5G4VC

Association of four two-k-turn units based on kt-7 3bg,3nc, forming a square-shaped structure
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
117
structure length
117
Chain Sequence
SYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Quasi-Cyclic RNA Nano-Scale Molecular Object Constructed Using Kink Turns.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Dna binding
molecule keywords HMKT-7
total genus 37
structure length 117
sequence length 117
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5g4vC00
3E20B 1DT9A 3J80M 1T0KB 1ZWZA 3NK6A 4X3MA 3LWOC 1VQMF 3CPWF 5FJ4C 1YIJF 3G6EF 3CCUF 3IR9A 3CCSF 3V7QA 3J7AR 3G4SF 5GANK 4X3LA 1YITF 1KC8H 4LCKA 2OTJF 2ALEA 2QEXF 1VQNF 1X7OA 1YJNF 1W40A 3RA6A 1K73H 1E7KA 3FFMA 3CCLF 3NVKE 1VQ6F 2KTVA 3N4YA 1K8AH 3HJWC 3LFOA 2OTLF 3CCJF 3WXMB 1VQ5F 2HVYD 1KQSF 3NVIB 3V7EA 3CD6F 1N8RH 5FLXM 3OBWA 1Q82H 5GINC 2OZBA 3CCEF 2BO1A 1W42A 1NJIH 3NK7A 2QA4F 1M90H 3G71F 3NMUC 5EWRA 5DCVA 3OW2F 1KD1H 3N4ZA 5GIOC 1VQ8F 1QVFF 3O85A 2LBWA 2FC3A 3CC4F 4TZZA 2CZWA 1YJ9F 2LBXA 2WALA 3CPQA 2VGNA 3CCRF 4BW0B 3ON1A 5G4VC 1VQ4F 1PXWA 3GYQA 3VI6A 2KG4A 3CMAF 1S72F 1RLGA 3CCQF 2OHWA 4NUTA 1CK2A 1GO1A 1W3EX 3E1YA 2VGMA 3MCAB 1QVGF 1X7PA 1VQ7F 1GO0A 1XBIA 3LWPC 5EO3A 5GIPC 1VQOF 1W2BF 3PLAC 1YI2F 3J81M 3LWQC 1VQ9F 1K9MH 3I56F 5GAPK 4BY9D 3AGKA 3VMFB 5A2QM 3CC2F 4C4WC 1NMUB 3OBYA 1Q7YH 1RA4A 1YHQF 2AIFA 3JCMM 3HAXD 3CMEF 1Q81H 1Q86H 1VQLF 3SIUA 3JAMM 3I55F 5G4UC 1X52A 3CC7F 3CG6A 1CN7A 3CCMF 1W41A 1GZ0A 1IPAA 3CCVF 1M1KH 1VQPF 1VQKF 1JJ2F 3SIVA 3LWRC 5IT9M 2QI2A 3CXCF 1YJWF 3RA5A 3PAFA 2KTUA 2JNBA 1SDSA 2I6DA 1H7MA 3LWVC
chains in the Genus database with same CATH superfamily
3LDTA 3E20B 2W8BC 3E22A 3RYHB 4TV9B 3CPWF 1YIJF 4NQ3A 3JVHA 4B5CA 2UYPA 3J7AR 1YITF 5GONB 3V3TA 4X1IA 2CHTA 4NWOB 1YJNF 1YQNA 3S0YA 2CSLA 1E7KA 5FNVA 3FFMA 3CCLF 2KTVA 1XRGA 2VAPA 1K8AH 1TVKA 3RYIA 3WGLA 4X1KA 3JALA 1VQ5F 2RHLA 3KHNA 2VAWA 2CWJA 2ZODA 4ZHVA 3IEQA 1Q82H 5GINC 5ITZB 5EZYB 4LNUA 2L26A 3FPIA 3ZP7A 1XV2A 2Z1UA 3KIZA 2ZVYA 3NK7A 2QA4F 4TV8B 1KD1H 2UYNA 2K1SA 3F0EA 2VXYA 4HNAA 