPA 3AT8A 3M17A 4HEPG 2AEPH 2FBJL 4JJHA 1U8MA 2AJXH 5KW9L 4NI3A 3RL1A 5IMOB 1WIUA 1PZAA 2PXYC 3MCKB 3RA7L 2G3MA 3EJQA 2CUIA 2JKTM 5BZZA 1XGUA 3UC2A 4PBDA 4X99A 1GGUA 1OOWA 1NDMA 4MB5A 5IM7B 2HJLA 4YDKH 2W94A 3TH2T 1L3WA 2CHNA 4L4JA 4YHZH 2NQ3A 3G6DL 4E41B 5JMOC 4GQQA 4Q6YA 1CZ8L 4MXVE 4ALAC 4RFNB 5GJTH 3DURA 4F2EA 1ORSA 4JG0H 1MDTA 2IG2L 4DGYL 3AQDA 1UCBH 2ADIA 2H8PA 1CDYA 4PB9L 4YLCA 1LQBC 3ZDZF 2ODIA 3HBGA 2QKIC 5T5FA 4NNXA 5I1AB 5I0YA 5IBLD 1A1MA 4Q9BA 4OJEH 1KPVA 1Q0XL 1CS6A 3BVNB 4AQOA 3W9DA 2E8ZA 2VDKB 1EXUB 2LVCA 3IFPA 5GRVL 1GRWA 4LHQB 25C8H 4GLRH 3F6IA 1NIEA 1DVSA 4XMKH 1N12A 1TEYA 1U8CA 1HKLL 1W0VB 3QZMA 4GI8A 3TEXA 3BFWA 4G7VL 4IBLT 1CICD 1XEDA 5GXBB 4IS6B 2AERT 2F58H 2OTWA 2QSQA 4Y2OA 1D5IL 1MIEL 2AQNA 2BFVL 3EUDA 2DQCH 2NSQA 4CC4C 4XODA 4PRDA 2WO4A 3N1MC 3B6SA 4PGJA 5LXGH 5T1DL 4H1LA 4N3TA 2A4EA 5K33A 1WD9A 2J8UE 1KB9K 4ODSH 5T5NG 2YMTA 4JPWL 1KT2B 2J6EH 3DPDA 2X4UA 5IJDC 2OP4L 3NAAH 1OSZB 3DX6B 3DX9B 5JHMA 1CF8H 2E74C 4D0CA 1BGXH 3VFNA 4R8WH 1QUNA 1AS8A 1BWMA 2LLGA 5JPNB 2ZUWA 3L3GB 2BP5M 1DFBL 5DT1L 4KV5E 3U6RA 3FTGB 1RJZB 4X9HA 1PSKH 4HJJL 2VDKL 3W3BA 4LKCA 3GMRB 3BPOB 5LQBL 4FQ2L 4X5WB 4ZFZA 4P23D 5DJDA 4PBXA 1XF3A 5K39B 1A6TA 4MJ4A 1BXVA 1YRKA 3GGWB 3PCYA 2ZUYA 5AYUL 1OZTG 4TQEH 2OULB 3MRCB 5FUZL 2GFBB 4FNQA 1FO0B 4LLWB 2MQCA 3WLWD 5IOKA 3GINA 4XNQB 3UCQA 2K4WA 1CXIA 2DIBA 3QNXA 1BM3H 3MNWB 5EU3A 3FT2B 4WWNA 4U6HB 1YEIH 2D31B 1KZQA 2VDML 5HYJE 3B1UA 4WNJA 1BXUA 2BINA 1U3NA 3AY4C 4FZEH 3GSQA 4O02H 4U1GB 5DMIH 4F3FA 1CURA 4FA7B 1S7SA 1PVHA 2ERJC 2FWUA 4PY7B 5E6IB 3VRIB 2ZXQA 1KCSH 4Q58C 3RWHA 5AFAA 3CDGB 4GQ9H 4S0SD 1M7XA 4NEHB 3QIWB 5AVVB 4L1TA 3M7OA 1KEML 5EC1A 1MFMA 3FQWB 4XNUH 2H7WA 3DTXA 4L4TE 3UAJA 2GYSA 1ZTXH 4P57A 4PY8I 2R59A 32C2A 2ZWSA 4RMVA 4Z7VB 2F61A 3ZKMD 1BF8A 5IHLB 2XY1A 1LLAA 1ZHNA 3IDYB 3CFBA 2J1XA 5IB3B 2E8YA 4LNVA 3OWEA 5TE4H 1A7PL 3L3DA 1RIVH 4HWEL 4JFWA 3HNTL 1WSST 3QFGA 2EILB 2JB6A 1RZGA 2YD8A 5IB4B 5JUEH 3MRNA 4RBPK 5SWQB 3BUDA 1ETZA 1G7HB 1LE9A 4FFYL 4JRXB 1CGXA 1E43A 4M29A 3DJSA 1N2RA 1KV3A 3FUIA 5IW3A 5KBMA 4BE5A 3ILEA 1XH2A 2NYKA 1LP9F 5E2TH 1TTFA 3QQXA 3TTYA 1I8MB 3D3VA 4QHMB 2EXYD 3BEWA 1CTMA 3FQ2A 2OLDA 2R83A 2OW7A 1WEJL 3BGMB 5I1GH 3FZUD 1HHJB 4XN7A 5TK4A 3AAZA 2PWDA 4C4KO 3H56A 2GY5A 3C6SB 3PWJA 1I8IB 3TO4B 5DRZA 4HS3B 1AIFB 5DWUL 3W39A 3WFHA 1Z9LA 4GW1A 3IDJA 1VACB 1XGQB 2YMOA 5EA0L 1EA9C 2WBJC 4AMWA 1EHNA 4KRPD 3D39D 3RFZC 4XB3A 3L5HA 1H15A 3VGBA 4BEIA 3G08A 4ERSL 3D3VD 3HVNA 4NT6B 3RZCC 4BZYA 2PW1B 4E41E 2VITB 3KNBB 4Y1AA 2E7MA 4NC0B 2R0LL 4K3JL 4LEBA 1I7UB 2P5WE 4HALA 5HGBA 1U9KA 3QUXC 4PWIA 4RQQA 1P4IH 2N7AA 5IB1B 4WFFD 3ZQ9A 2CDFB 4L2YA 4JFTA 1SMOA 1K3IA 4QRSA 2E9GA 2P52A 5JXAL 1DO6A 1MUJA 2KYIA 1IGTA 2W65A 4Y9BA 4F8LA 1PZ3A 2G4GA 4N9OB 3STZA 4OF7A 3NCXA 5E1AA 1P4BH 4BFJA 4RIRA 1HWHB 4IMLA 3N42F 5BV7L 2WLKA 4RZCA 4Y1AD 2P4AB 2GY7B 4N2HA 1G7MB 2JF1A 3WN6A 2ITDB 2NY4C 3LSOA 4HLJA 4JPIA 4PWFA 4H26A 4C56A 1GAFL 4K94C 5FF6B 2VXQA 4M02A 1E4XH 2D7PA 5HD8C 1TJHH 4XP1H 5T1JA 3QH3A 3SDDD 3MOQA 2AJXL 1VZIA 2Q8BL 2EEAA 3RI5F 5C92A 2YC1B 4ORGA 1THCA 4G3YL 1DJGA 4A2FA 4I3RH 2APWA 4BIKA 3CBKB 3CZGA 5I1HL 2GUOB 1S78C 3PDOA 5BRZA 1HH9B 3WO4B 4UQ3B 5FYLH 2BZDA 4X7SH 3ARBC 4YDKL 4P04A 4LLVA 4YE4H 4YHOL 5TFSH 1T0MB 3T8VA 2A74B 3SHSA 1R3IH 1F1GA 3BEVB 3V0VB 1DDHA 5K93A 2OMTB 2YO3A 2OTUA 4NNPH 2K78A 1IAOA 2R39A 4FJYA 4GG6F 3LRLA 4OZIB 3ARDA 4NJAH 4I2XA 3H9SB 4TNWK 1J9CT 3PJNA 1U3JA 4ETQA 2MCAA 4G8IB 3MRIB 5BRZD 2UUDK 35C8H 4HZLA 5EZJB 5IW1B 5EFIB 1F3DH 3L81A 3D0VB 5I6KA 4PJFB 4N3UA 4HYTB 1S46A 5IJCC 2JKWA 4WDIA 4Z5RA 4UQ2A 1LDPH 3UBFA 4WI9A 1T5WB 2F58L 4M7KL 1KBKA 3ARDD 3GMQA 4OFIA 2X44D 3O6LH 3QHTC 1T7ZA 2DQCL 5AVTB 3VJ6B 3AROA 2HMID 1AFVH 2HT4C 2ZXBA 4FKEA 4N2IA 5EU5B 3W11D 3H3PH 3A4AA 3BO8A 1ODUA 2YKKA 4F33B 5LXGL 5EEXA 1F4HA 2BVYA 4U3XA 1E5YA 5LG6A 3GYRA 1L7IL 4ODSL 5D7JD 4XH2B 1TDQA 3APCA 1S9XA 2RA1A 2V3FA 3K91A 4LLQA 3G3LA 3EDEA 2W81C 2CZNA 2VDOB 3DNKA 1YN7B 3T0EE 4ACTA 2XXMB 2IH1A 3E1ZA 2VL5A 3D2TA 4MQ7A 2V0AA 4WV1A 1BGXL 4LVOB 3ZVVA 3GSRB 4PJXF 1BIHA 2OR8A 1F4YH 4WGVB 1IM9A 5I18H 2V2WA 4Z7VE 5BCAA 2Y3NA 