5G4VC

Association of four two-k-turn units based on kt-7 3bg,3nc, forming a square-shaped structure
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
117
structure length
117
Chain Sequence
SYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Quasi-Cyclic RNA Nano-Scale Molecular Object Constructed Using Kink Turns.
pubmed doi rcsb
molecule keywords HMKT-7
molecule tags Dna binding
source organism Archaeoglobus fulgidus
total genus 37
structure length 117
sequence length 117
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5g4vC00
3JAMM 3NMUC 2OTJF 3O85A 1QVFF 4BW0B 3MCAB 1YITF 1K8AH 3LFOA 3G71F 3G4SF 2JNBA 3ON1A 1RLGA 2VGMA 3RA5A 1VQ4F 3IR9A 1GZ0A 4X3MA 1CN7A 1NJIH 5G4UC 1X7PA 3OBWA 1W40A 3CCEF 1VQ9F 1VQNF 3JCMM 2CZWA 3CG6A 1VQLF 3V7EA 1GO1A 1KQSF 1VQPF 1S72F 5FJ4C 2WALA 1VQ6F 1VQ5F 1W3EX 2KG4A 3CC4F 1YHQF 1W2BF 5GINC 3I55F 3CCLF 3SIVA 1K9MH 1W41A 1M90H 5GIOC 2KTUA 3OBYA 3CCMF 1VQOF 1H7MA 5EO3A 2QI2A 2I6DA 1RA4A 1M1KH 3J81M 3LWVC 3FFMA 1XBIA 3NK7A 2LBXA 1X52A 3AGKA 4C4WC 3E1YA 1SDSA 1YI2F 1K73H 5GIPC 5DCVA 3NVIB 1GO0A 3E20B 3G6EF 1DT9A 3CPQA 3CCVF 5FLXM 2ALEA 3CMAF 3LWRC 3CC2F 3RA6A 1W42A 2FC3A 3OW2F 2BO1A 1Q81H 1ZWZA 2OZBA 5GAPK 3LWQC 1KC8H 5GANK 1T0KB 3SIUA 5A2QM 2LBWA 3CCSF 1KD1H 2OTLF 4X3LA 3VMFB 1Q86H 3HJWC 3HAXD 3CCRF 1Q7YH 4LCKA 1CK2A 5G4VC 1VQ7F 3WXMB 3GYQA 2AIFA 3NK6A 2QEXF 1VQMF 2OHWA 1YJWF 1E7KA 3J80M 1JJ2F 1VQKF 4NUTA 1PXWA 3N4YA 3V7QA 3LWOC 3CCUF 1VQ8F 3PLAC 3LWPC 1IPAA 4TZZA 3CD6F 1QVGF 3NVKE 1YJ9F 3CPWF 3N4ZA 3I56F 3CXCF 3PAFA 1YJNF 4BY9D 2VGNA 2KTVA 1X7OA 5EWRA 1N8RH 5IT9M 3CCJF 3CCQF 3J7AR 3CC7F 1Q82H 3CMEF 1NMUB 2HVYD 1YIJF 2QA4F 3VI6A
chains in the Genus database with same CATH superfamily
2OTJF 3MCAB 3VCZA 1K8AH 4ZHWA 1JFFA 2VAWA 3ON1A 4LNUB 3S02A 3RA5A 4O4IB 3K0TA 5LP6A 3VOAA 3V4DA 4DXDA 5HY1A 2IG8A 3JAWA 1FNKA 3FBAA 3QHDA 4C82A 5ITZA 3CCEF 3JCMM 2H8CA 1GO1A 3WGJA 1KQSF 2V9YA 5LXTA 1S72F 1W5BA 5J2TB 2Z1FA 2KG4A 2HX0A 5J2UA 3CC4F 4ZK7A 3ZO8A 1UFYA 4O2AB 5CA0A 4HNAA 1QU9A 1SA0B 2L26A 3HTNA 3CCMF 5EO3A 1JFFB 4G4WA 3FD5A 3LWVC 3FFMA 5HY4A 5LP6B 2LBXA 3AGKA 