5G5EA

Crystallographic structure of the tau class glutathione s-transferase migstu from mango mangifera indica l.
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
220
structure length
220
Chain Sequence
AKSDVKLLGAWPSPYVMRARITLNVKSVDYELLEETLGSKSDLLLKSNPVHKKIPVLIHNDKPICESLIIVHYIDEFWSSGPSILPSDPYDRAIARFWAAYLDEKWYPSLKGIASAQGEEAKKAAVDQVGESLALIEDTYVKLSKGKPFFGGEKIGYLDIAFGCFLGWLRVTEKTSGVKFLNEAKTPHLAKWAVRFCADPAVKDVMPETEKLAEFAKLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAU CLASS GLUTATHIONE S-TRANSFERASE
publication title Insights Into Ligand Binding to a Glutathione S-Transferase from Mango: Structure, Thermodynamics and Kinetics
pubmed doi rcsb
source organism Mangifera indica
molecule tags Transferase
total genus 80
structure length 220
sequence length 220
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2016-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5g5eA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5g5eA01
4BVYB 1V2AA 3EMPA 1K0CA 5H5SA 1Y25A 3DMLA 2LSTA 4F03A 2F8AA 2FWHA 1K0MA 5DAKB 1YY7A 5F8BA 2H1DA 4O7HA 2H66A 2IMIA 2CT6A 1GSDA 3ZZXA 2V32A 1WMJA 3DEXA 1MD4A 1PRXA 1SD9A 2H0HA 2GGTA 3HY2A 2B5XA 3SWLA 3H4KA 3IA1A 2HQTA 2KP1A 2YZHA 2L4QA 3CRTA 5CO3A 3GYKA 2MBSA 4P3YB 4CW9A 2FA4A 5DALB 5CRWA 4KDXA 5KEJA 3GV1A 1FAAA 2YPMA 2HSYA 5ID2A 2R6KA 4NMUA 4MF6A 2FA8A 4MLYA 5GAND 3NIVA 3IAM2 1ON4A 2H1GA 2G0FA 2F8FA 3KH9A 4MJBA 2LNTA 14GSA 1S3DA 2WGRA 1VRSD 3HXSA 4MCUA 5JCWA 1Y6EA 3EU4A 1GSQA 1PSQA 1DBYA 4AJ6A 1XOAA 2M72A 5CRGA 4BWSA 4KCAA 2HSMA 2Z9SA 5G5FA 3WD6A 3DKSA 4F9ZA 3F0IA 1M0UA 3N5OA 3GKKA 1AIUA 5D73A 3A2VA 2VUPA 1BX9A 4L5LA 4ECJA 3ZVJD 2CV4A 1R7HA 1K0DA 4KUNA 3KIJA 3CTFA 5CAXA 4GQFA 3Q6OA 2JSYA 1M9AA 5A4VA 3RHCA 2DBCA 2YNXA 3F6FA 5IOXA 1EWXA 3HHVA 3BOAA 4IJ3A 2GQMA 4J56E 4LLRA 3UBLA 3GNJA 1GTAA 4ZL8A 4QQ7A 3WGDA 5DCGA 2UZ8A 1M7TA 4IGJA 4XCSA 3QFAC 3FY7A 3IK9A 1FG4A 1I5GA 2HFDA 4ZBDA 4AF2A 1Z3EA 3BCIA 2OE1A 1Z7PA 2CX4A 10GSA 4F2IA 4TVEA 2C0DA 3G9BA 5ECQB 1A0FA 2G2QA 4IS0A 3UIWA 4HJ2A 3F63A 2VM2A 2FWEA 3TRQA 2EC4A 2LUSA 4LMWA 1XW6A 1XW5A 2ON5A 2CZ3A 2H71A 2WFCA 5ECRB 5IMZA 2AUVA 1TK0B 1EP8A 1WIKA 1Z7RA 1X9SB 4PX1A 4GWRA 3GMFA 2OACA 3F9UA 2HI7A 5F06A 3SBCA 4I2UA 2C0FA 2AV4A 1K3LA 2GTUA 3F4TA 2J9HA 3FW2A 1ZCPA 3PGTA 2RM6A 4XRAA 1R5PA 2JZTA 1PGTA 3TB2A 2GQLA 2NDOA 3MSZA 2R3XA 3VPTA 2PWJA 3CBUA 2H70A 3IK7A 2B7KA 11GSA 3Q18A 5IMVA 5A4WA 3TKSC 3I6AA 2VCTA 4L0WA 1XWKA 1A8LA 5C04A 3UBKA 1QUWA 4J57E 4LL4B 2H8LA 1SK2A 1OC9B 4BA7A 1SKSB 4YH2A 3FK8A 3GH9A 1G7OA 4PURA 2VOCA 3UOMA 1ZGNA 1ACVA 2CZ2A 4MH3A 3H1NA 2L5OA 4ML6A 1EGRA 1MTCA 4ECBA 5F07A 6GSYA 3LYPA 3C1SA 3UL3A 1O73A 3IV4A 3NOFA 4K0GA 1X9MB 2N5FA 3WT1A 4MZBA 1FHEA 3GFKA 1N8JA 2L5LA 1X5CA 2TRXA 1GWCA 4KB3A 3ZVJA 3ERWA 3S9FA 5JWQB 4FYCA 2LEGA 3LQ7A 2L4CA 3JCML 4HQZA 4NXIA 1CQGA 4G0KA 2HZFA 2E0QA 3P2AA 4WBJA 4JR4A 3GUSA 4I5QA 5DQSA 1B48A 3ZREA 3M9KA 3TKQA 2O85A 1OC3A 2QGVA 2YCDA 4POMA 2X8CA 1FO5A 4EC0A 3PINA 3A5WA 1J9BA 2K8VA 1GNEA 1ZYQB 1XWGA 1A23A 3APQA 3A2WA 4USSA 4EUYA 3NZNA 3F3RA 2DJ0A 5L71A 3UJ1A 5IPHA 1MDIA 3DWVA 1V57A 2BTOT 2LQOA 3GTUA 1XOBA 4TR3A 1R4WA 1B4PA 2HZEA 5HFIA 1QGVA 4EE0A 4YAPA 2WULA 4Q5FA 4ZB8A 1F37A 5GSSA 2LV3A 2IPAA 1B9YC 5IQYA 1JZWA 3UAPA 3IBHA 4IELA 1K0NA 5JCUA 2GSSA 3BJ5A 1B4QA 1XIYA 3P7XA 4OMVA 5AIVA 5EL8A 6GSSA 3FR6A 2GZZA 1T1VA 2OA7A 1UA5A 2KHPA 3MAKA 3EE2A 2LRCA 3GSTA 3ZTLA 1YKCA 4WR5A 3HCZA 1MDJA 2QKEA 4KA0A 4N30A 3P8WA 5J4UA 2VM1A 3VK9A 5J9CA 1EZKA 3GL5A 4ZILA 2C80A 3M8NA 2CAIA 1CQHA 1XVQA 3QMXA 1JHBA 5LCZA 3D4TA 4K2DA 3M3MA 1M9BA 1YEPA 5HQPA 3GH6A 7GSSA 3KP9A 4NAXA 1USBA 1X9WB 1SJ6A 4ZB9A 2J23A 5IMCA 3I9V2 2KP2A 3GTUB 4MABA 5FWGA 3EURA 4L5OA 1T3BA 4FIWA 1TJDA 1GRXA 1H75A 4CDOA 3IHQA 2I9HA 2PN8A 3RHBA 4ML1A 4MZWA 1F2EA 1AQVA 1XW9A 4ZIJA 2M80A 3D4MA 2DJJA 4OFNA 5IMDA 3EWLA 2DJKA 4JE1A 2DIZA 5G30A 3Q19A 3EC3A 3M1GA 5JWOB 3HA9A 3GN3A 5AIXA 19GSA 2KLXA 1T4YA 4KGIA 1Z6MA 5JWRB 2O8VB 3VI5A 1QK8A 1M2DA 2KUCA 4V2LA 3HZ4A 1TW9A 1W89A 2H1BA 2YJ7A 2B7JA 3E0UA 1YQ1A 3DVWA 17GSA 1F9MA 3US3A 3IOSA 1V9WA 1LBKA 3KP8A 2PGTA 4MDCA 3WGEA 1YF1A 3GKXA 1X5DA 2B3SA 3HD5A 3BD2A 4I2TA 2H0GA 4L0UA 5IOWA 2NBSA 3TJBA 3KEBA 2CVKA 3ISOA 4WKWA 5DDLA 1JFUA 5FHIA 2LRNA 5D9XA 5DVBA 4K8MA 1OKDA 5CYYA 1ERTA 1A24A 4TOPA 8GSSA 1B9XC 4OFTA 1WE0A 3A3TA 2FUG2 3IDVA 1TRWA 2LKUA 4ZL7A 5DJLA 4XTSA 4IJIA 2BMXA 2LQQA 2WCIA 3F6DA 5HR0A 3FZ9A 2VO4A 4NV5A 4O32A 1XPVA 2V6KA 2HSHA 2R4VA 4ZL9A 2HRNA 1NHOA 1A2JA 1YF0A 1JLWA 2E2GA 4MPGA 1LU4A 2CAQA 1T00A 2C3TA 1GL8A 3LORA 1JZRA 4NWYA 4G9HA 4PXOA 2OBIA 2TRCP 2DIYA 1ILOA 1ML6A 4AJ7A 5ECMB 1BQ7A 2CVBA 1GTBA 2VL3A 2WJUA 2PVQA 4ZXGA 2NTOA 2RUEA 3ZIJA 2ZNMA 1F3BA 2VLTA 2HT9A 1FVKA 4EDZA 2H0IA 4HEA2 3TJGA 5CP1A 5F05A 1JZDA 4G0IA 5ECSA 2IIYA 4MJCA 4ACSA 3L0HA 1EEJA 1F3AA 5J41A 2X64A 2ZUPA 1X5EA 2K6VA 1EV9A 2YP6A 5IMFA 3TRPA 3FRCA 3FKFA 4MH2A 2C3QA 2MBTA 3KGKA 3EINA 1V58A 4HDEA 3F3QA 6GSXA 3MWHA 1THOA 3UARA 4WF4A 5J5NA 1URMA 1GSEA 2JZRA 2A4VA 4GXZA 1PQNA 5ID2B 2JADA 4KNDA 2K8SA 1ERUA 4Z7XA 4GSTA 3H8QA 3DVXA 4G0LA 4YAVA 6GSVA 3UEMA 2FWGA 2WB9A 2GVPA 2HYXA 3GSSA 4MPFA 2VL2C 4XS1A 4LL1B 2AJQB 5F0GA 3TKSA 3V1WA 3KTLA 3LEFA 3TKPA 4ZBAA 3C71A 1S3CA 4PQHA 3GX0A 5FT3A 3PPUA 5IM9A 2HRKA 2DJ1A 4KX4A 1I9DA 3ED3A 2H01A 2HSMB 4K0NA 1RW1A 1V98A 5B8AA 4V2MA 1PL1A 1ERWA 1SD8A 3J7Yb 1TRSA 2QC7A 5IMAA 4FH8A 3DXBA 1PMTA 2F51A 4OO4A 5J9BA 3ERGA 5ABRA 13GSA 3FR9A 1OE8A 2RM5A 2H76A 4GSSA 1WJKA 3CXGA 1J08A 3D6IA 1EGOA 4WEYA 2GZYA 1O8XA 4HZ2A 2DLXA 1MDKA 1O81A 4RI7A 4TR4A 4E8HA 1YDKA 1E6BA 1PD21 3G7IA 3HZ8A 5IPGA 4N0ZA 5J3RA 2IMKA 1O8WA 4RQRA 1TOFA 4WETA 1GLPA 2FGXA 4F0CA 3MDKA 1BYEA 3LSZA 4BL7A 1XFLA 3LJRA 1XZOA 1EOGA 2H72A 1UN2A 4KSOA 3F8UA 3CTGA 4N0VA 2HRFA 3QAWA 1TI3A 4OO5A 1Q4JA 5CRDA 4HJMA 1GUKA 5LD0A 2DC5A 2B6MA 3N9JA 1AUCA 3EU3A 4L8EA 4LA1A 5H5RA 3QDNA 5ENUA 4O92A 2YWOA 5DCHA 2LJAA 2QSIA 4G19A 3I69A 4TRXA 2FWFA 3M0FA 2PBJA 3ME7A 1DE1A 3FYGA 4DSRA 3FZ5A 1C72A 1PN9A 5E59A 2IFQA 2VAFA 3ZITA 4HUAA 1GULA 1T7PB 4TKYA 2P31A 1U6TA 1SJZA 4HOJA 1ZMAA 4IBPA 3TKRA 1NHYA 4ULXA 4V2NA 1MEKA 4IP1A 3GURA 5D9VA 4D73A 2YWMA 3RPPA 4IW9A 3QFBC 4HI7A 1TXXA 2RUFA 1GH2A 3W6GA 4Q5NA 3TOUA 1R5AA 1HQOA 3D21A 18GSA 1EOHA 2V1MA 3HDCA 1GSSA 3VWXA 4RUVA 1V40A 3TJFA 2V6OA 3GHAA 4JZQA 3ZFBA 3KTBA 1AQXA 3CSJA 2IJYA 1A8YA 4X0XA 2GT5A 3WT2A 4PTSA 3BCKA 3FHKA 5C00A 4EDYA 2FNOA 2IMEA 2JL4A 3HJMA 3ZRDA 3VURA 2AB6A 4EKZA 1GSYA 4CHSA 4ECCA 2B5YA 3VI7A 1J0FA 5A4UA 2IWTA 2OE3A 2OADA 5EPFA 1SKWB 4WBRD 1G6WA 2DJ3A 2WS2A 2H1AA 2E2MA 3EMXA 2PMTA 2ZCTA 1VF3A 3D22A 2IFQB 2JACA 1GLQA 2KOKA 3C7MA 5B6NA 4K7NA 2HNLA 3BBYA 3KMNA 1WOUA 9GSSA 2ON7A 1OE7A 5ECNB 5DQYA 3U5RE 3W8SA 1FOVA 4KE3A 3C73A 4D73B 1GSUA 1O85A 1GUHA 4DSQA 1W4VA 2DSAA 3GX8A 4X43A 2MMAA 2YANA 4PGTA 2CQ9A 1ST9A 3HJPA 2N5AA 1EEMA 1FB6A 2YWNA 4O5RA 4ID0A 2C8UA 4F82A 1TRUA 4JR6A 1WRYA 22GSA 3TJJA 4XS4A 1NW2A 4PNGA 5DAKA 1FB0A 2HZEB 3IXRA 4FYBA 1UC7A 5CRHA 1SK1A 4WF5A 2F3MA 3CRUA 4JRRA 1Z9HA 2H73A 2GDRA 2OBKA 1SK0A 3VWWA 3APSA 4HZ4A 2FCHA 3O3TA 1A2MA 3QAVA 3GIXA 4IN0A 1BEDA 4N11A 3TDGA 3VLNA 2H19A 2C0EA 4ISDA 1K3OA 2C1YA 2FHEA 1SENA 4EVMA 1E2YA 1KTEA 5DALA 1UVZA 5G2ZA 2DMLA 3O76A 4G2EA 2IN3A 4V1Ap 1TK5B 2CVDA 4FO5A 4PUFC 3ZLPA 3CSIA 2VCZA 3CYNA 4XRDA 1YEXA 12GSA 3VFIA 1QMVA 5E4WA 4HU7A 4XIHA 2P0GA 2HSNB 1JZOA 2XPDA 5G1KA 1K0OA 3L78A 4OFMA 1YJ6A 1XXUA 3QD9A 3MNGA 4H86A 2DMMA 4POLA 1VF4A 2WZ9A 2OKAA 5HFGA 2GQKA 2GZPA 2GS3A 5D8IA 2VCVA 2REMA 1SU9A 5AN1A 5AGYA 3FZ4A 4XHMA 2A2RA 5GSTA 3DIEA 3KJYA 2H74A 3PR8A 3GKMA 1K0AA 1TU8A 5DBQA 2GSQA 1O7UA 5B7CA 4XS4B 3EVIA 2C3NA 3IE3A 4MJAA 4QL9A 4IKHA 4KDYA 2O87A 2IMDA 1RQMA 4K9ZA 2H6XA 1OVNA 2I4AA 4MMMA 1DSBA 2XC2A 3DRNA 3HKRA 4GF0A 1F6MC 1TI1A 3RBTA 3QPMA 1Z5YE 5IO2A 2HE3A 2L59A 2B1KA 4TR1A 4KAEA 2K9FA 3L9SA 4MK3A 2DJ2A 2MMNA 4TW5A 2MMOA 3KM6A 1SL2B 3AY8A 6GSWA 2E7PA 2XPEA 1H4OA 3E3EA 3G7YA 3IAS2 3ZMLA 3H93A 1VF1A 4OCEA 3W8JA 4EXJA 2L6CA 4LMVA 4AGSA 3QR6A 1SL1B 1VGLA 1PKZA 1U3AA 4BVXA 3CMIA 4NHWA 3TUEA 4ECIA 2R37A 2YV9A 5ELAA 2VL2A 3LXZA 3H79A 4YQVA 1TK8B 5ECIB 1OYJA 5GZZB 1PX7A 4Q5QA 4GLTA 3UMAA 1AXDA 3LYKA 3P90A 1SKRB 5D96A 3LFLA 3IC8A 5A5KA 1M2AA 3KZQA 3TCOA 4E8EA 1SYXA 4EL1A 1IYIA 2LTKA 2L57A 1RK4A 3J7Yk 4GQCA 3DGQA 4BPYA 1G6YA 2H30A 1GP1A 3U6VA 3APOA 4J2FA 4PNFA 3GRXA 2ES7A 4GTUA 5ECPB 5ECOB 2H6ZA 2IL3A 2H6YA 5G31A 1BJXA 4OCFA 1OAZA 