1KPRA 4KUCD 5M95B 1DYZA 2XWBA 4TSAH 1BAFH 3O11B 4NM8L 1H3TA 2VZ1A 2ADJB 3J07A 2VSCA 4OZFA 5C07D 5HI3C 1E2VA 2HT2D 1B3IA 2CM6A 5I1EL 4HGWA 5A2CA 1RU9L 3DPBB 3IJHA 3BP5B 3KYMB 3MRBA 4J3VA 1ZT1B 3OKLB 3VH8A 1WGVA 2GBAA 1CLYL 1ZWIB 4N85A 3H9YA 3UPAA 1N9PA 1BM3L 4WO4A 3ZRSA 1LP9E 4JDEA 5CKAA 3CSPA 1YEIL 4BUQA 1IGCL 1H5BC 3UPCA 3NACL 1NBZA 2UVEA 1WK0A 2NY5L 5DMIL 2ICEC 5DSCA 4LCUB 1QFPA 1UQSB 1HQ4A 4P4RB 5HVHC 1KCSL 1E2ZA 2ATPB 3AGVA 4NJ9H 2FEJA 4WFGE 1T20A 1KLFA 1R3JA 3M17B 3FU3A 3WGUB 1QRKA 5HDBB 1GY1A 1U3HD 4XXWA 1ES0A 4I1NB 4OQTA 2FSDA 4WO4D 4P5KA 1OOAA 4XNUL 1XGUB 4I8DA 4X99B 1BBJA 1YY9C 3LN4B 1R46A 1JGUL 1NDMB 2HJLB 1DJYA 1SXZA 4QI3A 5AOZA 3E6HB 1CMOA 1O9VA 2XZCH 1JHKL 2ZUUA 3KGUA 1KJMB 3K8LA 3QJSB 2AJVH 4ALAH 4XNXH 3DURB 4KKZA 5IHZB 4HWZA 1ORSB 4A2EA 1BBDL 1RIVL 2X09A 2H8PB 3CFQA 3Q2WA 4JM4L 1BYPA 3CMOH 4GAGL 3QDJE 3LAFA 4Z77A 1A1MB 4U49A 5HGHA 1KPVB 4BM7A 1OGPA 2WBJD 2FX9L 3JV0A 3W9DB 2ZP9A 3F7PC 1XXDC 3IFPB 2VO5A 2WUCH 1KFAH 4KC3B 5CS7A 3WFBL 1AI1H 1Q72H 2P8PA 1QNZH 3ZRCC 1U8CB 4ISVA 4WJG3 2ZWNA 3CPUA 5I1GL 4PG2A 3E0GA 3UL4A 4BKLA 2CE6A 5L7XH 1H8OA 3K6OA 4J2XA 3UGUA 2OTWB 5IQLA 4Q2ZA 4JZNA 2VN5A 2G30A 3FRPA 4YN3A 1GH7A 2F6AA 3BKCL 2RJMA 3PLYA 5E99H 3VGHA 3B6SB 3GBDA 4HUVA 1EGJA 1BQHG 1MNUL 4H1LB 4PP1D 3PAVA 4OKDA 3TLRA 1HEHC 1P7KA 2X9WA 1A3QA 3DOIA 2DF3A 4HHGA 4FQ1L 2X4UB 3C5XA 5B38A 2VLJA 4Y5XC 1GOHA 2XBTA 3GIZH 4OZIE 1P4IL 3H9SE 4D0CB 5DWPA 2MPAL 3OKKA 3DUSA 3RPIA 2B8OT 2BWIA 2X12A 3LIUA 4DFIA 4F8TA 3CQQA 3M1CA 5DD1L 1U8NA 2J5LB 5KYXA 2KPNA 2XKNA 5AZUA 3NSJA 3RY5A 1ASQA 2YD6A 4W68A 4ZFZB 3DHMA 1IJ9A 1U4EA 1W0WA 2ALAA 1XF3B 4KKCD 4XI5D 5DJDB 5DS1A 3VD0A 2VLJD 5GGQH 1ZRUA 3KLHC 1V3JA 3RJQB 2AJUL 3GSVA 1MFNA 4AZ8A 1IQDA 1R0AL 1TJHL 4KKRA 1FE8L 3QNXB 3HMXA 1C5BH 3CHPA 5EU3B 2MFNA 2QLVB 5ILTL 2DWSA 1KC5H 1XX9C 1TJGL 4I3RL 3QYMA 5E8PA 3RKDC 2UX7A 4NENB 4F3FB 3GSQB 4FXGC 3V6BR 1WWBX 2VDPH 4X7SL 1NDGA 1ZTMA 4FFZL 1NBYA 2EIZA 3RWHB 4L23A 5DQDH 3L1EA 4NNPL 1KY7A 4XN1A 4BUHA 3ZW3A 2G0KA 2VDLB 2QVKA 4QRUA 2Z7WA 1FC1A 2YZ1A 5EC1B 4CSTA 4KOCA 4NJAL 1JFQH 3DTXB 4KXZH 2HT4D 4P57B 4YDZA 3FOLB 4KKBC 2EDTA 3TOPA 3BW9A 5A7BA 1XWVA 4D8OA 3CQPA 4CILA 3GJFH 1S7QA 4CA4A 3CFBB 4UNTA 3TBTA 1OWRM 4G8GD 3SSGA 3L3DB 3B8YA 4BA8A 1P0SE 3OB8A 2LOEA 2JB6B 2WXKA 4BCXA 5I5RA 4LAQH 1UJ3C 2EUXA 1L9RA 1ETZB 1UM5L 3FFCA 1KGCD 4JY5H 4UT6L 4YBLB 4ZS7H 1LE9B 1N2RB 3NJXA 4UV4H 4KRPB 5TDPA 1AFVL 3IDNA 2YRLA 1FA4A 1EV2E 3U36A 3TF7C 15C8H 3D3VB 3H3PL 2PO6A 2WNXA 3BEWB 4H8WL 5TJWK 4N1EA 4CVXB 2GBUA 1TNMA 1G9NC 1S7VA 1NLBH 2X6MA 4YNYA 3AAZB 5HI3D 1IBGH 2BWQA 1I8AA 4HBCH 5HDBE 2WLIA 3N1FC 2L7EA 2VDLL 4RX4A 3SDYH 4OZHA 2FQEA 5DRZB 3VSTA 2PCFB 2EDHA 3DGGA 2MKLC 4KXBA 3W39B 2GIYA 3WFHB 4GW1B 4AJWA 5BMFH 5MEOA 1HINH 1H6FA 2FCBA 4JO1H 4HGMA 1A6AB 2DMKA 2Y06H 1YPZA 5I0VA 4LPWA 5C0JA 1UWFA 2EDWA 3VUAA 4UTBL 4TSAL 1WGOA 1BAFL 1IX2A 2GHWB 4Y1AB 2HVJA 4Z95H 5HGBB 5E94B 5FHBH 1E7VA 5E70A 2Z6FA 4NKMA 4RQQB 1X3DA 4XE0A 4EI5A 2L3BA 2WOYA 4RX4D 4M93B 4P9MH 4QRSB 4AQEB 3SDDB 4ZZFA 2NOYA 1MUJB 3QWNA 4UINH 2W65B 1IAMA 3AG3B 3OC8A 1B4RA 3MOAH 5E1AB 1EHAA 3L4UA 2F53D 4PQXA 4XMLL 4IMLB 2E56A 4HVBA 3ZHKA 1YEJH 2DL9A 4QRPD 2CKNA 4GMTH 4RZCB 5FYJH 4ABUA 5C6PB 2NW2A 3N41F 4H2AA 4R97B 2V2TA 4Q9RH 1FNGA 1RSYA 3IJSA 4UNIA 5BXFA 3LSOB 2C9RA 5E24E 4JPIB 4H26B 4JM2D 4Y0GA 2BCMA 2EQDA 4LT7A 4C56B 1AS6A 4K94H 4RA0C 5E2VH 1PNCA 3G5XB 4NJ9L 4BWUA 2N7SA 4MA8H 3B83A 1LMKA 1PTZA 3QH3B 4K9EC 3ZZSA 4F7PB 3PHAA 1JWSA 3JSSA 5DO8A 4XP4L 2AP2A 2D7NA 2NY7H 2RCSH 4WWID 3GPEA 2HXAA 3G5WA 3VDCA 3DVFA 4ORGB 2V9TA 3ZTCC 5BRZB 3PDOB 2NY0D 2JJSA 5CLZA 1GZHC 3MNMA 2OZNA 4UYQA 4ZODA 3REWA 3ZTEA 1U8LA 1WYJA 4XNBA 4LLVB 5L9DH 2OW6A 3KVQA 4RGOH 2JK5A 3IXTB 3V8OA 3QG7L 4N2OA 1DDHB 4LLAA 2OTUB 3SDCA 2PF6A 5E2UH 3KLDA 5C0CD 1IAOB 2X70A 4MNHA 1OAZH 1SFHA 3ARDB 3QR0A 4I2XB 1CVSC 2R69A 4I1RA 1MAML 3KWWB 3QRGH 4AGLA 5GS1A 4B53A 4PJ5A 4Y4FC 3MX0B 4YE0A 1CDHA 3C8HA 2C7FA 3HC2A 4N26A 1RUKH 2VQ1A 2DN7A 4J3UA 1XAUA 4KKLC 2CQVA 3ORJA 4WHTB 5KANI 1AI1L 4ODBD 1B2WL 4WDIB 2DTSA 4Z5RB 4UQ2B 3SDCD 2ITFA 4JRFA 2E0PA 2IPUK 1UT2A 3B9KA 4WHCA 3GXIA 1LEIB 2DWEA 4YHYB 