1XV2A 3E1YA 5BMVA 1GO0A 3KJJA 3E20B 1TVKA 1Z5WA 3JAWB 2UYPA 3R0PA 3MDOA 2H8EA 3S0YA 2ALEA 5LP6C 4I4TA 1H48A 5LXTB 3CC2F 4TUYA 3L7QA 4X20A 1Q81H 3VYSC 3IKEA 4I50A 3LWQC 2ZOVA 5J2UB 1KC8H 5A2QM 2HP0A 2OTLF 4X3LA 3VMFB 1U43A 1Q86H 5CA0B 4HNAB 5KX5B 1TUBA 3HAXD 3F6MA 1Q7YH 3BYQA 3VOBA 2HRYA 5CB4A 3D00A 3RYFA 5G4VC 3V3TA 3GYQA 2AIFA 3P0ZA 1E7KA 3LDTA 1VQKF 3JARB 4NUTA 4E6EA 2HRUA 4C8EA 3V7QA 3KHNA 1TVKB 5AVMA 4NWOB 2VXYA 3N4ZA 3I56F 1CLIA 4I4TB 4EI9A 2VAPA 3CXCF 1COMA 4TUYB 4X1IA 3S0HA 4X20B 1YJNF 1YGYA 2F9ZC 3RYHA 3RYIA 1N8RH 3DDNA 4ZHYB 5LA6A 3CCQF 3CYQA 1NMUB 3P4EA 3D01A 4BT4A 3M1XA 5JCOC 3JAMM 4O2BA 3O85A 1TUBB 4BW0B 4BVSA 5EAZA 1QVFF 3LFOA 3G71F 2H6LA 5CB4B 2JNBA 1SA0A 4B45A 3IMPA 1PF5A 3HKDA 2IQQA 1GZ0A 4X3MA 3JASA 2HQSC 5EB1B 1NJIH 2DT4A 5G4UC 2ZAUA 1VQ9F 4X1YA 2LBTA 3TD4A 1VQPF 1W57A 2BTOA 5HXUA 3KIZA 4X1IB 1VQ6F 4IHJB 3RYHB 3RYIB 1T0AA 5LA6B 3CCLF 5MN4A 1XRGA 1M90H 3C9UA 4ZHVA 4O2BB 1VQOF 5EYPA 3MQWA 2CVLA 2I6DA 1RA4A 4R40B 4C8GA 5HWEA 2UYKA 3WJRA 1XBIA 2N48A 3HKDB 4YJ2A 3GTZA 4C4WC 1K73H 3JASB 5JVDA 1QD9A 4PWTA 2R6R1 5HXZA 4X1YB 5EIBD 5FLXM 3M84A 3LWRC 1W42A 3F0FA 1U3PA 1FFXA 5GAPK 5KX5A 3IEQA 1VH8A 4EI7A 1T0KB 3Q8HA 4O4LA 3CCSF 1FNJA 1YQNA 3HKCA 2QTPA 1H47A 3ERNA 2Z1UA 3WGMA 4C8IA 2GZLA 3HJWC 4NQ3A 3CCRF 3JARA 1CK2A 4I55A 3N2KA 3B6NA 5EYPB 3RE3A 2CHTA 3EORA 1VQ7F 3WXMB 2QEXF 4ZI7A 1VQMF 1YJWF 1JJ2F 4M8IA 3ZP4A 1UI9A 4YJ2B 1IV3A 2FGYA 4X1KA 4EB6A 1VK3A 3N4YA 5JVDB 4TV9A 5JH7A 3LWOC 4F6RA 4C81A 5JCOA 4BT3A 2EWCA 3K14A 3S0WA 4O4HA 1ONIA 3PAFA 3RYCA 5B8FA 1FFXB 4DRXB 1X7OA 3D54A 5EWRA 5HP8A 1RQ7A 1Q8RA 4O4LB 3T80A 2CHSA 4KWEA 2I6RA 2UYNB 4B46A 3HKCB 3CMEF 1YIJF 1VQVA 2RHLA 3GHZA 3WPWA 1W5FA 1YITF 3ESJA 3N2KB 4I55B 4BT7A 3HKEA 2VGMA 4ZI7B 3IEWA 1JY8A 3IR9A 1SZQA 3OONA 4ERHA 5CA1A 3FD6A 3F0GA 4X1KB 4EB6B 1CN7A 4TV9B 1X7PA 2OTMA 3OBWA 5JH7B 4F6RB 1ODEA 2CZWA 4G88A 1VQLF 3VYTC 4TV8A 4IHJA 4BVQA 2DYYA 4O4HB 3C8LA 2ZVYA 5KMGA 1W3EX 3RYCB 3C9SA 3C9TA 2CW4A 4G4VA 4RHAA 5GINC 3I55F 1W55A 3SIVA 2R751 1K9MH 1W41A 5GIOC 2ZODA 3UT5A 2NMUA 1H7MA 1Z5VA 3I7TA 1KNJA 2YYEA 1M1KH 3J81M 4WBNA 2RHHA 3HKEB 