4XS6A 3IRAA 5D93A 1N2AA 4TR1B 2RIIA 3QOUA 1XWCA 2VD1A 2C0GA 1QQ2A 2AAWA 1OC9A 3QAGA 3GKNA 3ZFLA 5HR1A 4DVCA 3EYTA 1SJIA 2AHEA 2K18A 1ABAA 2WRTA 3E9JB 4GSNA 5IIZA 2O7KA 1AQWA 1T4ZA 5D9WA 3HVXA 2XHFA 1X0RA 2CA8A 4BVXB 1TRVA 4KF9A 3DD3A 2B5EA 2RLIA 3G7JA 3KXOA 3LXTA 1EV4A 2MYGA 1KEBA 3RAZA 1B8XA 1XWBA 2R2JA 2EIQA 2P5QA 1XVWA 2FD3A 2GSRA 1TU7A 2IMFA 2LS5A 4POBA 1PX6A 5ECLB 1TKDB 5HFKA 3VPQA 4IHUA 5HR2A 2X99A 1AC1A 2GSTA 1HYUA 2D2ZA 5KN2A 4QL7A 5EY6A 2I3YA 3TKSE 4KDUA 1XWAA 1Q98A 1VF2A 1ERVA 2VIMA 4I6XA 1GUMA 2VLVA 2B1LA 2HXKA 4I8BA 4HS1A 4MF5A 4PUAA 4WXTA 4KW6A 4TXOA 2GT6A 2I1UA 3UVTA 3HYPA 4V1Ag 4OD7A 4G10A 4JU5A 3GA4A 3L4NA 1GTIA 4K7OA 3LGCA 1MD3A 1EP7A 4N10A 4I97A 2YWIA 5KN3A 2P5RA 4TXVA 4PQ1A 2YJHA 4EO3A 3ZIVA 3R3EA 4Q5RA 2PVOC 5IO0A 4HU9A 1M2BA 4KSMA 2EIRA 4KCEA 2HRKB 3ME8A 6GSTA 4X1UA 2JU5A 1U88A 1Z6NA 4MP4A 5BMUA 3KCMA 1GTUA 2X8HA 1S3AA 1XBSA 1WPIA 2MMZA 3FEUA 2PU9C 2TIRA 1K0BA 3I43A 3C1RA 3DYRA 5B6MA 5KN1A 3M9JA 1G0TA 1QFNA 1A2LA 1NSWA 2H75A 1R26A 3LWAA 3ZL5A 2HLSA 1FW1A 2LNSA 2PPTA 16GSA 2YOIA 2LJKA 3FR3A 1TP9A 1AAZA 3ZYWA 4ZBBA 2O89A 4HQSA 5KN0A 1HNBA 3PH9A 3KMOA 5B8BA 1A0RP 1ZYEA 2FY6A 4WR4A 4DSSA 5LNKe 1YZXA 3L9UA 4NV2A 4NHZA 2V2GA 4FYUA 2MZCA 1WWJA 4TXOB 2BJXA 1BG5A 1JLVA 2PUKC 4BL7B 3WYWA 3HVSA 5H5QA 1DE2A 3UVHA 2OJLA 2OE0A 1YKAA 1NM3A 5COHA 1TTZA 2EIOA 20GSA 4JEDA 4RI6A 4AJ8A 1THXA 2F9SA 2AYTA 3ZMKA 1IYHA 3IC4A 2A2SA 3D0ZA 2R5GA 2NVLA 3IPZA 4IQ1A 1TDIA 5HR3A 4KH7A 2PERA 4FQUA 2VCXA 2NPBA 1PKWA 5DJMA 5ELGA 3VWVA 3F4SA 5G5EA 2LJRA 4IQAA 1PL2A 3WGXA 5D9TA 2JZSA 4OWYA 4MZCA 2VCWA 4MJEA 1AW9A 4DEJA 5CNWA 5ECHB 4GRFA 1LJRA 4K1FA 1PA3A 2VD0A 4JBBA 4K6XA 4F0BA 2GLRA 1HNAA 5JCGA 1K3YA 2JSZA 4BVYA 1OC8A 4POKA 3GL3A 3VWUA 4RQXA 2V41A 3Q74A 1QXHA 3RPNA 4DSSB 1GNWA 2C4JA 4GCIA 2WDUA 1HD2A 3K8NA 2N5BA 4IP6A 3IR4A 4YQUA 3TRXA 2CX3A 4NPBA 1DUGA 1GSFA 3F4RA 3C8EA 2YZUA 3HVVA 3L9VA 3QCPA 1U87A 5CREA 1KBNA 3D5JA 1ZZYA 2XBIA 3TOTA 3KD0A 1M99A 3FZAA 4BWQA 3RDWA 1G7EA 3A2XA 1SYRA 4ILFA 1XCCA 1ZL9A 5G1LA 4K7IA 5EVOA 6GSUA 1KNGA 3R2QA 3KH7A 4EF0A 1OKTA 1T8EB 1U3IA 3HJOA 1HNCA 3OR5A 5ECKB 5AISA 4MA9A 4ZB6A 4MF7A 2VLUA 1FVJA 2YV7A 3TJKA 3TGZA 4PQIA 3ERFA 4TN8A 1WP0A 2LRTA 3LG6A 5GAPD 2X8GA 1ZOFA 2ALBA 3O6TA 2M46A 4IVFA 2YN1A 2HRAA 2XBQA 5INYA 1SL0B 2L6DA 2I81A 4TR0A 2VL9A 2FLSA 1BAYA 2VCQA 3CSHA 4YQMA 1O6JA
chains in the Genus database with same CATH superfamily
4BVYB 1V2AA 3EMPA 1K0CA 5H5SA 1Y25A 3DMLA 2LSTA 4F03A 2F8AA 2FWHA 1K0MA 5DAKB 1YY7A 5F8BA 2H1DA 4O7HA 2H66A 4Z2UA 2IMIA 2CT6A 1GSDA 3ZZXA 1SVLA 2V32A 1WMJA 3DEXA 1MD4A 1PRXA 1SD9A 2H0HA 2GGTA 2OT3A 3HY2A 2B5XA 3SWLA 3MIXA 3H4KA 3IA1A 2HQTA 2KP1A 2YZHA 2L4QA 3CRTA 5CO3A 3GYKA 2MBSA 4P3YB 4CW9A 2FA4A 5DALB 5CRWA 4KDXA 5KEJA 3GV1A 1FAAA 2YPMA 2HSYA 5ID2A 2R6KA 4NMUA 4MF6A 2FA8A 4MLYA 5GAND 3NIVA 3IAM2 2EFCA 1ON4A 2H1GA 2G0FA 2F8FA 3KH9A 4MJBA 2LNTA 14GSA 1S3DA 2WGRA 1VRSD 3HXSA 4MCUA 5JCWA 1Y6EA 3EU4A 1GSQA 1PSQA 1DBYA 4AJ6A 1XOAA 2M72A 5CRGA 4BWSA 4KCAA 2HSMA 2Z9SA 5G5FA 3WD6A 3DKSA 4F9ZA 3F0IA 4K5SA 1M0UA 3N5OA 3GKKA 1AIUA 5D73A 1TXUA 3A2VA 2VUPA 1BX9A 4L5LA 4ECJA 3ZVJD 3RGBC 2CV4A 1R7HA 1K0DA 4KUNA 3KIJA 3CTFA 5CAXA 3Q6OA 4GQFA 2JSYA 5KOWA 1M9AA 5A4VA 3RHCA 2DBCA 2YNXA 3F6FA 5IOXA 1EWXA 3HHVA 3BOAA 4IJ3A 2GQMA 4J56E 4LLRA 3UBLA 3GNJA 1GTAA 4ZL8A 4QQ7A 4QMKA 3WGDA 5DCGA 2UZ8A 1M7TA 4IGJA 4XCSA 2WZSA 3QFAC 5A1NA 3FY7A 3IK9A 1FG4A 1I5GA 2HFDA 4ZBDA 4AF2A 1Z3EA 3BCIA 2WW2A 2OE1A 1Z7PA 2CX4A 10GSA 4F2IA 4TVEA 2C0DA 3G9BA 5ECQB 4AKGA 1A0FA 2G2QA 4IS0A 3UIWA 4HJ2A 2R0CA 3F63A 2VM2A 2FWEA 3TRQA 2EC4A 2LUSA 4LMWA 4YKFA 1XW6A 1XW5A 2ON5A 2CZ3A 2H71A 2WFCA 5ECRB 5IMZA 2AUVA 1TK0B 1EP8A 1WIKA 1Z7RA 1X9SB 4PX1A 4GWRA 3GMFA 2OACA 3F9UA 2HI7A 5F06A 3SBCA 4I2UA 2C0FA 2AV4A 1K3LA 2GTUA 3F4TA 2J9HA 3FW2A 1ZCPA 3PGTA 2RM6A 4Z2RA 4XRAA 1R5PA 2JZTA 1I1IP 1PGTA 2EFEA 3TB2A 2GQLA 2NDOA 3MSZA 2R3XA 3VPTA 2PWJA 3CBUA 1ZYPA 2H70A 3IK7A 2B7KA 11GSA 3Q18A 5IMVA 5A4WA 3TKSC 3I6AA 2VCTA 4L0WA 1XWKA 1A8LA 5C04A 5A1NB 3UBKA 1QUWA 4J57E 4LL4B 2H8LA 1SK2A 1OC9B 4BA7A 1SKSB 4YH2A 3FK8A 3GH9A 1G7OA 4BIKA 4PURA 2VOCA 4E68A 3UOMA 1ZGNA 1ACVA 2CZ2A 4MH3A 3H1NA 2L5OA 4ML6A 1EGRA 1MTCA 4ECBA 5F07A 6GSYA 3LYPA 3C1SA 3UL3A 1O73A 3IV4A 3NOFA 4K0GA 1X9MB 2N5FA 3WT1A 4MZBA 1FHEA 3GFKA 4K5RA 1N8JA 2L5LA 1X5CA 2TRXA 1GWCA 4KB3A 3ZVJA 3ERWA 3S9FA 5JWQB 4FYCA 2LEGA 3LQ7A 2L4CA 3JCML 4HQZA 4NXIA 1CQGA 4G0KA 2HZFA 2E0QA 3P2AA 4WBJA 4JR4A 3GUSA 4I5QA 5DQSA 1B48A 3ZREA 3M9KA 3TKQA 5A5HB 2O85A 1OC3A 2QGVA 2YCDA 4POMA 2X8CA 1FO5A 4EC0A 3PINA 3A5WA 1J9BA 2K8VA 1GNEA 1ZYQB 1XWGA 1A23A 3APQA 3A2WA 4USSA 4EUYA 3NZNA 3F3RA 2DJ0A 5L71A 3UJ1A 5IPHA 1MDIA 3DWVA 1V57A 2BTOT 2LQOA 3GTUA 1XOBA 4TR3A 1R4WA 1B4PA 2HZEA 5HFIA 1QGVA 4EE0A 4YAPA 2WULA 4K2XA 4Q5FA 4ZB8A 1F37A 5GSSA 2LV3A 2IPAA 1B9YC 4N3ZA 5IQYA 1JZWA 3UAPA 3IBHA 5BMUB 4IELA 1K0NA 5JCUA 2GSSA 3BJ5A 1B4QA 1XIYA 3P7XA 4OMVA 5AIVA 5EL8A 6GSSA 3FR6A 2GZZA 1T1VA 2OA7A 1UA5A 2KHPA 3MAKA 3EE2A 2LRCA 3GSTA 4Z2TA 3ZTLA 1YKCA 4WR5A 3HCZA 2HSNA 1MDJA 2QKEA 4KA0A 4N30A 3P8WA 5J4UA 2VM1A 3VK9A 5J9CA 1EZKA 3GL5A 4ZILA 2C80A 3M8NA 5J4YA 2CAIA 4GDFA 1CQHA 1XVQA 3QMXA 1JHBA 5LCZA 3D4TA 4K2DA 3M3MA 1M9BA 1YEPA 5HQPA 3GH6A 7GSSA 3KP9A 4NAXA 1USBA 1YEWC 1X9WB 1SJ6A 4ZB9A 2J23A 5IMCA 3I9V2 2KP2A 3GTUB 4MABA 5FWGA 3EURA 4L5OA 1T3BA 4FIWA 1TJDA 1GRXA 1H75A 4CDOA 3IHQA 2I9HA 2PN8A 4HSCX 4W66A 3RHBA 4ML1A 4MZWA 1F2EA 1AQVA 1XW9A 4ZIJA 2M80A 3D4MA 2DJJA 4OFNA 4PI0C 5IMDA 3EWLA 2DJKA 2A2PA 4JE1A 2DIZA 5G30A 3Q19A 3EC3A 1Y1UA 3M1GA 5JWOB 3HA9A 3GN3A 5AIXA 19GSA 2KLXA 1T4YA 4KGIA 1Z6MA 5JWRB 2O8VB 3VI5A 1QK8A 1M2DA 2KUCA 4V2LA 3HZ4A 1TW9A 1W89A 2H1BA 2YJ7A 2B7JA 4ICYA 3E0UA 1YQ1A 3DVWA 17GSA 1F9MA 3US3A 3IOSA 1V9WA 1LBKA 3KP8A 2PGTA 4MDCA 3WGEA 1YF1A 3GKXA 1X5DA 2B3SA 3HD5A 3BD2A 4I2TA 2H0GA 4L0UA 5IOWA 2NBSA 1FOHA 3TJBA 3KEBA 2CVKA 3ISOA 2WVXA 4WKWA 5DDLA 1JFUA 5FHIA 2LRNA 5D9XA 5DVBA 4K8MA 1OKDA 5CYYA 1ERTA 1A24A 4TOPA 8GSSA 1XG8A 1B9XC 4OFTA 1WE0A 3A3TA 4PHZC 2FUG2 3IDVA 1TRWA 2LKUA 4ZL7A 5DJLA 3EPTA 4XTSA 4IJIA 2BMXA 2LQQA 4AKHA 2WCIA 3F6DA 5HR0A 3FZ9A 2VO4A 4NV5A 4O32A 1XPVA 2V6KA 2HSHA 2R4VA 4ZL9A 2HRNA 1NHOA 1A2JA 1YF0A 1JLWA 2E2GA 4MPGA 1LU4A 2CAQA 1T00A 2C3TA 4A5PA 1GL8A 3LORA 1JZRA 4NWYA 4G9HA 4PXOA 2OBIA 2TRCP 2DIYA 1ILOA 1ML6A 4AJ7A 5ECMB 1BQ7A 2CVBA 1GTBA 2VL3A 2WJUA 4X4JA 2PVQA 4ZXGA 2NTOA 2RUEA 3ZIJA 2ZNMA 1F3BA 2VLTA 2HT9A 1FVKA 4EDZA 1M3IA 2H0IA 4HEA2 1N25A 3TJGA 5CP1A 5F05A 1JZDA 4G0IA 5ECSA 2IIYA 4MJCA 4ACSA 3L0HA 1EEJA 2WVXB 1F3AA 5J41A 2X64A 2ZUPA 1X5EA 2K6VA 1EV9A 2YP6A 5IMFA 3TRPA 3FRCA 3FKFA 4MH2A 2C3QA 2MBTA 3KGKA 3EINA 1V58A 4HDEA 3F3QA 6GSXA 3MWHA 1THOA 3UARA 4WF4A 5J5NA 1URMA 1GSEA 2JZRA 2A4VA 4GXZA 1PQNA 5ID2B 2JADA 4KNDA 2K8SA 1ERUA 4Z7XA 4GSTA 3H8QA 3DVXA 4G0LA 4YAVA 6GSVA 3UEMA 2FWGA 2WB9A 2GVPA 2HYXA 3GSSA 4MPFA 2VL2C 4XS1A 4LL1B 2AJQB 5F0GA 3TKSA 3V1WA 3KTLA 3LEFA 3TKPA 3LW9A 4ZBAA 3C71A 1S3CA 4PQHA 3GX0A 5FT3A 3PPUA 5IM9A 2HRKA 2DJ1A 2WW1A 4KX4A 1I9DA 3ED3A 2H01A 2HSMB 4K0NA 1RW1A 1V98A 5B8AA 4V2MA 1PL1A 1ERWA 1SD8A 3J7Yb 1TRSA 2QC7A 5IMAA 4FH8A 3DXBA 1PMTA 2F51A 4OO4A 5J9BA 3ERGA 5ABRA 13GSA 3FR9A 1OE8A 1S4BP 2RM5A 2H76A 4GSSA 1WJKA 3CXGA 1J08A 3D6IA 1EGOA 4WEYA 2GZYA 1O8XA 4HZ2A 2DLXA 1MDKA 1O81A 4RI7A 4TR4A 4E8HA 1YDKA 1E6BA 1PD21 3G7IA 3HZ8A 5IPGA 4N0ZA 5J3RA 2IMKA 1O8WA 4RQRA 1TOFA 4WETA 1GLPA 2FGXA 4F0CA 3MDKA 4O5UA 1BYEA 3LSZA 4BL7A 1XFLA 2WVZA 3LJRA 2X4AA 1XZOA 1EOGA 2H72A 1UN2A 4KSOA 3F8UA 3CTGA 4N0VA 2EFHA 2HRFA 3QAWA 1TI3A 4OO5A 1Q4JA 5CRDA 4HJMA 1GUKA 5J4VA 5LD0A 2DC5A 2B6MA 3N9JA 1AUCA 3EU3A 4L8EA 4LA1A 5H5RA 3QDNA 5ENUA 4O92A 2YWOA 5DCHA 2LJAA 2QSIA 4EIPA 4G19A 3I69A 4TRXA 2FWFA 3M0FA 2PBJA 4O5QA 3ME7A 1DE1A 3FYGA 4DSRA 3FZ5A 1C72A 1PN9A 4G01A 5E59A 2IFQA 2VAFA 3ZITA 4HUAA 1GULA 1T7PB 4TKYA 2P31A 1U6TA 1SJZA 4HOJA 1ZMAA 4IBPA 3TKRA 1NHYA 4ULXA 4V2NA 1MEKA 4IP1A 3CQFA 3GURA 2X49A 5D9VA 4D73A 2YWMA 3RPPA 4IW9A 3QFBC 4HI7A 1TXXA 5A34A 2RUFA 1GH2A 3W6GA 4Q5NA 3TOUA 1R5AA 1HQOA 4PI2C 3D21A 18GSA 3CHXC 1EOHA 2V1MA 3HDCA 1GSSA 3VWXA 4RUVA 1V40A 3TJFA 2V6OA 3GHAA 4JZQA 3ZFBA 3KTBA 1AQXA 3CSJA 2IJYA 1A8YA 4X0XA 4CY6A 2GT5A 3WT2A 4PTSA 3BCKA 2R0GA 3FHKA 5C00A 4EDYA 2FNOA 2IMEA 2JL4A 3HJMA 3ZRDA 3VURA 2AB6A 4EKZA 1GSYA 4CHSA 4ECCA 2B5YA 3VI7A 1J0FA 5A4UA 2IWTA 2OE3A 2OADA 5EPFA 1SKWB 4WBRD 1G6WA 2DJ3A 2WS2A 