5T33H 4HUKB 1N5YL 3SCMA 3EOYG 4UAOB 1PYWA 2VRAA 2P80A 4POZD 2CGRL 2IPKA 3BO8B 5A2LH 2PR9A 3DTDA 5JIMA 4P46C 2V2XB 4FE9A 3ZKXC 1S9XB 2CPUA 4UWQB 4Z3IA 3RB5A 4M6NL 1BEYL 4HU8A 1QVOA 2IH1B 3DOHA 5JOFA 4MQ7B 3MXWL 3QI9A 1MRDH 1MCQA 1LGVA 1N18A 3CFTA 1EZSA 3RTQC 5MEQA 3SCMD 1L9PA 1M05A 2Z0UA 4QRAA 1KPRB 2WYHA 3QEHA 1AC0A 2XWBB 5I1LA 1JPSH 4XPTL 1CPUA 1VIWA 1WAAF 4YBHA 2QHLA 1ZIAA 2JVUA 2QR0A 4DSYA 1KG0A 2VCOA 3O3BB 5G4OA 3CVHA 4ANWA 5JW5B 3HE7C 2HVBA 4X9IA 3IJHB 4KTYA 4FG4A 1EBPA 4LVNC 5ICXA 2YSSA 4L4VA 1HILB 5C2BH 4WO4B 1MAKA 2O30A 2X38A 3D3VE 1W15A 3GBNL 1UOWA 2WXHA 1M2VA 3N43F 2OR9H 5HDRA 1NBZB 5ITBH 1DLFH 1LHZA 3ULUD 1L7TH 3C6LC 5DSCB 4EIBA 4UQBA 5GS0C 1HQ4B 4ZJ9A 1T20B 1KLFB 4IW4C 5DQDL 1HFUA 1R3JB 4QRTA 1EAJA 5E9DD 3BVTA 4LOUD 2DM7A 3S5LA 3RPKA 2AVGA 2R29H 1ZA6B 2Z34A 4M8RA 5GIRA 1KULA 3AB0C 3G6AB 1JFQL 2FK9A 3U7YH 1YEGL 1Q9KA 4JKPL 3R7QA 3GF8A 4LP4A 3D4GA 2J20A 2VN4A 4HUUA 4L5FE 4POUB 4WU7B 1E5ZA 1RZJH 4KVNH 1EEYA 4L3ED 4N2FA 3VDAA 3Q5OA 4MAYA 2OTPA 2UZIH 3QRBA 3TEZA 4HWZB 3FS9A 3BGFC 4GP8B 3BZFA 5FYKU 3ULVF 1PG7H 1Y0LA 1NAMA 5MHSE 4XVSH 1XF4B 4LCWA 1NCWH 1FFPB 5EEZA 4JY5L 4ZS7L 3EYFA 3W0WA 3QPQC 2VR4A 3GXMA 3UAEA 3ZDYF 3O6FD 4LL9A 4IMKC 5BUGA 4PLKC 2JCCA 3H7BA 3KW7A 2E7HA 4QWWC 4C56E 15C8L 3KZ8A 4OM1L 5EO9A 3AS2A 4WWKD 4XO5A 2P8PB 1INQA 4TF4A 1JTTA 3JVGC 1R19A 2XFGB 4Y89A 4P5RA 3HR5B 5F6HJ 1IBGL 4HBCL 3RJOA 3THMH 3LKPB 4ATTA 2YXMA 4JZNB 4U0QB 4OQTL 5HVGB 3HHSA 4CL7A 3WNNA 3ASNB 2O1AA 2VC2H 1RZFL 1GS7A 1H9VA 1TZHA 1HINL 3T3MF 4W4OC 5AOLA 3KBHE 2Y06L 4HUVB 2Q3ZA 2UY6A 5L8KB 4PI2A 1MLCA 1YUKB 3I6KA 3QGVA 4DEUA 4ZW5A 1NEUA 4RWYH 3KH3A 3T0EC 5GISH 1ZD6A 1HVXA 2F18A 1JI2A 1GTNA 2VLJB 5FHBL 5F3BA 1RZQA 5JA8B 3BLKA 2B1AH 1CDGA 4I2XE 1A6WL 2EIMB 4ZQTA 3OKKB 3RPIB 3SO3B 5K9JH 5J1AB 3DUUA 4PJIB 3T04D 3IJEB 1A3RH 4LO9A 1PCXA 2DEWX 3NMEA 4IK6A 5EWIL 1OW0C 3BIKA 1U8NB 1X5ZA 5KYXB 3QZWA 5GRUL 3ARRA 2ETWA 3GC3A 1RHFA 4LNRB 5F0PB 3LXCA 5IHUL 4KX7A 3PY9A 4XR8C 3T2PA 1ASOA 3S36L 5F1OB 5TE6H 1NANH 4MWFA 1M3JA 1UCTA 1IEHA 1JGEA 5IVZB 5HHMD 4KXZI 5JXED 2BP8B 2JB5H 2WQ8A 4K94L 3S0PA 1QBLH 4D9RE 1KYOK 3GSVB 4AZ8B 5GZNC 1QR4A 1EAOA 9PCYA 3U83A 4LPVA 4YDNA 3EFDH 1R3HA 3OZLA 2Q2LA 3UJJH 3ATFA 4NP4L 3ES6A 5AB9A 1QLRA 5E8PB 5JW4N 5I9QC 4B9ZA 1MZYA 3TO4C 2AHIA 5C0BE 1NDGB 3MJ9A 1HZHL 2HT3C 1HYSC 1NBYB 2EIZB 2NY6C 5JHLA 5L9DL 2MQGA 5IB5B 2RB8A 4LL4A 5IK3B 2HKHH 2QVTA 4I0PA 4PTUA 2W88A 4QRUB 4LFHD 1OAZL 4Q52A 1IC7H 2NZ1A 4LSDA 4Q9QH 2I32A 5EUKA 4HIEB 4B9CA 2EE3A 4Z7OF 3FO0H 1V8HA 3FUHA 3MHZA 5G4MA 1YMHA 2YBRA 3D12B 4E9SA 4N5ED 3KHOA 3S96B 1S7QB 3U7AA 5E1GA 3TBTB 2DQHH 4EJ1C 4NFDA 1WD8A 1TETL 4R7VA 1YG9A 4ZW7A 5E23A 3CIAA 2O5NA 3K80A 5DMKA 4M00A 4I0PD 3V2AR 2ZICA 1VPOH 4XC1H 3OD3A 5ISZE 3CVCA 4BFNA 1P69B 1R9FA 3FFCB 3VTTA 1P84K 2GSGA 4F5CA 4IU2B 3RX9A 1JPGA 5TDPB 5JDJA 3IDNB 4PJGA 4XMPL 2MCMA 1AZNA 5DURD 1N4XL 2C1OB 1W72A 4NKDA 1G9NH 1S7VB 4YNYB 5IVOA 3OL2A 1CWVA 4PTTA 3WE1A 3HE6D 2WLIB 3ZSSA 2C9SA 4NQQA 4S1SL 2RALA 3CBRA 4OZHB 5DFVD 5DS2A 2AEQH 3DGGB 4Z7UB 3OKYA 3H2QA 1I8LC 1WFIA 3ZN6A 1YPZB 2DAVA 2F53B 4XP6L 1ML0A 3WUWG 1AJ7H 4KJPC 4OCWH 5KVDE 3TIEA 4QRPB 1JPSL 4U1NA 2HVJB 3LNDA 5E8NA 7FABH 3CFCL 4HMDA 4KAQL 1QWUA 4XOCA 4NKMB 3LV3B 3V0JA 2XVBA 3ULVE 1H3PH 2XZZA 1SNRA 4GYBA 4EI5B 3FMGH 4LQ1A 2X4SB 4Y19A 3T0AA 2P28B 4YK4C 3U2IA 3VI4A 4X4KA 4FAAB 1I1FA 2YRPA 5EU7C 4X6DF 2R23A 3ZDYE 2DQUH 4J3XA 5AL8A 1HIMH 1MCNA 2NY0B 1ZGLA 1MG2C 3B7RL 3MRFA 1B88A 1PAMA 2V2TB 2NW2B 2OR9L 3WELA 4N24A 1FNGB 1DLFL 1A7OL 2IANA 5BXFB 5JW3H 2NXZB 4AQAB 5B7FA 4M5ZH 3INUH 4W9JC 2GITA 2XC8A 2CR6A 3MLSH 1DCEA 5F9AC 3PHOB 4Y19D 2WCSA 1U21A 3WJLA 5C0CB 5CO1A 4K9EH 3JXAA 3WFCL 1E3FA 1JWSB 1ETJA 2VLLA 3MYJA 2MMXA 1EBAA 3QQ9D 3IMWA 2B16A 4RSYA 3O45A 4JFFA 2XG5A 1F42A 3KPSA 4OCNC 2R0WH 4A55A 3REWB 1Z5HA 1MLBB 1KGWA 2HX9A 3K46A 4YDVB 5FW6A 2HKAA 5ENWA 1U8LB 2P42B 2IAND 2VLJE 2F8IA 4CC0A 2DQ6A 2JK5B 5KJRH 1RZJL 3MJGX 1DVYA 4ONGH 4M6MH 1B0IA 2QFPA 3SDCB 4D7PA 2WHVA 1USZA 4MNHB 1TFHA 1PG7L 3BJLA 4JHBA 1S8DA 3I6SA 2IDFA 3LNEA 4XMTA 5GS1B 4PJ5B 2J71A 1NCWL 4XZ4A 4J3OF 4TL4A 3LRSA 3RDTC 5EOQH 2QQLH 3CX5K 3NZHH 