3HKBA 3VYUC 4IIJA 3MBMA 5CA1B 1X52A 1QAHA 1YI2F 3FPIA 5GIPC 1W5EA 4G4YA 3WGNA 3ZP7A 1RQ2A 2CWJA 5EB0A 3F0EA 3CCVF 3JATA 4G4ZA 1IV4A 4TV8B 5C8YA 2IAFA 3E22A 2MQEA 3TD5A 3WJQA 2FC3A 3OW2F 2BO1A 2RB9A 1ZWZA 2HS0A 5IJ9B 5KMGB 2OZBA 1XHOA 5GANK 3HWUA 3SIUA 2AIZP 2LBWA 3K12A 3U0OA 3UT5B 3C9RA 5EZYA 5GONA 4WBNB 3I3FA 3HKBB 4RQOA 2GLZA 4IIJB 4B62A 1PXWA 1VQ8F 4TZZA 1QVGF 2HP3A 3WGKA 4DRXA 3JATB 3CPWF 1YJ9F 4EI8A 5C8YB 3E22B 2UYNA 1W59A 4BY9D 2VGNA 2CSLA 2KTVA 2PHNA 1X25A 3LYBA 2Z01A 5FNVB 2HVYD 2BTUA 4U3JA 3KJKA 3F0DA 5HP7A 3NMUC 2Z1TA 2UZHA 5LYJA 1W581 5EZYB 3WJPA 3G4SF 3MCQA 4O4JA 1RLGA 5GONB 3ELCA 2W8BC 1VQ4F 1U3LA 1R1MA 3VTIC 1GX1A 4G4XA 2ZF8A 1W40A 1VQNF 5JQGA 3CG6A 5MN6A 5LOVA 3V7EA 2LCAA 2GVIA 3QTYA 4XCQA 5FJ4C 3JVHA 4BVTA 2AMTA 2WALA 2Z1EA 5ITZB 5IYZA 1VQ5F 3P10A 3S06A 1YHQF 1W2BF 3KE1A 5EIBC 3TD3A 3QUWA 4U3JB 3N2GA 4ZHQA 2KTUA 3OBYA 4U39A 2QI2A 4ZOLA 5LYJB 2BTQB 2UYJA 1IV2A 2RHJA 3K2XA 4O4JB 2VAMA 1U40A 2G9IA 3IKFA 3NK7A 5DCVA 1SDSA 2YXZA 4BVRA 3NVIB 3G6EF 4FFBA 4BT5A 1DT9A 5IJ9A 5JQGB 3CPQA 3VIUA 1JD1A 5LOVB 4YJ3A 3DC2A 3CMAF 3M4SA 5BMVB 5HY2A 3RA6A 1W5AA 3JAKA 3JALA 2B33A 2PMPA 5IJ0A 5IYZB 1RLUA 3ZOPA 1KNKA 1KD1H 2HS4A 2K1SA 3N2GB 4ZHQB 4I50B 2HP0B 4LCKA 1IV1A 4ZOLB 4BT6A 4B5CA 4LNUA 3NK6A 2OHWA 1OAPA 4O4IA 3LMEA 3J80M 2Q1XA 3S03A 1JN1A 3RYFB 3CCUF 3PLAC 3LWPC 1IPAA 4FFBB 3CD6F 3VO8A 3NVKE 1J7HA 1DBFA 1VHAA 4YJ3B 3CB2A 4BT2A 5J2TA 3WPXA 5FNVA 1FSZA 3CYPB 2KGWA 3JAKB 3JALB 2Q1YA 5IJ0B 2HS3A 2ZVZA 2P6YA 5IT9M 3CCJF 3WGLA 1NQ3A 5HY0A 4O2AA 5MN5A 3J7AR 3CC7F 1OFUA 1Q82H 2RHOA 2QA4F 3VI6A
chains in the Genus database with same CATH topology
3JAMM 3NMUC 2OTJF 3O85A 4BVSA 4BW0B 1QVFF 3MCAB 1YITF 1K8AH 3LFOA 3G71F 3G4SF 2JNBA 3ON1A 1RLGA 2VGMA 3RA5A 1VQ4F 3IR9A 1GZ0A 4X3MA 5HY1A 1CN7A 1NJIH 5G4UC 1X7PA 3OBWA 1W40A 3CCEF 1VQ9F 1VQNF 3JCMM 2CZWA 3CG6A 1VQLF 3V7EA 4BVQA 1GO1A 4XCQA 1KQSF 1VQPF 1S72F 5FJ4C 5HXUA 4BVTA 2WALA 1VQ6F 1VQ5F 1W3EX 2KG4A 3CC4F 1YHQF 1W2BF 5GINC 3I55F 3CCLF 3SIVA 1K9MH 1W41A 1M90H 5GIOC 2KTUA 3OBYA 3CCMF 1VQOF 1H7MA 5EO3A 2QI2A 2I6DA 5HWEA 1RA4A 1M1KH 3J81M 3LWVC 3FFMA 