5G4VC

Association of four two-k-turn units based on kt-7 3bg,3nc, forming a square-shaped structure
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
117
structure length
117
Chain Sequence
b'SYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HMKT-7
publication title A Quasi-Cyclic RNA Nano-Scale Molecular Object Constructed Using Kink Turns.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Dna binding
total genus 37
structure length 117
sequence length 117
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5g4vC00
2JNBA 4C4WC 3CC4F 4NUTA 5G4VC 3OBYA 2I6DA 3AGKA 3CCJF 3CC7F 1GZ0A 3SIUA 3LWOC 1GO1A 2QI2A 4BY9D 3JAMM 3LWRC 3CCQF 3I56F 2QEXF 1M90H 3CC2F 1IPAA 1YHQF 3CXCF 5EO3A 1H7MA 2VGMA 1CK2A 5IT9M 1X7PA 3N4YA 5GINC 1QVFF 1RA4A 3N4ZA 5DCVA 3CCVF 2LBXA 3LWVC 3I55F 2OTJF 1T0KB 1Q86H 1VQMF 1CN7A 3RA5A 3VI6A 4TZZA 2CZWA 3CCSF 2KTVA 1DT9A 3CCLF 1YITF 2QA4F 3WXMB 5EWRA 1X7OA 1VQ6F 3LWQC 1YJWF 1GO0A 1YJNF 3JCMM 1W2BF 1KC8H 1VQ5F 1JJ2F 5FLXM 1NMUB 1VQ4F 5GIPC 1KQSF 3NK7A 5GIOC 3O85A 3V7QA 2VGNA 3HAXD 1VQ9F 1YI2F 1K73H 1Q82H 1W3EX 3OBWA 3NVKE 2LBWA 2WALA 3CCEF 3CCMF 1VQ7F 1W42A 2BO1A 2HVYD 2OTLF 3NMUC 1VQPF 1W41A 1VQ8F 3OW2F 3J80M 3G4SF 3CPWF 1ZWZA 3CPQA 3VMFB 3G71F 3CMAF 5G4UC 3PLAC 2OZBA 3CCRF 3CMEF 3GYQA 2KTUA 1NJIH 1K8AH 3LFOA 3E20B 1PXWA 1M1KH 1N8RH 3SIVA 2KG4A 3CCUF 3ON1A 2AIFA 1E7KA 3J7AR 1YJ9F 1XBIA 5GAPK 1S72F 3HJWC 1KD1H 3PAFA 2ALEA 4LCKA 3CG6A 3J81M 3G6EF 2OHWA 5GANK 3LWPC 5A2QM 1VQKF 3E1YA 1QVGF 1SDSA 1VQNF 3NVIB 3V7EA 1VQLF 5FJ4C 1W40A 3MCAB 1Q7YH 4X3MA 1K9MH 3FFMA 3NK6A 3IR9A 4X3LA 1X52A 1RLGA 1VQOF 3RA6A 2FC3A 4BW0B 1Q81H 3CD6F 1YIJF
chains in the Genus database with same CATH superfamily
4G4WA 3HKCA 5LA6B 5J2TA 2HRUA 5G4VC 2ZOVA 5KX5B 4O4LA 4EI9A 3SIUA 2QI2A 3LWRC 1U40A 3I7TA 3I56F 3WGNA 3CC2F 4C8GA 3CXCF 4EI7A 3WGLA 1FSZA 5IT9M 4O4IA 4I4TB 4I50B 3L7QA 4O2BA 4B45A 2OTJF 1UI9A 3B6NA 5EIBC 4BVQA 4XCQA 3VI6A 2IQQA 3VOBA 2KTVA 3K14A 3DDNA 2GVIA 3N2KB 5IJ0A 4BVRA 5JVDB 4YJ2B 3S0WA 2ZF8A 3LWQC 4C82A 3JCMM 4DXDA 1NMUB 1KQSF 4YJ3B 2GLZA 4U3JB 3O85A 3V4DA 5LA6A 4ZHVA 2VGNA 