3C6EA 5H8DA 4QTFA 1PLGH 2F1EA 4QYAA 4GSDH 2X4QA 3CX2A 4JL1A 1KTRL 3BPLC 3KM2A 4ADGA 5BZWA 3P69A 3N9GH 3HZMA 3OQRA 3B9KB 5BZDA 2DWEB 4L0PB 3CHOA 3THML 4PLOB 1MVUA 1MXGA 1E4KA 4P2RA 2W0FA 3NUKA 3SCMB 3MV7D 2XV2A 2MRYA 3ZTJG 1PYWB 3NQKA 1KNOA 3FQTA 2IPKB 4HD5A 4QHLA 4NP9A 4KQ0A 4P59H 4XC3H 3MFGB 4HH9A 4KDVA 1T03H 4ZFQA 1SLVA 5SX5K 4BSJA 2ZXAA 3UTTD 4ZX5A 1U8OB 4XNAA 5JOFB 1BM7A 2FH8A 1OPGH 3F58H 4RFEA 4PJAA 1T0NB 3D50A 5F3FA 4GP4B 5MEQB 4OUUB 4KOBA 4AYDC 3H54A 1M05B 2GCYA 4X8JA 4N8UA 4YH6A 3QEHB 3SBQA 5I1LB 1A9BB 4N2CA 3KYOA 1ONQA 2XY2A 5A2BA 2JQZA 4U2ZA 4K5PA 1KY6A 1RZPA 2QR0B 1KG0B 3GEFA 3D6GA 2R1XA 2NY6D 3PWLB 4YZFF 5A6MA 3CLFH 4JG1H 5IVXB 2NYZA 3FFCE 1TVDA 3L6FA 3GD1C 2F68X 3S35X 5ICXB 3NIFB 2QSCL 1I3GH 5AW9B 2DRUA 5FWRA 1MCDA 2DQTH 2FO8A 4KO9A 4D0BA 1L9MA 1T6VN 4X5PA 2EUWA 3V95A 1M2VB 4WI3A 3MDJA 5E4OA 1CR9L 3X11A 3GMLA 4DZ8B 3OHXC 5JZ7C 1V7MH 2QTEA 5ADPH 2XCMC 3F12A 5GS0H 1OAUL 4FADA 2QDVA 5ABDE 1EEUA 4XMZA 3O2VH 1LNUA 4QRTB 2XJLA 1X5GA 5LBSA 2B14A 5E4EC 4ZG1A 2HKHL 3K2UL 5E8DL 3TIDA 2HLAA 4GRWB 1RI8A 5I16B 3Q0HA 1YPZE 2AGJL 4RAUA 3N44F 1Q9KB 2DYSB 4PW4A 1CE6A 1LD9B 5DYOA 1TG8A 3CDCA 1SMAA 4AYEC 4PIRF 4K9JA 3FO0L 4HUUB 3ULUL 1TO5A 4OFYD 3NFSL 1EVUA 1EEYB 2ZOWA 3ATBA 3V4UH 2EDKA 1OK0A 4R7LA 2J5LC 3BZFB 3WKMH 6TAAA 4CGUB 4YSPA 1NAMB 3P9MA 2QBWA 4MJ6A 3MA9L 4LCWB 4OW6A 4XC1L 4G6MH 2RFXA 3EYFB 4LVEA 2PCPA 3W0WB 3VG0H 1RIHL 2EIKB 2JCCB 2R15A 2ZP0T 1PZCA 1RLWA 3H7BB 5FX3A 4DCQA 4HEPA 4Z3JA 5EO9B 1JDCA 3PUUA 2CBPA 4KK9C 2H2SC 3AWEA 1G9NL 4G6KH 1J5CA 4Z3EA 3O0RL 3WEXB 3SQRA 1TENA 4FQPA 4Y4HD 2LFEA 4QRRA 4WGKA 3ZJAA 3H42L 5JQIB 1ZKAA 1FZOB 1ROCA 2EDMA 5KJ7E 4FQCH 4FXKC 3HRZA 1TZHB 3NCFB 4YXLH 1E90A 1KB5A 3EW3B 1BYNA 2UY6B 2CO2A 3EH1A 5F1SA 4LLDA 4PRID 1MLCB 1IAIM 3I6KB 5F21B 2A3TA 3C5ZD 2QV4A 3RGVD 2XX0A 2YAHA 4ZO6A 1RJLA 2PWEA 5F3BB 5HHMB 1AG6A 3DKHA 1MCOH 5BVPH 1H3PL 5KOMC 5F97E 4UU9B 2EZ0D 1ZVSB 4PJ5E 5B39G 1FL5A 1N68A 5DC4B 3VXQA 1AKPA 4XRCA 4PD4J 3J27A 3D18A 3DUUB 1IT9L 4KI5F 4PUBH 3ZUCA 1A6VH 5D71H 1LO5A 5KSUB 3QZWB 3K2IA 1X5MA 1TTCA 2DWTA 1A4CA 4OFKA 4PYGA 1YZZA 4LIQL 4MWFB 1UWXK 4Y1TA 1JGEB 2Q3AA 1AOZA 3FSVA 4M5ZL 1KJVA 1HNGA 4A67A 3INUL 1TZOA 3G04A 2OCFD 2AS5M 2YBGA 3O0LA 4K3DL 2IBBA 3NVQA 2VO8A 4I4WA 1SPDA 4HHAA 4F15B 1R3HB 1KYAA 1NGYB 3ZZ1A 4FCAA 3LZLA 4E5XA 1UA7A 3P73A 5E8OA 3ES6B 1ZA3A 1QLRB 4OGXH 2H5UA 4BFOA 4DN4H 1MCIA 5KBPA 3VI3A 1JNNH 2XXGA 5DYFA 1CGTA 3DX0A 1UFUA 5DFAA 4KNQA 4K5NA 3LZOA 4EBQL 5BOZG 1QLEB 2KHAA 4I0PB 3TEUA 1WBXA 4AYMC 3RDJA 3KPOA 3Q8FA 1TJXA 1OSEA 2NZ9C 3D8MA 1HNFA 3TA4D 3VD5A 5DHMC 5EH1A 3L7FB 3EO0A 1F3DJ 4WCYH 2QQLL 3WEMA 1YMHB 3NZHL 2FL5A 5JPMA 5DURB 2IOIA 3TBYA 1LM8V 3KPQA 4EIZC 3GI8H 5FO7A 4YZFE 4Q74A 4ECNA 2FJHA 4NNYA 2QGBA 3NIFE 3VFTB 1J8HD 3HE6B 4HJ0C 1TTRA 4L4VE 5AZEL 5DMKB 3BIAX 5DD6B 1MFAL 3TV3L 3U4BH 3CVIL 4GO6B 3DVIA 1Y1UA 1I1AA 5KSAA 3T0XA 4OU3A 3FFOA 2GSGB 2IAMA 2XPGA 1JPGB 1GW6A 4PJGB 1HHIA 3UG3A 2IMMA 4PGCA 4EIGB 3HKFA 3MUGA 1W72B 4NKDB 4U1SA 5DJAA 4CAGA 4IEFA 1T03L 5DGRA 1ZLDA 4PTTB 1SHWA 4I18A 1QLEL 4N87A 3PS6A 5TH2A 1WTLA 3I75B 5AEAA 2KDYA 2F0CA 4FULA 1N0XL 4XCEB 2VWEE 2GJ6A 3QUKA 2IAMD 4I9WD 4U1LB 4BXSV 3GSOA 3T0DA 4BK4A 4G9DA 2BIOA 3DBSA 1PQZA 2C34A 2X1OA 1T04A 5DK2B 3TIEB 4U1NB 3ZKQD 5E8NB 4XNDA 1BG1A 1TZGL 4UILH 1M57B 4GMSH 3UABA 2GIMA 5DK0A 3S3SA 4X7FC 4JRYA 1JJUA 1SYSB 4LCWE 5J12C 1NMBL 3L3OA 2KQMA 4Y19B 3CLFL 1YA5A 3OSVA 3VI4B 4C58B 1I1FB 3WGVB 3Q9PA 2BVOA 3W0WE 1I3GL 2R23B 4MMXC 3OMIB 4UBDD 1QZ1A 2JCCE 4RGND 5GGTL 3WKNA 1K85A 4NN5B 4Y2DC 2J21A 2HJFA 1TMCB 1ZGLB 3MRFB 4FCHA 1DE4A 1W72L 1FLTX 3AXLA 2IANB 1UACH 3VFWB 3UZQA 2GITB 2BHFA 2Y07H 3FAWA 5ADPL 3R7RA 3E9UA 3FTSA 3O2VL 3KXFE 5C0IB 4HKZA 1SOSA 2VLLB 1ET5A 4L29A 2XX1A 3GMMB 1RUAL 1A21A 3MYJB 3EXJA 1IZKA 1F3JA 4A2GA 4XPGL 1WBZA 3O45B 1EAPA 2XG5B 2VMEA 2XETA 2WJ7A 1OB0A 4MHHI 1A4KA 2H26B 2X3AA 2D7TH 4URTB 2WZPA 4Z3FA 1DN0B 4WV1C 1RJYA 5C0RL 3T8MA 3FJTA 3SDXA 5IFAH 3ZOAA 1FC2D 1D2OA 3VQ1C 3V4UL 3WNLA 4QHPA 1UM4H 2LTQC 4Q97A 1DBKL 4MASA 3EF4A 2BS71 4PJDA 1S8DB 2Q2EB 2ADFH 4JY6A 4G6ML 5IESL 2RQ8A 2JJVA 3O3EA 1MH5B 4FNRA 3LRSB 4QR7A 4QTIL 1XZ0A 