5G4VC

Association of four two-k-turn units based on kt-7 3bg,3nc, forming a square-shaped structure
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
117
structure length
117
Chain Sequence
SYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Quasi-Cyclic RNA Nano-Scale Molecular Object Constructed Using Kink Turns.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Dna binding
molecule keywords HMKT-7
total genus 37
structure length 117
sequence length 117
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5g4vC00
3J80M 3I55F 1RA4A 3J81M 5G4VC 3JCMM 3LWOC 5A2QM 1K73H 3NK6A 1VQ7F 5GAPK 3SIVA 1W3EX 2KTVA 1RLGA 3GYQA 1YIJF 3LWRC 1M90H 3CCJF 3AGKA 1JJ2F 4X3MA 2CZWA 5EO3A 2OZBA 1VQLF 1YI2F 4BY9D 2QI2A 3HJWC 1Q82H 4LCKA 3FFMA 3LWPC 1VQMF 3HAXD 2VGMA 1X52A 3CC7F 3G4SF 1E7KA 3CC2F 2KTUA 1X7PA 1NJIH 1KD1H 1W2BF 3RA5A 1GO1A 3V7QA 2KG4A 3NK7A 4TZZA 3CCQF 3OW2F 1QVGF 3G6EF 2AIFA 5G4UC 3VI6A 5DCVA 1ZWZA 3VMFB 3NVIB 2OTLF 5FLXM 1VQ6F 4C4WC 3NMUC 1K9MH 3PAFA 1VQ4F 3MCAB 3CG6A 3WXMB 3CD6F 1W41A 3E1YA 3CCRF 1Q86H 2LBWA 1SDSA 3CPQA 3CXCF 3O85A 3N4YA 1KQSF 1DT9A 3LWVC 1VQ8F 3CCUF 3V7EA 5FJ4C 1IPAA 3ON1A 1VQPF 1KC8H 1Q81H 2BO1A 1YJNF 1QVFF 2QA4F 3JAMM 3CMAF 2ALEA 3CMEF 1PXWA 3RA6A 3N4ZA 2OHWA 5GIOC 4NUTA 1N8RH 3G71F 1VQKF 3CCVF 5GIPC 1VQ5F 1W40A 3E20B 1S72F 1YJ9F 2VGNA 3LWQC 3CCEF 5IT9M 1T0KB 1VQ9F 5EWRA 2OTJF 3SIUA 1GZ0A 1X7OA 1YITF 1W42A 2LBXA 4X3LA 2QEXF 1YJWF 1M1KH 1Q7YH 3J7AR 4BW0B 1NMUB 3CCMF 1H7MA 1CN7A 3CPWF 1YHQF 2HVYD 3OBWA 3NVKE 1VQNF 3CCSF 1VQOF 1GO0A 2WALA 5GINC 5GANK 1K8AH 1CK2A 3CC4F 1XBIA 3CCLF 3OBYA 3IR9A 3I56F 3LFOA 2I6DA 2FC3A 3PLAC 2JNBA
chains in the Genus database with same CATH superfamily
2VAWA 4I55A 4HNAA 3J81M 1RLUA 4DRXB 2LBTA 2BTUA 1R1MA 1Z5VA 5GAPK 2IAFA 3WGLA 1FFXA 5LA6B 1QU9A 3M84A 3K2XA 3CCJF 3WGKA 3K0TA 3RYIA 3F0DA 3HJWC 2AMTA 3B6NA 1Q82H 3HAXD 3VYTC 3ELCA 3CC7F 4B45A 4ZOLA 3MDOA 2H8EA 2RHLA 1SA0B 3CC2F 3JAKB 1W2BF 2RHOA 2OTMA 5C8YB 3NK7A 4YJ2A 3OW2F 2ZAUA 5G4UC 4C8GA 1ZWZA 1IV2A 2KGWA 1VQ6F 1VHAA 3FBAA 1OAPA 3F6MA 3IEQA 1OFUA 3JAWB 3PAFA 4X20B 3S06A 4EB6A 1H48A 