5G4VC

Association of four two-k-turn units based on kt-7 3bg,3nc, forming a square-shaped structure
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
117
structure length
117
Chain Sequence
SYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HMKT-7
publication title A Quasi-Cyclic RNA Nano-Scale Molecular Object Constructed Using Kink Turns.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Dna binding
total genus 37
structure length 117
sequence length 117
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5g4vC00
3RA6A 4NUTA 5G4VC 1IPAA 3VMFB 2BO1A 2KG4A 1VQ4F 1T0KB 3NMUC 3CCSF 3CCMF 5DCVA 1VQMF 1W2BF 2FC3A 1ZWZA 3CC7F 2I6DA 2WALA 2OHWA 1VQPF 3J80M 3SIVA 4BY9D 1VQ6F 3CG6A 1GO0A 1Q81H 3CCLF 2LBWA 3OBWA 2KTUA 3N4ZA 1PXWA 1W40A 1S72F 1X7PA 3I56F 3PAFA 3CCJF 1XBIA 5EWRA 2OTJF 1YIJF 1H7MA 5FJ4C 3GYQA 5EO3A 1VQLF 2AIFA 3LWVC 1YHQF 3CC2F 1M1KH 3NVKE 2CZWA 2KTVA 3CMEF 2QA4F 1VQ5F 1GZ0A 1Q86H 1KD1H 2ALEA 1K73H 3CC4F 3CD6F 1Q7YH 2VGNA 3G4SF 5IT9M 1W41A 3RA5A 3JAMM 1KQSF 4TZZA 5FLXM 1W3EX 1QVFF 1VQNF 3LFOA 1RA4A 3G71F 3MCAB 3OW2F 1K9MH 2HVYD 1YITF 3AGKA 3CCEF 3CCUF 4BW0B 3LWOC 3J7AR 1VQ7F 1DT9A 1YI2F 1VQ8F 1CN7A 3SIUA 3NVIB 3LWQC 3V7EA 3V7QA 4LCKA 1QVGF 3WXMB 3ON1A 2OZBA 3G6EF 1E7KA 1RLGA 3N4YA 5GAPK 1YJWF 3JCMM 4X3MA 2LBXA 3FFMA 3IR9A 1JJ2F 1SDSA 1M90H 1X7OA 2QI2A 1X52A 4X3LA 1CK2A 2VGMA 1N8RH 2OTLF 3LWRC 5GANK 3CCRF 1NMUB 5A2QM 4C4WC 1NJIH 1K8AH 3J81M 1VQKF 3HJWC 3NK7A 3PLAC 3NK6A 3O85A 3CXCF 1Q82H 1VQ9F 5G4UC 1W42A 3I55F 3VI6A 3CCVF 1KC8H 2QEXF 3CPQA 5GIPC 3LWPC 5GINC 1YJNF 3E1YA 3CCQF 1YJ9F 3OBYA 3CMAF 3E20B 1VQOF 1GO1A 3HAXD 5GIOC 3CPWF 2JNBA
chains in the Genus database with same CATH superfamily
2KG4A 4X1KB 1FNJA 1VQ4F 3NMUC 5DCVA 2Q1YA 2GVIA 1UI9A 3KHNA 4BVTA 3CC7F 3D01A 3ZP7A 4ZI7A 2OHWA 4ZK7A 1VQPF 2Z1UA 3J80M 5ITZA 2DYYA 2HS4A 2UYPA 5LYJA 1Q81H 3TD3A 3OBWA 4RHAA 1PXWA 4TV9B 3FD5A 4DXDA 4O2AB 1X7PA 3PAFA 4EI7A 1RQ2A 4I4TA 2PHNA 4O4JA 1YHQF 5JCOC 2R751 3CMEF 1Q86H 5JCOA 3C8LA 2ALEA 3K14A 1K73H 3VYSC 3CD6F 1Q7YH 3RYIA 2GLZA 3RA5A 1KQSF 5C8YA 1NQ3A 1QVFF 4BVQA 3WJPA 3F0GA 