3RYIB 4NQ3A 5BMVB 5KX5A 3JAWB 3WPWA 3RYCB 3NVKE 3E22B 2WALA 3LMEA 3CCEF 4X1IB 3CCMF 2CVLA 2OTLF 2BTOA 1VQPF 1W41A 1VQ8F 3WPXA 2P6YA 2UYJA 3K2XA 4I4TA 4I50A 3N2GB 5IYZB 3ZOPA 1OAPA 3JVHA 3CB2A 4TV8B 3KJKA 2DYYA 3QHDA 1DBFA 1M1KH 5HP7A 5LP6B 3ELCA 2H8EA 3F0EA 2AIFA 4BT4A 3LDTA 2G9IA 3N2KA 1S72F 1KD1H 3PAFA 5JVDA 4YJ2A 3JASB 4X1YB 1W581 3J81M 3GTZA 3C9SA 1RQ2A 3S02A 3D01A 5A2QM 3E1YA 1XRGA 3VCZA 1VQLF 5ITZB 4O2AB 4YJ3A 4U3JA 3VYSC 3MCAB 5HWEA 1IV3A 3CYPB 4G4VA 3RYIA 3IEWA 4E6EA 5BMVA 1X52A 3M1XA 3JAWA 1RLGA 1VQOF 3R0PA 4O4JB 3RYCA 3E22A 4X1IA 4ZOLB 3JALB 2AMTA 4NUTA 5HXUA 1W55A 3OBYA 2HP3A 1VH8A 1XHOA 4BT6A 3MBMA 1GZ0A 2N48A 3N2GA 5CB4B 1GO1A 5HY4A 3LWOC 4BY9D 5IYZA 5JCOA 4G88A 1IPAA 1U3LA 3IKFA 1H7MA 3WJRA 4TV8A 4O4HB 1VK3A 5FNVB 5LP6A 1RA4A 2YXZA 5EB0A 3K12A 2LBXA 2IG8A 3HTNA 3VO8A 3LWVC 1R1MA 4RQOA 3JASA 4X1YA 1COMA 4ERHA 2OTMA 4TZZA 4B62A 2Q1XA 3CCSF 1DT9A 2VAPA 5ITZA 1UFYA 1SA0B 2Z1UA 3P10A 4O2AA 3K0TA 1X7OA 1VQ6F 1GO0A 2BTQB 2IAFA 4FFBB 1VQ5F 2ZVZA 5FLXM 4O4JA 5GIPC 2NMUA 5IJ9B 4PWTA 3BYQA 3JALA 3JARB 3P0ZA 4ZOLA 5CA1B 2YYEA 1FNJA 2CWJA 2HRYA 1IV2A 4RHAA 5EZYB 3VOAA 1VQ9F 1NQ3A 1K73H 1W3EX 1FFXB 2V9YA 5CB4A 4BT5A 1VQ7F 2BO1A 3TD3A 2PHNA 4C8IA 3HWUA 2FGYA 3G4SF 3CPWF 3CPQA 3DC2A 2ZAUA 2HP0B 2CSLA 4O4HA 3ZP7A 1KNKA 3PLAC 2RB9A 3M84A 4DRXB 5FNVA 3F0GA 1IV1A 4ZK7A 3TD4A 4M8IA 1NJIH 1K8AH 5CA0B 3E20B 1PXWA 1W5BA 5JH7B 1TVKB 3WJPA 3CCUF 2MQEA 1SA0A 1XBIA 5GAPK 4LCKA 2ALEA 3G6EF 3EORA 5JCOC 4FFBA 3LWPC 1VQKF 2ZVYA 3KE1A 1VQNF 3S06A 5IJ9A 3V7EA 3JARA 3D54A 5CA1A 3HKBB 1Q7YH 1K9MH 3IR9A 4X3LA 5LP6C 4BVTA 5EZYA 1Q8RA 2GZLA 3T80A 3RA6A 1FFXA 1Q81H 2VXYA 3IMPA 2JNBA 2VAMA 3OONA 4C4WC 3LYBA 5HY2A 2I6DA 4ZHWA 1VHAA 2HP0A 4ZI7B 3CCJF 1QU9A 4DRXA 4X1KB 2Z1EA 3JAMM 5EYPB 3P4EA 3CCQF 2CHTA 2R751 1M90H 1YHQF 5EIBD 5EO3A 2B33A 5CA0A 4WBNB 1CK2A 1X25A 2BTUA 5JH7A 1X7PA 1OFUA 1TVKA 3N4YA 1QVFF 3N4ZA 5DCVA 3ERNA 4F6RB 3I55F 1Q86H 3Q8HA 2HX0A 3MQWA 3RA5A 2EWCA 2Q1YA 2CZWA 5AVMA 3MDOA 2ZODA 1FNKA 2Z1FA 3QTYA 2QA4F 3HKBA 5EWRA 5B8FA 2UYKA 1JD1A 3JAKB 2R6R1 1W2BF 1JJ2F 3HKDB 1QD9A 4TV9B 2Z01A 5GIOC 3V7QA 5LYJB 