1XBIA 5HY4A 3NK7A 2LBXA 1X52A 3AGKA 4C4WC 3E1YA 1SDSA 1YI2F 1K73H 5GIPC 5DCVA 4BVRA 3NVIB 1GO0A 3E20B 3G6EF 5HXZA 1DT9A 3CPQA 3CCVF 5FLXM 2ALEA 3CMAF 5HY2A 3LWRC 3CC2F 3RA6A 1W42A 2FC3A 3OW2F 2BO1A 1Q81H 1ZWZA 2OZBA 5GAPK 3LWQC 4EI7A 1KC8H 5GANK 1T0KB 3SIUA 5A2QM 2LBWA 3CCSF 1KD1H 2OTLF 4X3LA 3VMFB 1Q86H 3HJWC 3HAXD 4NQ3A 3CCRF 1Q7YH 4LCKA 1CK2A 3D00A 5G4VC 1VQ7F 3V3TA 3WXMB 3GYQA 2AIFA 3NK6A 2QEXF 1VQMF 2OHWA 1YJWF 1E7KA 3J80M 1JJ2F 1VQKF 2GLZA 4NUTA 1PXWA 2FGYA 3N4YA 3V7QA 3LWOC 3CCUF 1VQ8F 3PLAC 3LWPC 1IPAA 4TZZA 3CD6F 1QVGF 3NVKE 1YJ9F 3CPWF 4EI8A 3N4ZA 3I56F 3CXCF 4EI9A 3PAFA 1YJNF 2F9ZC 2VGNA 4BY9D 2KTVA 1X7OA 5EWRA 1N8RH 5IT9M 3CCJF 5HY0A 3CCQF 3J7AR 3CC7F 1Q82H 3CMEF 1NMUB 2HVYD 1YIJF 2QA4F 3VI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM M;  3NMU C;  2OTJ F;  3O85 A;  1QVF F;  4BW0 B;  3MCA B;  1YIT F;  1K8A H;  3LFO A;  3G71 F;  3G4S F;  2JNB A;  3ON1 A;  1RLG A;  2VGM A;  3RA5 A;  1VQ4 F;  3IR9 A;  1GZ0 A;  4X3M A;  1CN7 A;  1NJI H;  5G4U C;  1X7P A;  3OBW A;  1W40 A;  3CCE F;  1VQ9 F;  1VQN F;  3JCM M;  2CZW A;  3CG6 A;  1VQL F;  3V7E A;  1GO1 A;  1KQS F;  1VQP F;  1S72 F;  5FJ4 C;  2WAL A;  1VQ6 F;  1VQ5 F;  1W3E X;  2KG4 A;  3CC4 F;  1YHQ F;  1W2B F;  5GIN C;  3I55 F;  3CCL F;  3SIV A;  1K9M H;  1W41 A;  1M90 H;  5GIO C;  2KTU A;  3OBY A;  3CCM F;  1VQO F;  1H7M A;  5EO3 A;  2QI2 A;  2I6D A;  1RA4 A;  1M1K H;  3J81 M;  3LWV C;  3FFM A;  1XBI A;  3NK7 A;  2LBX A;  1X52 A;  3AGK A;  4C4W C;  3E1Y A;  1SDS A;  1YI2 F;  1K73 H;  5GIP C;  5DCV A;  3NVI B;  1GO0 A;  3E20 B;  3G6E F;  1DT9 A;  3CPQ A;  3CCV F;  5FLX M;  2ALE A;  3CMA F;  3LWR C;  3CC2 F;  3RA6 A;  1W42 A;  2FC3 A;  3OW2 F;  2BO1 A;  1Q81 H;  1ZWZ A;  2OZB A;  5GAP K;  3LWQ C;  1KC8 H;  5GAN K;  1T0K B;  3SIU A;  5A2Q M;  2LBW A;  3CCS F;  1KD1 H;  2OTL F;  4X3L A;  3VMF B;  1Q86 H;  3HJW C;  3HAX D;  3CCR F;  1Q7Y H;  4LCK A;  1CK2 A;  5G4V C;  1VQ7 F;  3WXM B;  3GYQ A;  2AIF A;  3NK6 A;  2QEX F;  1VQM F;  2OHW A;  1YJW F;  1E7K A;  3J80 M;  1JJ2 F;  1VQK F;  4NUT A;  1PXW A;  3N4Y A;  3V7Q A;  3LWO