5HXZA 4R40B 3RYHB 3VOAA 1YITF 3WPXA 4O4LB 1ONIA 4O2BA 3QTYA 3CCUF 3QHDA 3K12A 3HKCB 4IIJB 5EAZA 1VQ7F 1DT9A 2R6R1 5JQGB 1CN7A 4BT2A 3SIUA 3V7EA 3V7QA 1Q8RA 2HS0A 4F6RA 2HQSC 3JAWA 5MN4A 2K1SA 1IV3A 2LCAA 3FFMA 3OONA 3KJKA 4U3JA 5C8YB 1FFXB 5LA6B 3JATB 1SDSA 1M90H 1X7OA 2IG8A 3WJRA 3S03A 1X25A 2ZODA 2OTLF 3C9TA 3UT5A 3T80A 4EB6B 1JY8A 3S0HA 2OTMA 1NMUB 4PWTA 5IJ0A 1NJIH 3J81M 1VQKF 2H8EA 3NK6A 4B45A 5CB4A 3TD5A 1ODEA 4I55A 4F6RB 2Z1TA 2VXYA 2FGYA 4X1YA 1VQ9F 1KC8H 3CCVF 1U43A 2QEXF 3CPQA 2HP3A 4TV8B 1YJNF 3I3FA 3M84A 3WJQA 1JD1A 3MQWA 4U3JB 4ZHQA 3EORA 2UYNB 3E22B 1JN1A 3S06A 2G9IA 3FPIA 2KGWA 2RHLA 1T0KB 3UT5B 3CCMF 1XRGA 5JVDA 1W5AA 2FC3A 5J2TB 3C9SA 1KNKA 2I6DA 3HKEB 1GX1A 3L7QA 4X1IB 1RQ7A 4DRXA 5CB4B 2LBTA 4I55B 1FNKA 2LBWA 5LXTA 1QU9A 2KTUA 3N4ZA 1W40A 4X20B 4BT7A 2F9ZC 3K2XA 2BTOA 4O4IA 2EWCA 3IKFA 5J2UA 3CCJF 5EWRA 2PMPA 1YQNA 3U0OA 5EO3A 1TVKA 1YGYA 2AIFA 5IYZA 1VQLF 4G4WA 5HWEA 2YXZA 3R0PA 2W8BC 4I50A 1PF5A 5JVDB 5HY0A 3F0DA 5LP6B 3G4SF 1W41A 4WBNA 4B46A 3F0EA 2V9YA 2I6RA 4FFBA 1RA4A 5LXTB 3OW2F 3HKDA 5EIBD 3CB2A 4KWEA 4BW0B 4C8GA 3VIUA 4C8EA 5HY2A 3Q8HA 1TVKB 4G88A 5B8FA 2CSLA 3NVIB 3HTNA 2UYKA 5MN6A 4LCKA 3RYCA 1OFUA 3IEQA 4I50B 3ON1A 2CHTA 3JVHA 3G6EF 3K0TA 4HNAA 3HWUA 4ZI7B 3VTIC 1DBFA 2ZF8A 5ITZB 3S0WA 3VYUC 2LBXA 5KX5A 3IR9A 5LYJB 3M1XA 2AMTA 2QI2A 2Z1EA 1X52A 4X3LA 2CW4A 3HKDB 2VGMA 1N8RH 1T0AA 1VQVA 5GANK 2AIZP 3CCRF 4I4TB 3GTZA 4NWOB 4ZHVA 5BMVA 4O4JB 1W57A 4C4WC 1U40A 3HJWC 1QD9A 3PLAC 4B62A 3HKBA 4YJ3A 2MQEA 4TUYA 2HRYA 5HP8A 1XV2A 3I55F 3RYIB 3P0ZA 5MN5A 1YJ9F 4ERHA 5JH7A 3E20B 2CVLA 1JFFA 1VK3A 2ZAUA 5GIOC 1CLIA 5HP7A 4O2BB 1IPAA 3VMFB 3CCSF 2Q1XA 4M8IA 2N48A 1ZWZA 3FD6A 3JASA 2WALA 5AVMA 3BYQA 5CA0A 1VQ6F 3HKBB 4TUYB 2P6YA 3CCLF 3JAWB 5IJ9A 2B33A 3RYFA 1H47A 1W5FA 3KE1A 2ZVZA 5EYPA 2OTJF 4BT3A 3VCZA 5FJ4C 2L26A 1JFFB 3MBMA 1SA0A 3NVKE 3KIZA 2RB9A 3CYPB 4XCQA 3CC4F 3JASB 5IJ0B 5IT9M 2HP0A 4ZOLA 5EB1B 4BT6A 4E6EA 5FLXM 1W3EX 2IQQA 4X1YB 3LFOA 1VQNF 3MCAB 5EIBC 5KMGA 5LOVA 1K9MH 2HVYD 3AGKA 1IV2A 4ZHQB 1U3PA 3FBAA 4EI8A 2IAFA 3QUWA 3J7AR 2UYJA 4C8IA 5LP6C 1YI2F 2HRUA 