3T80A 3GHZA 3M1XA 1VQ8F 5HY1A 5KX5B 2HP0B 2FC3A 1FNJA 4TZZA 5JQGA 2EWCA 4O4LB 5G4VC 1VQ4F 4XCQA 1J7HA 3HKBA 3GYQA 1TUBA 1S72F 3WGJA 1CK2A 1W3EX 5CA1A 3R0PA 1XBIA 1W5BA 1YI2F 3ESJA 2HS0A 1VQ9F 3I56F 3IKEA 4ZI7B 3HKEB 4BT5A 3N2KB 4I4TB 1Z5VA 1NMUB 4I55A 1RA4A 5JVDA 5HY2A 2Z1FA 4O4HA 1RQ7A 1Q81H 4O4JA 5BMVB 3K12A 3I55F 3KJKA 2PMPA 2HS4A 3LMEA 5EYPB 3HKCA 5HXUA 1W41A 4ZOLA 1RQ2A 3CCVF 5KX5A 3ZO8A 1VQVA 4G4XA 1JJ2F 3SIVA 2IAFA 3JAKB 5C8YA 3PAFA 3ERNA 1COMA 2RHHA 1SDSA 4X1YB 3KJJA 1DT9A 4EI7A 3J80M 1T0KB 4IHJB 1ZWZA 3NK6A 4C82A 5HXZA 3HKBB 2GZLA 4U39A 3RYCB 3G6EF 2AMTA 4I55B 5CB4A 3IR9A 3WJRA 2VAMA 1W5AA 2HRUA 3V7QA 5CB4B 4X3LA 1FNKA 4M8IA 2ALEA 5EYPA 4ZHWA 3F0FA 4X1KB 5CA0B 2F9ZC 3N4YA 4ZHYB 3LFOA 3CCJF 5JVDB 3VCZA 4G4VA 5LYJB 3S0WA 4ZHQA 3NVIB 5J2TB 3V7EA 1VK3A 4I50B 1U3PA 5HP7A 1N8RH 3C9RA 3OBWA 3HKCB 2OZBA 3IMPA 3D01A 4BT7A 2N48A 2OTMA 3JATB 4BVTA 1DBFA 5FNVB 4C81A 3VOAA 5DCVA 2PHNA 3MBMA 2RHOA 2B33A 2H8CA 2IQQA 3P10A 5LOVA 4C8EA 2CW4A 2QTPA 1W5EA 3KE1A 1W57A 3U0OA 4WBNB 4O4LA 4BT6A 1RLUA 1OFUA 2CZWA 4LNUB 2GLZA 3B6NA 4G4WA 4X20B 3S0HA 5J2TA 3CCRF 5LYJA 1H48A 3BYQA 1PXWA 3C9TA 1KNKA 3CMAF 1RLGA 4O4JB 1GO1A 1W55A 2VGMA 1VQ7F 1XHOA 3S06A 5J2UB 2ZOVA 4ZK7A 1VQOF 1X25A 2UYJA 3JARB 3J81M 3LWQC 2HP3A 4BT3A 5GAPK 5EIBC 2LBTA 3UT5B 4E6EA 1FSZA 3AGKA 1TVKB 3VYTC 1FFXB 5EIBD 5AVMA 3C9SA 2ZVZA 1W59A 1JFFB 3JASA 3F0GA 5KMGA 2YYEA 1SZQA 2DYYA 5GONA 3SIUA 1H47A 4X20A 1PF5A 1X52A 3F6MA 3IKFA 4R40B 3CYPB 3I3FA 2FGYA 4B62A 1M1KH 1VQKF 3V4DA 4ZOLB 3LWRC 1IV2A 3CXCF 1Q8RA 2JNBA 3MQWA 4O4IA 4O4HB 3LWVC 4RQOA 5HWEA 3TD4A 5FJ4C 5HP8A 3CCUF 1QD9A 5J2UA 3K0TA 3WJQA 3G4SF 3Q8HA 5MN5A 2OTJF 3JARA 2QEXF 1VQNF 2NMUA 4FFBA 1X7OA 1W40A 5LA6A 1K73H 2CVLA 4X1YA 3ZOPA 4YJ3A 5CA1B 1UFYA 1W5FA 5LA6B 5IJ9A 3JAWA 2OTLF 2Z1TA 1JFFA 4KWEA 2HVYD 2V9YA 3D54A 1SA0A 4WBNA 3CD6F 2HS3A 5IJ0B 5FLXM 3F0DA 5JH7A 3I7TA 3RE3A 3CCEF 3VO8A 4YJ2A 1NJIH 3N2GA 5BMVA 2MQEA 1VH8A 2Q1YA 3ELCA 5LOVB 3S02A 3NMUC 1U43A 3OW2F 3JATA 2UYKA 1UI9A 1IV3A 4X1IB 5GIOC 3N2KA 2I6RA 3O85A 3LYBA 4I50A 5EB1B 4C8IA 5LXTA 4ZHQB 3EORA 4TV9A 2CHSA 2LBXA 2WALA 