1AGFA 3TJHC 2JKLA 4JDZB 4OLXH 2VIRB 5GGSA 4ODUA 4U3SB 2WZPD 4XNZB 3QXAA 2J1ZA 1XBDA 1LYQA 3MYZA 4O2CA 1U8IA 4J12A 3VQLA 3AMKA 4CSSA 3MA7A 3UTTB 4R2GD 3HZMB 1AZRA 4F9PA 1OAKH 4JQIH 1OTTC 3FCUB 3N2JA 4XPFH 1ACZA 3O9WD 3BH4A 1EJFA 1LO4H 2IQAA 4FQCL 4KDTA 1KNOB 1Y18A 4YXLL 5EOTA 3UJIH 1JNLL 5JHBA 5AB1A 2ZX8A 4XXWC 4V33A 3NJLA 4HIJB 1MCFA 3D52A 1X9RA 5JHAA 4FQQB 5GGVY 3Q9QA 5FXCH 2WWOA 3WKYA 2X6VA 5SV3A 4YS4A 3II2A 1EMTH 1MCOL 2QVIA 3ZMNA 2O93L 2FAUA 3FH7A 1QSFA 3OXSA 4BDVA 4RFEB 4E68A 1IGMH 1A3LL 1H8SA 4PJAB 5IHWA 5DUBB 1JF5A 4Y5YB 3ZIMA 1PCSA 5KYNA 3FDWA 2GCYB 4X8JB 5DEZA 2C4FT 3G6JF 4YZWA 1A6VL 2OMWA 5D7SH 1J0JA 3KYOB 4XNYH 3ULVC 3Q48A 5I0ZA 1SMDA 2P24A 1MFCL 3VB8A 5T5FH 2VR5A 4TQ8A 4WZ9A 2XDHA 1JG9A 4I0KA 2R1XB 3PAZA 4XN8A 2N01B 3HZYA 3PFQA 1DSFL 3DGCR 3RLSA 2VZVA 5LGJB 3ETBF 3OMAB 4F5CE 3NN8A 2HAZA 1Q8MA 3QQ3A 4PJGE 2CH8A 1U2HA 4D0BB 4P49A 2Y1VA 3E2HB 2WUBH 2ZJSL 4PG2C 4FG0A 5JNYB 3B7YA 1P2CA 4KTGA 3X11B 2Z91A 1WQVT 3GMLB 2A9NL 1OP5H 4PGEA 2V6HA 1M71A 4HLZH 3F12B 3I84A 3OKEA 2BSSA 2HLFD 3MRDA 4UDUB 4WFEE 3P3RA 1WT5A 1QOKA 3UGEA 2OSWA 3G9AB 1A0QH 4NWTH 2OMZA 3TIDB 2WB7A 5CUSL 3ILQD 1JZ2A 4HF5H 2V17H 2VMCA 2WXGA 4RAUB 5F88B 1QO3A 3NPSC 3JWNE 4GIOA 3ABKB 5DYOB 4HWUA 2XG4A 3VRJB 4BHUA 4QXVA 4KTDH 2IALA 4BE6A 4ZD3H 2DMGA 4XCNA 2AW2A 3K71A 5JLZA 3O4LA 3SO3C 1N6QH 4WFHD 4GAYB 2OMBA 2NZIA 2VSDA 3VI4E 4E0RB 4WGWB 3QDGD 3SZ6A 4Y4HB 5EG6C 1DQVA 2BHYA 2DLEA 2ZYRA 3P9MB 1A7QH 4MJ6B 1N64L 4MS8D 5TQ2L 5IUCA 3FUEA 4MDIA 1OSYA 1PG7W 4LHUD 3U4BL 3RIKA 1KXHA 2RFXB 2ZSWA 3TJPA 2PCPB 3G5VA 4XMWA 3IRZA 4JGNA 4Y16C 3KPRA 3MLWH 2IANE 4DCQB 3S34H 4LSPH 3IGFA 1AMXA 43C9A 1TQUA 3C5ZB 4NGHH 4ZX3A 5AG8A 2VR3A 4AVJA 2QQNH 5JYLA 4OGZA 2CCVA 3PWNA 4MJID 3MLXH 4JEGB 3CUPB 5AVSB 5AD0B 5E0FA 3WLBB 1WVZA 4JFFE 2PUQT 3R19A 3KPSE 4RA3A 2DWDA 5AVUB 3F84A 2JI2A 3I6GA 2WMPA 2C1PB 2G75B 2MCPL 2AEWA 4IK7A 3WTWA 4LLDB 3MLUH 1MCJA 1VCBC 5J6SA 3X12A 4R4ND 4C83A 4UILL 2Q86B 1PD6A 3AREC 1D9KA 2QKSA 4GMSL 2YA1A 4K7PH 2NR6A 2X5PA 1FH5H 2W5PA 5IQMA 1FYHB 3U9PL 4K15A 3LZRA 2WKOF 1MFUA 2HJKA 3CPLA 5EOCJ 1MPAL 1FL5B 3VXQB 1KCUL 3ATEA 2BVQA 1WWWX 4D2NA 1HYRC 4IGBC 4N5UA 4QLRA 2Z4QA 4UT7L 3HFML 2K9UA 2V4LA 1ZMYA 1KPUB 3UJTL 3WS6A 2AVFA 4Z7NB 5EEUA 2DQIH 4JPQA 3ILDA 1ECYA 2UXGA 3AC0A 2NR6D 1KJVB 3KPMA 1MI5A 2ICWI 1BFVL 3G04B 4RH4A 3MJWA 2Y07L 2WQSA 1W80A 3IU4H 4QHKI 5DMGC 4P2RE 2PO6C 1BQHA 4IIQA 1D7BA 4UTAA 2Y7OA 1IIIA 4I4WB 1RZIA 4HHAB 1GPOL 4TOYH 1KLGB 2VYRE 3P73B 5E8OB 3V6OA 3PF2A 1UGNA 2OL3L 5F7FA 5CCJA 4JHWH 4NIYE 3VI3B 4AEEA 4GEJA 3FN0H 5E08H 2D7TL 4MGXA 4M3JA 4EZMA 3LZFH 4I3GA 4M6OL 5IFAL 5FM4A 1J8HB 1MHCA 2X2IA 1L6XA 3QUHA 4PJAE 3PHQA 1WBXB 1UM4L 4P2QD 5B1JC 3KPOB 4X5LA 1IGJB 2B0SH 1JUFB 1U30A 1NGXB 4CJ0A 4EI5C 4KUZH 3EO0B 2IWKA 3P77B 2CGZA 3WYRA 1MJJA 2FL5B 4WU5B 5AOJA 1L0PA 1RK1A 3KPQB 4YLQT 1NLDH 4AOFA 5FO7B 5F71A 4FI6A 2G0LA 2JNZA 4LSRL 1FLRH 2FJHB 4NNYB 3TBVA 3S37H 5FA4B 3ABGA 4PJCA 1S3RA 4B9FA 5KYUB 5EF3A 3KD4A 1H3GA 5I76A 1OAKL 4P9HC 1CFVL 4JFDD 2NXZC 2E4TA 3QJRB 4NKOA 4QT5A 1CUOA 3H7LA 2IAMB 1OLLA 3HNSH 1J5HA 1HHIB 4UDTA 2WLLA 3KYAA 1YEKH 4PGCB 3UJIL 2H32A 3MUGB 4KX9A 1AG0A 4U1SB 5D2NA 3AW5A 5D2LA 4IEFB 5SWSD 3IDUA 5G2NA 2D7MA 3RX8A 1VA9A 4IBYA 4CMMB 5F9WB 3CFKA 3TP4A 1YYLH 2XJKA 4ZUSA 1SXAA 1X4ZA 4I18B 1GJIA 1EMTL 3AQZA 3I3DA 3OLDA 1SLXA 3MRHA 4M48H 2HFGH 1IGML 2WQXA 3QUKB 4RGNB 4AI7A 4KKPA 3E1F1 4G9DB 1PQZB 2QEJA 1K5NA 5D7SL 4M7ZC 2YEZB 4NLHA 1E4WH 4BZ2H 3IFOB 3NSDA 5DK0B 4X98A 1A6UH 1TPXB 1QI3A 5JHDA 1I82A 4JRYB 1S5IH 2YN3A 1NMAH 3AQYA 3L3OB 4J3OC 3X3GH 5IEHB 2IMNA 2IBZX 4WY7L 2UVFA 4PLJC 4QXTB 3ZHDA 4AIZA 1J9SA 5CZVH 1OZUA 4KJQC 3U9WA 3HC4H 4JO8A 5DUJA 3OPZH 2HJFB 2WUBL 2VZTA 2F8OA 1Q1JL 1A6PA 3B9KC 2YSTA 1DE4B 4Y4KC 5CP3A 5FW7A 3UO1L 3MV01 3UZQB 4QRRE 3TCLA 1BFTA 3Q8CA 3DSNB 4RISL 4GXUN 4L3CB 1IGFH 4HKZB 4L29B 1A0QL 2GC7C 2H2PD 4QYOA 1GC1L 1F3JB 3F8UB 1OT1A 5C86A 4G6FB 1WBZB 4OCYL 1EAPB 1I85A 4WEBH 4LESA 1NEZA 1A4KB 2IGFL 3KBPA 4HKBB 4GAFB 3QI9C 4P4KA 4PYHA 2XXCB 4ZD3L 5IJKA 2EXWD 2WLHA 4ZDHA 3SDXF 3TT1H 1RJYB 1N6QL 3LNFA 4NRXA 3TTSA 1B4LA 3C09B 4NN7B 4R2GB 1ESOA 4PJDF 3KE0A 4Z7WF 