1VQ8F 4BVRA 3IEWA 1SA0B 3LWQC 3GHZA 5HY1A 4YJ2A 3WXMB 1VH8A 2OZBA 4BVSA 2CHSA 5GAPK 4TV9A 4RQOA 3ESJA 1W55A 3JCMM 4X3MA 4DRXB 1JJ2F 3VO8A 3JARA 3WGJA 2HX0A 2UZHA 4G4VA 5EZYA 3ZOPA 4O4IB 5LOVB 4O4HA 5J2UB 1UFYA 2DT4A 3LMEA 3LWRC 3WGLA 5EB0A 3WPWA 5IYZB 5A2QM 2BTUA 2BTQB 4LNUA 4YJ2B 1TUBA 1RLUA 1Q82H 3CYQA 2Z1FA 4ZHYB 3N2GA 5G4UC 3LWPC 2VAWA 3RYHA 4WBNB 1VHAA 4O4LA 3C9RA 3CCQF 1U3LA 3OBYA 3CMAF 3HKCA 2Z01A 4IIJA 4FFBB 3JARB 3V3TA 5EZYB 5JQGA 3D00A 3CPWF 4O4HB 3RA6A 4NUTA 1W5EA 5G4VC 1OAPA 2BO1A 4BT4A 1IV4A 4BT5A 1VQMF 1W2BF 3N2KA 3P10A 4C81A 4G4ZA 3SIVA 4BY9D 3CG6A 4LNUB 3RYCB 3WGNA 1J7HA 1GO0A 1TUBB 2ZOVA 1FFXA 5LA6A 3JATA 3WGKA 4HNAB 2ZVYA 3N2GB 5GONA 4C82A 2VAMA 3JAKA 1S72F 3I56F 1XBIA 5KX5B 1Z5WA 3S02A 1YIJF 1H7MA 1KNJA 1W5BA 4U39A 3M4SA 4EB6A 3GYQA 3LWVC 3LDTA 5CA1A 3CC2F 3D54A 1M1KH 2CZWA 2KTVA 3LYBA 1VQ5F 2QA4F 1GZ0A 1KD1H 1COMA 2HS3A 3ELCA 1IV1A 2RHHA 5BMVB 3RE3A 3N2KB 2VGNA 1QAHA 1FSZA 4TV8A 5FNVA 1SZQA 3JAMM 4NQ3A 4TZZA 4YJ3B 5HY4A 4ZHWA 1W59A 2UYNA 3ZP4A 3G71F 3E22A 3IMPA 3ZO8A 3B6NA 2RHJA 5GONB 3JAKB 1XHOA 3CCEF 5JH7B 3MCQA 2CWJA 3LWOC 2H6LA 4G4XA 5J2TA 3JALA 3HKEA 3C9UA 5CA1B 3I7TA 4X1IA 1Z5VA 2H8CA 3V4DA 1QVGF 3KJJA 5HXUA 4IHJA 3TD4A 1E7KA 1RLGA 3N4YA 2QTPA 1YJWF 3MDOA 4X20A 3DC2A 5FNVB 5CA0B 1W581 3VYTC 3ERNA 2YYEA 5IJ9B 3P4EA 1CK2A 3RYFB 1R1MA 2RHOA 3DDNA 4X1KA 5EYPB 3VOBA 3IKEA 2GZLA 2NMUA 3F6MA 4EI9A 3JALB 3WGMA 1K8AH 5LP6A 3NK7A 2VAPA 3O85A 3CXCF 4IHJB 1W42A 3VI6A 4O2AA 5GIPC 5GINC 2HP0B 3E1YA 3F0FA 4ZOLB 1H48A 3S0YA 4B5CA 1VQOF 1GO1A 3HAXD 5KMGB 4G4YA 2JNBA
chains in the Genus database with same CATH topology
3RA6A 4NUTA 5G4VC 1IPAA 3VMFB 2BO1A 2KG4A 1VQ4F 1T0KB 3NMUC 3CCSF 3CCMF 5DCVA 1VQMF 1W2BF 2FC3A 4BVTA 1ZWZA 3CC7F 2I6DA 2WALA 2OHWA 1VQPF 3J80M 3SIVA 4BY9D 1VQ6F 3CG6A 1GO0A 1Q81H 3CCLF 2LBWA 3OBWA 2KTUA 3N4ZA 1PXWA 1W40A 2F9ZC 1S72F 1X7PA 3I56F 3PAFA 3CCJF 1XBIA 5EWRA 2OTJF 1YIJF 1H7MA 5FJ4C 4EI7A 3GYQA 5EO3A 1VQLF 2AIFA 3LWVC 1YHQF 3CC2F 5HWEA 1M1KH 3NVKE 2CZWA 2KTVA 3CMEF 2QA4F 1VQ5F 1GZ0A 1Q86H 1KD1H 2ALEA 4XCQA 1K73H 3CC4F 5HY0A 3CD6F 1Q7YH 2VGNA 3G4SF 