C;  3CCU F;  1VQ8 F;  3PLA C;  3LWP C;  1IPA A;  4TZZ A;  3CD6 F;  1QVG F;  3NVK E;  1YJ9 F;  3CPW F;  3N4Z A;  3I56 F;  3CXC F;  3PAF A;  1YJN F;  4BY9 D;  2VGN A;  2KTV A;  1X7O A;  5EWR A;  1N8R H;  5IT9 M;  3CCJ F;  3CCQ F;  3J7A R;  3CC7 F;  1Q82 H;  3CME F;  1NMU B;  2HVY D;  1YIJ F;  2QA4 F;  3VI6 A; 
#chains in the Genus database with same CATH topology
 2OTJ F;  3MCA B;  3VCZ A;  1K8A H;  4ZHW A;  1JFF A;  2VAW A;  3ON1 A;  4LNU B;  3S02 A;  3RA5 A;  4O4I B;  3K0T A;  5LP6 A;  3VOA A;  3V4D A;  4DXD A;  5HY1 A;  2IG8 A;  3JAW A;  1FNK A;  3FBA A;  3QHD A;  4C82 A;  5ITZ A;  3CCE F;  3JCM M;  2H8C A;  1GO1 A;  3WGJ A;  1KQS F;  2V9Y A;  5LXT A;  1S72 F;  1W5B A;  5J2T B;  2Z1F A;  2KG4 A;  2HX0 A;  5J2U A;  3CC4 F;  4ZK7 A;  3ZO8 A;  1UFY A;  4O2A B;  5CA0 A;  4HNA A;  1QU9 A;  1SA0 B;  2L26 A;  3HTN A;  3CCM F;  5EO3 A;  1JFF B;  4G4W A;  3FD5 A;  3LWV C;  3FFM A;  5HY4 A;  5LP6 B;  2LBX A;  3AGK A;  1XV2 A;  3E1Y A;  5BMV A;  1GO0 A;  3KJJ A;  3E20 B;  1TVK A;  1Z5W A;  3JAW B;  2UYP A;  3R0P A;  3MDO A;  2H8E A;  3S0Y A;  2ALE A;  5LP6 C;  4I4T A;  1H48 A;  5LXT B;  3CC2 F;  4TUY A;  3L7Q A;  4X20 A;  1Q81 H;  3VYS C;  3IKE A;  4I50 A;  3LWQ C;  2ZOV A;  5J2U B;  1KC8 H;  5A2Q M;  2HP0 A;  2OTL F;  4X3L A;  3VMF B;  1U43 A;  1Q86 H;  5CA0 B;  4HNA B;  5KX5 B;  1TUB A;  3HAX D;  3F6M A;  1Q7Y H;  3BYQ A;  3VOB A;  2HRY A;  5CB4 A;  3D00 A;  3RYF A;  5G4V C;  3V3T A;  3GYQ A;  2AIF A;  3P0Z A;  1E7K A;  3LDT A;  1VQK F;  3JAR B;  4NUT A;  4E6E A;  2HRU A;  4C8E A;  3V7Q A;  3KHN A;  1TVK B;  5AVM A;  4NWO B;  2VXY A;  3N4Z A;  3I56 F;  1CLI A;  4I4T B;  4EI9 A;  2VAP A;  3CXC F;  1COM A;  4TUY B;  4X1I A;  3S0H A;  4X20 B;  1YJN F;  1YGY A;  2F9Z C;  3RYH A;  3RYI A;  1N8R H;  3DDN A;  4ZHY B;  5LA6 A;  3CCQ F;  3CYQ A;  1NMU B;  3P4E A;  3D01 A;  4BT4 A;  3M1X A;  5JCO C;  3JAM M;  4O2B A;  3O85 A;  1TUB B;  4BW0 B;  4BVS A;  5EAZ A;  1QVF F;  3LFO A;  3G71 F;  2H6L A;  5CB4 B;  2JNB A;  1SA0 A;  4B45 A;  3IMP A;  1PF5 A;  3HKD A;  2IQQ A;  1GZ0 A;  4X3M A;  3JAS A;  2HQS C;  