1Q86H 2CWJA 3RYCB 4X1YB 3WJQA 1SDSA 3O85A 5MN4A 2CW4A 5LP6B 4KWEA 3DC2A 1W57A 3WJRA 3CCUF 2Z1TA 2DT4A 5FJ4C 3E22B 1VQPF 5HY1A 3C9UA 2HP0B 1TVKA 4G4VA 1T0AA 3N4ZA 3KJJA 5HP7A 2BTQB 2CHTA 1IV1A 4TUYA 1W40A 4TUYB 2ZF8A 1VQ5F 3E20B 5KX5B 4F6RB 2RHHA 4O4HB 3WPXA 1YJ9F 1RQ2A 1VQ9F 5GONB 4I50A 4EI9A 2PMPA 3S03A 2UYNA 5FNVB 2QEXF 1YJWF 3KIZA 3J7AR 5HP8A 3F0GA 3N2KA 1W581 5CA0A 3CPWF 1YHQF 4PWTA 4BT4A 3RYCA 3OBWA 1GO0A 3IKFA 5GANK 4G4YA 1K8AH 3JASA 3E22A 3CC4F 4O4JB 3IMPA 4C8EA 5LXTA 3I56F 1JD1A 5FNVA 5LP6A 5A2QM 1JY8A 4LNUA 4TV8B 1NQ3A 5LOVB 3NK6A 5HY2A 1K73H 2H8CA 1ODEA 3SIVA 1RLGA 3GYQA 1QAHA 1TUBA 3M4SA 3ZOPA 3AGKA 1JJ2F 2IQQA 5EO3A 3K14A 1VH8A 5IJ0B 3Q8HA 2VAMA 4LCKA 1U40A 4ZHQA 3LWPC 1VQMF 2VGMA 4O4JA 1X52A 5EIBC 3P4EA 4X1YA 1VQVA 3G4SF 1X7PA 3CYPB 3JAKA 3TD5A 2HP3A 1GO1A 3JALB 4F6RA 2UYKA 3HKBB 3CCQF 1SZQA 1KNJA 4R40B 5CA0B 4O4IA 5IJ9B 3QTYA 5DCVA 2CHSA 1X25A 3NVIB 3N2GA 2OTLF 3VYUC 4C4WC 1K9MH 5C8YA 3D54A 1CLIA 1VQ4F 1W59A 3MCAB 4EI8A 1XV2A 5EB1B 5CB4B 3WXMB 2EWCA 3WGJA 3R0PA 2LBWA 1FNKA 1KNKA 3K12A 4BVQA 4DXDA 4I4TB 2ZVYA 3JAWA 3P0ZA 1IPAA 3IEWA 3ON1A 4B62A 3ERNA 5HXZA 1YJNF 4HNAB 3JAMM 2ALEA 1N8RH 1W5EA 3D00A 4YJ3B 5JVDB 1W5FA 4YJ2B 5EAZA 3ZO8A 3QUWA 2VAPA 4G4ZA 5CB4A 3TD4A 1Z5WA 2IG8A 3VO8A 2OTJF 2HQSC 5KMGA 1GZ0A 1H47A 1RQ7A 1X7OA 1W55A 3WGNA 3N2GB 2B33A 3BYQA 2G9IA 4BW0B 2F9ZC 1CN7A 3TD3A 5MN6A 3C9SA 3HKCB 3NVKE 3FD6A 2WALA 5LP6C 1W5AA 4BT5A 2Q1XA 2DYYA 1YQNA 4ZI7A 5BMVA 1CK2A 3LDTA 3CCLF 3CB2A 3FPIA 3OBYA 3IR9A 4TV9B 3LFOA 3HKDA 3HKDB 1U43A 3ZP4A 1RA4A 1JFFA 1QD9A 2HS4A 5JCOA 4ZHYB 5G4VC 3LWOC 5AVMA 1VQ7F 3JALA 5JVDA 3UT5B 2KTVA 2RB9A 4RQOA 1YIJF 1TUBB 3LWRC 2AIZP 2H6LA 2R6R1 4X1KA 2CZWA 3HTNA 4X1IB 4M8IA 2OZBA 1VQLF 4DRXA 3GTZA 2QI2A 4U3JA 2GVIA 4O4IB 3FFMA 3VIUA 3L7QA 3MCQA 3M1XA 3JASB 2ZODA 4BVSA 4ZHWA 2GLZA 1E7KA 3WGMA 1KD1H 1IV3A 3RA5A 4C8IA 1ONIA 2HRUA 3EORA 2KG4A 4TV8A 1U3PA 4NQ3A 4YJ3A 3G6EF 5CA1A 2YXZA 5MN5A 5IYZB 2HS0A 3V3TA 3OONA 5EZYA 2PHNA 3S0HA 3VMFB 3QHDA 5LXTB 3DDNA 5FLXM 4ZK7A 3HKBA 4ZHQB 5ITZB 1J7HA 4O2AA 4I4TA 3CG6A 3LYBA 3VYSC 3MBMA 4FFBB 4O4LB 4BT3A 3N4YA 