2H1AA 2E2MA 3EMXA 2PMTA 2ZCTA 1VF3A 3D22A 2IFQB 3FMWA 2JACA 1GLQA 2KOKA 3C7MA 5B6NA 4K7NA 2HNLA 3BBYA 3KMNA 1WOUA 9GSSA 2ON7A 1OE7A 5ECNB 5DQYA 3U5RE 3W8SA 1FOVA 4KE3A 3C73A 4D73B 1GSUA 1O85A 1GUHA 4DSQA 1W4VA 2DSAA 3GX8A 4X43A 2MMAA 2YANA 4PGTA 5A34B 2CQ9A 1ST9A 3HJPA 2N5AA 1EEMA 1FB6A 2YWNA 4O5RA 4ID0A 2C8UA 4F82A 1TRUA 4JR6A 1WRYA 22GSA 3TJJA 4XS4A 1NW2A 4PNGA 5DAKA 1FB0A 2HZEB 3IXRA 4FYBA 1UC7A 5CRHA 1SK1A 4WF5A 2F3MA 3CRUA 4JRRA 1Z9HA 2H73A 2GDRA 2OBKA 1SK0A 3VWWA 3APSA 4HZ4A 2FCHA 3O3TA 1A2MA 3QAVA 3GIXA 4IN0A 1BEDA 4N11A 3TDGA 3VLNA 2H19A 2C0EA 4ISDA 1K3OA 2C1YA 2FHEA 1SENA 4EVMA 1E2YA 1KTEA 5DALA 1UVZA 5G2ZA 2DMLA 3O76A 4G2EA 2IN3A 4V1Ap 1TK5B 2CVDA 4FO5A 4PUFC 3ZLPA 3CSIA 2VCZA 1BG1A 3CYNA 4XRDA 1YEXA 12GSA 2VKZG 3VFIA 1QMVA 5E4WA 4HU7A 2A4HA 4XIHA 2P0GA 2HSNB 1JZOA 2XPDA 5G1KA 1K0OA 3L78A 4OFMA 1YJ6A 1XXUA 3QD9A 3MNGA 4H86A 2DMMA 4POLA 1VF4A 1ZYNA 2WZ9A 2OKAA 5HFGA 2GQKA 2DKIA 2GZPA 2GS3A 5D8IA 2VCVA 2REMA 1SU9A 5AN1A 5AGYA 3FZ4A 4XHMA 4EIQA 2A2RA 5GSTA 3DIEA 3KJYA 2H74A 3PR8A 3GKMA 3HVNA 1K0AA 1TU8A 5DBQA 2GSQA 1O7UA 5B7CA 4XS4B 3EVIA 2C3NA 3IE3A 4MJAA 2QA1A 4QL9A 4IKHA 4KDYA 2O87A 5BRTA 5KOXA 2IMDA 1RQMA 4K9ZA 2H6XA 1OVNA 2I4AA 4MMMA 1DSBA 2XC2A 3DRNA 3HKRA 4GF0A 1F6MC 1TI1A 2O3EA 3RBTA 3QPMA 1Z5YE 5IO2A 2HE3A 2L59A 2B1KA 4TR1A 4KAEA 2K9FA 3L9SA 4MK3A 2QA2A 2DJ2A 2MMNA 4TW5A 2MMOA 3KM6A 1SL2B 3AY8A 6GSWA 2E7PA 2XPEA 1H4OA 3E3EA 3G7YA 3IAS2 3ZMLA 2O36A 3H93A 1VF1A 4OCEA 3W8JA 4EXJA 2L6CA 4LMVA 4AGSA 3QR6A 1SL1B 1VGLA 1PKZA 4AKIA 1U3AA 4BVXA 3CMIA 4NHWA 3TUEA 4ECIA 2R37A 2YV9A 5ELAA 2VL2A 3LXZA 3H79A 4YQVA 1TK8B 5ECIB 1OYJA 5GZZB 1PX7A 4Q5QA 4GLTA 3UMAA 1AXDA 3LYKA 3P90A 1SKRB 5D96A 3LFLA 3TU3B 3IC8A 5A5KA 1M2AA 3KZQA 3TCOA 4E8EA 1SYXA 1BF5A 4EL1A 1IYIA 2LTKA 2L57A 1RK4A 3J7Yk 4GQCA 3DGQA 2H1LA 4BPYA 1G6YA 2H30A 4AI6A 1GP1A 3U6VA 3APOA 1PN0A 4J2FA 4PNFA 3GRXA 2ES7A 4GTUA 5ECPB 5ECOB 2H6ZA 2IL3A 2H6YA 5G31A 1BJXA 4OCFA 1OAZA 4XS6A 3IRAA 5D93A 1N2AA 3HMJG 4TR1B 2RIIA 3QOUA 1XWCA 2VD1A 2C0GA 1QQ2A 2AAWA 1OC9A 3QAGA 3GKNA 3ZFLA 5HR1A 4DVCA 3EYTA 1SJIA 2AHEA 2K18A 1ABAA 2WRTA 2O5VA 1PFOA 3E9JB 4GSNA 5IIZA 2O7KA 1AQWA 1T4ZA 5D9WA 3HVXA 2XHFA 1X0RA 2CA8A 4BVXB 1TRVA 4KF9A 3DD3A 2B5EA 2RLIA 3G7JA 3KXOA 3LXTA 1EV4A 2MYGA 1KEBA 3RAZA 1B8XA 1XWBA 2R2JA 2EIQA 2P5QA 1XVWA 2FD3A 2GSRA 1TU7A 2IMFA 2LS5A 4POBA 1PX6A 5ECLB 1TKDB 5HFKA 3VPQA 1YVLA 4IHUA 5HR2A 2X99A 1AC1A 2GSTA 1HYUA 2D2ZA 5A5HA 5KN2A 4QL7A 5EY6A 2I3YA 3TKSE 4KDUA 1XWAA 1Q98A 1VF2A 1ERVA 2VIMA 4I6XA 1GUMA 2VLVA 2B1LA 2WVYA 1S3RA 2HXKA 1M3JA 4I8BA 4HS1A 4MF5A 4PUAA 4WXTA 4KW6A 4TXOA 2GT6A 2I1UA 3UVTA 3HYPA 4V1Ag 2DKHA 4OD7A 4G10A 4JU5A 3GA4A 3L4NA 1GTIA 4K7OA 3LGCA 1MD3A 1EP7A 4N10A 4I97A 2YWIA 5KN3A 2P5RA 4TXVA 4PQ1A 2YJHA 4EO3A 3ZIVA 3R3EA 4CY8A 4Q5RA 2PVOC 5IO0A 5J40A 4HU9A 1M2BA 4KSMA 4YKGA 2EIRA 4KCEA 2HRKB 3ME8A 6GSTA 4X1UA 2JU5A 1U88A 1Z6NA 4MP4A 5BMUA 3KCMA 1GTUA 2X8HA 1S3AA 1XBSA 1WPIA 2MMZA 3FEUA 2PU9C 2TIRA 1K0BA 3I43A 3C1RA 3DYRA 5B6MA 5KN1A 3M9JA 1G0TA 1QFNA 1A2LA 1NSWA 2H75A 1R26A 3LWAA 3ZL5A 2HLSA 1FW1A 2LNSA 2PPTA 16GSA 2YOIA 2LJKA 3FR3A 1TP9A 1AAZA 3ZYWA 4ZBBA 2O89A 4HQSA 5KN0A 1HNBA 3PH9A 3KMOA 5B8BA 1A0RP 1ZYEA 2FY6A 4WR4A 4DSSA 5LNKe 1YZXA 3L9UA 4NV2A 4NHZA 2V2GA 4FYUA 2MZCA 1WWJA 4TXOB 2BJXA 1BG5A 1JLVA 2PUKC 4BL7B 3WYWA 3HVSA 5H5QA 1DE2A 3UVHA 2OJLA 2OE0A 1YKAA 1NM3A 5COHA 1TTZA 2EIOA 20GSA 4JEDA 4RI6A 4AJ8A 3RFRC 1THXA 2F9SA 2AYTA 3ZMKA 3A5IA 1IYHA 3IC4A 3MYDA 2A2SA 3D0ZA 2R5GA 2NVLA 3IPZA 4IQ1A 1TDIA 5HR3A 4KH7A 4MNNA 2PERA 4FQUA 2VCXA 2NPBA 1PKWA 5DJMA 5ELGA 3VWVA 3F4SA 4AKXB 5G5EA 2LJRA 4IQAA 1PL2A 3WGXA 5D9TA 2JZSA 4OWYA 4MZCA 2VCWA 4MJEA 1AW9A 4DEJA 5CNWA 5ECHB 4GRFA 1SVMA 1LJRA 4K1FA 1PA3A 2VD0A 4JBBA 3IHGA 4K6XA 4F0BA 2GLRA 1HNAA 5JCGA 1K3YA 2JSZA 4BVYA 4FXYP 1OC8A 4POKA 3GL3A 3VWUA 4RQXA 2V41A 3Q74A 1QXHA 3RPNA 4DSSB 1GNWA 2C4JA 4GCIA 2WDUA 3CWGA 1HD2A 3K8NA 2N5BA 4IP6A 3IR4A 4YQUA 2R0PA 3TRXA 2CX3A 4NPBA 1DUGA 1GSFA 3F4RA 3C8EA 2YZUA 3HVVA 3L9VA 3QCPA 1U87A 5CREA 1KBNA 3D5JA 1ZZYA 2XBIA 3TOTA 3KD0A 1M99A 3FZAA 4BWQA 3RDWA 1G7EA 3A2XA 1SYRA 4ILFA 1XCCA 1ZL9A 5G1LA 4K7IA 5EVOA 6GSUA 1KNGA 3R2QA 3KH7A 4EF0A 1OKTA 1T8EB 1U3IA 3HJOA 1HNCA 3OR5A 5ECKB 5AISA 4MA9A 4ZB6A 4MF7A 2VLUA 1FVJA 2YV7A 2UV8G 3TJKA 2EFDA 3TGZA 2WW0A 4ZB7A 4PQIA 3ERFA 4TN8A 1WP0A 2LRTA 3LG6A 5GAPD 2X8GA 1ZOFA 2ALBA 3O6TA 2M46A 4IVFA 2WW3A 2YN1A 2HRAA 2XBQA 5INYA 1SL0B 2L6DA 2I81A 4TR0A 2VL9A 5J47A 1SVOA 2FLSA 1BAYA 2VCQA 3CSHA 4YQMA 1O6JA
chains in the Genus database with same CATH topology
4BVYB 1V2AA 3EMPA 1K0CA 5H5SA 1Y25A 3DMLA 2LSTA 4F03A 2F8AA 2FWHA 1K0MA 5DAKB 1YY7A 5F8BA 2H1DA 4O7HA 2H66A 4Z2UA 2IMIA 2CT6A 1GSDA 3ZZXA 1SVLA 2V32A 1WMJA 3DEXA 1MD4A 1PRXA 1SD9A 2H0HA 2GGTA 2OT3A 3HY2A 2B5XA 3SWLA 3MIXA 3H4KA 3IA1A 2HQTA 2KP1A 2YZHA 2L4QA 3CRTA 5CO3A 3GYKA 2MBSA 4P3YB 4CW9A 2FA4A 5DALB 5CRWA 4KDXA 5KEJA 3GV1A 1FAAA 2YPMA 2HSYA 5ID2A 2R6KA 4NMUA 4MF6A 2FA8A 4MLYA 5GAND 3NIVA 3IAM2 2EFCA 1ON4A 2H1GA 2G0FA 2F8FA 3KH9A 4MJBA 2LNTA 14GSA 1S3DA 2WGRA 1VRSD 3HXSA 4MCUA 5JCWA 1Y6EA 3EU4A 1GSQA 1PSQA 1DBYA 4AJ6A 1XOAA 2M72A 5CRGA 4BWSA 4KCAA 2HSMA 2Z9SA 5G5FA 3WD6A 3DKSA 4F9ZA 3F0IA 4K5SA 1M0UA 3N5OA 3GKKA 1AIUA 5D73A 1TXUA 3A2VA 2VUPA 1BX9A 4L5LA 4ECJA 3ZVJD 2CV4A 1R7HA 1K0DA 4KUNA 3KIJA 3CTFA 5CAXA 3Q6OA 4GQFA 2JSYA 5KOWA 1M9AA 5A4VA 3RHCA 2DBCA 2YNXA 3F6FA 5IOXA 1EWXA 3HHVA 3BOAA 4IJ3A 2GQMA 4J56E 4LLRA 3UBLA 3GNJA 1GTAA 4ZL8A 4QQ7A 4QMKA 3WGDA 5DCGA 2UZ8A 1M7TA 4IGJA 4XCSA 3QFAC 5A1NA 3FY7A 3IK9A 1FG4A 1I5GA 2HFDA 4ZBDA 4AF2A 1Z3EA 3BCIA 2OE1A 1Z7PA 2CX4A 10GSA 4F2IA 4TVEA 2C0DA 3G9BA 5ECQB 4AKGA 1A0FA 2G2QA 4IS0A 3UIWA 4HJ2A 2R0CA 3F63A 2VM2A 2FWEA 3TRQA 2EC4A 2LUSA 4LMWA 4YKFA 1XW6A 1XW5A 2ON5A 2CZ3A 2H71A 2WFCA 5ECRB 5IMZA 2AUVA 1TK0B 1EP8A 1WIKA 1Z7RA 1X9SB 4PX1A 4GWRA 3GMFA 2OACA 3F9UA 2HI7A 5F06A 3SBCA 4I2UA 2C0FA 2AV4A 1K3LA 2GTUA 3F4TA 2J9HA 3FW2A 1ZCPA 3PGTA 2RM6A 4Z2RA 4XRAA 1R5PA 2JZTA 1PGTA 2EFEA 3TB2A 2GQLA 2NDOA 3MSZA 2R3XA 3VPTA 2PWJA 3CBUA 1ZYPA 2H70A 3IK7A 2B7KA 11GSA 3Q18A 5IMVA 5A4WA 3TKSC 3I6AA 2VCTA 4L0WA 1XWKA 1A8LA 5C04A 5A1NB 3UBKA 1QUWA 4J57E 4LL4B 2H8LA 1SK2A 1OC9B 4BA7A 1SKSB 4YH2A 3FK8A 3GH9A 1G7OA 4PURA 2VOCA 4E68A 3UOMA 1ZGNA 1ACVA 2CZ2A 4MH3A 3H1NA 2L5OA 4ML6A 1EGRA 1MTCA 4ECBA 5F07A 6GSYA 3LYPA 3C1SA 3UL3A 1O73A 3IV4A 3NOFA 4K0GA 1X9MB 2N5FA 3WT1A 4MZBA 1FHEA 3GFKA 4K5RA 1N8JA 2L5LA 1X5CA 2TRXA 1GWCA 4KB3A 3ZVJA 3ERWA 3S9FA 5JWQB 4FYCA 2LEGA 3LQ7A 2L4CA 3JCML 4HQZA 4NXIA 1CQGA 4G0KA 2HZFA 2E0QA 3P2AA 4WBJA 4JR4A 3GUSA 4I5QA 5DQSA 1B48A 3ZREA 3M9KA 3TKQA 5A5HB 2O85A 1OC3A 2QGVA 2YCDA 4POMA 2X8CA 1FO5A 4EC0A 3PINA 3A5WA 1J9BA 2K8VA 1GNEA 1ZYQB 1XWGA 1A23A 3APQA 3A2WA 4USSA 4EUYA 3NZNA 3F3RA 2DJ0A 5L71A 3UJ1A 5IPHA 1MDIA 3DWVA 1V57A 2BTOT 2LQOA 3GTUA 1XOBA 4TR3A 1R4WA 1B4PA 2HZEA 5HFIA 1QGVA 4EE0A 4YAPA 2WULA 4K2XA 4Q5FA 4ZB8A 1F37A 5GSSA 2LV3A 2IPAA 1B9YC 4N3ZA 5IQYA 1JZWA 3UAPA 3IBHA 5BMUB 4IELA 1K0NA 5JCUA 2GSSA 3BJ5A 1B4QA 1XIYA 3P7XA 4OMVA 5AIVA 5EL8A 6GSSA 3FR6A 2GZZA 1T1VA 2OA7A 1UA5A 2KHPA 3MAKA 3EE2A 2LRCA 3GSTA 4Z2TA 3ZTLA 1YKCA 4WR5A 3HCZA 2HSNA 1MDJA 2QKEA 4KA0A 4N30A 3P8WA 5J4UA 2VM1A 3VK9A 5J9CA 1EZKA 3GL5A 4ZILA 2C80A 3M8NA 5J4YA 2CAIA 4GDFA 1CQHA 1XVQA 3QMXA 1JHBA 5LCZA 3D4TA 4K2DA 3M3MA 1M9BA 1YEPA 5HQPA 3GH6A 7GSSA 3KP9A 4NAXA 1USBA 1X9WB 1SJ6A 4ZB9A 2J23A 5IMCA 3I9V2 2KP2A 3GTUB 4MABA 5FWGA 3EURA 4L5OA 1T3BA 4FIWA 1TJDA 1GRXA 1H75A 4CDOA 3IHQA 2I9HA 2PN8A 4W66A 3RHBA 4ML1A 4MZWA 1F2EA 1AQVA 1XW9A 4ZIJA 2M80A 3D4MA 2DJJA 4OFNA 5IMDA 3EWLA 2DJKA 2A2PA 4JE1A 2DIZA 5G30A 3Q19A 3EC3A 1Y1UA 3M1GA 5JWOB 3HA9A 3GN3A 5AIXA 19GSA 2KLXA 1T4YA 4KGIA 1Z6MA 5JWRB 2O8VB 3VI5A 1QK8A 1M2DA 2KUCA 4V2LA 3HZ4A 1TW9A 1W89A 2H1BA 2YJ7A 2B7JA 4ICYA 3E0UA 1YQ1A 3DVWA 17GSA 1F9MA 3US3A 3IOSA 1V9WA 1LBKA 3KP8A 2PGTA 4MDCA 3WGEA 1YF1A 3GKXA 1X5DA 2B3SA 3HD5A 3BD2A 4I2TA 2H0GA 4L0UA 5IOWA 2NBSA 1FOHA 3TJBA 3KEBA 2CVKA 3ISOA 4WKWA 5DDLA 1JFUA 5FHIA 2LRNA 5D9XA 5DVBA 4K8MA 1OKDA 5CYYA 1ERTA 1A24A 4TOPA 8GSSA 1B9XC 4OFTA 1WE0A 3A3TA 2FUG2 3IDVA 1TRWA 2LKUA 4ZL7A 5DJLA 3EPTA 4XTSA 4IJIA 2BMXA 2LQQA 4AKHA 2WCIA 3F6DA 5HR0A 3FZ9A 2VO4A 4NV5A 4O32A 1XPVA 2V6KA 2HSHA 2R4VA 4ZL9A 2HRNA 1NHOA 1A2JA 1YF0A 1JLWA 2E2GA 4MPGA 1LU4A 2CAQA 1T00A 2C3TA 4A5PA 1GL8A 3LORA 1JZRA 4NWYA 4G9HA 4PXOA 2OBIA 