5IT9M 1W41A 2GLZA 3RA5A 3JAMM 1KQSF 4NQ3A 4TZZA 5FLXM 1W3EX 1QVFF 5HY4A 1VQNF 3LFOA 4BVQA 1RA4A 3G71F 3MCAB 3OW2F 1K9MH 2HVYD 5HXZA 1YITF 3AGKA 3CCEF 3CCUF 4BW0B 4EI8A 3LWOC 3J7AR 5HY2A 1VQ7F 1DT9A 1YI2F 1VQ8F 4BVRA 1CN7A 3SIUA 3NVIB 3LWQC 3V7EA 3V7QA 5HY1A 4LCKA 1QVGF 5HXUA 3WXMB 3ON1A 2OZBA 4BVSA 3G6EF 1E7KA 1RLGA 3N4YA 5GAPK 1YJWF 3JCMM 4X3MA 2LBXA 3FFMA 3IR9A 1JJ2F 1SDSA 1M90H 1X7OA 2QI2A 1X52A 4X3LA 1CK2A 2VGMA 1N8RH 2OTLF 3LWRC 5GANK 3CCRF 4EI9A 1NMUB 5A2QM 4C4WC 1NJIH 1K8AH 3J81M 1VQKF 3HJWC 3NK7A 3PLAC 3NK6A 3O85A 3CXCF 1Q82H 2FGYA 1VQ9F 5G4UC 1W42A 3I55F 3VI6A 3CCVF 1KC8H 2QEXF 3CPQA 5GIPC 3LWPC 5GINC 1YJNF 3E1YA 3CCQF 1YJ9F 3OBYA 3CMAF 3E20B 1VQOF 1GO1A 3HAXD 5GIOC 3V3TA 3D00A 3CPWF 2JNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RA6 A;  4NUT A;  5G4V C;  1IPA A;  3VMF B;  2BO1 A;  2KG4 A;  1VQ4 F;  1T0K B;  3NMU C;  3CCS F;  3CCM F;  5DCV A;  1VQM F;  1W2B F;  2FC3 A;  1ZWZ A;  3CC7 F;  2I6D A;  2WAL A;  2OHW A;  1VQP F;  3J80 M;  3SIV A;  4BY9 D;  1VQ6 F;  3CG6 A;  1GO0 A;  1Q81 H;  3CCL F;  2LBW A;  3OBW A;  2KTU A;  3N4Z A;  1PXW A;  1W40 A;  1S72 F;  1X7P A;  3I56 F;  3PAF A;  3CCJ F;  1XBI A;  5EWR A;  2OTJ F;  1YIJ F;  1H7M A;  5FJ4 C;  3GYQ A;  5EO3 A;  1VQL F;  2AIF A;  3LWV C;  1YHQ F;  3CC2 F;  1M1K H;  3NVK E;  2CZW A;  2KTV A;  3CME F;  2QA4 F;  1VQ5 F;  1GZ0 A;  1Q86 H;  1KD1 H;  2ALE A;  1K73 H;  3CC4 F;  3CD6 F;  1Q7Y H;  2VGN A;  3G4S F;  5IT9 M;  1W41 A;  3RA5 A;  3JAM M;  1KQS F;  4TZZ A;  5FLX M;  1W3E X;  1QVF F;  1VQN F;  3LFO A;  1RA4 A;  3G71 F;  3MCA B;  3OW2 F;  1K9M H;  2HVY D;  1YIT F;  3AGK A;  3CCE F;  3CCU F;  4BW0 B;  3LWO C;  3J7A R;  1VQ7 F;  1DT9 A;  1YI2 F;  1VQ8 F;  1CN7 A;  3SIU A;  3NVI B;  3LWQ C;  3V7E A;  3V7Q A;  4LCK A;  1QVG F;  3WXM B;  3ON1 A;  2OZB A;  3G6E F;  1E7K A;  1RLG A;  3N4Y A;  5GAP K;  1YJW F;  3JCM M;  4X3M A;  2LBX A;  3FFM A;  3IR9 A;  1JJ2 F;  1SDS A;  1M90 H;  1X7O A;  2QI2 A;  1X52 A;  4X3L A;  1CK2 A;  2VGM A;  1N8R H;  2OTL F;  3LWR C;  5GAN K;  3CCR F;  1NMU B;  5A2Q M;  4C4W C;  1NJI H;  1K8A H;  3J81 M;  1VQK F;  3HJW C;  3NK7 A;  3PLA C;  3NK6 A;  3O85 A;  3CXC F;  1Q82 H;  1VQ9 F;  5G4U C;  1W42 A;  3I55 F;  3VI6 A;  3CCV F;  1KC8 H;  2QEX F;  3CPQ A;  5GIP C;  3LWP C;  5GIN C;  1YJN F;  3E1Y A;  3CCQ F;  1YJ9 F;  3OBY A;  3CMA F;  3E20 B;  1VQO F;  1GO1 A;  3HAX D;  5GIO C;  3CPW F;  2JNB A; 