3IEWA 3CPQA 3MCQA 2VGNA 5LP6A 4EI8A 3D00A 1GX1A 4U3JB 3JALB 1NQ3A 2ZF8A 2HQSC 4DXDA 3WGKA 4FFBB 2KG4A 1JD1A 1QU9A 3QTYA 3CCQF 3CYQA 1IV4A 5EZYA 1QVGF 3E1YA 3MCAB 1X7PA 1JY8A 3N2GB 1GO0A 4YJ2B 3LWPC 4B45A 5EO3A 5GIPC 3PLAC 4ZI7A 3M84A 2LCAA 3VYUC 2RB9A 3FBAA 3HKDA 3K2XA 4DRXB 4I4TA 2Z01A 2H8EA 2ZAUA 5MN6A 5A2QM 1T0AA 3HWUA 4C4WC 4O2AB 3RYFA 3VTIC 5JCOC 1IV1A 1YHQF 2AIFA 4G88A 2GVIA 1VQLF 3JAMM 3MDOA 4U3JA 5JCOA 4BT2A 3JASB 4BVRA 5KMGB 1R1MA 3ZP4A 3CG6A 1GZ0A 4F6RB 4G4ZA 5IYZA 4PWTA 1IPAA 4C8GA 1VQPF 5IYZB 1YGYA 3M4SA 2QI2A 4ERHA 4BVQA 3RYIB 1H7MA 3WPWA 5LP6B 3WJPA 4X3MA 3LWOC 1VQMF 2P6YA 1ONIA 4TUYB 4EB6A 1SA0B 3CCSF 5GANK 4LCKA 2RHJA 3GTZA 4EB6B 1KC8H 3HKDB 3DC2A 3RA6A 3C8LA 4BVSA 4RHAA 5HY4A 1VQ6F 3NVKE 3FD6A 5EAZA 2BTUA 3HJWC 3WXMB 4EI9A 5B8FA 3P4EA 2BTOA 4BT4A 1KQSF 1FFXA 3UT5A 3CB2A 5JQGB 4IHJA 3RYCA 2BO1A 5IJ0A 2UYNB 1W42A 1W581 4TUYA 1M90H 2H6LA 4HNAB 3G71F 4O2BA 2IG8A 5EWRA 3TD5A 3JAKA 3JAWB 2KGWA 2G9IA 4O2BB 5C8YB 3N4ZA 1ODEA 5CA0A 1QVFF 1Z5WA 2LBWA 3CC4F 5ITZA 4DRXA 1YJ9F 5HY0A 5LXTB 1JN1A 2HP0A 4B46A 4G4YA 3WPXA 4O4IB 4BW0B 3ON1A 2R6R1 1QAHA 3VI6A 5MN4A 4TV8A 3WGNA 3VYSC 2OHWA 4NUTA 2DT4A 2R751 3C9UA 2Z1EA 1W2BF 3FD5A 3K14A 1K9MH 4F6RA 2HX0A 4O2AA 2HRYA 3RYFB 2AIZP 3VOBA 3VIUA 4BY9D 3E22B 3RYHA 1U3LA 5IJ9B 3L7QA 3VMFB 3CC2F 3P0ZA 4YJ3B 1OAPA 3TD3A 3OBYA 1Q7YH 3S03A 2BTQB 3QUWA 3JCMM 3HAXD 3WGMA 3CMEF 1U40A 1TUBB 3OONA 1Q86H 5LP6C 5G4UC 2Q1XA 1VHAA 3CC7F 5JH7B 4IIJB 1CN7A 3CCMF 1CLIA 2YXZA 4IIJA 3DDNA 3HKEA 3HTNA 5IT9M 2UZHA 5EB0A 1YJWF 3RA5A 2KTUA 1KNJA 2I6DA 3QHDA
chains in the Genus database with same CATH topology
3E20B 1DT9A 4EI7A 5HWEA 3J80M 1T0KB 1ZWZA 3NK6A 4X3MA 5HXZA 3LWOC 1VQMF 3CPWF 5FJ4C 1YIJF 4NQ3A 3G6EF 3CCUF 3IR9A 3CCSF 3V7QA 3J7AR 3G4SF 5GANK 4X3LA 1YITF 1KC8H 4LCKA 3V3TA 2OTJF 2ALEA 2QEXF 1VQNF 1X7OA 1YJNF 1W40A 3RA6A 1K73H 1E7KA 2F9ZC 3FFMA 4BVSA 5HY4A 3CCLF 1VQ6F 2KTVA 3N4YA 1K8AH 3NVKE 3HJWC 3LFOA 2OTLF 3CCJF 3WXMB 4EI9A 1VQ5F 2HVYD 1KQSF 3NVIB 3V7EA 3CD6F 1N8RH 5FLXM 3OBWA 1Q82H 5GINC 2OZBA 3CCEF 2BO1A 1W42A 4BVTA 1NJIH 3NK7A 2QA4F 1M90H 3G71F 3NMUC 5EWRA 