5EB1 B;  1NJI H;  2DT4 A;  5G4U C;  2ZAU A;  1VQ9 F;  4X1Y A;  2LBT A;  3TD4 A;  1VQP F;  1W57 A;  2BTO A;  5HXU A;  3KIZ A;  4X1I B;  1VQ6 F;  4IHJ B;  3RYH B;  3RYI B;  1T0A A;  5LA6 B;  3CCL F;  5MN4 A;  1XRG A;  1M90 H;  3C9U A;  4ZHV A;  4O2B B;  1VQO F;  5EYP A;  3MQW A;  2CVL A;  2I6D A;  1RA4 A;  4R40 B;  4C8G A;  5HWE A;  2UYK A;  3WJR A;  1XBI A;  2N48 A;  3HKD B;  4YJ2 A;  3GTZ A;  4C4W C;  1K73 H;  3JAS B;  5JVD A;  1QD9 A;  4PWT A;  2R6R 1;  5HXZ A;  4X1Y B;  5EIB D;  5FLX M;  3M84 A;  3LWR C;  1W42 A;  3F0F A;  1U3P A;  1FFX A;  5GAP K;  5KX5 A;  3IEQ A;  1VH8 A;  4EI7 A;  1T0K B;  3Q8H A;  4O4L A;  3CCS F;  1FNJ A;  1YQN A;  3HKC A;  2QTP A;  1H47 A;  3ERN A;  2Z1U A;  3WGM A;  4C8I A;  2GZL A;  3HJW C;  4NQ3 A;  3CCR F;  3JAR A;  1CK2 A;  4I55 A;  3N2K A;  3B6N A;  5EYP B;  3RE3 A;  2CHT A;  3EOR A;  1VQ7 F;  3WXM B;  2QEX F;  4ZI7 A;  1VQM F;  1YJW F;  1JJ2 F;  4M8I A;  3ZP4 A;  1UI9 A;  4YJ2 B;  1IV3 A;  2FGY A;  4X1K A;  4EB6 A;  1VK3 A;  3N4Y A;  5JVD B;  4TV9 A;  5JH7 A;  3LWO C;  4F6R A;  4C81 A;  5JCO A;  4BT3 A;  2EWC A;  3K14 A;  3S0W A;  4O4H A;  1ONI A;  3PAF A;  3RYC A;  5B8F A;  1FFX B;  4DRX B;  1X7O A;  3D54 A;  5EWR A;  5HP8 A;  1RQ7 A;  1Q8R A;  4O4L B;  3T80 A;  2CHS A;  4KWE A;  2I6R A;  2UYN B;  4B46 A;  3HKC B;  3CME F;  1YIJ F;  1VQV A;  2RHL A;  3GHZ A;  3WPW A;  1W5F A;  1YIT F;  3ESJ A;  3N2K B;  4I55 B;  4BT7 A;  3HKE A;  2VGM A;  4ZI7 B;  3IEW A;  1JY8 A;  3IR9 A;  1SZQ A;  3OON A;  4ERH A;  5CA1 A;  3FD6 A;  3F0G A;  4X1K B;  4EB6 B;  1CN7 A;  4TV9 B;  1X7P A;  2OTM A;  3OBW A;  5JH7 B;  4F6R B;  1ODE A;  2CZW A;  4G88 A;  1VQL F;  3VYT C;  4TV8 A;  4IHJ A;  4BVQ A;  2DYY A;  4O4H B;  3C8L A;  2ZVY A;  5KMG A;  1W3E X;  3RYC B;  3C9S A;  3C9T A;  2CW4 A;  4G4V A;  4RHA A;  5GIN C;  3I55 F;  1W55 A;  3SIV A;  2R75 1;  1K9M H;  1W41 A;  5GIO C;  2ZOD A;  3UT5 A;  2NMU A;  1H7M A;  1Z5V A;  3I7T A;  1KNJ A;  2YYE A;  1M1K H;  3J81 M;  4WBN A;  2RHH A;  3HKE B;  3HKB A;  3VYU C;  4IIJ A;  3MBM A;  5CA1 B;  1X52 A;  1QAH A;  1YI2 F;  3FPI A;  5GIP