#chains in the Genus database with same CATH topology
 2KG4 A;  4X1K B;  1FNJ A;  1VQ4 F;  3NMU C;  5DCV A;  2Q1Y A;  2GVI A;  1UI9 A;  3KHN A;  4BVT A;  3CC7 F;  3D01 A;  3ZP7 A;  4ZI7 A;  2OHW A;  4ZK7 A;  1VQP F;  2Z1U A;  3J80 M;  5ITZ A;  2DYY A;  2HS4 A;  2UYP A;  5LYJ A;  1Q81 H;  3TD3 A;  3OBW A;  4RHA A;  1PXW A;  4TV9 B;  3FD5 A;  4DXD A;  4O2A B;  1X7P A;  3PAF A;  4EI7 A;  1RQ2 A;  4I4T A;  2PHN A;  4O4J A;  1YHQ F;  5JCO C;  2R75 1;  3CME F;  1Q86 H;  5JCO A;  3C8L A;  2ALE A;  3K14 A;  1K73 H;  3VYS C;  3CD6 F;  1Q7Y H;  3RYI A;  2GLZ A;  3RA5 A;  1KQS F;  5C8Y A;  1NQ3 A;  1QVF F;  4BVQ A;  3WJP A;  3F0G A;  5HXZ A;  4R40 B;  3RYH B;  3VOA A;  1YIT F;  3WPX A;  4O4L B;  1ONI A;  4O2B A;  3QTY A;  3CCU F;  3QHD A;  3K12 A;  3HKC B;  4IIJ B;  5EAZ A;  1VQ7 F;  1DT9 A;  2R6R 1;  5JQG B;  1CN7 A;  4BT2 A;  3SIU A;  3V7E A;  3V7Q A;  1Q8R A;  2HS0 A;  4F6R A;  2HQS C;  3JAW A;  5MN4 A;  2K1S A;  1IV3 A;  2LCA A;  3FFM A;  3OON A;  3KJK A;  4U3J A;  5C8Y B;  1FFX B;  5LA6 B;  3JAT B;  1SDS A;  1M90 H;  1X7O A;  2IG8 A;  3WJR A;  3S03 A;  1X25 A;  2ZOD A;  2OTL F;  3C9T A;  3UT5 A;  3T80 A;  4EB6 B;  1JY8 A;  3S0H A;  2OTM A;  1NMU B;  4PWT A;  5IJ0 A;  1NJI H;  3J81 M;  1VQK F;  2H8E A;  3NK6 A;  4B45 A;  5CB4 A;  3TD5 A;  1ODE A;  4I55 A;  4F6R B;  2Z1T A;  2VXY A;  2FGY A;  4X1Y A;  1VQ9 F;  1KC8 H;  3CCV F;  1U43 A;  2QEX F;  3CPQ A;  2HP3 A;  4TV8 B;  1YJN F;  3I3F A;  3M84 A;  3WJQ A;  1JD1 A;  3MQW A;  4U3J B;  4ZHQ A;  3EOR A;  2UYN B;  3E22 B;  1JN1 A;  3S06 A;  2G9I A;  3FPI A;  2KGW A;  2RHL A;  1T0K B;  3UT5 B;  3CCM F;  1XRG A;  5JVD A;  1W5A A;  2FC3 A;  5J2T B;  3C9S A;  1KNK A;  2I6D A;  3HKE B;  1GX1 A;  3L7Q A;  4X1I B;  1RQ7 A;  4DRX A;  5CB4 B;  2LBT A;  4I55 