2TRCP 2DIYA 1ILOA 1ML6A 4AJ7A 5ECMB 1BQ7A 2CVBA 1GTBA 2VL3A 2WJUA 4X4JA 2PVQA 4ZXGA 2NTOA 2RUEA 3ZIJA 2ZNMA 1F3BA 2VLTA 2HT9A 1FVKA 4EDZA 2H0IA 4HEA2 1N25A 3TJGA 5CP1A 5F05A 1JZDA 4G0IA 5ECSA 2IIYA 4MJCA 4ACSA 3L0HA 1EEJA 1F3AA 5J41A 2X64A 2ZUPA 1X5EA 2K6VA 1EV9A 2YP6A 5IMFA 3TRPA 3FRCA 3FKFA 4MH2A 2C3QA 2MBTA 3KGKA 3EINA 1V58A 4HDEA 3F3QA 6GSXA 3MWHA 1THOA 3UARA 4WF4A 5J5NA 1URMA 1GSEA 2JZRA 2A4VA 4GXZA 1PQNA 5ID2B 2JADA 4KNDA 2K8SA 1ERUA 4Z7XA 4GSTA 3H8QA 3DVXA 4G0LA 4YAVA 6GSVA 3UEMA 2FWGA 2WB9A 2GVPA 2HYXA 3GSSA 4MPFA 2VL2C 4XS1A 4LL1B 2AJQB 5F0GA 3TKSA 3V1WA 3KTLA 3LEFA 3TKPA 3LW9A 4ZBAA 3C71A 1S3CA 4PQHA 3GX0A 5FT3A 3PPUA 5IM9A 2HRKA 2DJ1A 4KX4A 1I9DA 3ED3A 2H01A 2HSMB 4K0NA 1RW1A 1V98A 5B8AA 4V2MA 1PL1A 1ERWA 1SD8A 3J7Yb 1TRSA 2QC7A 5IMAA 4FH8A 3DXBA 1PMTA 2F51A 4OO4A 5J9BA 3ERGA 5ABRA 13GSA 3FR9A 1OE8A 2RM5A 2H76A 4GSSA 1WJKA 3CXGA 1J08A 3D6IA 1EGOA 4WEYA 2GZYA 1O8XA 4HZ2A 2DLXA 1MDKA 1O81A 4RI7A 4TR4A 4E8HA 1YDKA 1E6BA 1PD21 3G7IA 3HZ8A 5IPGA 4N0ZA 5J3RA 2IMKA 1O8WA 4RQRA 1TOFA 4WETA 1GLPA 2FGXA 4F0CA 3MDKA 4O5UA 1BYEA 3LSZA 4BL7A 1XFLA 3LJRA 2X4AA 1XZOA 1EOGA 2H72A 1UN2A 4KSOA 3F8UA 3CTGA 4N0VA 2EFHA 2HRFA 3QAWA 1TI3A 4OO5A 1Q4JA 5CRDA 4HJMA 1GUKA 5J4VA 5LD0A 2DC5A 2B6MA 3N9JA 1AUCA 3EU3A 4L8EA 4LA1A 5H5RA 3QDNA 5ENUA 4O92A 2YWOA 5DCHA 2LJAA 2QSIA 4EIPA 4G19A 3I69A 4TRXA 2FWFA 3M0FA 2PBJA 4O5QA 3ME7A 1DE1A 3FYGA 4DSRA 3FZ5A 1C72A 1PN9A 4G01A 5E59A 2IFQA 2VAFA 3ZITA 4HUAA 1GULA 1T7PB 4TKYA 2P31A 1U6TA 1SJZA 4HOJA 1ZMAA 4IBPA 3TKRA 1NHYA 4ULXA 4V2NA 1MEKA 4IP1A 3GURA 2X49A 5D9VA 4D73A 2YWMA 3RPPA 4IW9A 3QFBC 4HI7A 1TXXA 5A34A 2RUFA 1GH2A 3W6GA 4Q5NA 3TOUA 1R5AA 1HQOA 3D21A 18GSA 1EOHA 2V1MA 3HDCA 1GSSA 3VWXA 4RUVA 1V40A 3TJFA 2V6OA 3GHAA 4JZQA 3ZFBA 3KTBA 1AQXA 3CSJA 2IJYA 1A8YA 4X0XA 4CY6A 2GT5A 3WT2A 4PTSA 3BCKA 2R0GA 3FHKA 5C00A 4EDYA 2FNOA 2IMEA 2JL4A 3HJMA 3ZRDA 3VURA 2AB6A 4EKZA 1GSYA 4CHSA 4ECCA 2B5YA 3VI7A 1J0FA 5A4UA 2IWTA 2OE3A 2OADA 5EPFA 1SKWB 4WBRD 1G6WA 2DJ3A 2WS2A 2H1AA 2E2MA 3EMXA 2PMTA 2ZCTA 1VF3A 3D22A 2IFQB 3FMWA 2JACA 1GLQA 2KOKA 3C7MA 5B6NA 4K7NA 2HNLA 3BBYA 3KMNA 1WOUA 9GSSA 2ON7A 1OE7A 5ECNB 5DQYA 3U5RE 3W8SA 1FOVA 4KE3A 3C73A 4D73B 1GSUA 1O85A 1GUHA 4DSQA 1W4VA 2DSAA 3GX8A 4X43A 2MMAA 2YANA 4PGTA 5A34B 2CQ9A 1ST9A 3HJPA 2N5AA 1EEMA 1FB6A 2YWNA 4O5RA 4ID0A 2C8UA 4F82A 1TRUA 4JR6A 1WRYA 22GSA 3TJJA 4XS4A 1NW2A 4PNGA 5DAKA 1FB0A 2HZEB 3IXRA 4FYBA 1UC7A 5CRHA 1SK1A 4WF5A 2F3MA 3CRUA 4JRRA 1Z9HA 2H73A 2GDRA 2OBKA 1SK0A 3VWWA 3APSA 4HZ4A 2FCHA 3O3TA 1A2MA 3QAVA 3GIXA 4IN0A 1BEDA 4N11A 3TDGA 3VLNA 2H19A 2C0EA 4ISDA 1K3OA 2C1YA 2FHEA 1SENA 4EVMA 1E2YA 1KTEA 5DALA 1UVZA 5G2ZA 2DMLA 3O76A 4G2EA 2IN3A 4V1Ap 1TK5B 2CVDA 4FO5A 4PUFC 3ZLPA 3CSIA 2VCZA 1BG1A 3CYNA 4XRDA 1YEXA 12GSA 2VKZG 3VFIA 1QMVA 5E4WA 4HU7A 2A4HA 4XIHA 2P0GA 2HSNB 1JZOA 2XPDA 5G1KA 1K0OA 3L78A 4OFMA 1YJ6A 1XXUA 3QD9A 3MNGA 4H86A 2DMMA 4POLA 1VF4A 1ZYNA 2WZ9A 2OKAA 5HFGA 2GQKA 2DKIA 2GZPA 2GS3A 5D8IA 2VCVA 2REMA 1SU9A 5AN1A 5AGYA 3FZ4A 4XHMA 4EIQA 2A2RA 5GSTA 3DIEA 3KJYA 2H74A 3PR8A 3GKMA 1K0AA 1TU8A 5DBQA 2GSQA 1O7UA 5B7CA 4XS4B 3EVIA 2C3NA 3IE3A 4MJAA 2QA1A 4QL9A 4IKHA 4KDYA 2O87A 5BRTA 5KOXA 2IMDA 1RQMA 4K9ZA 2H6XA 1OVNA 2I4AA 4MMMA 1DSBA 2XC2A 3DRNA 3HKRA 4GF0A 1F6MC 1TI1A 3RBTA 3QPMA 1Z5YE 5IO2A 2HE3A 2L59A 2B1KA 4TR1A 4KAEA 2K9FA 3L9SA 4MK3A 2QA2A 2DJ2A 2MMNA 4TW5A 2MMOA 3KM6A 1SL2B 3AY8A 6GSWA 2E7PA 2XPEA 1H4OA 3E3EA 3G7YA 3IAS2 3ZMLA 3H93A 1VF1A 4OCEA 3W8JA 4EXJA 2L6CA 4LMVA 4AGSA 3QR6A 1SL1B 1VGLA 1PKZA 4AKIA 1U3AA 4BVXA 3CMIA 4NHWA 3TUEA 4ECIA 2R37A 2YV9A 5ELAA 2VL2A 3LXZA 3H79A 4YQVA 1TK8B 5ECIB 1OYJA 5GZZB 1PX7A 4Q5QA 4GLTA 3UMAA 1AXDA 3LYKA 3P90A 1SKRB 5D96A 3LFLA 3TU3B 3IC8A 5A5KA 1M2AA 3KZQA 3TCOA 4E8EA 1SYXA 1BF5A 4EL1A 1IYIA 2LTKA 2L57A 1RK4A 3J7Yk 4GQCA 3DGQA 2H1LA 4BPYA 1G6YA 2H30A 4AI6A 1GP1A 3U6VA 3APOA 1PN0A 4J2FA 4PNFA 3GRXA 2ES7A 4GTUA 5ECPB 5ECOB 2H6ZA 2IL3A 2H6YA 5G31A 1BJXA 4OCFA 1OAZA 4XS6A 3IRAA 5D93A 1N2AA 3HMJG 4TR1B 2RIIA 3QOUA 1XWCA 2VD1A 2C0GA 1QQ2A 2AAWA 1OC9A 3QAGA 3GKNA 3ZFLA 5HR1A 4DVCA 3EYTA 1SJIA 2AHEA 2K18A 1ABAA 2WRTA 2O5VA 3E9JB 4GSNA 5IIZA 2O7KA 1AQWA 1T4ZA 5D9WA 3HVXA 2XHFA 1X0RA 2CA8A 4BVXB 1TRVA 4KF9A 3DD3A 2B5EA 2RLIA 3G7JA 3KXOA 3LXTA 1EV4A 2MYGA 1KEBA 3RAZA 1B8XA 1XWBA 2R2JA 2EIQA 2P5QA 1XVWA 2FD3A 2GSRA 1TU7A 2IMFA 2LS5A 4POBA 1PX6A 5ECLB 1TKDB 5HFKA 3VPQA 1YVLA 4IHUA 5HR2A 2X99A 1AC1A 2GSTA 1HYUA 2D2ZA 5A5HA 5KN2A 4QL7A 5EY6A 2I3YA 3TKSE 4KDUA 1XWAA 1Q98A 1VF2A 1ERVA 2VIMA 4I6XA 1GUMA 2VLVA 2B1LA 2HXKA 4I8BA 4HS1A 4MF5A 4PUAA 4WXTA 4KW6A 4TXOA 2GT6A 2I1UA 3UVTA 3HYPA 4V1Ag 2DKHA 4OD7A 4G10A 4JU5A 3GA4A 3L4NA 1GTIA 4K7OA 3LGCA 1MD3A 1EP7A 4N10A 4I97A 2YWIA 5KN3A 2P5RA 4TXVA 4PQ1A 2YJHA 4EO3A 3ZIVA 3R3EA 4CY8A 4Q5RA 2PVOC 5IO0A 5J40A 4HU9A 1M2BA 4KSMA 4YKGA 2EIRA 4KCEA 2HRKB 3ME8A 6GSTA 4X1UA 2JU5A 1U88A 1Z6NA 4MP4A 5BMUA 3KCMA 1GTUA 2X8HA 1S3AA 1XBSA 1WPIA 2MMZA 3FEUA 2PU9C 2TIRA 1K0BA 3I43A 3C1RA 3DYRA 5B6MA 5KN1A 3M9JA 1G0TA 1QFNA 1A2LA 1NSWA 2H75A 1R26A 3LWAA 3ZL5A 2HLSA 1FW1A 2LNSA 2PPTA 16GSA 2YOIA 2LJKA 3FR3A 1TP9A 1AAZA 3ZYWA 4ZBBA 2O89A 4HQSA 5KN0A 1HNBA 3PH9A 3KMOA 5B8BA 1A0RP 1ZYEA 2FY6A 4WR4A 4DSSA 5LNKe 1YZXA 3L9UA 4NV2A 4NHZA 2V2GA 4FYUA 2MZCA 1WWJA 4TXOB 2BJXA 1BG5A 1JLVA 2PUKC 4BL7B 3WYWA 3HVSA 5H5QA 1DE2A 3UVHA 2OJLA 2OE0A 1YKAA 1NM3A 5COHA 1TTZA 2EIOA 20GSA 4JEDA 4RI6A 4AJ8A 1THXA 2F9SA 2AYTA 3ZMKA 3A5IA 1IYHA 3IC4A 3MYDA 2A2SA 3D0ZA 2R5GA 2NVLA 3IPZA 4IQ1A 1TDIA 5HR3A 4KH7A 4MNNA 2PERA 4FQUA 2VCXA 2NPBA 1PKWA 5DJMA 5ELGA 3VWVA 3F4SA 4AKXB 5G5EA 2LJRA 4IQAA 1PL2A 3WGXA 5D9TA 2JZSA 4OWYA 4MZCA 2VCWA 4MJEA 1AW9A 4DEJA 5CNWA 5ECHB 4GRFA 1SVMA 1LJRA 4K1FA 1PA3A 2VD0A 4JBBA 3IHGA 4K6XA 4F0BA 2GLRA 1HNAA 5JCGA 1K3YA 2JSZA 4BVYA 1OC8A 4POKA 3GL3A 3VWUA 4RQXA 2V41A 3Q74A 1QXHA 3RPNA 4DSSB 1GNWA 2C4JA 4GCIA 2WDUA 3CWGA 1HD2A 3K8NA 2N5BA 4IP6A 3IR4A 4YQUA 2R0PA 3TRXA 2CX3A 4NPBA 1DUGA 1GSFA 3F4RA 3C8EA 2YZUA 3HVVA 3L9VA 3QCPA 1U87A 5CREA 1KBNA 3D5JA 1ZZYA 2XBIA 3TOTA 3KD0A 1M99A 3FZAA 4BWQA 3RDWA 1G7EA 3A2XA 1SYRA 4ILFA 1XCCA 1ZL9A 5G1LA 4K7IA 5EVOA 6GSUA 1KNGA 3R2QA 3KH7A 4EF0A 1OKTA 1T8EB 1U3IA 3HJOA 1HNCA 3OR5A 5ECKB 5AISA 4MA9A 4ZB6A 4MF7A 2VLUA 1FVJA 2YV7A 2UV8G 3TJKA 2EFDA 3TGZA 4ZB7A 4PQIA 3ERFA 4TN8A 1WP0A 2LRTA 3LG6A 5GAPD 2X8GA 1ZOFA 2ALBA 3O6TA 2M46A 4IVFA 2YN1A 2HRAA 2XBQA 5INYA 1SL0B 2L6DA 2I81A 4TR0A 2VL9A 5J47A 1SVOA 2FLSA 1BAYA 2VCQA 3CSHA 4YQMA 1O6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BVY B;  1V2A A;  3EMP A;  1K0C A;  5H5S A;  1Y25 A;  3DML A;  2LST A;  4F03 A;  2F8A A;  2FWH A;  1K0M A;  5DAK B;  1YY7 A;  5F8B A;  2H1D A;  4O7H A;  2H66 A;  2IMI A;  2CT6 A;  1GSD A;  3ZZX A;  2V32 A;  1WMJ A;  3DEX A;  1MD4 A;  1PRX A;  1SD9 A;  2H0H A;  2GGT A;  3HY2 A;  2B5X A;  3SWL A;  3H4K A;  3IA1 A;  2HQT A;  2KP1 A;  2YZH A;  2L4Q A;  3CRT A;  5CO3 A;  3GYK A;  2MBS A;  4P3Y B;  4CW9 A;  2FA4 A;  5DAL B;  5CRW A;  4KDX A;  5KEJ A;  3GV1 A;  1FAA A;  2YPM A;  2HSY A;  5ID2 A;  2R6K A;  4NMU A;  4MF6 A;  2FA8 A;  4MLY A;  5GAN D;  3NIV A;  3IAM 2;  1ON4 A;  2H1G A;  2G0F A;  2F8F A;  3KH9 A;  4MJB A;  2LNT A;  14GS A;  1S3D A;  2WGR A;  1VRS D;  3HXS A;  4MCU A;  5JCW A;  1Y6E A;  3EU4 A;  1GSQ A;  1PSQ A;  1DBY A;  4AJ6 A;  1XOA A;  2M72 A;  5CRG A;  4BWS A;  4KCA A;  2HSM A;  2Z9S A;  5G5F A;  3WD6 A;  3DKS A;  4F9Z A;  3F0I A;  1M0U A;  3N5O A;  3GKK A;  1AIU A;  5D73 A;  3A2V A;  2VUP A;  1BX9 A;  4L5L A;  4ECJ A;  3ZVJ D;  2CV4 A;  1R7H A;  1K0D A;  4KUN A;  3KIJ A;  3CTF A;  5CAX A;  4GQF A;  3Q6O A;  2JSY A;  1M9A A;  5A4V A;  3RHC A;  2DBC A;  2YNX A;  3F6F A;  5IOX A;  1EWX A;  3HHV A;  3BOA A;  4IJ3 A;  2GQM A;  4J56 E;  4LLR A;  3UBL A;  3GNJ A;  1GTA A;  4ZL8 A;  4QQ7 A;  3WGD A;  5DCG A;  2UZ8 A;  1M7T A;  4IGJ A;  4XCS A;  3QFA C;  3FY7 A;  3IK9 A;  1FG4 A;  1I5G A;  2HFD A;  4ZBD A;  4AF2 A;  1Z3E A;  3BCI A;  2OE1 A;  1Z7P A;  2CX4 A;  10GS A;  4F2I A;  4TVE A;  2C0D A;  3G9B A;  5ECQ B;  1A0F A;  2G2Q A;  4IS0 A;  3UIW A;  4HJ2 A;  3F63 A;  2VM2 A;  2FWE A;  3TRQ A;  2EC4 A;  2LUS A;  4LMW A;  1XW6 A;  1XW5 A;  2ON5 A;  2CZ3 A;  2H71 A;  2WFC A;  5ECR B;  5IMZ A;  2AUV A;  1TK0 B;  1EP8 A;  1WIK A;  1Z7R A;  1X9S B;  4PX1 A;  4GWR A;  3GMF A;  2OAC A;  3F9U A;  2HI7 