5J2UB 5LOVB 1YI2F 3F0DA 4B5CA 4HNAB 4ZI7A 1ODEA 5EAZA 4X1KA 5GONB 1YQNA 5EYPA 2HVYD 3F0FA 5MN4A 3M4SA 3S03A 3OW2F 1ZWZA 3VMFB 3G71F 4WBNA 5G4UC 3KIZA 2OZBA 2HS0A 3CMEF 3ESJA 3GYQA 2KTUA 2LCAA 3ZO8A 4F6RA 1VQVA 2W8BC 3RYFB 2VAWA 3KJJA 2HQSC 3JATB 3ON1A 1E7KA 1W5AA 3J7AR 3TD5A 3HJWC 1QAHA 1Z5WA 3JAKA 2UYNB 4G4YA 5GANK 3GHZA 5HP8A 1QVGF 1SDSA 1YGYA 3HKDA 3HKEB 1GX1A 2KGWA 4TV9A 4LNUB 1U3PA 4I55B 2I6RA 2F9ZC 4X3MA 3FFMA 5LYJA 4TUYB 5J2UA 5LOVA 4BT3A 4HNAA 1CLIA 4KWEA 5LXTB 5GONA 4BW0B 1T0KB 3CD6F 4BT7A 1YIJF 3I3FA 5MN5A 3CC4F 1RLUA 3VYUC 3RYHB 3S0HA 3UT5B 3AGKA 2RHJA 3WGKA 2H8CA 3CC7F 4C8EA 1Z5VA 3F6MA 2QEXF 2HS3A 2RHLA 3U0OA 2VGMA 1W5EA 3C9RA 1TUBB 3RYFA 3CYQA 4B46A 3WGJA 2HS4A 3KHNA 3RE3A 5GINC 5HY0A 1JY8A 3JATA 1W59A 5C8YB 3CCVF 3C9TA 1W57A 1U43A 1VQMF 3QUWA 1CN7A 4EB6B 2UYNA 1JFFB 3HKEA 3CCLF 1H47A 4LNUA 1YITF 4I55A 3WXMB 2L26A 1YJWF 4TUYA 5HY1A 1YJNF 1KC8H 4U39A 1IV4A 5LXTA 2RHHA 1VQ4F 5KMGB 3C8LA 5HXZA 4X20B 4IIJB 2AIZP 3C9UA 3NK7A 4ZHQB 1JN1A 3RYHA 4NWOB 2UZHA 4IHJB 3UT5A 5JQGB 2K1SA 3HAXD 1J7HA 1SZQA 3FBAA 1Q82H 3OBWA 2LBWA 3WGMA 2QTPA 1W42A 1W5FA 4G4ZA 1H48A 3NMUC 2DT4A 1PF5A 3HKCB 5J2TB 3J80M 3CMAF 1TUBA 4BT2A 4O4LB 3V3TA 2CHSA 2H6LA 3CCRF 2PMPA 2Z1TA 5C8YA 3VIUA 1KNJA 3MCQA 3LFOA 5EB1B 4EB6A 3IKEA 1N8RH 3SIVA 4O4IB 2KG4A 3WJQA 1JFFA 4EI8A 4ZHYB 3FD6A 2CW4A 1YJ9F 4O2BB 3IEQA 3FD5A 3CG6A 2UYPA 3S0YA 3VTIC 1ONIA 2RHOA 3FPIA 4R40B 4C81A 2OHWA 1T0AA 2LBTA 5KMGA 3NVIB 3D00A 4X20A 4IIJA 5FJ4C 4G4XA 1W40A 5IJ0B 4BVSA 3VYTC 4ZHQA 3NK6A 1XV2A 1RQ7A 4IHJA 5JQGA 5MN6A 3ZP4A 2FC3A
chains in the Genus database with same CATH topology
2JNBA 4C4WC 3CC4F 4NUTA 5HXUA 5HY2A 3OBYA 5G4VC 2I6DA 3AGKA 3CCJF 4EI9A 3CC7F 1GZ0A 3SIUA 3LWOC 1GO1A 2QI2A 5HY4A 3JAMM 4BY9D 3LWRC 3CCQF 3I56F 2QEXF 1M90H 3CC2F 1IPAA 1YHQF 3CXCF 5EO3A 1H7MA 2VGMA 4EI7A 1CK2A 5IT9M 1X7PA 3N4YA 5GINC 1QVFF 5HY0A 1RA4A 3N4ZA 5DCVA 3CCVF 2LBXA 3LWVC 3I55F 2OTJF 1T0KB 1Q86H 1VQMF 1CN7A 3RA5A 4BVQA 4XCQA 3VI6A 4TZZA 2CZWA 3CCSF 2KTVA 1DT9A 3CCLF 1YITF 2QA4F 3WXMB 5EWRA 4BVRA 1X7OA 1VQ6F 3LWQC 1YJWF 1GO0A 5HY1A 1YJNF 3JCMM 1W2BF 