2CVLA 1DT9A 3C9RA 3D01A 4XCQA 2UYJA 3V7EA 5J2UB 3V4DA 1W5BA 5J2TA 1PF5A 1KC8H 3HKEA 4G4XA 2QA4F 2RHJA 4I50B 3CMEF 3WJPA 1PXWA 3RA6A 2OHWA 2YYEA 4NUTA 1VQKF 5JQGA 3G71F 5KX5A 4B5CA 4EB6B 3LWQC 3CCEF 2UYPA 5EYPA 5EWRA 5LYJA 2HP0A 3SIUA 1YITF 3U0OA 1Q8RA 3IKEA 4LNUB 1W42A 2QTPA 5LOVA 2LBXA 3RYHA 3S0YA 1M1KH 3KE1A 1Q7YH 3CYQA 5EB0A 1NMUB 3JATB 5CA1B 4O2BA 1UI9A 4O4HA 2HX0A 2Z1EA 3VCZA 5GONA 1VQNF 5JQGB 1YGYA 3CCSF 4IHJB 4X20A 2ZOVA 3C9TA 2LCAA 1JN1A 3T80A 2L26A 5IJ9A 4G4WA 2I6DA 2FC3A 3PLAC 3J80M 3I55F 2HRYA 5IJ0A 3ESJA 1FSZA 3RYHB 2UYNB 3JCMM 4X1IA 4BVTA 1W3EX 1FNJA 1M90H 5HWEA 2ZVZA 1VK3A 5EIBD 3HWUA 1XHOA 2VXYA 4X3MA 4C81A 5JCOC 2P6YA 1YI2F 1JFFB 3ZP7A 4BY9D 4I55B 3N2KB 5J2UA 5ITZA 5IYZA 4RHAA 1UFYA 2FGYA 3S0WA 4IIJB 3HKEB 2BTOA 1IV4A 4ZI7B 5BMVB 5J2TB 2K1SA 3C8LA 2KTUA 5LYJB 1NJIH 2NMUA 4IHJA 2HS3A 4O2AB 3HKCA 3V7QA 3JVHA 3RE3A 4TZZA 3I7TA 3KJKA 1QVGF 4ERHA 2AIFA 4O2BB 2Z01A 3JATA 3VI6A 2Q1YA 1COMA 1TVKB 4ZOLB 2CSLA 4BT2A 4C82A 3NMUC 4U39A 4E6EA 4WBNB 2W8BC 4BT7A 1FFXB 3CD6F 1W41A 3E1YA 5EYPB 2I6RA 3CCRF 3CPQA 3CXCF 3F0EA 3GHZA 1KQSF 4NWOB 3LWVC 2Z1UA 2GZLA 1VQ8F 4G88A 3WPWA 3RYFB 3UT5A 5JH7A 1U3LA 3FD5A 1Q81H 2BO1A 2UZHA 5B8FA 2Z1FA 1QVFF 4ZHVA 3CMAF 5EZYB 1DBFA 3KHNA 5GIOC 5HY0A 3P10A 3CCVF 5GIPC 1S72F 4X1KB 2VGNA 4FFBA 4O4LA 3LMEA 3VTIC 4B46A 5HXUA 5LA6A 4BT6A 3F0FA 1T0KB 5IT9M 1GX1A 1SA0A 4EI7A 3JARA 3MQWA 2N48A 4X3LA 5JH7B 3VOBA 3RYFA 2R751 3I3FA 4TV9A 4U3JB 3CCMF 1H7MA 5KMGB 2HVYD 3RYIB 2V9YA 4BVRA 1VQOF 3S02A 4WBNA 5HY4A 5GINC 2MQEA 4IIJA 1XRGA 1XBIA 3JARB 3VOAA 2JNBA
chains in the Genus database with same CATH topology
3J80M 3I55F 1RA4A 3J81M 5G4VC 3JCMM 3LWOC 5A2QM 1K73H 3NK6A 5HY2A 1VQ7F 4BVTA 5GAPK 1W3EX 3SIVA 2KTVA 1RLGA 3GYQA 1YIJF 3LWRC 1M90H 5HWEA 3CCJF 3AGKA 1JJ2F 4X3MA 2CZWA 5EO3A 2OZBA 1VQLF 1YI2F 4BY9D 2QI2A 3HJWC 1Q82H 4LCKA 3FFMA 3LWPC 1VQMF 2FGYA 3HAXD 2VGMA 1X52A 3CC7F 4BVSA 2GLZA 3G4SF 1E7KA 3CC2F 2KTUA 1X7PA 1NJIH 1KD1H 1W2BF 3RA5A 1GO1A 3V7QA 2KG4A 3NK7A 4TZZA 3CCQF 3OW2F 1QVGF 4NQ3A 3G6EF 2AIFA 5G4UC 3VI6A 3V3TA 5DCVA 1ZWZA 3VMFB 3NVIB 2OTLF 5FLXM 1VQ6F 