B;  1FNK A;  2LBW A;  5LXT A;  1QU9 A;  2KTU A;  3N4Z A;  1W40 A;  4X20 B;  4BT7 A;  2F9Z C;  3K2X A;  2BTO A;  4O4I A;  2EWC A;  3IKF A;  5J2U A;  3CCJ F;  5EWR A;  2PMP A;  1YQN A;  3U0O A;  5EO3 A;  1TVK A;  1YGY A;  2AIF A;  5IYZ A;  1VQL F;  4G4W A;  5HWE A;  2YXZ A;  3R0P A;  2W8B C;  4I50 A;  1PF5 A;  5JVD B;  5HY0 A;  3F0D A;  5LP6 B;  3G4S F;  1W41 A;  4WBN A;  4B46 A;  3F0E A;  2V9Y A;  2I6R A;  4FFB A;  1RA4 A;  5LXT B;  3OW2 F;  3HKD A;  5EIB D;  3CB2 A;  4KWE A;  4BW0 B;  4C8G A;  3VIU A;  4C8E A;  5HY2 A;  3Q8H A;  1TVK B;  4G88 A;  5B8F A;  2CSL A;  3NVI B;  3HTN A;  2UYK A;  5MN6 A;  4LCK A;  3RYC A;  1OFU A;  3IEQ A;  4I50 B;  3ON1 A;  2CHT A;  3JVH A;  3G6E F;  3K0T A;  4HNA A;  3HWU A;  4ZI7 B;  3VTI C;  1DBF A;  2ZF8 A;  5ITZ B;  3S0W A;  3VYU C;  2LBX A;  5KX5 A;  3IR9 A;  5LYJ B;  3M1X A;  2AMT A;  2QI2 A;  2Z1E A;  1X52 A;  4X3L A;  2CW4 A;  3HKD B;  2VGM A;  1N8R H;  1T0A A;  1VQV A;  5GAN K;  2AIZ P;  3CCR F;  4I4T B;  3GTZ A;  4NWO B;  4ZHV A;  5BMV A;  4O4J B;  1W57 A;  4C4W C;  1U40 A;  3HJW C;  1QD9 A;  3PLA C;  4B62 A;  3HKB A;  4YJ3 A;  2MQE A;  4TUY A;  2HRY A;  5HP8 A;  1XV2 A;  3I55 F;  3RYI B;  3P0Z A;  5MN5 A;  1YJ9 F;  4ERH A;  5JH7 A;  3E20 B;  2CVL A;  1JFF A;  1VK3 A;  2ZAU A;  5GIO C;  1CLI A;  5HP7 A;  4O2B B;  1IPA A;  3VMF B;  3CCS F;  2Q1X A;  4M8I A;  2N48 A;  1ZWZ A;  3FD6 A;  3JAS A;  2WAL A;  5AVM A;  3BYQ A;  5CA0 A;  1VQ6 F;  3HKB B;  4TUY B;  2P6Y A;  3CCL F;  3JAW B;  5IJ9 A;  2B33 A;  3RYF A;  1H47 A;  1W5F A;  3KE1 A;  2ZVZ A;  5EYP A;  2OTJ F;  4BT3 A;  3VCZ A;  5FJ4 C;  2L26 A;  1JFF B;  3MBM A;  1SA0 A;  3NVK E;  3KIZ A;  2RB9 A;  3CYP B;  4XCQ A;  3CC4 F;  3JAS B;  5IJ0 B;  5IT9 M;  2HP0 A;  4ZOL A;  5EB1 B;  4BT6 A;  4E6E A;  5FLX M;  1W3E X;  2IQQ A;  4X1Y B;  3LFO A;  1VQN F;  3MCA B;  5EIB C;  5KMG A;  5LOV A;  1K9M H;  2HVY D;  3AGK A;  1IV2 A;  4ZHQ B;  1U3P A;  3FBA A;  4EI8 A;  2IAF A;  3QUW A;  3J7A R;  2UYJ A;  4C8I A;  5LP6 C;  1YI2 F;  2HRU A;  1VQ8 F;  4BVR A;  3IEW A;  1SA0 B;  3LWQ C;  3GHZ A;  5HY1 A;  4YJ2 A;  