4J3TA 5SWZA 3V0AC 3U9UA 3PPEA 4OZFH 4AV0A 3O9WB 1KJ3H 3EOTL 4JY6B 3MBXH 3O3EB 4QY8A 3WY2A 1SJXA 1U36A 4Z7NE 1AGFB 2YZ8A 3TGXA 3CTTA 2OMXA 3HA0A 4ODUB 3S48A 3WNPA 4N0FB 3LKRB 2WXJA 3QXAB 2Q7NA 5HDOA 1FPTL 4O2CB 1U8IB 1OF0A 3SBPA 4JAMA 4EKXA 3CMGA 1J48A 1WC7B 4B9KC 4WTZG 4BWTA 3DYOA 3MLXL 3TCXA 3SEPA 2IF7A 2VOTA 2NSXA 2IQAB 1UB6B 1SEQH 4EDXA 1Y18B 2BVTA 5CIPH 5EOTB 4GRMB 3BDBA 4M03A 3BQUD 1XR8B 2HRPH 2LE9A 5DVKA 4WK0B 1DQTA 2VWEC 4H20H 3RWGA 3GXNA 3OXSB 3OAZK 2EE9A 3Q8AA 1X5KA 4JR9L 2YPLD 4MAYC 3CFDA 3AY2A 2ZUQC 3IJ9A 2KZBA 4NFBA 2OMWB 5J13B 4L8CA 3UC0L 2CLVA 3ULVH 1BOYA 4ESKA 2P24B 2I9TA 4XVUD 3QISA 3TT3L 3DXAA 5FYKE 3FQ1A 1SBSH 4OCMC 5CCKH 1W6WA 3T6XA 1OB1A 5E5MA 5IUSA 5AW0B 3HZYB 5DJCA 1OM3H 2ZYSA 3AU0A 3T09A 1DCLA 1NPUA 4ZPVA 4K8RC 1R6VA 2YGOA 1NPJA 3IU4L 3NN8B 4O9HL 2XIDA 3QCTH 3QQ3B 3QHZH 3EHBC 1CD9B 3P30H 1CD1A 5C8JA 4XMVA 3DIFB 2DM3A 3RAJL 2B5IB 2NX5A 3CLEL 3NCYS 4OF5A 4KMTL 4TOYL 4OLYL 4ZOCA 4H25A 5DU7A 3T6VA 5LJYH 3D4ZA 1I3RB 3N04A 1WO2A 4TSBH 5I19L 2ORBL 4NZUH 4JHWL 2Z91B 2RQEA 3BH8A 4R5XA 4XWGH 4NC1C 2YPVA 3FN0L 1M71B 5HI5C 4ZAKA 4XT1C 3ZL4L 1U58A 3OKEB 3MRDB 3APMA 1UB5A 3QDGB 4LOFA 5AWNL 1EGJH 1OGAA 2GAZB 2FGWL 3BDYL 3OB0K 4OF8A 1UXSA 1S3KL 2GJ6E 4KMLB 1UGKA 1L5GA 2NNAA 4PJ9A 3DOSA 4NQDD 3T2LA 1IKNC 1QO3B 2AFNA 4JREC 2NX5D 3QJXA 1RCYA 2IFFH 1OTUC 2OMUA 1EUTA 1WUZA 1MIMH 2LV4A 3GLZA 2XG4B 3FUMA 3K71B 1KJ2B 2ILLA 2Z8WC 3IGAA 1UHVA 3O4LB 4JRYE 2FYVA 4QXGL 5JLZB 4ZAKD 3HLAA 3MC0A 4RDBA 4MAUH 5EORH 4KI5C 1U95A 3TNMA 2WQAA 4BUGA 1KXVC 2VISA 1XL6A 2AK4A 2OKMA 5TQ0L 1F4WH 3BSZA 2BSBA 4EQ3A 4MDIB 1T1WA 2ZXGA 3D25A 2ZSWB 5I1IH 2E7LC 4CJ1A 4F1SA 1KSRA 3NP4A 5L2KD 2ZQKA 43C9B 5DD5L 3L4ZA 2YLHA 4F15C 2MHAA 1QAWA 2Q20A 5E9NA 4D7BA 2C3GA 4FS0A 1QQDA 5I8EA 3D30A 1L0YA 2D3NA 3DWTA 3RL2A 3C60D 1UT9A 1XF5A 3CE1A 1MRCH 2X2UA 2DWDB 2FEDD 4TN9A 1DJZA 3C12A 3I6GB 1K8IA 3IDMA 4AJVA 2WMPB 4YBQD 1GR7A 1SVCP 2OXGA 1KJ2L 1BMGA 2H4EA 3SDXE 3WNMA 4C83B 1WS7A 3MNVA 4Z3HA 1NCAH 1D9KB 4HFUL 2TAAA 1AYRA 4BZ2L 4OM0H 1A6UL 2NUTA 2P47B 2FYYA 4PJDE 1JNHA 2OCCB 1OCCB 3NCBB 4KY1H 4PJEF 4QTHA 4MCNA 1NMAL 1SFDA 2HJKB 1YNTF 3CPLB 1S9WA 4F8OA 3MODL 4ZFOA 4UANA 1MRFH 5AAPA 3KBFA 1A8ZA 2VXSH 5KAQG 3FHAA 5D70L 1MQKH 3PQYA 3EOAA 2WYTA 1D7FA 3HC4L 4AIEA 2RIKA 1JV2A 3BUPA 4ZMNA 4G5ZL 2R51A 4EQ2A 3PL6A 2BJMH 2PPFA 4PCSA 2A5UA 4FQXC 1KN4H 4ZFGH 2EC9T 1MI5B 5FIEA 4H0IA 3BXNB 3L17A 5IMLA 1BQHB 4IIQB 3BVDB 1XIWD 4KO5A 3FQXA 1RZIB 2B59A 3MBEA 3PQYD 1TVBA 5HJBA 4AIOA 2H47C 4OD2B 2P1YA 5HPMA 2I27N 4G7YH 3X13A 2M83A 1SHMA 2WLYA 4OFDA 3VYOA 4B97A 2B15A 5AOKA 5I71B 1QSFE 1U8PA 3NSXA 1MHCB 3T9WA 3T0BA 4KHXH 3UERA 3LRMA 3PHQB 1IE5A 3DV4A 3WU1A 2DQGL 3NQIA 1T5XA 2AJ3A 1PGRB 4M62H 4N2MA 4CMHC 4AMXA 2YAFA 5HDLA 2VQ4A 5F72S 4IKJA 2FJUB 1KJ3L 1WFUA 4KJWC 1BJMA 2WQWA 4HXAH 4L9LA 1MJJB 2VLRE 5DHVH 3N1GC 4KJYB 4FYQA 4NO0A 5SWSB 4B0MB 3UEQA 4PWJA 2H0PA 3TBVB 1Q0EA 3LYRA 2YN5A 4MSWA 4PJCB 4JKMA 4NXKA 4JFHD 3EBIA 3BWAA 2AEIT 5I76B 3EJZC 1TXKA 4ODXA 3WNOA 4K4KA 4P9HH 1G1CA 4NKOB 4QT5B 1XQ4A 4NWUH 1N3NA 3X1BA 4LSTL 3KDPB 5LO7A 1XL4A 4LDLB 4UDTB 2WLLB 4J4PD 1XTLA 2F5BH 4KK6C 4WFHE 4U6VL 2H32B 1GS6X 1ZLVK 1BA9A 5D2NB 5D2LB 5IEKA 1RZ8A 2AJSL 4NO0D 4HOWA 1FN4A 4E9WA 2R4RL 3CFKB 4ZUSB 1CLOL 3UAFA 3KH4A 4TPRH 1LO3L 4KKAC 1UD6A 3UGXA 4X7CC 2WW8A 1EH9A 4RCAA 3RFRA 4BRVA 1BMWA 4B60A 4TUKH 2AQTA 1T21A 3KCPB 3QUGA 1NIBA 3O4LE 1K5NB 1OARH 2OI9B 2L7JA 4BQ9A 1WRFA 2XTSA 2FWLB 3LJ3A 1UKTA 1ERNA 1IU1A 4NQCD 4J3OH 4OGAD 1KCLA 3VFUB 4PEEA 4G80B 5HHVH 1WIPA 3HPLA 5E6RB 4AIZB 5ECGA 4NB7A 3KPRE 4PVLA 1R17A 4NRYB 3QHZL 4G42A 4GQPH 3RJDA 3IAGC 1EK3A 4F2MB 4K7FA 1LO0L 3BAWA 3GRWL 3ZZLA 2UWEA 4MCMA 2VNCA 1AQKH 1GJUA 4LSUH 1J11A 4FNTA 4TSBL 3GS0A 4NZUL 5C09D 5KZCD 4FABL 1J0IA 3S3DB 3TCLB 4FXTA 1THAA 1E6JH 3WD5L 5I0XA 1JYNA 4KI5D 1E9OA 1SY6A 4IJTA 3GMPA 2X87A 4DPAX 3WUWA 3CFEB 4AQZA 1AP2A 3EUUA 3IBEA 4GNKB 1D5RA 5A16A 4MB4A 1MNNA 4AVHA 4G1EA 5I24A 4FG6C 3H3BC 1MFDL 2TRHA 1AHWB 4J8QA 2R9HC 5E6YA 4KK8D 1B4JH 3BZDA 3ENEA 5LWYH 1QFWM 1MIML 4NN6B 1S7TB 4WI8A 7PAZA 5IFHH 4P4KB 5AW2B 3RB7A 4ZDHB 4DQOL 3NZ8A 4NRXB 3VM5A 1U8HA 2WWNA 4H0HB 