4C4WC 3NMUC 1K9MH 3PAFA 1VQ4F 3MCAB 4EI8A 3CG6A 3WXMB 3CD6F 1W41A 3E1YA 3CCRF 1Q86H 2LBWA 1SDSA 3CPQA 3CXCF 3O85A 3N4YA 1KQSF 1DT9A 3LWVC 4BVQA 1VQ8F 3CCUF 4XCQA 3V7EA 5FJ4C 1IPAA 3ON1A 1VQPF 1KC8H 5HXZA 2BO1A 1YJNF 1Q81H 5HY1A 1QVFF 2QA4F 3JAMM 3CMAF 2ALEA 3CMEF 1PXWA 3RA6A 3N4ZA 2OHWA 5GIOC 4NUTA 1N8RH 5HY0A 3G71F 1VQKF 3CCVF 3D00A 5GIPC 1VQ5F 1W40A 3E20B 1S72F 1YJ9F 2VGNA 3LWQC 3CCEF 5HXUA 5IT9M 1T0KB 1VQ9F 5EWRA 2OTJF 4EI7A 3SIUA 1GZ0A 1X7OA 4EI9A 1YITF 1W42A 2LBXA 4X3LA 2QEXF 1YJWF 1M1KH 1Q7YH 3J7AR 4BW0B 2F9ZC 1NMUB 3CCMF 1H7MA 1CN7A 3CPWF 1YHQF 2HVYD 3OBWA 3NVKE 4BVRA 1VQNF 3CCSF 1VQOF 1GO0A 2WALA 5HY4A 5GINC 5GANK 1K8AH 1CK2A 3CC4F 1XBIA 3CCLF 3OBYA 3IR9A 3I56F 3LFOA 2I6DA 2FC3A 3PLAC 2JNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 M;  3I55 F;  1RA4 A;  3J81 M;  5G4V C;  3JCM M;  3LWO C;  5A2Q M;  1K73 H;  3NK6 A;  1VQ7 F;  5GAP K;  3SIV A;  1W3E X;  2KTV A;  1RLG A;  3GYQ A;  1YIJ F;  3LWR C;  1M90 H;  3CCJ F;  3AGK A;  1JJ2 F;  4X3M A;  2CZW A;  5EO3 A;  2OZB A;  1VQL F;  1YI2 F;  4BY9 D;  2QI2 A;  3HJW C;  1Q82 H;  4LCK A;  3FFM A;  3LWP C;  1VQM F;  3HAX D;  2VGM A;  1X52 A;  3CC7 F;  3G4S F;  1E7K A;  3CC2 F;  2KTU A;  1X7P A;  1NJI H;  1KD1 H;  1W2B F;  3RA5 A;  1GO1 A;  3V7Q A;  2KG4 A;  3NK7 A;  4TZZ A;  3CCQ F;  3OW2 F;  1QVG F;  3G6E F;  2AIF A;  5G4U C;  3VI6 A;  5DCV A;  1ZWZ A;  3VMF B;  3NVI B;  2OTL F;  5FLX M;  1VQ6 F;  4C4W C;  3NMU C;  1K9M H;  3PAF A;  1VQ4 F;  3MCA B;  3CG6 A;  3WXM B;  3CD6 F;  1W41 A;  3E1Y A;  3CCR F;  1Q86 H;  2LBW A;  1SDS A;  3CPQ A;  3CXC F;  3O85 A;  3N4Y A;  1KQS F;  1DT9 A;  3LWV C;  1VQ8 F;  3CCU F;  3V7E A;  5FJ4 C;  1IPA A;  3ON1 A;  1VQP F;  1KC8 H;  1Q81 H;  2BO1 A;  1YJN F;  1QVF F;  2QA4 F;  3JAM M;  3CMA F;  2ALE A;  3CME F;  1PXW A;  3RA6 A;  3N4Z A;  2OHW A;  5GIO C;  4NUT A;  1N8R H;  3G71 F;  1VQK F;  3CCV F;  5GIP C;  1VQ5 F;  1W40 A;  3E20 B;  1S72 F;  1YJ9 F;  2VGN A;  3LWQ C;  3CCE F;  5IT9 M;  1T0K B;  1VQ9 F;  5EWR A;  2OTJ F;  3SIU A;  1GZ0 A;  1X7O A;  1YIT F;  1W42 A;  2LBX A;  4X3L A;  2QEX F;  1YJW F;  1M1K H;  1Q7Y H;  3J7A R;  4BW0 B;  1NMU B;  3CCM F;  1H7M A;  1CN7 A;  3CPW F;  1YHQ F;  2HVY D;  3OBW A;  3NVK E;  1VQN F;  3CCS F;  1VQO F;  1GO0 A;  2WAL A;  5GIN C;  5GAN K;  1K8A H;  1CK2 A;  3CC4 F;  1XBI A;  3CCL F;  3OBY A;  3IR9 A;  3I56 F;  3LFO A;  2I6D A;  2FC3 A;  3PLA C;  2JNB A; 