A;  5F06 A;  3SBC A;  4I2U A;  2C0F A;  2AV4 A;  1K3L A;  2GTU A;  3F4T A;  2J9H A;  3FW2 A;  1ZCP A;  3PGT A;  2RM6 A;  4XRA A;  1R5P A;  2JZT A;  1PGT A;  3TB2 A;  2GQL A;  2NDO A;  3MSZ A;  2R3X A;  3VPT A;  2PWJ A;  3CBU A;  2H70 A;  3IK7 A;  2B7K A;  11GS A;  3Q18 A;  5IMV A;  5A4W A;  3TKS C;  3I6A A;  2VCT A;  4L0W A;  1XWK A;  1A8L A;  5C04 A;  3UBK A;  1QUW A;  4J57 E;  4LL4 B;  2H8L A;  1SK2 A;  1OC9 B;  4BA7 A;  1SKS B;  4YH2 A;  3FK8 A;  3GH9 A;  1G7O A;  4PUR A;  2VOC A;  3UOM A;  1ZGN A;  1ACV A;  2CZ2 A;  4MH3 A;  3H1N A;  2L5O A;  4ML6 A;  1EGR A;  1MTC A;  4ECB A;  5F07 A;  6GSY A;  3LYP A;  3C1S A;  3UL3 A;  1O73 A;  3IV4 A;  3NOF A;  4K0G A;  1X9M B;  2N5F A;  3WT1 A;  4MZB A;  1FHE A;  3GFK A;  1N8J A;  2L5L A;  1X5C A;  2TRX A;  1GWC A;  4KB3 A;  3ZVJ A;  3ERW A;  3S9F A;  5JWQ B;  4FYC A;  2LEG A;  3LQ7 A;  2L4C A;  3JCM L;  4HQZ A;  4NXI A;  1CQG A;  4G0K A;  2HZF A;  2E0Q A;  3P2A A;  4WBJ A;  4JR4 A;  3GUS A;  4I5Q A;  5DQS A;  1B48 A;  3ZRE A;  3M9K A;  3TKQ A;  2O85 A;  1OC3 A;  2QGV A;  2YCD A;  4POM A;  2X8C A;  1FO5 A;  4EC0 A;  3PIN A;  3A5W A;  1J9B A;  2K8V A;  1GNE A;  1ZYQ B;  1XWG A;  1A23 A;  3APQ A;  3A2W A;  4USS A;  4EUY A;  3NZN A;  3F3R A;  2DJ0 A;  5L71 A;  3UJ1 A;  5IPH A;  1MDI A;  3DWV A;  1V57 A;  2BTO T;  2LQO A;  3GTU A;  1XOB A;  4TR3 A;  1R4W A;  1B4P A;  2HZE A;  5HFI A;  1QGV A;  4EE0 A;  4YAP A;  2WUL A;  4Q5F A;  4ZB8 A;  1F37 A;  5GSS A;  2LV3 A;  2IPA A;  1B9Y C;  5IQY A;  1JZW A;  3UAP A;  3IBH A;  4IEL A;  1K0N A;  5JCU A;  2GSS A;  3BJ5 A;  1B4Q A;  1XIY A;  3P7X A;  4OMV A;  5AIV A;  5EL8 A;  6GSS A;  3FR6 A;  2GZZ A;  1T1V A;  2OA7 A;  1UA5 A;  2KHP A;  3MAK A;  3EE2 A;  2LRC A;  3GST A;  3ZTL A;  1YKC A;  4WR5 A;  3HCZ A;  1MDJ A;  2QKE A;  4KA0 A;  4N30 A;  3P8W A;  5J4U A;  2VM1 A;  3VK9 A;  5J9C A;  1EZK A;  3GL5 A;  4ZIL A;  2C80 A;  3M8N A;  2CAI A;  1CQH A;  1XVQ A;  3QMX A;  1JHB A;  5LCZ A;  3D4T A;  4K2D A;  3M3M A;  1M9B A;  1YEP A;  5HQP A;  3GH6 A;  7GSS A;  3KP9 A;  4NAX A;  1USB A;  1X9W B;  1SJ6 A;  4ZB9 A;  2J23 A;  5IMC A;  3I9V 2;  2KP2 A;  3GTU B;  4MAB A;  5FWG A;  3EUR A;  4L5O A;  1T3B A;  4FIW A;  1TJD A;  1GRX A;  1H75 A;  4CDO A;  3IHQ A;  2I9H A;  2PN8 A;  3RHB A;  4ML1 A;  4MZW A;  1F2E A;  1AQV A;  1XW9 A;  4ZIJ A;  2M80 A;  3D4M A;  2DJJ A;  4OFN A;  5IMD A;  3EWL A;  2DJK A;  4JE1 A;  2DIZ A;  5G30 A;  3Q19 A;  3EC3 A;  3M1G A;  5JWO B;  3HA9 A;  3GN3 A;  5AIX A;  19GS A;  2KLX A;  1T4Y A;  4KGI A;  1Z6M A;  5JWR B;  2O8V B;  3VI5 A;  1QK8 A;  1M2D A;  2KUC A;  4V2L A;  3HZ4 A;  1TW9 A;  1W89 A;  2H1B A;  2YJ7 A;  2B7J A;  3E0U A;  1YQ1 A;  3DVW A;  17GS A;  1F9M A;  3US3 A;  3IOS A;  1V9W A;  1LBK A;  3KP8 A;  2PGT A;  4MDC A;  3WGE A;  1YF1 A;  3GKX A;  1X5D A;  2B3S A;  3HD5 A;  3BD2 A;  4I2T A;  2H0G A;  4L0U A;  5IOW A;  2NBS A;  3TJB A;  3KEB A;  2CVK A;  3ISO A;  4WKW A;  5DDL A;  1JFU A;  5FHI A;  2LRN A;  5D9X A;  5DVB A;  4K8M A;  1OKD A;  5CYY A;  1ERT A;  1A24 A;  4TOP A;  8GSS A;  1B9X C;  4OFT A;  1WE0 A;  3A3T A;  2FUG 2;  3IDV A;  1TRW A;  2LKU A;  4ZL7 A;  5DJL A;  4XTS A;  4IJI A;  2BMX A;  2LQQ A;  2WCI A;  3F6D A;  5HR0 A;  3FZ9 A;  2VO4 A;  4NV5 A;  4O32 A;  1XPV A;  2V6K A;  2HSH A;  2R4V A;  4ZL9 A;  2HRN A;  1NHO A;  1A2J A;  1YF0 A;  1JLW A;  2E2G A;  4MPG A;  1LU4 A;  2CAQ A;  1T00 A;  2C3T A;  1GL8 A;  3LOR A;  1JZR A;  4NWY A;  4G9H A;  4PXO A;  2OBI A;  2TRC P;  2DIY A;  1ILO A;  1ML6 A;  4AJ7 A;  5ECM B;  1BQ7 A;  2CVB A;  1GTB A;  2VL3 A;  2WJU A;  2PVQ A;  4ZXG A;  2NTO A;  2RUE A;  3ZIJ A;  2ZNM A;  1F3B A;  2VLT A;  2HT9 A;  1FVK A;  4EDZ A;  2H0I A;  4HEA 2;  3TJG A;  5CP1 A;  5F05 A;  1JZD A;  4G0I A;  5ECS A;  2IIY A;  4MJC A;  4ACS A;  3L0H A;  1EEJ A;  1F3A A;  5J41 A;  2X64 A;  2ZUP A;  1X5E A;  2K6V A;  1EV9 A;  2YP6 A;  5IMF A;  3TRP A;  3FRC A;  3FKF A;  4MH2 A;  2C3Q A;  2MBT A;  3KGK A;  3EIN A;  1V58 A;  4HDE A;  3F3Q A;  6GSX A;  3MWH A;  1THO A;  3UAR A;  4WF4 A;  5J5N A;  1URM A;  1GSE A;  2JZR A;  2A4V A;  4GXZ A;  1PQN A;  5ID2 B;  2JAD A;  4KND A;  2K8S A;  1ERU A;  4Z7X A;  4GST A;  3H8Q A;  3DVX A;  4G0L A;  4YAV A;  6GSV A;  3UEM A;  2FWG A;  2WB9 A;  2GVP A;  2HYX A;  3GSS A;  4MPF A;  2VL2 C;  4XS1 A;  4LL1 B;  2AJQ B;  5F0G A;  3TKS A;  3V1W A;  3KTL A;  3LEF A;  3TKP A;  4ZBA A;  3C71 A;  1S3C A;  4PQH A;  3GX0 A;  5FT3 A;  3PPU A;  5IM9 A;  2HRK A;  2DJ1 A;  4KX4 A;  1I9D A;  3ED3 A;  2H01 A;  2HSM B;  4K0N A;  1RW1 A;  1V98 A;  5B8A A;  4V2M A;  1PL1 A;  1ERW A;  1SD8 A;  3J7Y b;  1TRS A;  2QC7 A;  5IMA A;  4FH8 A;  3DXB A;  1PMT A;  2F51 A;  4OO4 A;  5J9B A;  3ERG A;  5ABR A;  13GS A;  3FR9 A;  1OE8 A;  2RM5 A;  2H76 A;  4GSS A;  1WJK A;  3CXG A;  1J08 A;  3D6I A;  1EGO A;  4WEY A;  2GZY A;  1O8X A;  4HZ2 A;  2DLX A;  1MDK A;  1O81 A;  4RI7 A;  4TR4 A;  4E8H A;  1YDK A;  1E6B A;  1PD2 1;  3G7I A;  3HZ8 A;  5IPG A;  4N0Z A;  5J3R A;  2IMK A;  1O8W A;  4RQR A;  1TOF A;  4WET A;  1GLP A;  2FGX A;  4F0C A;  3MDK A;  1BYE A;  3LSZ A;  4BL7 A;  1XFL A;  3LJR A;  1XZO A;  1EOG A;  2H72 A;  1UN2 A;  4KSO A;  3F8U A;  3CTG A;  4N0V A;  2HRF A;  3QAW A;  1TI3 A;  4OO5 A;  1Q4J A;  5CRD A;  4HJM A;  1GUK A;  5LD0 A;  2DC5 A;  2B6M A;  3N9J A;  1AUC A;  3EU3 A;  4L8E A;  4LA1 A;  5H5R A;  3QDN A;  5ENU A;  4O92 A;  2YWO A;  5DCH A;  2LJA A;  2QSI A;  4G19 A;  3I69 A;  4TRX A;  2FWF A;  3M0F A;  2PBJ A;  3ME7 A;  1DE1 A;  3FYG A;  4DSR A;  3FZ5 A;  1C72 A;  1PN9 A;  5E59 A;  2IFQ A;  2VAF A;  3ZIT A;  4HUA A;  1GUL A;  1T7P B;  4TKY A;  2P31 A;  1U6T A;  1SJZ A;  4HOJ A;  1ZMA A;  4IBP A;  3TKR A;  1NHY A;  4ULX A;  4V2N A;  1MEK A;  4IP1 A;  3GUR A;  5D9V A;  4D73 A;  2YWM A;  3RPP A;  4IW9 A;  3QFB C;  4HI7 A;  1TXX A;  2RUF A;  1GH2 A;  3W6G A;  4Q5N A;  3TOU A;  1R5A A;  1HQO A;  3D21 A;  18GS A;  1EOH A;  2V1M A;  3HDC A;  1GSS A;  3VWX A;  4RUV A;  1V40 A;  3TJF A;  2V6O A;  3GHA A;  4JZQ A;  3ZFB A;  3KTB A;  1AQX A;  3CSJ A;  2IJY A;  1A8Y A;  4X0X A;  2GT5 A;  3WT2 A;  4PTS A;  3BCK A;  3FHK A;  5C00 A;  4EDY A;  2FNO A;  2IME A;  2JL4 A;  3HJM A;  3ZRD A;  3VUR A;  2AB6 A;  4EKZ A;  1GSY A;  4CHS A;  4ECC A;  2B5Y A;  3VI7 A;  1J0F A;  5A4U A;  2IWT A;  2OE3 A;  2OAD A;  5EPF A;  1SKW B;  4WBR D;  1G6W A;  2DJ3 A;  2WS2 A;  2H1A A;  2E2M A;  3EMX A;  2PMT A;  2ZCT A;  1VF3 A;  3D22 A;  2IFQ B;  2JAC A;  1GLQ A;  2KOK A;  3C7M A;  5B6N A;  4K7N A;  2HNL A;  3BBY A;  3KMN A;  1WOU A;  9GSS A;  2ON7 A;  1OE7 A;  5ECN B;  5DQY A;  3U5R E;  3W8S A;  1FOV A;  4KE3 A;  3C73 A;  4D73 B;  1GSU A;  1O85 A;  1GUH A;  4DSQ A;  1W4V A;  2DSA A;  3GX8 A;  4X43 A;  2MMA A;  2YAN A;  4PGT A;  2CQ9 A;  1ST9 A;  3HJP A;  2N5A A;  1EEM A;  1FB6 A;  2YWN A;  4O5R A;  4ID0 A;  2C8U A;  4F82 A;  1TRU A;  4JR6 A;  1WRY A;  22GS A;  3TJJ A;  4XS4 A;  1NW2 A;  4PNG A;  5DAK A;  1FB0 A;  2HZE B;  3IXR A;  4FYB A;  1UC7 A;  5CRH A;  1SK1 A;  4WF5 A;  2F3M A;  3CRU A;  4JRR A;  1Z9H A;  2H73 A;  2GDR A;  2OBK A;  1SK0 A;  3VWW A;  3APS A;  4HZ4 A;  2FCH A;  3O3T A;  1A2M A;  3QAV A;  3GIX A;  4IN0 A;  1BED A;  4N11 A;  3TDG A;  3VLN A;  2H19 A;  2C0E A;  4ISD A;  1K3O A;  2C1Y A;  2FHE A;  1SEN A;  4EVM A;  1E2Y A;  1KTE A;  5DAL A;  1UVZ A;  5G2Z A;  2DML A;  3O76 A;  4G2E A;  2IN3 A;  4V1A p;  1TK5 B;  2CVD A;  4FO5 A;  4PUF C;  3ZLP A;  3CSI A;  2VCZ A;  3CYN A;  4XRD A;  1YEX A;  12GS A;  3VFI A;  1QMV A;  5E4W A;  4HU7 A;  4XIH A;  2P0G A;  2HSN B;  1JZO A;  2XPD A;  5G1K A;  1K0O A;  3L78 A;  4OFM A;  1YJ6 A;  1XXU A;  3QD9 A;  3MNG A;  4H86 A;  2DMM A;  4POL A;  1VF4 A;  2WZ9 A;  2OKA A;  5HFG A;  2GQK A;  2GZP A;  2GS3 A;  5D8I A;  2VCV A;  2REM A;  1SU9 A;  5AN1 A;  5AGY A;  3FZ4 A;  4XHM A;  2A2R A;  5GST A;  3DIE A;  3KJY A;  2H74 A;  3PR8 A;  3GKM A;  1K0A A;  1TU8 A;  5DBQ A;  2GSQ A;  1O7U A;  5B7C A;  4XS4 B;  3EVI A;  2C3N A;  3IE3 A;  4MJA A;  4QL9 A;  4IKH A;  4KDY A;  2O87 A;  2IMD A;  1RQM A;  4K9Z A;  2H6X A;  1OVN A;  2I4A A;  4MMM A;  1DSB A;  2XC2 A;  3DRN A;  3HKR A;  4GF0 A;  1F6M C;  1TI1 A;  3RBT A;  3QPM A;  1Z5Y E;  5IO2 A;  2HE3 A;  2L59 A;  2B1K A;  4TR1 A;  4KAE A;  2K9F A;  3L9S A;  4MK3 A;  2DJ2 