5DCVA 3OW2F 1KD1H 3N4ZA 5GIOC 1VQ8F 5HY1A 1QVFF 3O85A 2LBWA 2FC3A 3CC4F 4TZZA 2CZWA 1YJ9F 5HY0A 2LBXA 2GLZA 2WALA 3CPQA 2VGNA 4EI8A 3D00A 3CCRF 4BW0B 3ON1A 5G4VC 1VQ4F 4XCQA 1PXWA 3GYQA 3VI6A 2KG4A 3CMAF 1S72F 1RLGA 3CCQF 2OHWA 4NUTA 1CK2A 1GO1A 1W3EX 3E1YA 2VGMA 3MCAB 1QVGF 1X7PA 1VQ7F 1GO0A 1XBIA 3LWPC 5EO3A 5GIPC 1VQOF 1W2BF 3PLAC 1YI2F 3J81M 3LWQC 1VQ9F 1K9MH 3I56F 5GAPK 4BY9D 3AGKA 3VMFB 5A2QM 3CC2F 4C4WC 1NMUB 3OBYA 1Q7YH 1RA4A 1YHQF 2AIFA 3JCMM 3HAXD 5HY2A 3CMEF 1Q81H 1Q86H 1VQLF 3SIUA 3JAMM 4BVRA 3I55F 5G4UC 1X52A 3CC7F 3CG6A 5HXUA 1CN7A 3CCMF 1W41A 1GZ0A 2FGYA 1IPAA 3CCVF 1M1KH 1VQPF 1VQKF 1JJ2F 3SIVA 3LWRC 5IT9M 2QI2A 3CXCF 1YJWF 3RA5A 3PAFA 2KTUA 2JNBA 1SDSA 2I6DA 4BVQA 1H7MA 3LWVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E20 B;  1DT9 A;  3J80 M;  1T0K B;  1ZWZ A;  3NK6 A;  4X3M A;  3LWO C;  1VQM F;  3CPW F;  5FJ4 C;  1YIJ F;  3G6E F;  3CCU F;  3IR9 A;  3CCS F;  3V7Q A;  3J7A R;  3G4S F;  5GAN K;  4X3L A;  1YIT F;  1KC8 H;  4LCK A;  2OTJ F;  2ALE A;  2QEX F;  1VQN F;  1X7O A;  1YJN F;  1W40 A;  3RA6 A;  1K73 H;  1E7K A;  3FFM A;  3CCL F;  3NVK E;  1VQ6 F;  2KTV A;  3N4Y A;  1K8A H;  3HJW C;  3LFO A;  2OTL F;  3CCJ F;  3WXM B;  1VQ5 F;  2HVY D;  1KQS F;  3NVI B;  3V7E A;  3CD6 F;  1N8R H;  5FLX M;  3OBW A;  1Q82 H;  5GIN C;  2OZB A;  3CCE F;  2BO1 A;  1W42 A;  1NJI H;  3NK7 A;  2QA4 F;  1M90 H;  3G71 F;  3NMU C;  5EWR A;  5DCV A;  3OW2 F;  1KD1 H;  3N4Z A;  5GIO C;  1VQ8 F;  1QVF F;  3O85 A;  2LBW A;  2FC3 A;  3CC4 F;  4TZZ A;  2CZW A;  1YJ9 F;  2LBX A;  2WAL A;  3CPQ A;  2VGN A;  3CCR F;  4BW0 B;  3ON1 A;  5G4V C;  1VQ4 F;  1PXW A;  3GYQ A;  3VI6 A;  2KG4 A;  3CMA F;  1S72 F;  1RLG A;  3CCQ F;  2OHW A;  4NUT A;  1CK2 A;  1GO1 A;  1W3E X;  3E1Y A;  2VGM A;  3MCA B;  1QVG F;  1X7P A;  1VQ7 F;  1GO0 A;  1XBI A;  3LWP C;  5EO3 A;  5GIP C;  1VQO F;  1W2B F;  3PLA C;  1YI2 F;  3J81 M;  3LWQ C;  1VQ9 F;  1K9M H;  3I56 F;  5GAP K;  4BY9 D;  3AGK A;  3VMF B;  5A2Q M;  3CC2 F;  4C4W C;  1NMU B;  3OBY A;  1Q7Y H;  1RA4 A;  1YHQ F;  2AIF A;  3JCM M;  3HAX D;  3CME F;  1Q81 H;  1Q86 H;  1VQL F;  3SIU A;  3JAM M;  3I55 F;  5G4U C;  1X52 A;  3CC7 F;  3CG6 A;  1CN7 A;  3CCM F;  1W41 A;  1GZ0 A;  1IPA A;  3CCV F;  1M1K H;  1VQP F;  1VQK F;  1JJ2 F;  3SIV A;  3LWR C;  5IT9 M;  2QI2 A;  3CXC F;  1YJW F;  3RA5 A;  3PAF A;  2KTU A;  2JNB A;  1SDS A;  2I6D A;  1H7M A;  3LWV C; 