1KC8H 1VQ5F 1JJ2F 5FLXM 1NMUB 1VQ4F 5GIPC 5HXZA 1KQSF 3NK7A 5GIOC 2GLZA 3O85A 3V7QA 2VGNA 4NQ3A 3HAXD 1VQ9F 1YI2F 1K73H 1Q82H 1W3EX 3OBWA 3NVKE 2LBWA 2WALA 3CCEF 3CCMF 1VQ7F 1W42A 2BO1A 2HVYD 2OTLF 3NMUC 1VQPF 1W41A 2FGYA 1VQ8F 3OW2F 3J80M 3G4SF 3CPWF 1ZWZA 3CPQA 3VMFB 3G71F 3CMAF 5G4UC 3PLAC 3V3TA 2OZBA 3CCRF 3CMEF 3GYQA 2KTUA 1NJIH 1K8AH 3LFOA 3E20B 1PXWA 1M1KH 1N8RH 3SIVA 2KG4A 3CCUF 3ON1A 2AIFA 4EI8A 1E7KA 3J7AR 1YJ9F 1XBIA 5GAPK 1S72F 3HJWC 1KD1H 3PAFA 2ALEA 4LCKA 3CG6A 3J81M 3G6EF 2OHWA 5GANK 3LWPC 5A2QM 1VQKF 3E1YA 1QVGF 1SDSA 1VQNF 3NVIB 3D00A 3V7EA 1VQLF 5FJ4C 1W40A 2F9ZC 3MCAB 4BVSA 5HWEA 4X3MA 1Q7YH 1K9MH 3FFMA 3NK6A 3IR9A 4X3LA 4BVTA 1X52A 1RLGA 1VQOF 3RA6A 2FC3A 4BW0B 1Q81H 3CD6F 1YIJF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JNB A;  4C4W C;  3CC4 F;  4NUT A;  5G4V C;  3OBY A;  2I6D A;  3AGK A;  3CCJ F;  3CC7 F;  1GZ0 A;  3SIU A;  3LWO C;  1GO1 A;  2QI2 A;  4BY9 D;  3JAM M;  3LWR C;  3CCQ F;  3I56 F;  2QEX F;  1M90 H;  3CC2 F;  1IPA A;  1YHQ F;  3CXC F;  5EO3 A;  1H7M A;  2VGM A;  1CK2 A;  5IT9 M;  1X7P A;  3N4Y A;  5GIN C;  1QVF F;  1RA4 A;  3N4Z A;  5DCV A;  3CCV F;  2LBX A;  3LWV C;  3I55 F;  2OTJ F;  1T0K B;  1Q86 H;  1VQM F;  1CN7 A;  3RA5 A;  3VI6 A;  4TZZ A;  2CZW A;  3CCS F;  2KTV A;  1DT9 A;  3CCL F;  1YIT F;  2QA4 F;  3WXM B;  5EWR A;  1X7O A;  1VQ6 F;  3LWQ C;  1YJW F;  1GO0 A;  1YJN F;  3JCM M;  1W2B F;  1KC8 H;  1VQ5 F;  1JJ2 F;  5FLX M;  1NMU B;  1VQ4 F;  5GIP C;  1KQS F;  3NK7 A;  5GIO C;  3O85 A;  3V7Q A;  2VGN A;  3HAX D;  1VQ9 F;  1YI2 F;  1K73 H;  1Q82 H;  1W3E X;  3OBW A;  3NVK E;  2LBW A;  2WAL A;  3CCE F;  3CCM F;  1VQ7 F;  1W42 A;  2BO1 A;  2HVY D;  2OTL F;  3NMU C;  1VQP F;  1W41 A;  1VQ8 F;  3OW2 F;  3J80 M;  3G4S F;  3CPW F;  1ZWZ A;  3CPQ A;  3VMF B;  3G71 F;  3CMA F;  5G4U C;  3PLA C;  2OZB A;  3CCR F;  3CME F;  3GYQ A;  2KTU A;  1NJI H;  1K8A H;  3LFO A;  3E20 B;  1PXW A;  1M1K H;  1N8R H;  3SIV A;  2KG4 A;  3CCU F;  3ON1 A;  2AIF A;  1E7K A;  3J7A R;  1YJ9 F;  1XBI A;  5GAP K;  1S72 F;  3HJW C;  1KD1 H;  3PAF A;  2ALE A;  4LCK A;  3CG6 