A;  2MMN A;  4TW5 A;  2MMO A;  3KM6 A;  1SL2 B;  3AY8 A;  6GSW A;  2E7P A;  2XPE A;  1H4O A;  3E3E A;  3G7Y A;  3IAS 2;  3ZML A;  3H93 A;  1VF1 A;  4OCE A;  3W8J A;  4EXJ A;  2L6C A;  4LMV A;  4AGS A;  3QR6 A;  1SL1 B;  1VGL A;  1PKZ A;  1U3A A;  4BVX A;  3CMI A;  4NHW A;  3TUE A;  4ECI A;  2R37 A;  2YV9 A;  5ELA A;  2VL2 A;  3LXZ A;  3H79 A;  4YQV A;  1TK8 B;  5ECI B;  1OYJ A;  5GZZ B;  1PX7 A;  4Q5Q A;  4GLT A;  3UMA A;  1AXD A;  3LYK A;  3P90 A;  1SKR B;  5D96 A;  3LFL A;  3IC8 A;  5A5K A;  1M2A A;  3KZQ A;  3TCO A;  4E8E A;  1SYX A;  4EL1 A;  1IYI A;  2LTK A;  2L57 A;  1RK4 A;  3J7Y k;  4GQC A;  3DGQ A;  4BPY A;  1G6Y A;  2H30 A;  1GP1 A;  3U6V A;  3APO A;  4J2F A;  4PNF A;  3GRX A;  2ES7 A;  4GTU A;  5ECP B;  5ECO B;  2H6Z A;  2IL3 A;  2H6Y A;  5G31 A;  1BJX A;  4OCF A;  1OAZ A;  4XS6 A;  3IRA A;  5D93 A;  1N2A A;  4TR1 B;  2RII A;  3QOU A;  1XWC A;  2VD1 A;  2C0G A;  1QQ2 A;  2AAW A;  1OC9 A;  3QAG A;  3GKN A;  3ZFL A;  5HR1 A;  4DVC A;  3EYT A;  1SJI A;  2AHE A;  2K18 A;  1ABA A;  2WRT A;  3E9J B;  4GSN A;  5IIZ A;  2O7K A;  1AQW A;  1T4Z A;  5D9W A;  3HVX A;  2XHF A;  1X0R A;  2CA8 A;  4BVX B;  1TRV A;  4KF9 A;  3DD3 A;  2B5E A;  2RLI A;  3G7J A;  3KXO A;  3LXT A;  1EV4 A;  2MYG A;  1KEB A;  3RAZ A;  1B8X A;  1XWB A;  2R2J A;  2EIQ A;  2P5Q A;  1XVW A;  2FD3 A;  2GSR A;  1TU7 A;  2IMF A;  2LS5 A;  4POB A;  1PX6 A;  5ECL B;  1TKD B;  5HFK A;  3VPQ A;  4IHU A;  5HR2 A;  2X99 A;  1AC1 A;  2GST A;  1HYU A;  2D2Z A;  5KN2 A;  4QL7 A;  5EY6 A;  2I3Y A;  3TKS E;  4KDU A;  1XWA A;  1Q98 A;  1VF2 A;  1ERV A;  2VIM A;  4I6X A;  1GUM A;  2VLV A;  2B1L A;  2HXK A;  4I8B A;  4HS1 A;  4MF5 A;  4PUA A;  4WXT A;  4KW6 A;  4TXO A;  2GT6 A;  2I1U A;  3UVT A;  3HYP A;  4V1A g;  4OD7 A;  4G10 A;  4JU5 A;  3GA4 A;  3L4N A;  1GTI A;  4K7O A;  3LGC A;  1MD3 A;  1EP7 A;  4N10 A;  4I97 A;  2YWI A;  5KN3 A;  2P5R A;  4TXV A;  4PQ1 A;  2YJH A;  4EO3 A;  3ZIV A;  3R3E A;  4Q5R A;  2PVO C;  5IO0 A;  4HU9 A;  1M2B A;  4KSM A;  2EIR A;  4KCE A;  2HRK B;  3ME8 A;  6GST A;  4X1U A;  2JU5 A;  1U88 A;  1Z6N A;  4MP4 A;  5BMU A;  3KCM A;  1GTU A;  2X8H A;  1S3A A;  1XBS A;  1WPI A;  2MMZ A;  3FEU A;  2PU9 C;  2TIR A;  1K0B A;  3I43 A;  3C1R A;  3DYR A;  5B6M A;  5KN1 A;  3M9J A;  1G0T A;  1QFN A;  1A2L A;  1NSW A;  2H75 A;  1R26 A;  3LWA A;  3ZL5 A;  2HLS A;  1FW1 A;  2LNS A;  2PPT A;  16GS A;  2YOI A;  2LJK A;  3FR3 A;  1TP9 A;  1AAZ A;  3ZYW A;  4ZBB A;  2O89 A;  4HQS A;  5KN0 A;  1HNB A;  3PH9 A;  3KMO A;  5B8B A;  1A0R P;  1ZYE A;  2FY6 A;  4WR4 A;  4DSS A;  5LNK e;  1YZX A;  3L9U A;  4NV2 A;  4NHZ A;  2V2G A;  4FYU A;  2MZC A;  1WWJ A;  4TXO B;  2BJX A;  1BG5 A;  1JLV A;  2PUK C;  4BL7 B;  3WYW A;  3HVS A;  5H5Q A;  1DE2 A;  3UVH A;  2OJL A;  2OE0 A;  1YKA A;  1NM3 A;  5COH A;  1TTZ A;  2EIO A;  20GS A;  4JED A;  4RI6 A;  4AJ8 A;  1THX A;  2F9S A;  2AYT A;  3ZMK A;  1IYH A;  3IC4 A;  2A2S A;  3D0Z A;  2R5G A;  2NVL A;  3IPZ A;  4IQ1 A;  1TDI A;  5HR3 A;  4KH7 A;  2PER A;  4FQU A;  2VCX A;  2NPB A;  1PKW A;  5DJM A;  5ELG A;  3VWV A;  3F4S A;  5G5E A;  2LJR A;  4IQA A;  1PL2 A;  3WGX A;  5D9T A;  2JZS A;  4OWY A;  4MZC A;  2VCW A;  4MJE A;  1AW9 A;  4DEJ A;  5CNW A;  5ECH B;  4GRF A;  1LJR A;  4K1F A;  1PA3 A;  2VD0 A;  4JBB A;  4K6X A;  4F0B A;  2GLR A;  1HNA A;  5JCG A;  1K3Y A;  2JSZ A;  4BVY A;  1OC8 A;  4POK A;  3GL3 A;  3VWU A;  4RQX A;  2V41 A;  3Q74 A;  1QXH A;  3RPN A;  4DSS B;  1GNW A;  2C4J A;  4GCI A;  2WDU A;  1HD2 A;  3K8N A;  2N5B A;  4IP6 A;  3IR4 A;  4YQU A;  3TRX A;  2CX3 A;  4NPB A;  1DUG A;  1GSF A;  3F4R A;  3C8E A;  2YZU A;  3HVV A;  3L9V A;  3QCP A;  1U87 A;  5CRE A;  1KBN A;  3D5J A;  1ZZY A;  2XBI A;  3TOT A;  3KD0 A;  1M99 A;  3FZA A;  4BWQ A;  3RDW A;  1G7E A;  3A2X A;  1SYR A;  4ILF A;  1XCC A;  1ZL9 A;  5G1L A;  4K7I A;  5EVO A;  6GSU A;  1KNG A;  3R2Q A;  3KH7 A;  4EF0 A;  1OKT A;  1T8E B;  1U3I A;  3HJO A;  1HNC A;  3OR5 A;  5ECK B;  5AIS A;  4MA9 A;  4ZB6 A;  4MF7 A;  2VLU A;  1FVJ A;  2YV7 A;  3TJK A;  3TGZ A;  4PQI A;  3ERF A;  4TN8 A;  1WP0 A;  2LRT A;  3LG6 A;  5GAP D;  2X8G A;  1ZOF A;  2ALB A;  3O6T A;  2M46 A;  4IVF A;  2YN1 A;  2HRA A;  2XBQ A;  5INY A;  1SL0 B;  2L6D A;  2I81 A;  4TR0 A;  2VL9 A;  2FLS A;  1BAY A;  2VCQ A;  3CSH A;  4YQM A;  1O6J A; 
#chains in the Genus database with same CATH topology
 4BVY B;  1V2A A;  3EMP A;  1K0C A;  5H5S A;  1Y25 A;  3DML A;  2LST A;  4F03 A;  2F8A A;  2FWH A;  1K0M A;  5DAK B;  1YY7 A;  5F8B A;  2H1D A;  4O7H A;  2H66 A;  4Z2U A;  2IMI A;  2CT6 A;  1GSD A;  3ZZX A;  1SVL A;  2V32 A;  1WMJ A;  3DEX A;  1MD4 A;  1PRX A;  1SD9 A;  2H0H A;  2GGT A;  2OT3 A;  3HY2 A;  2B5X A;  3SWL A;  3MIX A;  3H4K A;  3IA1 A;  2HQT A;  2KP1 A;  2YZH A;  2L4Q A;  3CRT A;  5CO3 A;  3GYK A;  2MBS A;  4P3Y B;  4CW9 A;  2FA4 A;  5DAL B;  5CRW A;  4KDX A;  5KEJ A;  3GV1 A;  1FAA A;  2YPM A;  2HSY A;  5ID2 A;  2R6K A;  4NMU A;  4MF6 A;  2FA8 A;  4MLY A;  5GAN D;  3NIV A;  3IAM 2;  2EFC A;  1ON4 A;  2H1G A;  2G0F A;  2F8F A;  3KH9 A;  4MJB A;  2LNT A;  14GS A;  1S3D A;  2WGR A;  1VRS D;  3HXS A;  4MCU A;  5JCW A;  1Y6E A;  3EU4 A;  1GSQ A;  1PSQ A;  1DBY A;  4AJ6 A;  1XOA A;  2M72 A;  5CRG A;  4BWS A;  4KCA A;  2HSM A;  2Z9S A;  5G5F A;  3WD6 A;  3DKS A;  4F9Z A;  3F0I A;  4K5S A;  1M0U A;  3N5O A;  3GKK A;  1AIU A;  5D73 A;  1TXU A;  3A2V A;  2VUP A;  1BX9 A;  4L5L A;  4ECJ A;  3ZVJ D;  3RGB C;  2CV4 A;  1R7H A;  1K0D A;  4KUN A;  3KIJ A;  3CTF A;  5CAX A;  3Q6O A;  4GQF A;  2JSY A;  5KOW A;  1M9A A;  5A4V A;  3RHC A;  2DBC A;  2YNX A;  3F6F A;  5IOX A;  1EWX A;  3HHV A;  3BOA A;  4IJ3 A;  2GQM A;  4J56 E;  4LLR A;  3UBL A;  3GNJ A;  1GTA A;  4ZL8 A;  4QQ7 A;  4QMK A;  3WGD A;  5DCG A;  2UZ8 A;  1M7T A;  4IGJ A;  4XCS A;  2WZS A;  3QFA C;  5A1N A;  3FY7 A;  3IK9 A;  1FG4 A;  1I5G A;  2HFD A;  4ZBD A;  4AF2 A;  1Z3E A;  3BCI A;  2WW2 A;  2OE1 A;  1Z7P A;  2CX4 A;  10GS A;  4F2I A;  4TVE A;  2C0D A;  3G9B A;  5ECQ B;  4AKG A;  1A0F A;  2G2Q A;  4IS0 A;  3UIW A;  4HJ2 A;  2R0C A;  3F63 A;  2VM2 A;  2FWE A;  3TRQ A;  2EC4 A;  2LUS A;  4LMW A;  4YKF A;  1XW6 A;  1XW5 A;  2ON5 A;  2CZ3 A;  2H71 A;  2WFC A;  5ECR B;  5IMZ A;  2AUV A;  1TK0 B;  1EP8 A;  1WIK A;  1Z7R A;  1X9S B;  4PX1 A;  4GWR A;  3GMF A;  2OAC A;  3F9U A;  2HI7 A;  5F06 A;  3SBC A;  4I2U A;  2C0F A;  2AV4 A;  1K3L A;  2GTU A;  3F4T A;  2J9H A;  3FW2 A;  1ZCP A;  3PGT A;  2RM6 A;  4Z2R A;  4XRA A;  1R5P A;  2JZT A;  1I1I P;  1PGT A;  2EFE A;  3TB2 A;  2GQL A;  2NDO A;  3MSZ A;  2R3X A;  3VPT A;  2PWJ A;  3CBU A;  1ZYP A;  2H70 A;  3IK7 A;  2B7K A;  11GS A;  3Q18 A;  5IMV A;  5A4W A;  3TKS C;  3I6A A;  2VCT A;  4L0W A;  1XWK A;  1A8L A;  5C04 A;  5A1N B;  3UBK A;  1QUW A;  4J57 E;  4LL4 B;  2H8L A;  1SK2 A;  1OC9 B;  4BA7 A;  1SKS B;  4YH2 A;  3FK8 A;  3GH9 A;  1G7O A;  4BIK A;  4PUR A;  2VOC A;  4E68 A;  3UOM A;  1ZGN A;  1ACV A;  2CZ2 A;  4MH3 A;  3H1N A;  2L5O A;  4ML6 A;  1EGR A;  1MTC A;  4ECB A;  5F07 A;  6GSY A;  3LYP A;  3C1S A;  3UL3 A;  1O73 A;  3IV4 A;  3NOF A;  4K0G A;  1X9M B;  2N5F A;  3WT1 A;  4MZB A;  1FHE A;  3GFK A;  4K5R A;  1N8J A;  2L5L A;  1X5C A;  2TRX A;  1GWC A;  4KB3 A;  3ZVJ A;  3ERW A;  3S9F A;  5JWQ B;  4FYC A;  2LEG A;  3LQ7 A;  2L4C A;  3JCM L;  4HQZ A;  4NXI A;  1CQG A;  4G0K A;  2HZF A;  2E0Q A;  3P2A A;  4WBJ A;  4JR4 A;  3GUS A;  4I5Q A;  5DQS A;  1B48 A;  3ZRE A;  3M9K A;  3TKQ A;  5A5H B;  2O85 A;  1OC3 A;  2QGV A;  2YCD A;  4POM A;  2X8C A;  1FO5 A;  4EC0 A;  3PIN A;  3A5W A;  1J9B A;  2K8V A;  1GNE A;  1ZYQ B;  1XWG A;  1A23 A;  3APQ A;  3A2W A;  4USS A;  4EUY A;  3NZN A;  3F3R A;  2DJ0 A;  5L71 A;  3UJ1 A;  5IPH A;  1MDI A;  3DWV A;  1V57 A;  2BTO T;  2LQO A;  3GTU A;  1XOB A;  4TR3 A;  1R4W A;  1B4P A;  2HZE A;  5HFI A;  1QGV A;  4EE0 A;  4YAP A;  2WUL A;  4K2X A;  4Q5F A;  4ZB8 A;  1F37 A;  5GSS A;  2LV3 A;  2IPA A;  1B9Y C;  4N3Z A;  5IQY A;  1JZW A;  3UAP A;  3IBH A;  5BMU B;  4IEL A;  1K0N A;  5JCU A;  2GSS A;  3BJ5 A;  1B4Q A;  1XIY A;  3P7X A;  4OMV A;  5AIV A;  5EL8 A;  6GSS A;  3FR6 A;  2GZZ A;  1T1V A;  2OA7 A;  1UA5 A;  2KHP A;  3MAK A;  3EE2 A;  2LRC A;  3GST A;  4Z2T A;  3ZTL A;  1YKC A;  4WR5 A;  3HCZ A;  2HSN