#chains in the Genus database with same CATH topology
 3LDT A;  3E20 B;  2W8B C;  3E22 A;  3RYH B;  4TV9 B;  3CPW F;  1YIJ F;  4NQ3 A;  3JVH A;  4B5C A;  2UYP A;  3J7A R;  1YIT F;  5GON B;  3V3T A;  4X1I A;  2CHT A;  4NWO B;  1YJN F;  1YQN A;  3S0Y A;  2CSL A;  1E7K A;  5FNV A;  3FFM A;  3CCL F;  2KTV A;  1XRG A;  2VAP A;  1K8A H;  1TVK A;  3RYI A;  3WGL A;  4X1K A;  3JAL A;  1VQ5 F;  2RHL A;  3KHN A;  2VAW A;  2CWJ A;  2ZOD A;  4ZHV A;  3IEQ A;  1Q82 H;  5GIN C;  5ITZ B;  5EZY B;  4LNU A;  2L26 A;  3FPI A;  3ZP7 A;  1XV2 A;  2Z1U A;  3KIZ A;  2ZVY A;  3NK7 A;  2QA4 F;  4TV8 B;  1KD1 H;  2UYN A;  2K1S A;  3F0E A;  2VXY A;  4HNA A;  3T80 A;  3GHZ A;  3M1X A;  1VQ8 F;  5HY1 A;  5KX5 B;  2HP0 B;  2FC3 A;  1FNJ A;  4TZZ A;  5JQG A;  2EWC A;  4O4L B;  5G4V C;  1VQ4 F;  4XCQ A;  1J7H A;  3HKB A;  3GYQ A;  1TUB A;  1S72 F;  3WGJ A;  1CK2 A;  1W3E X;  5CA1 A;  3R0P A;  1XBI A;  1W5B A;  1YI2 F;  3ESJ A;  2HS0 A;  1VQ9 F;  3I56 F;  3IKE A;  4ZI7 B;  3HKE B;  4BT5 A;  3N2K B;  4I4T B;  1Z5V A;  1NMU B;  4I55 A;  1RA4 A;  5JVD A;  5HY2 A;  2Z1F A;  4O4H A;  1RQ7 A;  1Q81 H;  4O4J A;  5BMV B;  3K12 A;  3I55 F;  3KJK A;  2PMP A;  2HS4 A;  3LME A;  5EYP B;  3HKC A;  5HXU A;  1W41 A;  4ZOL A;  1RQ2 A;  3CCV F;  5KX5 A;  3ZO8 A;  1VQV A;  4G4X A;  1JJ2 F;  3SIV A;  2IAF A;  3JAK B;  5C8Y A;  3PAF A;  3ERN A;  1COM A;  2RHH A;  1SDS A;  4X1Y B;  3KJJ A;  1DT9 A;  4EI7 A;  3J80 M;  1T0K B;  4IHJ B;  1ZWZ A;  3NK6 A;  4C82 A;  5HXZ A;  3HKB B;  2GZL A;  4U39 A;  3RYC B;  3G6E F;  2AMT A;  4I55 B;  5CB4 A;  3IR9 A;  3WJR A;  2VAM A;  1W5A A;  2HRU A;  3V7Q A;  5CB4 B;  4X3L A;  1FNK A;  4M8I A;  2ALE A;  5EYP A;  4ZHW A;  3F0F A;  4X1K B;  5CA0 B;  2F9Z C;  3N4Y A;  4ZHY B;  3LFO A;  3CCJ F;  5JVD B;  3VCZ A;  