#chains in the Genus database with same CATH topology
 2VAW A;  4I55 A;  4HNA A;  3J81 M;  1RLU A;  4DRX B;  2LBT A;  2BTU A;  1R1M A;  1Z5V A;  5GAP K;  2IAF A;  3WGL A;  1FFX A;  5LA6 B;  1QU9 A;  3M84 A;  3K2X A;  3CCJ F;  3WGK A;  3K0T A;  3RYI A;  3F0D A;  3HJW C;  2AMT A;  3B6N A;  1Q82 H;  3HAX D;  3VYT C;  3ELC A;  3CC7 F;  4B45 A;  4ZOL A;  3MDO A;  2H8E A;  2RHL A;  1SA0 B;  3CC2 F;  3JAK B;  1W2B F;  2RHO A;  2OTM A;  5C8Y B;  3NK7 A;  4YJ2 A;  3OW2 F;  2ZAU A;  5G4U C;  4C8G A;  1ZWZ A;  1IV2 A;  2KGW A;  1VQ6 F;  1VHA A;  3FBA A;  1OAP A;  3F6M A;  3IEQ A;  1OFU A;  3JAW B;  3PAF A;  4X20 B;  3S06 A;  4EB6 A;  1H48 A;  1Q86 H;  2CWJ A;  3RYC B;  4X1Y B;  3WJQ A;  1SDS A;  3O85 A;  5MN4 A;  2CW4 A;  5LP6 B;  4KWE A;  3DC2 A;  1W57 A;  3WJR A;  3CCU F;  2Z1T A;  2DT4 A;  5FJ4 C;  3E22 B;  1VQP F;  5HY1 A;  3C9U A;  2HP0 B;  1TVK A;  4G4V A;  1T0A A;  3N4Z A;  3KJJ A;  5HP7 A;  2BTQ B;  2CHT A;  1IV1 A;  4TUY A;  1W40 A;  4TUY B;  2ZF8 A;  1VQ5 F;  3E20 B;  5KX5 B;  4F6R B;  2RHH A;  4O4H B;  3WPX A;  1YJ9 F;  1RQ2 A;  1VQ9 F;  5GON B;  4I50 A;  4EI9 A;  2PMP A;  3S03 A;  2UYN A;  5FNV B;  2QEX F;  1YJW F;  3KIZ A;  3J7A R;  5HP8 A;  3F0G A;  3N2K A;  1W58 1;  5CA0 A;  3CPW F;  1YHQ F;  4PWT A;  4BT4 A;  3RYC A;  3OBW A;  1GO0 A;  3IKF A;  5GAN K;  4G4Y A;  1K8A H;  3JAS A;  3E22 A;  3CC4 F;  4O4J B;  3IMP A;  4C8E A;  5LXT A;  3I56 F;  1JD1 A;  5FNV A;  5LP6 A;  5A2Q M;  1JY8 A;  4LNU A;  4TV8 B;  1NQ3 A;  5LOV B;  3NK6 A;  5HY2 A;  1K73 H;  2H8C A;  1ODE A;  3SIV A;  1RLG A;  3GYQ A;  1QAH A;  1TUB A;  3M4S A;  3ZOP A;  3AGK A;  1JJ2 F;  2IQQ A;  5EO3 A;  3K14 A;  1VH8 A;  5IJ0 B;  3Q8H A;  2VAM A;  4LCK A;  1U40 A;  4ZHQ A;  3LWP C;  1VQM F;  2VGM A;  4O4J A;  1X52 A;  5EIB C;  