C;  1W5E A;  4G4Y A;  3WGN A;  3ZP7 A;  1RQ2 A;  2CWJ A;  5EB0 A;  3F0E A;  3CCV F;  3JAT A;  4G4Z A;  1IV4 A;  4TV8 B;  5C8Y A;  2IAF A;  3E22 A;  2MQE A;  3TD5 A;  3WJQ A;  2FC3 A;  3OW2 F;  2BO1 A;  2RB9 A;  1ZWZ A;  2HS0 A;  5IJ9 B;  5KMG B;  2OZB A;  1XHO A;  5GAN K;  3HWU A;  3SIU A;  2AIZ P;  2LBW A;  3K12 A;  3U0O A;  3UT5 B;  3C9R A;  5EZY A;  5GON A;  4WBN B;  3I3F A;  3HKB B;  4RQO A;  2GLZ A;  4IIJ B;  4B62 A;  1PXW A;  1VQ8 F;  4TZZ A;  1QVG F;  2HP3 A;  3WGK A;  4DRX A;  3JAT B;  3CPW F;  1YJ9 F;  4EI8 A;  5C8Y B;  3E22 B;  2UYN A;  1W59 A;  4BY9 D;  2VGN A;  2CSL A;  2KTV A;  2PHN A;  1X25 A;  3LYB A;  2Z01 A;  5FNV B;  2HVY D;  2BTU A;  4U3J A;  3KJK A;  3F0D A;  5HP7 A;  3NMU C;  2Z1T A;  2UZH A;  5LYJ A;  1W58 1;  5EZY B;  3WJP A;  3G4S F;  3MCQ A;  4O4J A;  1RLG A;  5GON B;  3ELC A;  2W8B C;  1VQ4 F;  1U3L A;  1R1M A;  3VTI C;  1GX1 A;  4G4X A;  2ZF8 A;  1W40 A;  1VQN F;  5JQG A;  3CG6 A;  5MN6 A;  5LOV A;  3V7E A;  2LCA A;  2GVI A;  3QTY A;  4XCQ A;  5FJ4 C;  3JVH A;  4BVT A;  2AMT A;  2WAL A;  2Z1E A;  5ITZ B;  5IYZ A;  1VQ5 F;  3P10 A;  3S06 A;  1YHQ F;  1W2B F;  3KE1 A;  5EIB C;  3TD3 A;  3QUW A;  4U3J B;  3N2G A;  4ZHQ A;  2KTU A;  3OBY A;  4U39 A;  2QI2 A;  4ZOL A;  5LYJ B;  2BTQ B;  2UYJ A;  1IV2 A;  2RHJ A;  3K2X A;  4O4J B;  2VAM A;  1U40 A;  2G9I A;  3IKF A;  3NK7 A;  5DCV A;  1SDS A;  2YXZ A;  4BVR A;  3NVI B;  3G6E F;  4FFB A;  4BT5 A;  1DT9 A;  5IJ9 A;  5JQG B;  3CPQ A;  3VIU A;  1JD1 A;  5LOV B;  4YJ3 A;  3DC2 A;  3CMA F;  3M4S A;  5BMV B;  5HY2 A;  3RA6 A;  1W5A A;  3JAK A;  3JAL A;  2B33 A;  2PMP A;  5IJ0 A;  5IYZ B;  1RLU A;  3ZOP A;  1KNK A;  1KD1 H;  2HS4 A;  2K1S A;  3N2G B;  4ZHQ B;  4I50 B;  2HP0 B;  4LCK A;  1IV1 A;  4ZOL B;  4BT6 A;  4B5C A;  4LNU A;  3NK6 A;  2OHW A;  1OAP A;  4O4I A;  3LME A;  3J80 M;  2Q1X A;  3S03 A;  1JN1 A;  3RYF B;  3CCU F;  3PLA C;  3LWP C;  1IPA A;  4FFB B;  3CD6 F;  3VO8 A;  3NVK E;  1J7H A;  1DBF A;  1VHA A;  4YJ3 B;  3CB2 A;  4BT2 A;  5J2T A;  3WPX A;  5FNV A;  1FSZ A;  3CYP B;  2KGW A;  3JAK B;  3JAL B;  2Q1Y A;  5IJ0 B;  2HS3 A;  2ZVZ A;  2P6Y A;  5IT9 M;  3CCJ F;  3WGL A;  1NQ3 A;  5HY0 A;  4O2A A;  5MN5 A;  3J7A R;  3CC7 F;  1OFU A;  1Q82 H;  2RHO A;  2QA4 F;  3VI6 A; 