A;  3J81 M;  3G6E F;  2OHW A;  5GAN K;  3LWP C;  5A2Q M;  1VQK F;  3E1Y A;  1QVG F;  1SDS A;  1VQN F;  3NVI B;  3V7E A;  1VQL F;  5FJ4 C;  1W40 A;  3MCA B;  1Q7Y H;  4X3M A;  1K9M H;  3FFM A;  3NK6 A;  3IR9 A;  4X3L A;  1X52 A;  1RLG A;  1VQO F;  3RA6 A;  2FC3 A;  4BW0 B;  1Q81 H;  3CD6 F;  1YIJ F; 
#chains in the Genus database with same CATH topology
 4G4W A;  3HKC A;  5LA6 B;  5J2T A;  2HRU A;  5G4V C;  2ZOV A;  5KX5 B;  4O4L A;  4EI9 A;  3SIU A;  2QI2 A;  3LWR C;  1U40 A;  3I7T A;  3I56 F;  3WGN A;  3CC2 F;  4C8G A;  3CXC F;  4EI7 A;  3WGL A;  1FSZ A;  5IT9 M;  4O4I A;  4I4T B;  4I50 B;  3L7Q A;  4O2B A;  4B45 A;  2OTJ F;  1UI9 A;  3B6N A;  5EIB C;  4BVQ A;  4XCQ A;  3VI6 A;  2IQQ A;  3VOB A;  2KTV A;  3K14 A;  3DDN A;  2GVI A;  3N2K B;  5IJ0 A;  4BVR A;  5JVD B;  4YJ2 B;  3S0W A;  2ZF8 A;  3LWQ C;  4C82 A;  3JCM M;  4DXD A;  1NMU B;  1KQS F;  4YJ3 B;  2GLZ A;  4U3J B;  3O85 A;  3V4D A;  5LA6 A;  4ZHV A;  2VGN A;  3RYI B;  4NQ3 A;  5BMV B;  5KX5 A;  3JAW B;  3WPW A;  3RYC B;  3NVK E;  3E22 B;  2WAL A;  3LME A;  3CCE F;  4X1I B;  3CCM F;  2CVL A;  2OTL F;  2BTO A;  1VQP F;  1W41 A;  1VQ8 F;  3WPX A;  2P6Y A;  2UYJ A;  3K2X A;  4I4T A;  4I50 A;  3N2G B;  5IYZ B;  3ZOP A;  1OAP A;  3JVH A;  3CB2 A;  4TV8 B;  3KJK A;  2DYY A;  3QHD A;  1DBF A;  1M1K H;  5HP7 A;  5LP6 B;  3ELC A;  2H8E A;  3F0E A;  2AIF A;  4BT4 A;  3LDT A;  2G9I A;  3N2K A;  1S72 F;  1KD1 H;  3PAF A;  5JVD A;  4YJ2 A;  3JAS B;  4X1Y B;  1W58 1;  3J81 M;  3GTZ A;  3C9S A;  1RQ2 A;  3S02 A;  3D01 A;  5A2Q M;  3E1Y A;  1XRG A;  3VCZ A;  1VQL F;  5ITZ B;  4O2A B;  4YJ3 A;  4U3J A;  3VYS C;  3MCA B;  5HWE A;  1IV3 A;  3CYP B;  4G4V A;  3RYI A;  3IEW A;  4E6E A;  5BMV A;  1X52 A;  3M1X A;  3JAW A;  1RLG A;  1VQO F;  3R0P A;  4O4J B;  3RYC A;  3E22 A;  4X1I A;  4ZOL B;  3JAL B;  2AMT A;  4NUT A;  5HXU A;  1W55 A;  3OBY A;  2HP3 A;  1VH8 A;  1XHO A;  4BT6 A;  3MBM A;  1GZ0 A;  2N48 A;  3N2G A;  5CB4 B;  1GO1 A;  5HY4 A;  3LWO C;  4BY9 D;  5IYZ A;  5JCO A;  4G88 A;  1IPA A;  1U3L A;  3IKF A;  1H7M A;  3WJR A;  4TV8 A;  4O4H