A;  1MDJ A;  2QKE A;  4KA0 A;  4N30 A;  3P8W A;  5J4U A;  2VM1 A;  3VK9 A;  5J9C A;  1EZK A;  3GL5 A;  4ZIL A;  2C80 A;  3M8N A;  5J4Y A;  2CAI A;  4GDF A;  1CQH A;  1XVQ A;  3QMX A;  1JHB A;  5LCZ A;  3D4T A;  4K2D A;  3M3M A;  1M9B A;  1YEP A;  5HQP A;  3GH6 A;  7GSS A;  3KP9 A;  4NAX A;  1USB A;  1YEW C;  1X9W B;  1SJ6 A;  4ZB9 A;  2J23 A;  5IMC A;  3I9V 2;  2KP2 A;  3GTU B;  4MAB A;  5FWG A;  3EUR A;  4L5O A;  1T3B A;  4FIW A;  1TJD A;  1GRX A;  1H75 A;  4CDO A;  3IHQ A;  2I9H A;  2PN8 A;  4HSC X;  4W66 A;  3RHB A;  4ML1 A;  4MZW A;  1F2E A;  1AQV A;  1XW9 A;  4ZIJ A;  2M80 A;  3D4M A;  2DJJ A;  4OFN A;  4PI0 C;  5IMD A;  3EWL A;  2DJK A;  2A2P A;  4JE1 A;  2DIZ A;  5G30 A;  3Q19 A;  3EC3 A;  1Y1U A;  3M1G A;  5JWO B;  3HA9 A;  3GN3 A;  5AIX A;  19GS A;  2KLX A;  1T4Y A;  4KGI A;  1Z6M A;  5JWR B;  2O8V B;  3VI5 A;  1QK8 A;  1M2D A;  2KUC A;  4V2L A;  3HZ4 A;  1TW9 A;  1W89 A;  2H1B A;  2YJ7 A;  2B7J A;  4ICY A;  3E0U A;  1YQ1 A;  3DVW A;  17GS A;  1F9M A;  3US3 A;  3IOS A;  1V9W A;  1LBK A;  3KP8 A;  2PGT A;  4MDC A;  3WGE A;  1YF1 A;  3GKX A;  1X5D A;  2B3S A;  3HD5 A;  3BD2 A;  4I2T A;  2H0G A;  4L0U A;  5IOW A;  2NBS A;  1FOH A;  3TJB A;  3KEB A;  2CVK A;  3ISO A;  2WVX A;  4WKW A;  5DDL A;  1JFU A;  5FHI A;  2LRN A;  5D9X A;  5DVB A;  4K8M A;  1OKD A;  5CYY A;  1ERT A;  1A24 A;  4TOP A;  8GSS A;  1XG8 A;  1B9X C;  4OFT A;  1WE0 A;  3A3T A;  4PHZ C;  2FUG 2;  3IDV A;  1TRW A;  2LKU A;  4ZL7 A;  5DJL A;  3EPT A;  4XTS A;  4IJI A;  2BMX A;  2LQQ A;  4AKH A;  2WCI A;  3F6D A;  5HR0 A;  3FZ9 A;  2VO4 A;  4NV5 A;  4O32 A;  1XPV A;  2V6K A;  2HSH A;  2R4V A;  4ZL9 A;  2HRN A;  1NHO A;  1A2J A;  1YF0 A;  1JLW A;  2E2G A;  4MPG A;  1LU4 A;  2CAQ A;  1T00 A;  2C3T A;  4A5P A;  1GL8 A;  3LOR A;  1JZR A;  4NWY A;  4G9H A;  4PXO A;  2OBI A;  2TRC P;  2DIY A;  1ILO A;  1ML6 A;  4AJ7 A;  5ECM B;  1BQ7 A;  2CVB A;  1GTB A;  2VL3 A;  2WJU A;  4X4J A;  2PVQ A;  4ZXG A;  2NTO A;  2RUE A;  3ZIJ A;  2ZNM A;  1F3B A;  2VLT A;  2HT9 A;  1FVK A;  4EDZ A;  1M3I A;  2H0I A;  4HEA 2;  1N25 A;  3TJG A;  5CP1 A;  5F05 A;  1JZD A;  4G0I A;  5ECS A;  2IIY A;  4MJC A;  4ACS A;  3L0H A;  1EEJ A;  2WVX B;  1F3A A;  5J41 A;  2X64 A;  2ZUP A;  1X5E A;  2K6V A;  1EV9 A;  2YP6 A;  5IMF A;  3TRP A;  3FRC A;  3FKF A;  4MH2 A;  2C3Q A;  2MBT A;  3KGK A;  3EIN A;  1V58 A;  4HDE A;  3F3Q A;  6GSX A;  3MWH A;  1THO A;  3UAR A;  4WF4 A;  5J5N A;  1URM A;  1GSE A;  2JZR A;  2A4V A;  4GXZ A;  1PQN A;  5ID2 B;  2JAD A;  4KND A;  2K8S A;  1ERU A;  4Z7X A;  4GST A;  3H8Q A;  3DVX A;  4G0L A;  4YAV A;  6GSV A;  3UEM A;  2FWG A;  2WB9 A;  2GVP A;  2HYX A;  3GSS A;  4MPF A;  2VL2 C;  4XS1 A;  4LL1 B;  2AJQ B;  5F0G A;  3TKS A;  3V1W A;  3KTL A;  3LEF A;  3TKP A;  3LW9 A;  4ZBA A;  3C71 A;  1S3C A;  4PQH A;  3GX0 A;  5FT3 A;  3PPU A;  5IM9 A;  2HRK A;  2DJ1 A;  2WW1 A;  4KX4 A;  1I9D A;  3ED3 A;  2H01 A;  2HSM B;  4K0N A;  1RW1 A;  1V98 A;  5B8A A;  4V2M A;  1PL1 A;  1ERW A;  1SD8 A;  3J7Y b;  1TRS A;  2QC7 A;  5IMA A;  4FH8 A;  3DXB A;  1PMT A;  2F51 A;  4OO4 A;  5J9B A;  3ERG A;  5ABR A;  13GS A;  3FR9 A;  1OE8 A;  1S4B P;  2RM5 A;  2H76 A;  4GSS A;  1WJK A;  3CXG A;  1J08 A;  3D6I A;  1EGO A;  4WEY A;  2GZY A;  1O8X A;  4HZ2 A;  2DLX A;  1MDK A;  1O81 A;  4RI7 A;  4TR4 A;  4E8H A;  1YDK A;  1E6B A;  1PD2 1;  3G7I A;  3HZ8 A;  5IPG A;  4N0Z A;  5J3R A;  2IMK A;  1O8W A;  4RQR A;  1TOF A;  4WET A;  1GLP A;  2FGX A;  4F0C A;  3MDK A;  4O5U A;  1BYE A;  3LSZ A;  4BL7 A;  1XFL A;  2WVZ A;  3LJR A;  2X4A A;  1XZO A;  1EOG A;  2H72 A;  1UN2 A;  4KSO A;  3F8U A;  3CTG A;  4N0V A;  2EFH A;  2HRF A;  3QAW A;  1TI3 A;  4OO5 A;  1Q4J A;  5CRD A;  4HJM A;  1GUK A;  5J4V A;  5LD0 A;  2DC5 A;  2B6M A;  3N9J A;  1AUC A;  3EU3 A;  4L8E A;  4LA1 A;  5H5R A;  3QDN A;  5ENU A;  4O92 A;  2YWO A;  5DCH A;  2LJA A;  2QSI A;  4EIP A;  4G19 A;  3I69 A;  4TRX A;  2FWF A;  3M0F A;  2PBJ A;  4O5Q A;  3ME7 A;  1DE1 A;  3FYG A;  4DSR A;  3FZ5 A;  1C72 A;  1PN9 A;  4G01 A;  5E59 A;  2IFQ A;  2VAF A;  3ZIT A;  4HUA A;  1GUL A;  1T7P B;  4TKY A;  2P31 A;  1U6T A;  1SJZ A;  4HOJ A;  1ZMA A;  4IBP A;  3TKR A;  1NHY A;  4ULX A;  4V2N A;  1MEK A;  4IP1 A;  3CQF A;  3GUR A;  2X49 A;  5D9V A;  4D73 A;  2YWM A;  3RPP A;  4IW9 A;  3QFB C;  4HI7 A;  1TXX A;  5A34 A;  2RUF A;  1GH2 A;  3W6G A;  4Q5N A;  3TOU A;  1R5A A;  1HQO A;  4PI2 C;  3D21 A;  18GS A;  3CHX C;  1EOH A;  2V1M A;  3HDC A;  1GSS A;  3VWX A;  4RUV A;  1V40 A;  3TJF A;  2V6O A;  3GHA A;  4JZQ A;  3ZFB A;  3KTB A;  1AQX A;  3CSJ A;  2IJY A;  1A8Y A;  4X0X A;  4CY6 A;  2GT5 A;  3WT2 A;  4PTS A;  3BCK A;  2R0G A;  3FHK A;  5C00 A;  4EDY A;  2FNO A;  2IME A;  2JL4 A;  3HJM A;  3ZRD A;  3VUR A;  2AB6 A;  4EKZ A;  1GSY A;  4CHS A;  4ECC A;  2B5Y A;  3VI7 A;  1J0F A;  5A4U A;  2IWT A;  2OE3 A;  2OAD A;  5EPF A;  1SKW B;  4WBR D;  1G6W A;  2DJ3 A;  2WS2 A;  2H1A A;  2E2M A;  3EMX A;  2PMT A;  2ZCT A;  1VF3 A;  3D22 A;  2IFQ B;  3FMW A;  2JAC A;  1GLQ A;  2KOK A;  3C7M A;  5B6N A;  4K7N A;  2HNL A;  3BBY A;  3KMN A;  1WOU A;  9GSS A;  2ON7 A;  1OE7 A;  5ECN B;  5DQY A;  3U5R E;  3W8S A;  1FOV A;  4KE3 A;  3C73 A;  4D73 B;  1GSU A;  1O85 A;  1GUH A;  4DSQ A;  1W4V A;  2DSA A;  3GX8 A;  4X43 A;  2MMA A;  2YAN A;  4PGT A;  5A34 B;  2CQ9 A;  1ST9 A;  3HJP A;  2N5A A;  1EEM A;  1FB6 A;  2YWN A;  4O5R A;  4ID0 A;  2C8U A;  4F82 A;  1TRU A;  4JR6 A;  1WRY A;  22GS A;  3TJJ A;  4XS4 A;  1NW2 A;  4PNG A;  5DAK A;  1FB0 A;  2HZE B;  3IXR A;  4FYB A;  1UC7 A;  5CRH A;  1SK1 A;  4WF5 A;  2F3M A;  3CRU A;  4JRR A;  1Z9H A;  2H73 A;  2GDR A;  2OBK A;  1SK0 A;  3VWW A;  3APS A;  4HZ4 A;  2FCH A;  3O3T A;  1A2M A;  3QAV A;  3GIX A;  4IN0 A;  1BED A;  4N11 A;  3TDG A;  3VLN A;  2H19 A;  2C0E A;  4ISD A;  1K3O A;  2C1Y A;  2FHE A;  1SEN A;  4EVM A;  1E2Y A;  1KTE A;  5DAL A;  1UVZ A;  5G2Z A;  2DML A;  3O76 A;  4G2E A;  2IN3 A;  4V1A p;  1TK5 B;  2CVD A;  4FO5 A;  4PUF C;  3ZLP A;  3CSI A;  2VCZ A;  1BG1 A;  3CYN A;  4XRD A;  1YEX A;  12GS A;  2VKZ G;  3VFI A;  1QMV A;  5E4W A;  4HU7 A;  2A4H A;  4XIH A;  2P0G A;  2HSN B;  1JZO A;  2XPD A;  5G1K A;  1K0O A;  3L78 A;  4OFM A;  1YJ6 A;  1XXU A;  3QD9 A;  3MNG A;  4H86 A;  2DMM A;  4POL A;  1VF4 A;  1ZYN A;  2WZ9 A;  2OKA A;  5HFG A;  2GQK A;  2DKI A;  2GZP A;  2GS3 A;  5D8I A;  2VCV A;  2REM A;  1SU9 A;  5AN1 A;  5AGY A;  3FZ4 A;  4XHM A;  4EIQ A;  2A2R A;  5GST A;  3DIE A;  3KJY A;  2H74 A;  3PR8 A;  3GKM A;  3HVN A;  1K0A A;  1TU8 A;  5DBQ A;  2GSQ A;  1O7U A;  5B7C A;  4XS4 B;  3EVI A;  2C3N A;  3IE3 A;  4MJA A;  2QA1 A;  4QL9 A;  4IKH A;  4KDY A;  2O87 A;  5BRT A;  5KOX A;  2IMD A;  1RQM A;  4K9Z A;  2H6X A;  1OVN A;  2I4A A;  4MMM A;  1DSB A;  2XC2 A;  3DRN A;  3HKR A;  4GF0 A;  1F6M C;  1TI1 A;  2O3E A;  3RBT A;  3QPM A;  1Z5Y E;  5IO2 A;  2HE3 A;  2L59 A;  2B1K A;  4TR1 A;  4KAE A;  2K9F A;  3L9S A;  4MK3 A;  2QA2 A;  2DJ2 A;  2MMN A;  4TW5 A;  2MMO A;  3KM6 A;  1SL2 B;  3AY8 A;  6GSW A;  2E7P A;  2XPE A;  1H4O A;  3E3E A;  3G7Y A;  3IAS 2;  3ZML A;  2O36 A;  3H93 A;  1VF1 A;  4OCE A;  3W8J A;  4EXJ A;  2L6C A;  4LMV A;  4AGS A;  3QR6 A;  1SL1 B;  1VGL A;  1PKZ A;  4AKI A;  1U3A A;  4BVX A;  3CMI A;  4NHW A;  3TUE A;  4ECI A;  2R37 A;  2YV9 A;  5ELA A;  2VL2 A;  3LXZ A;  3H79 A;  4YQV A;  1TK8 B;  5ECI B;  1OYJ A;  5GZZ B;  1PX7 A;  4Q5Q A;  4GLT A;  3UMA A;  1AXD A;  3LYK A;  3P90 A;  1SKR B;  5D96 A;  3LFL A;  3TU3 B;  3IC8 A;  5A5K A;  1M2A A;  3KZQ A;  3TCO A;  4E8E A;  1SYX A;  1BF5 A;  4EL1 A;  1IYI A;  2LTK A;  2L57 A;  1RK4 A;  3J7Y k;  4GQC A;  3DGQ A;  2H1L A;  4BPY A;  1G6Y A;  2H30 A;  4AI6 A;  1GP1 A;  3U6V A;  3APO A;  1PN0 A;  4J2F A;  4PNF A;  3GRX A;  2ES7 A;  4GTU A;  5ECP B;  5ECO B;  2H6Z A;  2IL3 A;  2H6Y A;  5G31 A;  1BJX A;  4OCF A;  1OAZ A;  4XS6 A;  3IRA A;  5D93 A;  1N2A A;  3HMJ G;  4TR1 B;  2RII A;  3QOU A;  1XWC A;  2VD1 A;  2C0G A;  1QQ2 A;  2AAW A;  1OC9 A;  3QAG A;  3GKN A;  3ZFL A;  5HR1 A;  4DVC A;  3EYT A;  1SJI A;  2AHE A;  2K18 A;  1ABA A;  2WRT A;  2O5V A;  1PFO A;  3E9J B;  4GSN A;  5IIZ A;  2O7K A;  1AQW A;  1T4Z A;  5D9W A;  3HVX A;  2XHF A;  1X0R A;  2CA8 A;  4BVX B;  1TRV A;  4KF9 A;  3DD3 A;  2B5E A;  