3WXM B;  1VH8 A;  2OZB A;  4BVS A;  2CHS A;  5GAP K;  4TV9 A;  4RQO A;  3ESJ A;  1W55 A;  3JCM M;  4X3M A;  4DRX B;  1JJ2 F;  3VO8 A;  3JAR A;  3WGJ A;  2HX0 A;  2UZH A;  4G4V A;  5EZY A;  3ZOP A;  4O4I B;  5LOV B;  4O4H A;  5J2U B;  1UFY A;  2DT4 A;  3LME A;  3LWR C;  3WGL A;  5EB0 A;  3WPW A;  5IYZ B;  5A2Q M;  2BTU A;  2BTQ B;  4LNU A;  4YJ2 B;  1TUB A;  1RLU A;  1Q82 H;  3CYQ A;  2Z1F A;  4ZHY B;  3N2G A;  5G4U C;  3LWP C;  2VAW A;  3RYH A;  4WBN B;  1VHA A;  4O4L A;  3C9R A;  3CCQ F;  1U3L A;  3OBY A;  3CMA F;  3HKC A;  2Z01 A;  4IIJ A;  4FFB B;  3JAR B;  3V3T A;  5EZY B;  5JQG A;  3D00 A;  3CPW F;  4O4H B;  3RA6 A;  4NUT A;  1W5E A;  5G4V C;  1OAP A;  2BO1 A;  4BT4 A;  1IV4 A;  4BT5 A;  1VQM F;  1W2B F;  3N2K A;  3P10 A;  4C81 A;  4G4Z A;  3SIV A;  4BY9 D;  3CG6 A;  4LNU B;  3RYC B;  3WGN A;  1J7H A;  1GO0 A;  1TUB B;  2ZOV A;  1FFX A;  5LA6 A;  3JAT A;  3WGK A;  4HNA B;  2ZVY A;  3N2G B;  5GON A;  4C82 A;  2VAM A;  3JAK A;  1S72 F;  3I56 F;  1XBI A;  5KX5 B;  1Z5W A;  3S02 A;  1YIJ F;  1H7M A;  1KNJ A;  1W5B A;  4U39 A;  3M4S A;  4EB6 A;  3GYQ A;  3LWV C;  3LDT A;  5CA1 A;  3CC2 F;  3D54 A;  1M1K H;  2CZW A;  2KTV A;  3LYB A;  1VQ5 F;  2QA4 F;  1GZ0 A;  1KD1 H;  1COM A;  2HS3 A;  3ELC A;  1IV1 A;  2RHH A;  5BMV B;  3RE3 A;  3N2K B;  2VGN A;  1QAH A;  1FSZ A;  4TV8 A;  5FNV A;  1SZQ A;  3JAM M;  4NQ3 A;  4TZZ A;  4YJ3 B;  5HY4 A;  4ZHW A;  1W59 A;  2UYN A;  3ZP4 A;  3G71 F;  3E22 A;  3IMP A;  3ZO8 A;  3B6N A;  2RHJ A;  5GON B;  3JAK B;  1XHO A;  3CCE F;  5JH7 B;  3MCQ A;  2CWJ A;  3LWO C;  2H6L A;  4G4X A;  5J2T A;  3JAL A;  3HKE A;  3C9U A;  5CA1 B;  3I7T A;  4X1I A;  1Z5V A;  2H8C A;  3V4D A;  1QVG F;  3KJJ A;  5HXU A;  4IHJ A;  3TD4 A;  1E7K A;  1RLG A;  3N4Y A;  2QTP A;  1YJW F;  3MDO A;  4X20 A;  3DC2 A;  5FNV B;  5CA0 B;  1W58 1;  3VYT C;  3ERN A;  2YYE A;  5IJ9 B;  3P4E A;  1CK2 A;  3RYF B;  1R1M A;  2RHO A;  3DDN A;  4X1K A;  5EYP B;  3VOB A;  3IKE A;  2GZL A;  2NMU A;  3F6M A;  4EI9 A;  3JAL B;  3WGM A;  1K8A H;  5LP6 A;  3NK7 A;  2VAP A;  3O85 A;  3CXC F;  4IHJ B;  1W42 A;  3VI6 A;  4O2A A;  5GIP C;  5GIN C;  2HP0 B;  3E1Y A;  3F0F A;  4ZOL B;  1H48 A;  3S0Y A;  4B5C A;  1VQO F;  1GO1 A;  3HAX D;  5KMG B;  4G4Y A;  2JNB A; 