4G4V A;  5LYJ B;  3S0W A;  4ZHQ A;  3NVI B;  5J2T B;  3V7E A;  1VK3 A;  4I50 B;  1U3P A;  5HP7 A;  1N8R H;  3C9R A;  3OBW A;  3HKC B;  2OZB A;  3IMP A;  3D01 A;  4BT7 A;  2N48 A;  2OTM A;  3JAT B;  4BVT A;  1DBF A;  5FNV B;  4C81 A;  3VOA A;  5DCV A;  2PHN A;  3MBM A;  2RHO A;  2B33 A;  2H8C A;  2IQQ A;  3P10 A;  5LOV A;  4C8E A;  2CW4 A;  2QTP A;  1W5E A;  3KE1 A;  1W57 A;  3U0O A;  4WBN B;  4O4L A;  4BT6 A;  1RLU A;  1OFU A;  2CZW A;  4LNU B;  2GLZ A;  3B6N A;  4G4W A;  4X20 B;  3S0H A;  5J2T A;  3CCR F;  5LYJ A;  1H48 A;  3BYQ A;  1PXW A;  3C9T A;  1KNK A;  3CMA F;  1RLG A;  4O4J B;  1GO1 A;  1W55 A;  2VGM A;  1VQ7 F;  1XHO A;  3S06 A;  5J2U B;  2ZOV A;  4ZK7 A;  1VQO F;  1X25 A;  2UYJ A;  3JAR B;  3J81 M;  3LWQ C;  2HP3 A;  4BT3 A;  5GAP K;  5EIB C;  2LBT A;  3UT5 B;  4E6E A;  1FSZ A;  3AGK A;  1TVK B;  3VYT C;  1FFX B;  5EIB D;  5AVM A;  3C9S A;  2ZVZ A;  1W59 A;  1JFF B;  3JAS A;  3F0G A;  5KMG A;  2YYE A;  1SZQ A;  2DYY A;  5GON A;  3SIU A;  1H47 A;  4X20 A;  1PF5 A;  1X52 A;  3F6M A;  3IKF A;  4R40 B;  3CYP B;  3I3F A;  2FGY A;  4B62 A;  1M1K H;  1VQK F;  3V4D A;  4ZOL B;  3LWR C;  1IV2 A;  3CXC F;  1Q8R A;  2JNB A;  3MQW A;  4O4I A;  4O4H B;  3LWV C;  4RQO A;  5HWE A;  3TD4 A;  5FJ4 C;  5HP8 A;  3CCU F;  1QD9 A;  5J2U A;  3K0T A;  3WJQ A;  3G4S F;  3Q8H A;  5MN5 A;  2OTJ F;  3JAR A;  2QEX F;  1VQN F;  2NMU A;  4FFB A;  1X7O A;  1W40 A;  5LA6 A;  1K73 H;  2CVL A;  4X1Y A;  3ZOP A;  4YJ3 A;  5CA1 B;  1UFY A;  1W5F A;  5LA6 B;  5IJ9 A;  3JAW A;  2OTL F;  2Z1T A;  1JFF A;  4KWE A;  2HVY D;  2V9Y A;  3D54 A;  1SA0 A;  4WBN A;  3CD6 F;  2HS3 A;  5IJ0 B;  5FLX M;  3F0D A;  5JH7 A;  3I7T A;  3RE3 A;  3CCE F;  3VO8 A;  4YJ2 A;  1NJI H;  3N2G A;  5BMV A;  2MQE A;  1VH8 A;  2Q1Y A;  3ELC A;  5LOV B;  3S02 A;  3NMU C;  1U43 A;  3OW2 F;  3JAT A;  2UYK A;  1UI9 A;  1IV3 A;  4X1I B;  5GIO C;  3N2K A;  2I6R A;  3O85 A;  3LYB A;  4I50 A;  5EB1 B;  4C8I A;  5LXT A;  4ZHQ B;  3EOR A;  4TV9 A;  2CHS A;  2LBX A;  2WAL A;  3IEW A;  3CPQ A;  3MCQ A;  2VGN A;  5LP6 A;  4EI8 A;  3D00 A;  1GX1 A;  