3P4E A;  4X1Y A;  1VQV A;  3G4S F;  1X7P A;  3CYP B;  3JAK A;  3TD5 A;  2HP3 A;  1GO1 A;  3JAL B;  4F6R A;  2UYK A;  3HKB B;  3CCQ F;  1SZQ A;  1KNJ A;  4R40 B;  5CA0 B;  4O4I A;  5IJ9 B;  3QTY A;  5DCV A;  2CHS A;  1X25 A;  3NVI B;  3N2G A;  2OTL F;  3VYU C;  4C4W C;  1K9M H;  5C8Y A;  3D54 A;  1CLI A;  1VQ4 F;  1W59 A;  3MCA B;  4EI8 A;  1XV2 A;  5EB1 B;  5CB4 B;  3WXM B;  2EWC A;  3WGJ A;  3R0P A;  2LBW A;  1FNK A;  1KNK A;  3K12 A;  4BVQ A;  4DXD A;  4I4T B;  2ZVY A;  3JAW A;  3P0Z A;  1IPA A;  3IEW A;  3ON1 A;  4B62 A;  3ERN A;  5HXZ A;  1YJN F;  4HNA B;  3JAM M;  2ALE A;  1N8R H;  1W5E A;  3D00 A;  4YJ3 B;  5JVD B;  1W5F A;  4YJ2 B;  5EAZ A;  3ZO8 A;  3QUW A;  2VAP A;  4G4Z A;  5CB4 A;  3TD4 A;  1Z5W A;  2IG8 A;  3VO8 A;  2OTJ F;  2HQS C;  5KMG A;  1GZ0 A;  1H47 A;  1RQ7 A;  1X7O A;  1W55 A;  3WGN A;  3N2G B;  2B33 A;  3BYQ A;  2G9I A;  4BW0 B;  2F9Z C;  1CN7 A;  3TD3 A;  5MN6 A;  3C9S A;  3HKC B;  3NVK E;  3FD6 A;  2WAL A;  5LP6 C;  1W5A A;  4BT5 A;  2Q1X A;  2DYY A;  1YQN A;  4ZI7 A;  5BMV A;  1CK2 A;  3LDT A;  3CCL F;  3CB2 A;  3FPI A;  3OBY A;  3IR9 A;  4TV9 B;  3LFO A;  3HKD A;  3HKD B;  1U43 A;  3ZP4 A;  1RA4 A;  1JFF A;  1QD9 A;  2HS4 A;  5JCO A;  4ZHY B;  5G4V C;  3LWO C;  5AVM A;  1VQ7 F;  3JAL A;  5JVD A;  3UT5 B;  2KTV A;  2RB9 A;  4RQO A;  1YIJ F;  1TUB B;  3LWR C;  2AIZ P;  2H6L A;  2R6R 1;  4X1K A;  2CZW A;  3HTN A;  4X1I B;  4M8I A;  2OZB A;  1VQL F;  4DRX A;  3GTZ A;  2QI2 A;  4U3J A;  2GVI A;  4O4I B;  3FFM A;  3VIU A;  3L7Q A;  3MCQ A;  3M1X A;  3JAS B;  2ZOD A;  4BVS A;  4ZHW A;  2GLZ A;  1E7K A;  3WGM A;  1KD1 H;  1IV3 A;  3RA5 A;  4C8I A;  1ONI A;  2HRU A;  3EOR A;  2KG4 A;  4TV8 A;  1U3P A;  4NQ3 A;  4YJ3 A;  3G6E F;  5CA1 A;  2YXZ A;  5MN5 A;  5IYZ B;  2HS0 A;  3V3T A;  3OON A;  5EZY A;  2PHN A;  3S0H A;  3VMF B;  3QHD A;  5LXT B;  3DDN A;  5FLX M;  4ZK7 A;  3HKB A;  4ZHQ B;  5ITZ B;  1J7H A;  4O2A A;  4I4T A;  3CG6 A;  3LYB A;  3VYS C;  3MBM A;  4FFB B;  4O4L B;  4BT3 A;  3N4Y A;  2CVL A;  1DT9 A;  3C9R A;  3D01 A;  4XCQ A;  2UYJ A;  3V7E A;  5J2U B;  