1RL1A 2KPWA 5EORL 5ETUA 1CYWA 3VSUA 4CADA 4DAGH 3GK8H 2FHBA 3U9UB 3MUJA 1Q38A 3IE4A 2D8KA 1RZ7H 3CVHH 2L0DA 1BQSA 2G5UA 4HIHB 4DP0X 4IBVA 2CKBH 3FU8A 4HCRA 1AR1B 3NOIA 2OMXB 4B9PA 2KT6A 5ESAA 1WFOA 4MNQA 1GCFA 5L2JB 3SGJA 2ZONA 2R4SL 3A5VA 1MI5E 3CDFA 3V7AE 2ROXA 3BIBX 3BT0A 2OJEA 3E2HC 5TF1H 3QJHA 2X0WA 3X17A 1H9DA 1XMWA 3QUYD 3MVSA 4O00A 5I6XB 5KVGH 4A6YA 5CLXA 4KO6A 3VD2A 4P2OD 5HYFA 4Q0XH 3NEOA 3V6OE 1MRCL 2YPLB 1NWPA 4EDXB 1U8JA 5DZVA 3ASOB 4CVZB 2MTAA 3DRQA 4FLRA 4ODHL 1UZGA 2EIBA 3O3UN 4L1SA 3L3IA 5CGBA 3GSWA 1NCAL 3SE3A 4BZ1H 4FQXD 4PJHF 3IS1X 4OM0L 4NHUA 3RZWA 4AJ0A 3RWGB 4XO3A 3TZVD 4PS8A 1UUNA 2EDDA 4PJ8C 5IROA 2BNQD 4PCTA 5A2JH 3QQNA 2WBWB 5FECA 1YN6A 4FFWC 3FAXA 5LNEA 4FHKA 2W38A 1J8RA 3L54A 4G6AD 4L8CB 4WK4B 2A0LC 2X6UA 2CLVB 3FPYA 1J0KA 1XF1A 1DFXA 1YLBB 5DR5H 3VFVA 2JJTA 1QYGH 2ZG2A 1H19A 3DXAB 3APDA 3L7EB 2BJML 3M8OH 4PJCE 1UXMA 3MAWA 3HI6H 5FFLA 5E5MB 2HG0A 1GYVA 3F7VA 3GI9L 4WVRA 5DJCB 3SODB 1GSMA 4ZPVB 2ZCHH 3QAZC 4K8RH 3VXRA 3FO2A 5IROD 3EYQC 3S98A 5J11B 5GZOD 1CD1B 4NQDB 5C8JB 1Z3GL 1Z9PA 3UADA 4ODWA 1FV1B 2E6JA 2NX5B 3SGKC 4HGKC 4H25B 5HGAB 3FCTA 3IXAA 5D2LE 4JCMA 5D93B 3BH8B 3FT4A 2BDNH 2O61A 4G7YL 2EINB 4Q14A 2VB5A 4ZAKB 1T6BX 3HRZC 1U58B 3WAJA 1EZVY 1UB5B 3RVUC 4ABWA 1OGAB 4MA3A 5HDWA 1UXSB 2AZUA 2NPLX 3AU1A 4KHXL 4NZRH 3DARA 1L5GB 2FNBA 2NNAB 5HYSA 4PJ9B 5GRVK 3LPPA 4J1UA 4OAWA 4M62L 4YJZL 3AT9A 5KBDA 1YEDB 2OMUB 2NXYC 1ZLUH 3ZE1F 3LNIA 4U2YA 4RAVA 1AO7D 3KW8A 3OKNB 5JIIA 5JHDE 5L2KB 2K8MA 3IGAB 3CAFA 1MCBA 4LEXL 2DBLH 1CDIA 1E28B 3HLAB 4JDVB 1DTUA 1BZ9A 1U95B 3TNMB 2H0EA 3CQFA 5IWLA 4FEIA 4NUQA 5E5UB 1WPCA 3ZGIA 1M9WA 2VISB 3LTVA 4AEHH 4ZXBC 2AK4B 3WSQL 2E9IA 3QZOA 4MZ3A 5DLLA 3ATAA 2EDBA 3QUZA 3WXVH 1T1WB 1R3LA 3D25B 3K8KA 4U6XB 3MKGA 2H3NA 4URKA 4YFDB 2HG5A 2XTJD 5BW7C 4XZUA 3CJJA 2F5BL 2FD6H 2YPVL 1SQMA 1QP1A 4R84A 1B0RA 3I50L 2MHAB 4ZI8A 1SN2A 2FO4A 2Y5TB 3JVFC 1QQDB 5I8EB 3SJVE 3FOMA 3DX8A 4YPJA 3RL2B 4F24A 3QUZD 3UACA 1XF5B 1NUNB 4FX5A 3VGDA 3MJ9H 4A7SA 3LCYA 4J7RA 5A2AA 4WLCA 2BIHA 5L6YH 1UXLA 3FB5A 1K8IB 3O6ML 3CZFB 3NH7H 5ACMA 2OXGB 1OARL 3WFZA 4V2BA 5I26A 3QR1A 1MEXH 1NAKL 3UBXA 5SWZE 1JNHB 3BD5A 5F2FA 1EFXA 4X6CF 4ZFOB 3WDHA 3BSZL 4TVUA 5JPMC 1IMHC 1UG9A 1XIWB 1K4DB 3IFLH 1ZHKA 4TVPD 1JOIA 5F1NA 1PPIA 3GZPA 3PQYB 4XWOD 3EOAB 4I89A 4JS7A 1L0XA 1YNLL 1TYRA 2R9HD 1JV2B 4EDWH 4N90D 3CWGA 3SO5A 3ZE2F 4PGDA 1AQKL 5HDQL 1F6AA 1I1AC 2DDQH 2PP7A 2XXFA 4JJOA 5KSAC 3QAQA 1HXYB 5CFHA 3B3IA 4TULH 2FVNA 3BKJH 3ARWA 3LRGA 5I75B 3EGXA 1T0PB 1EFXD 3BWZA 3LKNA 2EVJA 3B7UX 2A9MH 4TLKA 3DDFA 2YRBA 1BD2A 3RVTD 1WAEA 3LRHA 2J44A 2R1WA 5KSBA 1YC8A 4I18C 1ORQA 1FL3B 1MVFA 2WXOA 1JVLA 5HPMB 5D9SA 1EDQA 5B39A 3MFFA 5LWYL 2OS7A 3X13B 4MRBA 1FIGH 1KDIA 2FX7L 2D7QA 4JQVA 2XSKA 2X3CA 1BQLH 1A4JB 4GXUM 3QHFH 1U8PB 2EDOA 4Q4EA 3ARGD 5HHNB 5EBWA 1ROWA 2BC4A 2H1PH 2Q7AA 1AKJA 3DV4B 4GKZA 4JUSA 4K0OA 3GO1H 1T5XB 3ZL1A 4MCZA 4DHLA 2VTFA 3P9LA 3NDZE 1SM3H 1RZ7L 3QZLA 3O6KH 2NT1A 1UWGL 2CM5A 2J3SA 3FO9B 3DXAE 3VYNA 2CKBL 1AZUA 3KBEA 1V5JA 4P3CL 4Z0BH 1ZCRA 5J1TC 3P4NA 1RUPH 1IEBB 2CXKA 4NO0B 2F15A 3QUMA 5GQBA 2WNKA 1ZVNA 3FUJA 5TF1L 2JELH 4HQQL 5BNXD 4MSWB 3M88A 3VWJA 1ZSDA 4PB0H 1AKJD 1OP3H 1MW1A 5KVGL 1CIDA 1BVLA 3KHQA 3HKZA 2NX5E 4N0YL 4MVBD 4PJ8D 4ODXB 4ZK8A 1DQQA 1WCQA 3IN0A 5FCUH 4NBYB 3UTQA 3WKQA 1N3NB 1A6ZA 1AZBA 1O5DT 3CHSA 4NQVB 5E8EB 2NW3A 2WANA 5FO9B 1SN0A 3UAAA 2IXQA 4EUPA 1CVRA 5CD5C 1D5MA 2A0LD 5AL0A 1IQWL 1VZHA 1J7VR 4A1RA 4L1BA 5D7LA 4E9TA 3IS0X 1RZ8B 5IEKB 2Z31D 5C70A 1FBIL 1OGAE 2Q1EA 3IWVA 4UNUA 3U4EA 2IQ9H 2XV6B 1YJDC 3HG5A 3QW9A 3CSYB 4BZ1L 1Y7VA 3EJJX 4MBRA 4KZCA 4K55A 2FZ3A 4D3CH 4RDQG 3ZE1E 1DL7L 2DQEL 4FMFA 5H37H 1UT1A 3B2PA 3HHRB 1FI8C 3BN9C 2WD0A 3AMLA 3LZPA 4HWNA 4XCFH 1Q9WA 5BPPA 1QYGL 5C09B 2YKLL 3RY6A 1CF1A 3ULSA 2AK4E 2AAVA 1KCRL 1SXBA 3CV5A 2ZCLH 3MKKA 3QARA 4W9DC 1QR1A 5K69A 3RRQA 4R7DA 3HPLB 2ZCHL 1JAEA 1FFRA 3UYRL 4ZMLA 4OZGF 2Y6SC 4DUXA 1GTFA 1JN6A 3CFJA 4G42B 2F2HA 1ADQA 5GHWH 2ISDA 4MQXC 1IAIH 4PRNA 2VDRH 1REIA 2UWEB 3ARFA 3EJTA 4F9PC 2PTUA 1BF5A 4GKSB 4F91B 4HSQA 1NC4A 3ECBA 4XBGB 4DEPB 4GUQA 1N67A 3WS3A 