4U3J B;  3JAL B;  1NQ3 A;  2ZF8 A;  2HQS C;  4DXD A;  3WGK A;  4FFB B;  2KG4 A;  1JD1 A;  1QU9 A;  3QTY A;  3CCQ F;  3CYQ A;  1IV4 A;  5EZY A;  1QVG F;  3E1Y A;  3MCA B;  1X7P A;  1JY8 A;  3N2G B;  1GO0 A;  4YJ2 B;  3LWP C;  4B45 A;  5EO3 A;  5GIP C;  3PLA C;  4ZI7 A;  3M84 A;  2LCA A;  3VYU C;  2RB9 A;  3FBA A;  3HKD A;  3K2X A;  4DRX B;  4I4T A;  2Z01 A;  2H8E A;  2ZAU A;  5MN6 A;  5A2Q M;  1T0A A;  3HWU A;  4C4W C;  4O2A B;  3RYF A;  3VTI C;  5JCO C;  1IV1 A;  1YHQ F;  2AIF A;  4G88 A;  2GVI A;  1VQL F;  3JAM M;  3MDO A;  4U3J A;  5JCO A;  4BT2 A;  3JAS B;  4BVR A;  5KMG B;  1R1M A;  3ZP4 A;  3CG6 A;  1GZ0 A;  4F6R B;  4G4Z A;  5IYZ A;  4PWT A;  1IPA A;  4C8G A;  1VQP F;  5IYZ B;  1YGY A;  3M4S A;  2QI2 A;  4ERH A;  4BVQ A;  3RYI B;  1H7M A;  3WPW A;  5LP6 B;  3WJP A;  4X3M A;  3LWO C;  1VQM F;  2P6Y A;  1ONI A;  4TUY B;  4EB6 A;  1SA0 B;  3CCS F;  5GAN K;  4LCK A;  2RHJ A;  3GTZ A;  4EB6 B;  1KC8 H;  3HKD B;  3DC2 A;  3RA6 A;  3C8L A;  4BVS A;  4RHA A;  5HY4 A;  1VQ6 F;  3NVK E;  3FD6 A;  5EAZ A;  2BTU A;  3HJW C;  3WXM B;  4EI9 A;  5B8F A;  3P4E A;  2BTO A;  4BT4 A;  1KQS F;  1FFX A;  3UT5 A;  3CB2 A;  5JQG B;  4IHJ A;  3RYC A;  2BO1 A;  5IJ0 A;  2UYN B;  1W42 A;  1W58 1;  4TUY A;  1M90 H;  2H6L A;  4HNA B;  3G71 F;  4O2B A;  2IG8 A;  5EWR A;  3TD5 A;  3JAK A;  3JAW B;  2KGW A;  2G9I A;  4O2B B;  5C8Y B;  3N4Z A;  1ODE A;  5CA0 A;  1QVF F;  1Z5W A;  2LBW A;  3CC4 F;  5ITZ A;  4DRX A;  1YJ9 F;  5HY0 A;  5LXT B;  1JN1 A;  2HP0 A;  4B46 A;  4G4Y A;  3WPX A;  4O4I B;  4BW0 B;  3ON1 A;  2R6R 1;  1QAH A;  3VI6 A;  5MN4 A;  4TV8 A;  3WGN A;  3VYS C;  2OHW A;  4NUT A;  2DT4 A;  2R75 1;  3C9U A;  2Z1E A;  1W2B F;  3FD5 A;  3K14 A;  1K9M H;  4F6R A;  2HX0 A;  4O2A A;  2HRY A;  3RYF B;  2AIZ P;  3VOB A;  3VIU A;  4BY9 D;  3E22 B;  3RYH A;  1U3L A;  5IJ9 B;  3L7Q A;  3VMF B;  3CC2 F;  3P0Z A;  4YJ3 B;  1OAP A;  3TD3 A;  3OBY A;  1Q7Y H;  3S03 A;  2BTQ B;  3QUW A;  3JCM M;  3HAX D;  3WGM A;  3CME F;  1U40 A;  1TUB B;  3OON A;  1Q86 H;  5LP6 C;  5G4U C;  2Q1X A;  1VHA A;  3CC7 F;  5JH7 B;  4IIJ B;  1CN7 A;  3CCM F;  1CLI A;  2YXZ A;  4IIJ A;  3DDN A;  3HKE A;  3HTN A;  5IT9 M;  2UZH A;  5EB0 A;  1YJW F;  3RA5 A;  2KTU A;  1KNJ A;  2I6D A;  3QHD A; 