3V4D A;  1W5B A;  5J2T A;  1PF5 A;  1KC8 H;  3HKE A;  4G4X A;  2QA4 F;  2RHJ A;  4I50 B;  3CME F;  3WJP A;  1PXW A;  3RA6 A;  2OHW A;  2YYE A;  4NUT A;  1VQK F;  5JQG A;  3G71 F;  5KX5 A;  4B5C A;  4EB6 B;  3LWQ C;  3CCE F;  2UYP A;  5EYP A;  5EWR A;  5LYJ A;  2HP0 A;  3SIU A;  1YIT F;  3U0O A;  1Q8R A;  3IKE A;  4LNU B;  1W42 A;  2QTP A;  5LOV A;  2LBX A;  3RYH A;  3S0Y A;  1M1K H;  3KE1 A;  1Q7Y H;  3CYQ A;  5EB0 A;  1NMU B;  3JAT B;  5CA1 B;  4O2B A;  1UI9 A;  4O4H A;  2HX0 A;  2Z1E A;  3VCZ A;  5GON A;  1VQN F;  5JQG B;  1YGY A;  3CCS F;  4IHJ B;  4X20 A;  2ZOV A;  3C9T A;  2LCA A;  1JN1 A;  3T80 A;  2L26 A;  5IJ9 A;  4G4W A;  2I6D A;  2FC3 A;  3PLA C;  3J80 M;  3I55 F;  2HRY A;  5IJ0 A;  3ESJ A;  1FSZ A;  3RYH B;  2UYN B;  3JCM M;  4X1I A;  4BVT A;  1W3E X;  1FNJ A;  1M90 H;  5HWE A;  2ZVZ A;  1VK3 A;  5EIB D;  3HWU A;  1XHO A;  2VXY A;  4X3M A;  4C81 A;  5JCO C;  2P6Y A;  1YI2 F;  1JFF B;  3ZP7 A;  4BY9 D;  4I55 B;  3N2K B;  5J2U A;  5ITZ A;  5IYZ A;  4RHA A;  1UFY A;  2FGY A;  3S0W A;  4IIJ B;  3HKE B;  2BTO A;  1IV4 A;  4ZI7 B;  5BMV B;  5J2T B;  2K1S A;  3C8L A;  2KTU A;  5LYJ B;  1NJI H;  2NMU A;  4IHJ A;  2HS3 A;  4O2A B;  3HKC A;  3V7Q A;  3JVH A;  3RE3 A;  4TZZ A;  3I7T A;  3KJK A;  1QVG F;  4ERH A;  2AIF A;  4O2B B;  2Z01 A;  3JAT A;  3VI6 A;  2Q1Y A;  1COM A;  1TVK B;  4ZOL B;  2CSL A;  4BT2 A;  4C82 A;  3NMU C;  4U39 A;  4E6E A;  4WBN B;  2W8B C;  4BT7 A;  1FFX B;  3CD6 F;  1W41 A;  3E1Y A;  5EYP B;  2I6R A;  3CCR F;  3CPQ A;  3CXC F;  3F0E A;  3GHZ A;  1KQS F;  4NWO B;  3LWV C;  2Z1U A;  2GZL A;  1VQ8 F;  4G88 A;  3WPW A;  3RYF B;  3UT5 A;  5JH7 A;  1U3L A;  3FD5 A;  1Q81 H;  2BO1 A;  2UZH A;  5B8F A;  2Z1F A;  1QVF F;  4ZHV A;  3CMA F;  5EZY B;  1DBF A;  3KHN A;  5GIO C;  5HY0 A;  3P10 A;  3CCV F;  5GIP C;  1S72 F;  4X1K B;  2VGN A;  4FFB A;  4O4L A;  3LME A;  3VTI C;  4B46 A;  5HXU A;  5LA6 A;  4BT6 A;  3F0F A;  1T0K B;  5IT9 M;  1GX1 A;  1SA0 A;  4EI7 A;  3JAR A;  3MQW A;  2N48 A;  4X3L A;  5JH7 B;  3VOB A;  3RYF A;  2R75 1;  3I3F A;  4TV9 A;  4U3J B;  3CCM F;  1H7M A;  5KMG B;  2HVY D;  3RYI B;  2V9Y A;  4BVR A;  1VQO F;  3S02 A;  4WBN A;  5HY4 A;  5GIN C;  2MQE A;  4IIJ A;  1XRG A;  1XBI A;  3JAR B;  3VOA A;  2JNB A; 