2BSTA 2X2JA 1DANT 1E9OB 1M56B 3WUWB 1V7NH 1AP2B 1SJMA 2FSEA 1JSYA 4X5XA 5A16B 3X3FH 3ZYOA 4NHCL 4NZRL 1J8SA 1O6TA 3L95A 4XTRD 1J1OL 4LASH 3FQ4A 3CN0A 3A67H 1TTAA 1JDDA 2XU9A 3K4DA 4ZNEA 2YUVA 4IU3A 1T7WA 2DYPA 5TPWH 1XB8A 2DKMA 3P0YL 4JFEA 1U8HB 3NFNA 1DVFC 2C4FU 4MQTB 5ETUB 5I82A 3GSNB 3N55A 5J13C 4OJFH 1TT6A 4DP1X 2YGVA 3QUYB 1YHPA 4X4YA 2X4RA 4CADB 1G7PA 3PGDA 4P2OB 3VX0A 4BH7B 1IFHH 1NC2A 2OQJA 3WXVL 1EANA 3IDXH 2DLGA 1CE1L 4M8UA 2E59A 3BP7A 5D1ZD 1OPOA 1PZBA 1YEHL 3TYGH 3VGEA 4M3KB 3O3DB 2CCLA 5ESAB 4MNQB 3CLWA 1X9QA 3O8XD 5JQ6L 1XH0A 5HHXH 2PNDA 4JFED 2OJEB 2IDSA 2IEPA 3QJHB 5ECJE 4LSVL 4U6YA 2ZOOA 4AM0A 1SQ2N 4A6YB 3TZVB 2CO4A 2NRDA 1PX4A 2R0ZH 5EDXA 3ZU8A 3QJFA 2BNQB 5EUOF 3LN5A 4HPYH 3SKUD 2VLKA 3QIUD 1U8JB 1FFTB 1JD7A 1T66C 5J9PA 1G7IA 5L6YL 1WT5C 3DRQB 3D85A 5IQ7L 4NERA 1C9SA 4RRPG 3NH7L 2OFQA 1O7DE 5LBGA 3L3IB 2AMUA 2DM2A 4OCXH 5A3IC 3GSWB 5TE7L 3UPRA 1NTDA 3MV8A 1VESA 1TTUA 3GSNL 2DI7A 2VUOA 5CEXA 3P3TA 1BIIA 2BOBA 3OZKA 2OYPA 1JZDC 4W9CC 3QWRA 4Y5VA 1O75A 2O6EA 4PHXA 1TJIH 1J9RA 1YN6B 1JZIA 4GUPA 4UT9H 3IFLL 4N2NA 2AJZA 3IWUA 1WA2X 3TA3C 4YDLC 5BOJA 1M2OA 3D85D 5DJZA 3VFVB 4PBWD 3MCYA 2BRQA 1S6NA 1E8XA 5D6DC 5C0DA 4YC2B 4IRZL 4OLUL 2KBGA 5CZXD 5J57B 4MJ2A 1FG2A 2DEXX 2WXRA 4TULL 4Y88A 3DETD 3CFUA 2AAAA 4WUUD 1E9PB 3FO2B 4Q8BA 1DQKA 5DUMH 3X14A 2K4AA 3V4PA 4PJBA 1FYTA 3DDGA 3ROLA 4ODWB 2EYTA 1P53A 5C0AD 2VQUA 4GP5B 3QORA 3FCTB 4M1CC 4OFVA 5EEVA 5KN5B 1F4AA 1OY3B 5F1IA 5H2BA 1AO7B 2MOGA 3CZEA 2J7LA 3IF1A 2O61B 4LLMA 3QRFM 1FIGL 1KB5H 2F54D 4PRHD 2QELA 5AVZB 3EO9H 3Q05A 2V7NB 4HG4J 2UYLA 3AU1B 5CJXC 3W81A 2H6PA 4GXFA 3DMMA 2EUZA 4N1HB 4OAWB 3P4MA 1D9KC 5CJQH 3QORD 5C3TA 4RAVB 1ED3B 2XTJB 4HCIA 1FCGA 5CKGA 1MKFA 4V11A 4L1HA 3RIFK 4CSZA 1JRHH 1RUPL 2P5ED 3L2MA 4GRLA 1UYWL 3FUDA 4EOWL 1BZ9B 2R1YA 1C5CH 4PH8A 5JMRA 1FVDA 3WS6C 5SV4A 3I9AA 4P5TA 5CEZD 5I1JL 4N2KA 3LH8A 4PB0L 3SKJH 3QUZB 4AC2A 3DMMD 3HB3D 3OJ2C 4JO2H 4Q4IA 5E5RB 4IIZA 2UWEE 1HHKA 1WE5A 2XFXA 3R8BB 5FCUL 2H3NB 2Z0BA 1A3ZA 1FSKC 1RP9A 2PR4H 1X5HA 1P7HL 3QNYA 4X8GA 4XZUB 2DEYX 4IIQC 4OIIH 1FQ9C 4XPHH 3BX7C 1QI4A 1URLA 1ND0A 2I7OA 3T4AC 5FLUA 3P0GB 4OV5B 4AGMA 1HOEA 4A7GF 2FO4B 4FGMA 2D73A 2P8MA 4K7PX 5C0EA 3QS3A 2X3BA 5D1XA 5MP6H 4PD4K 4HETA 4J3WA 5D1QC 2XV3A 1U6AH 1UA3A 3B9DA 1IL1A 2D7OA 2N0MA 5ALBH 3T2QA 1NGQL 5GS2H 3I6LD 4BFBD 1AGCB 2HRLA 5I15L 3GUTB 3MNDA 2KS0A 3VXPA 1QACA 5KVEH 2OJZH 2XACC 4NUJB 1G87A 5DUPL 4BSVA 3ZHFA 4XCFL 4H88L 4Y9FA 5DFWH 1UZ6F 4JO3L 1KN2L 4WI0B 5DVOA 3OPUA 4UQDA 2EDYA 3P4OA 4W1TA 5F7KC 3TEWA 3KLAA 1EFXB 1S9VB 2ZCLL 2O6DA 1JE6A 1VKXA 1UD2A 1A14H 1P7BA 4PV8B 4BD4A 3M1BA 1XCXA 2ZT9C 1DSYA 3KR3L 2XA8H 4MNQE 1II4E 5FYKH 5GHWL 1QNIA 2CRYA 1IAIL 5J4MA 3PUCA 1F6AB 1QBBA 4PJ6A 3N5AA 1MF2L 1K5WA 3R18A 5KUMA 3B3IB 2PMZA 3NZSA 3OKDA 2G2RA 2WXMA 2ZSVA 3EGXB 1DVFD 5DJYA 2WN3A 3PYCA 4GJTB 3BT2H 3QNZA 3LKNB 1V7NL 1L9SA 4L9DA 4BQCA 1BD2B 5DD3H 1X5AA 4H0LC 4TVPL 2R1WB 1NCGA 1S7XA 5KSBB 2EE2A 2APTA 2V5MA 1OAYL 4OF6A 2B1HH 2GVYA 3SQOL 1ORQB 4AQ1B 3K5SA 1MHEB 3QJOA 4F37K 5B39B 1T7YA 3OQ3B 5TPWL 4XN5A 5I73C 3S88L 3FUNA 2JXMA 1JPEA 3ROOA 5EBWB 4DIXA 4ZMTA 1C08B 1E3XA 1OSPH 2BC4B 4GBXD 4OBRA 1AKJB 4OJFL 5DLMH 4IBTA 3T5WA 4Q89A 1QFUH 4YHNA 1BQUA 3P9LB 1UC6A 2NY2D 5B4MD 5KS9B 1KFGA 4O51A 5EO1A 5LVEA 3MRKA 3NABL 1PZSA 5K9OB 3TH3T 5DJ6A 4I1PA 2ZOKA 5DA0B 3TYGL 3LQAC 2CDEA 4FC3E 1DEEB 3P4NB 4TQHA 2R27A 4Z9KB 3QUMB 3ZKNC 5HHXL 2HPTA 3GBML 3VXRE 5IMMB 1UKSA 4GSRA 1O9ZA 3PHSA 1M1XA 2VZUA 1A7RH 2OYKA 1BVLB 3H9HB 1RVFH 1BMZA 5D72L 2CO3A 2QADB 2R0ZL 1DQQB 5FHAH 3OC5A 3UTQB 2YK1L 5DMJB 2WLNA 2JJUA 5AKRA 2NW3B 3VD9A 4FNLH 4EUPB 2IXQB 3DECA 4LAJH 1D5MB 5ADOL 2QFRA 4HKJA 2LU4A 1ZS8A 3CCHA 5GGRB 1IAKA 3D1MC 4ZO9A 1WIOA 2HFFA 2CK0H 1I85C 1YJDH 3NJIA 5IM7A 1QTSA 1IAII 4QRBA 4HIPA 5CEZH 5K1NA 4PV1C 3QYNA 2FZ3B 3SPCA 5B1AB 5MERA 3K6SA 1OF2A 1PY9A 2J43A 4TSCH 4IDJH 1ECZA 4UT9L 1AANA 4FTVA 1EHLH 2DTML 3CK0H 2HTLD 5CINL 4KXAA 2W0KA 5I1AA 1Q9WB 3F64A 1BQKA 1F8TH 3RPBA 5INCB 4HA1A 2BY0A 2X9XA 3BVNA 3D48R 3ELQA 3ULSB 3G5ZA 1G6RH 4HS8H 1AR1C 4JGUA 1NMCC 2VZ3A 1JYVA 4AGQA 5KTEH 3BKML 4AXWB 4FN0A 5DUML