#chains in the Genus database with same CATH homology
 3RA6 A;  4NUT A;  5G4V C;  1IPA A;  3VMF B;  2BO1 A;  2KG4 A;  1VQ4 F;  1T0K B;  3NMU C;  3CCS F;  3CCM F;  5DCV A;  1VQM F;  1W2B F;  2FC3 A;  4BVT A;  1ZWZ A;  3CC7 F;  2I6D A;  2WAL A;  2OHW A;  1VQP F;  3J80 M;  3SIV A;  4BY9 D;  1VQ6 F;  3CG6 A;  1GO0 A;  1Q81 H;  3CCL F;  2LBW A;  3OBW A;  2KTU A;  3N4Z A;  1PXW A;  1W40 A;  2F9Z C;  1S72 F;  1X7P A;  3I56 F;  3PAF A;  3CCJ F;  1XBI A;  5EWR A;  2OTJ F;  1YIJ F;  1H7M A;  5FJ4 C;  4EI7 A;  3GYQ A;  5EO3 A;  1VQL F;  2AIF A;  3LWV C;  1YHQ F;  3CC2 F;  5HWE A;  1M1K H;  3NVK E;  2CZW A;  2KTV A;  3CME F;  2QA4 F;  1VQ5 F;  1GZ0 A;  1Q86 H;  1KD1 H;  2ALE A;  4XCQ A;  1K73 H;  3CC4 F;  5HY0 A;  3CD6 F;  1Q7Y H;  2VGN A;  3G4S F;  5IT9 M;  1W41 A;  2GLZ A;  3RA5 A;  3JAM M;  1KQS F;  4NQ3 A;  4TZZ A;  5FLX M;  1W3E X;  1QVF F;  5HY4 A;  1VQN F;  3LFO A;  4BVQ A;  1RA4 A;  3G71 F;  3MCA B;  3OW2 F;  1K9M H;  2HVY D;  5HXZ A;  1YIT F;  3AGK A;  3CCE F;  3CCU F;  4BW0 B;  4EI8 A;  3LWO C;  3J7A R;  5HY2 A;  1VQ7 F;  1DT9 A;  1YI2 F;  1VQ8 F;  4BVR A;  1CN7 A;  3SIU A;  3NVI B;  3LWQ C;  3V7E A;  3V7Q A;  5HY1 A;  4LCK A;  1QVG F;  5HXU A;  3WXM B;  3ON1 A;  2OZB A;  4BVS A;  3G6E F;  1E7K A;  1RLG A;  3N4Y A;  5GAP K;  1YJW F;  3JCM M;  4X3M A;  2LBX A;  3FFM A;  3IR9 A;  1JJ2 F;  1SDS A;  1M90 H;  1X7O A;  2QI2 A;  1X52 A;  4X3L A;  1CK2 A;  2VGM A;  1N8R H;  2OTL F;  3LWR C;  5GAN K;  3CCR F;  4EI9 A;  1NMU B;  5A2Q M;  4C4W C;  1NJI H;  1K8A H;  3J81 M;  1VQK F;  3HJW C;  3NK7 A;  3PLA C;  3NK6 A;  3O85 A;  3CXC F;  1Q82 H;  2FGY A;  1VQ9 F;  5G4U C;  1W42 A;  3I55 F;  3VI6 A;  3CCV F;  1KC8 H;  2QEX F;  3CPQ A;  5GIP C;  3LWP C;  5GIN C;  1YJN F;  3E1Y A;  3CCQ F;  1YJ9 F;  3OBY A;  3CMA F;  3E20 B;  1VQO F;  1GO1 A;  3HAX D;  5GIO C;  3V3T A;  3D00 A;  3CPW F;  2JNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...