#chains in the Genus database with same CATH homology
 3J80 M;  3I55 F;  1RA4 A;  3J81 M;  5G4V C;  3JCM M;  3LWO C;  5A2Q M;  1K73 H;  3NK6 A;  5HY2 A;  1VQ7 F;  4BVT A;  5GAP K;  1W3E X;  3SIV A;  2KTV A;  1RLG A;  3GYQ A;  1YIJ F;  3LWR C;  1M90 H;  5HWE A;  3CCJ F;  3AGK A;  1JJ2 F;  4X3M A;  2CZW A;  5EO3 A;  2OZB A;  1VQL F;  1YI2 F;  4BY9 D;  2QI2 A;  3HJW C;  1Q82 H;  4LCK A;  3FFM A;  3LWP C;  1VQM F;  2FGY A;  3HAX D;  2VGM A;  1X52 A;  3CC7 F;  4BVS A;  2GLZ A;  3G4S F;  1E7K A;  3CC2 F;  2KTU A;  1X7P A;  1NJI H;  1KD1 H;  1W2B F;  3RA5 A;  1GO1 A;  3V7Q A;  2KG4 A;  3NK7 A;  4TZZ A;  3CCQ F;  3OW2 F;  1QVG F;  4NQ3 A;  3G6E F;  2AIF A;  5G4U C;  3VI6 A;  3V3T A;  5DCV A;  1ZWZ A;  3VMF B;  3NVI B;  2OTL F;  5FLX M;  1VQ6 F;  4C4W C;  3NMU C;  1K9M H;  3PAF A;  1VQ4 F;  3MCA B;  4EI8 A;  3CG6 A;  3WXM B;  3CD6 F;  1W41 A;  3E1Y A;  3CCR F;  1Q86 H;  2LBW A;  1SDS A;  3CPQ A;  3CXC F;  3O85 A;  3N4Y A;  1KQS F;  1DT9 A;  3LWV C;  4BVQ A;  1VQ8 F;  3CCU F;  4XCQ A;  3V7E A;  5FJ4 C;  1IPA A;  3ON1 A;  1VQP F;  1KC8 H;  5HXZ A;  2BO1 A;  1YJN F;  1Q81 H;  5HY1 A;  1QVF F;  2QA4 F;  3JAM M;  3CMA F;  2ALE A;  3CME F;  1PXW A;  3RA6 A;  3N4Z A;  2OHW A;  5GIO C;  4NUT A;  1N8R H;  5HY0 A;  3G71 F;  1VQK F;  3CCV F;  3D00 A;  5GIP C;  1VQ5 F;  1W40 A;  3E20 B;  1S72 F;  1YJ9 F;  2VGN A;  3LWQ C;  3CCE F;  5HXU A;  5IT9 M;  1T0K B;  1VQ9 F;  5EWR A;  2OTJ F;  4EI7 A;  3SIU A;  1GZ0 A;  1X7O A;  4EI9 A;  1YIT F;  1W42 A;  2LBX A;  4X3L A;  2QEX F;  1YJW F;  1M1K H;  1Q7Y H;  3J7A R;  4BW0 B;  2F9Z C;  1NMU B;  3CCM F;  1H7M A;  1CN7 A;  3CPW F;  1YHQ F;  2HVY D;  3OBW A;  3NVK E;  4BVR A;  1VQN F;  3CCS F;  1VQO F;  1GO0 A;  2WAL A;  5HY4 A;  5GIN C;  5GAN K;  1K8A H;  1CK2 A;  3CC4 F;  1XBI A;  3CCL F;  3OBY A;  3IR9 A;  3I56 F;  3LFO A;  2I6D A;  2FC3 A;  3PLA C;  2JNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...