B;  1VK3 A;  5FNV B;  5LP6 A;  1RA4 A;  2YXZ A;  5EB0 A;  3K12 A;  2LBX A;  2IG8 A;  3HTN A;  3VO8 A;  3LWV C;  1R1M A;  4RQO A;  3JAS A;  4X1Y A;  1COM A;  4ERH A;  2OTM A;  4TZZ A;  4B62 A;  2Q1X A;  3CCS F;  1DT9 A;  2VAP A;  5ITZ A;  1UFY A;  1SA0 B;  2Z1U A;  3P10 A;  4O2A A;  3K0T A;  1X7O A;  1VQ6 F;  1GO0 A;  2BTQ B;  2IAF A;  4FFB B;  1VQ5 F;  2ZVZ A;  5FLX M;  4O4J A;  5GIP C;  2NMU A;  5IJ9 B;  4PWT A;  3BYQ A;  3JAL A;  3JAR B;  3P0Z A;  4ZOL A;  5CA1 B;  2YYE A;  1FNJ A;  2CWJ A;  2HRY A;  1IV2 A;  4RHA A;  5EZY B;  3VOA A;  1VQ9 F;  1NQ3 A;  1K73 H;  1W3E X;  1FFX B;  2V9Y A;  5CB4 A;  4BT5 A;  1VQ7 F;  2BO1 A;  3TD3 A;  2PHN A;  4C8I A;  3HWU A;  2FGY A;  3G4S F;  3CPW F;  3CPQ A;  3DC2 A;  2ZAU A;  2HP0 B;  2CSL A;  4O4H A;  3ZP7 A;  1KNK A;  3PLA C;  2RB9 A;  3M84 A;  4DRX B;  5FNV A;  3F0G A;  1IV1 A;  4ZK7 A;  3TD4 A;  4M8I A;  1NJI H;  1K8A H;  5CA0 B;  3E20 B;  1PXW A;  1W5B A;  5JH7 B;  1TVK B;  3WJP A;  3CCU F;  2MQE A;  1SA0 A;  1XBI A;  5GAP K;  4LCK A;  2ALE A;  3G6E F;  3EOR A;  5JCO C;  4FFB A;  3LWP C;  1VQK F;  2ZVY A;  3KE1 A;  1VQN F;  3S06 A;  5IJ9 A;  3V7E A;  3JAR A;  3D54 A;  5CA1 A;  3HKB B;  1Q7Y H;  1K9M H;  3IR9 A;  4X3L A;  5LP6 C;  4BVT A;  5EZY A;  1Q8R A;  2GZL A;  3T80 A;  3RA6 A;  1FFX A;  1Q81 H;  2VXY A;  3IMP A;  2JNB A;  2VAM A;  3OON A;  4C4W C;  3LYB A;  5HY2 A;  2I6D A;  4ZHW A;  1VHA A;  2HP0 A;  4ZI7 B;  3CCJ F;  1QU9 A;  4DRX A;  4X1K B;  2Z1E A;  3JAM M;  5EYP B;  3P4E A;  3CCQ F;  2CHT A;  2R75 1;  1M90 H;  1YHQ F;  5EIB D;  5EO3 A;  2B33 A;  5CA0 A;  4WBN B;  1CK2 A;  1X25 A;  2BTU A;  5JH7 A;  1X7P A;  1OFU A;  1TVK A;  3N4Y A;  1QVF F;  3N4Z A;  5DCV A;  3ERN A;  4F6R B;  3I55 F;  1Q86 H;  3Q8H A;  2HX0 A;  3MQW A;  3RA5 A;  2EWC A;  2Q1Y A;  2CZW A;  5AVM A;  3MDO A;  2ZOD A;  1FNK A;  2Z1F A;  3QTY A;  2QA4 F;  3HKB A;  5EWR A;  5B8F A;  2UYK A;  1JD1 A;  3JAK B;  2R6R 1;  1W2B F;  1JJ2 F;  3HKD B;  1QD9 A;  4TV9 B;  2Z01 A;  5GIO C;  3V7Q A;  5LYJ B;  5J2U B;  5LOV B;  1YI2 F;  3F0D A;  4B5C A;  4HNA B;  4ZI7 A;  1ODE A;  