#chains in the Genus database with same CATH homology
 3JAM M;  3NMU C;  2OTJ F;  3O85 A;  4BVS A;  4BW0 B;  1QVF F;  3MCA B;  1YIT F;  1K8A H;  3LFO A;  3G71 F;  3G4S F;  2JNB A;  3ON1 A;  1RLG A;  2VGM A;  3RA5 A;  1VQ4 F;  3IR9 A;  1GZ0 A;  4X3M A;  5HY1 A;  1CN7 A;  1NJI H;  5G4U C;  1X7P A;  3OBW A;  1W40 A;  3CCE F;  1VQ9 F;  1VQN F;  3JCM M;  2CZW A;  3CG6 A;  1VQL F;  3V7E A;  4BVQ A;  1GO1 A;  4XCQ A;  1KQS F;  1VQP F;  1S72 F;  5FJ4 C;  5HXU A;  4BVT A;  2WAL A;  1VQ6 F;  1VQ5 F;  1W3E X;  2KG4 A;  3CC4 F;  1YHQ F;  1W2B F;  5GIN C;  3I55 F;  3CCL F;  3SIV A;  1K9M H;  1W41 A;  1M90 H;  5GIO C;  2KTU A;  3OBY A;  3CCM F;  1VQO F;  1H7M A;  5EO3 A;  2QI2 A;  2I6D A;  5HWE A;  1RA4 A;  1M1K H;  3J81 M;  3LWV C;  3FFM A;  1XBI A;  5HY4 A;  3NK7 A;  2LBX A;  1X52 A;  3AGK A;  4C4W C;  3E1Y A;  1SDS A;  1YI2 F;  1K73 H;  5GIP C;  5DCV A;  4BVR A;  3NVI B;  1GO0 A;  3E20 B;  3G6E F;  5HXZ A;  1DT9 A;  3CPQ A;  3CCV F;  5FLX M;  2ALE A;  3CMA F;  5HY2 A;  3LWR C;  3CC2 F;  3RA6 A;  1W42 A;  2FC3 A;  3OW2 F;  2BO1 A;  1Q81 H;  1ZWZ A;  2OZB A;  5GAP K;  3LWQ C;  4EI7 A;  1KC8 H;  5GAN K;  1T0K B;  3SIU A;  5A2Q M;  2LBW A;  3CCS F;  1KD1 H;  2OTL F;  4X3L A;  3VMF B;  1Q86 H;  3HJW C;  3HAX D;  4NQ3 A;  3CCR F;  1Q7Y H;  4LCK A;  1CK2 A;  3D00 A;  5G4V C;  1VQ7 F;  3V3T A;  3WXM B;  3GYQ A;  2AIF A;  3NK6 A;  2QEX F;  1VQM F;  2OHW A;  1YJW F;  1E7K A;  3J80 M;  1JJ2 F;  1VQK F;  2GLZ A;  4NUT A;  1PXW A;  2FGY A;  3N4Y A;  3V7Q A;  3LWO C;  3CCU F;  1VQ8 F;  3PLA C;  3LWP C;  1IPA A;  4TZZ A;  3CD6 F;  1QVG F;  3NVK E;  1YJ9 F;  3CPW F;  4EI8 A;  3N4Z A;  3I56 F;  3CXC F;  4EI9 A;  3PAF A;  1YJN F;  2F9Z C;  2VGN A;  4BY9 D;  2KTV A;  1X7O A;  5EWR A;  1N8R H;  5IT9 M;  3CCJ F;  5HY0 A;  3CCQ F;  3J7A R;  3CC7 F;  1Q82 H;  3CME F;  1NMU B;  2HVY D;  1YIJ F;  2QA4 F;  3VI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...