#chains in the Genus database with same CATH homology
 3E20 B;  1DT9 A;  4EI7 A;  5HWE A;  3J80 M;  1T0K B;  1ZWZ A;  3NK6 A;  4X3M A;  5HXZ A;  3LWO C;  1VQM F;  3CPW F;  5FJ4 C;  1YIJ F;  4NQ3 A;  3G6E F;  3CCU F;  3IR9 A;  3CCS F;  3V7Q A;  3J7A R;  3G4S F;  5GAN K;  4X3L A;  1YIT F;  1KC8 H;  4LCK A;  3V3T A;  2OTJ F;  2ALE A;  2QEX F;  1VQN F;  1X7O A;  1YJN F;  1W40 A;  3RA6 A;  1K73 H;  1E7K A;  2F9Z C;  3FFM A;  4BVS A;  5HY4 A;  3CCL F;  1VQ6 F;  2KTV A;  3N4Y A;  1K8A H;  3NVK E;  3HJW C;  3LFO A;  2OTL F;  3CCJ F;  3WXM B;  4EI9 A;  1VQ5 F;  2HVY D;  1KQS F;  3NVI B;  3V7E A;  3CD6 F;  1N8R H;  5FLX M;  3OBW A;  1Q82 H;  5GIN C;  2OZB A;  3CCE F;  2BO1 A;  1W42 A;  4BVT A;  1NJI H;  3NK7 A;  2QA4 F;  1M90 H;  3G71 F;  3NMU C;  5EWR A;  5DCV A;  3OW2 F;  1KD1 H;  3N4Z A;  5GIO C;  1VQ8 F;  5HY1 A;  1QVF F;  3O85 A;  2LBW A;  2FC3 A;  3CC4 F;  4TZZ A;  2CZW A;  1YJ9 F;  5HY0 A;  2LBX A;  2GLZ A;  2WAL A;  3CPQ A;  2VGN A;  4EI8 A;  3D00 A;  3CCR F;  4BW0 B;  3ON1 A;  5G4V C;  1VQ4 F;  4XCQ A;  1PXW A;  3GYQ A;  3VI6 A;  2KG4 A;  3CMA F;  1S72 F;  1RLG A;  3CCQ F;  2OHW A;  4NUT A;  1CK2 A;  1GO1 A;  1W3E X;  3E1Y A;  2VGM A;  3MCA B;  1QVG F;  1X7P A;  1VQ7 F;  1GO0 A;  1XBI A;  3LWP C;  5EO3 A;  5GIP C;  1VQO F;  1W2B F;  3PLA C;  1YI2 F;  3J81 M;  3LWQ C;  1VQ9 F;  1K9M H;  3I56 F;  5GAP K;  4BY9 D;  3AGK A;  3VMF B;  5A2Q M;  3CC2 F;  4C4W C;  1NMU B;  3OBY A;  1Q7Y H;  1RA4 A;  1YHQ F;  2AIF A;  3JCM M;  3HAX D;  5HY2 A;  3CME F;  1Q81 H;  1Q86 H;  1VQL F;  3SIU A;  3JAM M;  4BVR A;  3I55 F;  5G4U C;  1X52 A;  3CC7 F;  3CG6 A;  5HXU A;  1CN7 A;  3CCM F;  1W41 A;  1GZ0 A;  2FGY A;  1IPA A;  3CCV F;  1M1K H;  1VQP F;  1VQK F;  1JJ2 F;  3SIV A;  3LWR C;  5IT9 M;  2QI2 A;  3CXC F;  1YJW F;  3RA5 A;  3PAF A;  2KTU A;  2JNB A;  1SDS A;  2I6D A;  4BVQ A;  1H7M A;  3LWV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...