5EAZ A;  4X1K A;  5GON B;  1YQN A;  5EYP A;  2HVY D;  3F0F A;  5MN4 A;  3M4S A;  3S03 A;  3OW2 F;  1ZWZ A;  3VMF B;  3G71 F;  4WBN A;  5G4U C;  3KIZ A;  2OZB A;  2HS0 A;  3CME F;  3ESJ A;  3GYQ A;  2KTU A;  2LCA A;  3ZO8 A;  4F6R A;  1VQV A;  2W8B C;  3RYF B;  2VAW A;  3KJJ A;  2HQS C;  3JAT B;  3ON1 A;  1E7K A;  1W5A A;  3J7A R;  3TD5 A;  3HJW C;  1QAH A;  1Z5W A;  3JAK A;  2UYN B;  4G4Y A;  5GAN K;  3GHZ A;  5HP8 A;  1QVG F;  1SDS A;  1YGY A;  3HKD A;  3HKE B;  1GX1 A;  2KGW A;  4TV9 A;  4LNU B;  1U3P A;  4I55 B;  2I6R A;  2F9Z C;  4X3M A;  3FFM A;  5LYJ A;  4TUY B;  5J2U A;  5LOV A;  4BT3 A;  4HNA A;  1CLI A;  4KWE A;  5LXT B;  5GON A;  4BW0 B;  1T0K B;  3CD6 F;  4BT7 A;  1YIJ F;  3I3F A;  5MN5 A;  3CC4 F;  1RLU A;  3VYU C;  3RYH B;  3S0H A;  3UT5 B;  3AGK A;  2RHJ A;  3WGK A;  2H8C A;  3CC7 F;  4C8E A;  1Z5V A;  3F6M A;  2QEX F;  2HS3 A;  2RHL A;  3U0O A;  2VGM A;  1W5E A;  3C9R A;  1TUB B;  3RYF A;  3CYQ A;  4B46 A;  3WGJ A;  2HS4 A;  3KHN A;  3RE3 A;  5GIN C;  5HY0 A;  1JY8 A;  3JAT A;  1W59 A;  5C8Y B;  3CCV F;  3C9T A;  1W57 A;  1U43 A;  1VQM F;  3QUW A;  1CN7 A;  4EB6 B;  2UYN A;  1JFF B;  3HKE A;  3CCL F;  1H47 A;  4LNU A;  1YIT F;  4I55 A;  3WXM B;  2L26 A;  1YJW F;  4TUY A;  5HY1 A;  1YJN F;  1KC8 H;  4U39 A;  1IV4 A;  5LXT A;  2RHH A;  1VQ4 F;  5KMG B;  3C8L A;  5HXZ A;  4X20 B;  4IIJ B;  2AIZ P;  3C9U A;  3NK7 A;  4ZHQ B;  1JN1 A;  3RYH A;  4NWO B;  2UZH A;  4IHJ B;  3UT5 A;  5JQG B;  2K1S A;  3HAX D;  1J7H A;  1SZQ A;  3FBA A;  1Q82 H;  3OBW A;  2LBW A;  3WGM A;  2QTP A;  1W42 A;  1W5F A;  4G4Z A;  1H48 A;  3NMU C;  2DT4 A;  1PF5 A;  3HKC B;  5J2T B;  3J80 M;  3CMA F;  1TUB A;  4BT2 A;  4O4L B;  3V3T A;  2CHS A;  2H6L A;  3CCR F;  2PMP A;  2Z1T A;  5C8Y A;  3VIU A;  1KNJ A;  3MCQ A;  3LFO A;  5EB1 B;  4EB6 A;  3IKE A;  1N8R H;  3SIV A;  4O4I B;  2KG4 A;  3WJQ A;  1JFF A;  4EI8 A;  4ZHY B;  3FD6 A;  2CW4 A;  1YJ9 F;  4O2B B;  3IEQ A;  3FD5 A;  3CG6 A;  2UYP A;  3S0Y A;  3VTI C;  1ONI A;  2RHO A;  3FPI A;  4R40 B;  4C81 A;  2OHW A;  1T0A A;  2LBT A;  5KMG A;  3NVI B;  3D00 A;  4X20 A;  4IIJ A;  5FJ4 C;  4G4X A;  1W40 A;  5IJ0 B;  4BVS A;  3VYT C;  4ZHQ A;  3NK6 A;  1XV2 A;  1RQ7 A;  4IHJ A;  5JQG A;  5MN6 A;  3ZP4 A;  2FC3 A; 
#chains in the Genus database with same CATH homology
 2JNB A;  4C4W C;  3CC4 F;  4NUT A;  5HXU A;  5HY2 A;  3OBY A;  5G4V C;  2I6D A;  3AGK A;  3CCJ F;  4EI9 A;  3CC7 F;  1GZ0 A;  3SIU A;  3LWO C;  1GO1 A;  2QI2 A;  5HY4 A;  3JAM M;  4BY9 D;  3LWR C;  3CCQ F;  3I56 F;  2QEX F;  1M90 H;  3CC2 F;  1IPA A;  1YHQ F;  3CXC F;  5EO3 A;  1H7M A;  2VGM A;  4EI7 A;  1CK2 A;  5IT9 M;  1X7P A;  3N4Y A;  5GIN C;  1QVF F;  5HY0 A;  1RA4 A;  3N4Z A;  5DCV A;  3CCV F;  2LBX A;  3LWV C;  3I55 F;  2OTJ F;  1T0K B;  1Q86 H;  1VQM F;  1CN7 A;  3RA5 A;  4BVQ A;  4XCQ A;  3VI6 A;  4TZZ A;  2CZW A;  3CCS F;  2KTV A;  1DT9 A;  3CCL F;  1YIT F;  2QA4 F;  3WXM B;  5EWR A;  4BVR A;  1X7O A;  1VQ6 F;  3LWQ C;  1YJW F;  1GO0 A;  5HY1 A;  1YJN F;  3JCM M;  1W2B F;  1KC8 H;  1VQ5 F;  1JJ2 F;  5FLX M;  1NMU B;  1VQ4 F;  5GIP C;  5HXZ A;  1KQS F;  3NK7 A;  5GIO C;  2GLZ A;  3O85 A;  3V7Q A;  2VGN A;  4NQ3 A;  3HAX D;  1VQ9 F;  1YI2 F;  1K73 H;  1Q82 H;  1W3E X;  3OBW A;  3NVK E;  2LBW A;  2WAL A;  3CCE F;  3CCM F;  1VQ7 F;  1W42 A;  2BO1 A;  2HVY D;  2OTL F;  3NMU C;  1VQP F;  1W41 A;  2FGY A;  1VQ8 F;  3OW2 F;  3J80 M;  3G4S F;  3CPW F;  1ZWZ A;  3CPQ A;  3VMF B;  3G71 F;  3CMA F;  5G4U C;  3PLA C;  3V3T A;  2OZB A;  3CCR F;  3CME F;  3GYQ A;  2KTU A;  1NJI H;  1K8A H;  3LFO A;  3E20 B;  1PXW A;  1M1K H;  1N8R H;  3SIV A;  2KG4 A;  3CCU F;  3ON1 A;  2AIF A;  4EI8 A;  1E7K A;  3J7A R;  1YJ9 F;  1XBI A;  5GAP K;  1S72 F;  3HJW C;  1KD1 H;  3PAF A;  2ALE A;  4LCK A;  3CG6 A;  3J81 M;  3G6E F;  2OHW A;  5GAN K;  3LWP C;  5A2Q M;  1VQK F;  3E1Y A;  1QVG F;  1SDS A;  1VQN F;  3NVI B;  3D00 A;  3V7E A;  1VQL F;  5FJ4 C;  1W40 A;  2F9Z C;  3MCA B;  4BVS A;  5HWE A;  4X3M A;  1Q7Y H;  1K9M H;  3FFM A;  3NK6 A;  3IR9 A;  4X3L A;  4BVT A;  1X52 A;  1RLG A;  1VQO F;  3RA6 A;  2FC3 A;  4BW0 B;  1Q81 H;  3CD6 F;  1YIJ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...