2RLI A;  3G7J A;  3KXO A;  3LXT A;  1EV4 A;  2MYG A;  1KEB A;  3RAZ A;  1B8X A;  1XWB A;  2R2J A;  2EIQ A;  2P5Q A;  1XVW A;  2FD3 A;  2GSR A;  1TU7 A;  2IMF A;  2LS5 A;  4POB A;  1PX6 A;  5ECL B;  1TKD B;  5HFK A;  3VPQ A;  1YVL A;  4IHU A;  5HR2 A;  2X99 A;  1AC1 A;  2GST A;  1HYU A;  2D2Z A;  5A5H A;  5KN2 A;  4QL7 A;  5EY6 A;  2I3Y A;  3TKS E;  4KDU A;  1XWA A;  1Q98 A;  1VF2 A;  1ERV A;  2VIM A;  4I6X A;  1GUM A;  2VLV A;  2B1L A;  2WVY A;  1S3R A;  2HXK A;  1M3J A;  4I8B A;  4HS1 A;  4MF5 A;  4PUA A;  4WXT A;  4KW6 A;  4TXO A;  2GT6 A;  2I1U A;  3UVT A;  3HYP A;  4V1A g;  2DKH A;  4OD7 A;  4G10 A;  4JU5 A;  3GA4 A;  3L4N A;  1GTI A;  4K7O A;  3LGC A;  1MD3 A;  1EP7 A;  4N10 A;  4I97 A;  2YWI A;  5KN3 A;  2P5R A;  4TXV A;  4PQ1 A;  2YJH A;  4EO3 A;  3ZIV A;  3R3E A;  4CY8 A;  4Q5R A;  2PVO C;  5IO0 A;  5J40 A;  4HU9 A;  1M2B A;  4KSM A;  4YKG A;  2EIR A;  4KCE A;  2HRK B;  3ME8 A;  6GST A;  4X1U A;  2JU5 A;  1U88 A;  1Z6N A;  4MP4 A;  5BMU A;  3KCM A;  1GTU A;  2X8H A;  1S3A A;  1XBS A;  1WPI A;  2MMZ A;  3FEU A;  2PU9 C;  2TIR A;  1K0B A;  3I43 A;  3C1R A;  3DYR A;  5B6M A;  5KN1 A;  3M9J A;  1G0T A;  1QFN A;  1A2L A;  1NSW A;  2H75 A;  1R26 A;  3LWA A;  3ZL5 A;  2HLS A;  1FW1 A;  2LNS A;  2PPT A;  16GS A;  2YOI A;  2LJK A;  3FR3 A;  1TP9 A;  1AAZ A;  3ZYW A;  4ZBB A;  2O89 A;  4HQS A;  5KN0 A;  1HNB A;  3PH9 A;  3KMO A;  5B8B A;  1A0R P;  1ZYE A;  2FY6 A;  4WR4 A;  4DSS A;  5LNK e;  1YZX A;  3L9U A;  4NV2 A;  4NHZ A;  2V2G A;  4FYU A;  2MZC A;  1WWJ A;  4TXO B;  2BJX A;  1BG5 A;  1JLV A;  2PUK C;  4BL7 B;  3WYW A;  3HVS A;  5H5Q A;  1DE2 A;  3UVH A;  2OJL A;  2OE0 A;  1YKA A;  1NM3 A;  5COH A;  1TTZ A;  2EIO A;  20GS A;  4JED A;  4RI6 A;  4AJ8 A;  3RFR C;  1THX A;  2F9S A;  2AYT A;  3ZMK A;  3A5I A;  1IYH A;  3IC4 A;  3MYD A;  2A2S A;  3D0Z A;  2R5G A;  2NVL A;  3IPZ A;  4IQ1 A;  1TDI A;  5HR3 A;  4KH7 A;  4MNN A;  2PER A;  4FQU A;  2VCX A;  2NPB A;  1PKW A;  5DJM A;  5ELG A;  3VWV A;  3F4S A;  4AKX B;  5G5E A;  2LJR A;  4IQA A;  1PL2 A;  3WGX A;  5D9T A;  2JZS A;  4OWY A;  4MZC A;  2VCW A;  4MJE A;  1AW9 A;  4DEJ A;  5CNW A;  5ECH B;  4GRF A;  1SVM A;  1LJR A;  4K1F A;  1PA3 A;  2VD0 A;  4JBB A;  3IHG A;  4K6X A;  4F0B A;  2GLR A;  1HNA A;  5JCG A;  1K3Y A;  2JSZ A;  4BVY A;  4FXY P;  1OC8 A;  4POK A;  3GL3 A;  3VWU A;  4RQX A;  2V41 A;  3Q74 A;  1QXH A;  3RPN A;  4DSS B;  1GNW A;  2C4J A;  4GCI A;  2WDU A;  3CWG A;  1HD2 A;  3K8N A;  2N5B A;  4IP6 A;  3IR4 A;  4YQU A;  2R0P A;  3TRX A;  2CX3 A;  4NPB A;  1DUG A;  1GSF A;  3F4R A;  3C8E A;  2YZU A;  3HVV A;  3L9V A;  3QCP A;  1U87 A;  5CRE A;  1KBN A;  3D5J A;  1ZZY A;  2XBI A;  3TOT A;  3KD0 A;  1M99 A;  3FZA A;  4BWQ A;  3RDW A;  1G7E A;  3A2X A;  1SYR A;  4ILF A;  1XCC A;  1ZL9 A;  5G1L A;  4K7I A;  5EVO A;  6GSU A;  1KNG A;  3R2Q A;  3KH7 A;  4EF0 A;  1OKT A;  1T8E B;  1U3I A;  3HJO A;  1HNC A;  3OR5 A;  5ECK B;  5AIS A;  4MA9 A;  4ZB6 A;  4MF7 A;  2VLU A;  1FVJ A;  2YV7 A;  2UV8 G;  3TJK A;  2EFD A;  3TGZ A;  2WW0 A;  4ZB7 A;  4PQI A;  3ERF A;  4TN8 A;  1WP0 A;  2LRT A;  3LG6 A;  5GAP D;  2X8G A;  1ZOF A;  2ALB A;  3O6T A;  2M46 A;  4IVF A;  2WW3 A;  2YN1 A;  2HRA A;  2XBQ A;  5INY A;  1SL0 B;  2L6D A;  2I81 A;  4TR0 A;  2VL9 A;  5J47 A;  1SVO A;  2FLS A;  1BAY A;  2VCQ A;  3CSH A;  4YQM A;  1O6J A; 
#chains in the Genus database with same CATH homology
 4BVY B;  1V2A A;  3EMP A;  1K0C A;  5H5S A;  1Y25 A;  3DML A;  2LST A;  4F03 A;  2F8A A;  2FWH A;  1K0M A;  5DAK B;  1YY7 A;  5F8B A;  2H1D A;  4O7H A;  2H66 A;  4Z2U A;  2IMI A;  2CT6 A;  1GSD A;  3ZZX A;  1SVL A;  2V32 A;  1WMJ A;  3DEX A;  1MD4 A;  1PRX A;  1SD9 A;  2H0H A;  2GGT A;  2OT3 A;  3HY2 A;  2B5X A;  3SWL A;  3MIX A;  3H4K A;  3IA1 A;  2HQT A;  2KP1 A;  2YZH A;  2L4Q A;  3CRT A;  5CO3 A;  3GYK A;  2MBS A;  4P3Y B;  4CW9 A;  2FA4 A;  5DAL B;  5CRW A;  4KDX A;  5KEJ A;  3GV1 A;  1FAA A;  2YPM A;  2HSY A;  5ID2 A;  2R6K A;  4NMU A;  4MF6 A;  2FA8 A;  4MLY A;  5GAN D;  3NIV A;  3IAM 2;  2EFC A;  1ON4 A;  2H1G A;  2G0F A;  2F8F A;  3KH9 A;  4MJB A;  2LNT A;  14GS A;  1S3D A;  2WGR A;  1VRS D;  3HXS A;  4MCU A;  5JCW A;  1Y6E A;  3EU4 A;  1GSQ A;  1PSQ A;  1DBY A;  4AJ6 A;  1XOA A;  2M72 A;  5CRG A;  4BWS A;  4KCA A;  2HSM A;  2Z9S A;  5G5F A;  3WD6 A;  3DKS A;  4F9Z A;  3F0I A;  4K5S A;  1M0U A;  3N5O A;  3GKK A;  1AIU A;  5D73 A;  1TXU A;  3A2V A;  2VUP A;  1BX9 A;  4L5L A;  4ECJ A;  3ZVJ D;  2CV4 A;  1R7H A;  1K0D A;  4KUN A;  3KIJ A;  3CTF A;  5CAX A;  3Q6O A;  4GQF A;  2JSY A;  5KOW A;  1M9A A;  5A4V A;  3RHC A;  2DBC A;  2YNX A;  3F6F A;  5IOX A;  1EWX A;  3HHV A;  3BOA A;  4IJ3 A;  2GQM A;  4J56 E;  4LLR A;  3UBL A;  3GNJ A;  1GTA A;  4ZL8 A;  4QQ7 A;  4QMK A;  3WGD A;  5DCG A;  2UZ8 A;  1M7T A;  4IGJ A;  4XCS A;  3QFA C;  5A1N A;  3FY7 A;  3IK9 A;  1FG4 A;  1I5G A;  2HFD A;  4ZBD A;  4AF2 A;  1Z3E A;  3BCI A;  2OE1 A;  1Z7P A;  2CX4 A;  10GS A;  4F2I A;  4TVE A;  2C0D A;  3G9B A;  5ECQ B;  4AKG A;  1A0F A;  2G2Q A;  4IS0 A;  3UIW A;  4HJ2 A;  2R0C A;  3F63 A;  2VM2 A;  2FWE A;  3TRQ A;  2EC4 A;  2LUS A;  4LMW A;  4YKF A;  1XW6 A;  1XW5 A;  2ON5 A;  2CZ3 A;  2H71 A;  2WFC A;  5ECR B;  5IMZ A;  2AUV A;  1TK0 B;  1EP8 A;  1WIK A;  1Z7R A;  1X9S B;  4PX1 A;  4GWR A;  3GMF A;  2OAC A;  3F9U A;  2HI7 A;  5F06 A;  3SBC A;  4I2U A;  2C0F A;  2AV4 A;  1K3L A;  2GTU A;  3F4T A;  2J9H A;  3FW2 A;  1ZCP A;  3PGT A;  2RM6 A;  4Z2R A;  4XRA A;  1R5P A;  2JZT A;  1PGT A;  2EFE A;  3TB2 A;  2GQL A;  2NDO A;  3MSZ A;  2R3X A;  3VPT A;  2PWJ A;  3CBU A;  1ZYP A;  2H70 A;  3IK7 A;  2B7K A;  11GS A;  3Q18 A;  5IMV A;  5A4W A;  3TKS C;  3I6A A;  2VCT A;  4L0W A;  1XWK A;  1A8L A;  5C04 A;  5A1N B;  3UBK A;  1QUW A;  4J57 E;  4LL4 B;  2H8L A;  1SK2 A;  1OC9 B;  4BA7 A;  1SKS B;  4YH2 A;  3FK8 A;  3GH9 A;  1G7O A;  4PUR A;  2VOC A;  4E68 A;  3UOM A;  1ZGN A;  1ACV A;  2CZ2 A;  4MH3 A;  3H1N A;  2L5O A;  4ML6 A;  1EGR A;  1MTC A;  4ECB A;  5F07 A;  6GSY A;  3LYP A;  3C1S A;  3UL3 A;  1O73 A;  3IV4 A;  3NOF A;  4K0G A;  1X9M B;  2N5F A;  3WT1 A;  4MZB A;  1FHE A;  3GFK A;  4K5R A;  1N8J A;  2L5L A;  1X5C A;  2TRX A;  1GWC A;  4KB3 A;  3ZVJ A;  3ERW A;  3S9F A;  5JWQ B;  4FYC A;  2LEG A;  3LQ7 A;  2L4C A;  3JCM L;  4HQZ A;  4NXI A;  1CQG A;  4G0K A;  2HZF A;  2E0Q A;  3P2A A;  4WBJ A;  4JR4 A;  3GUS A;  4I5Q A;  5DQS A;  1B48 A;  3ZRE A;  3M9K A;  3TKQ A;  5A5H B;  2O85 A;  1OC3 A;  2QGV A;  2YCD A;  4POM A;  2X8C A;  1FO5 A;  4EC0 A;  3PIN A;  3A5W A;  1J9B A;  2K8V A;  1GNE A;  1ZYQ B;  1XWG A;  1A23 A;  3APQ A;  3A2W A;  4USS A;  4EUY A;  3NZN A;  3F3R A;  2DJ0 A;  5L71 A;  3UJ1 A;  5IPH A;  1MDI A;  3DWV A;  1V57 A;  2BTO T;  2LQO A;  3GTU A;  1XOB A;  4TR3 A;  1R4W A;  1B4P A;  2HZE A;  5HFI A;  1QGV A;  4EE0 A;  4YAP A;  2WUL A;  4K2X A;  4Q5F A;  4ZB8 A;  1F37 A;  5GSS A;  2LV3 A;  2IPA A;  1B9Y C;  4N3Z A;  5IQY A;  1JZW A;  3UAP A;  3IBH A;  5BMU B;  4IEL A;  1K0N A;  5JCU A;  2GSS A;  3BJ5 A;  1B4Q A;  1XIY A;  3P7X A;  4OMV A;  5AIV A;  5EL8 A;  6GSS A;  3FR6 A;  2GZZ A;  1T1V A;  2OA7 A;  1UA5 A;  2KHP A;  3MAK A;  3EE2 A;  2LRC A;  3GST A;  4Z2T A;  3ZTL A;  1YKC A;  4WR5 A;  3HCZ A;  2HSN A;  1MDJ A;  2QKE A;  4KA0 A;  4N30 A;  3P8W A;  5J4U A;  2VM1 A;  3VK9 A;  5J9C A;  1EZK A;  3GL5 A;  4ZIL A;  2C80 A;  3M8N A;  5J4Y A;  2CAI A;  4GDF A;  1CQH A;  1XVQ A;  3QMX A;  1JHB A;  5LCZ A;  3D4T A;  4K2D A;  3M3M A;  1M9B A;  1YEP A;  5HQP A;  3GH6 A;  7GSS A;  3KP9 A;  4NAX A;  1USB A;  1X9W B;  1SJ6 A;  4ZB9 A;  2J23 A;  5IMC A;  3I9V 2;  2KP2 A;  3GTU B;  4MAB A;  5FWG A;  3EUR A;  4L5O A;  1T3B A;  4FIW A;  1TJD A;  1GRX A;  1H75 A;  4CDO A;  3IHQ A;  2I9H A;  2PN8 A;  4W66 A;  3RHB A;  4ML1 A;  4MZW A;  1F2E A;  1AQV A;  1XW9 A;  4ZIJ A;  2M80 A;  3D4M A;  2DJJ A;  4OFN A;  5IMD A;  3EWL A;  2DJK A;  2A2P A;  4JE1 A;  2DIZ A;  5G30 A;  3Q19 A;  3EC3 A;  1Y1U A;  3M1G A;  5JWO B;  3HA9 A;  3GN3 A;  5AIX A;  19GS A;  2KLX A;  1T4Y A;  4KGI A;  1Z6M A;  5JWR B;  2O8V B;  3VI5 A;  1QK8 A;  1M2D A;  2KUC A;  4V2L A;  3HZ4 A;  1TW9 A;  1W89 A;  2H1B A;  2YJ7 A;  2B7J A;  4ICY A;  3E0U A;  1YQ1 A;  3DVW A;  17GS A;  1F9M A;  3US3 A;  3IOS A;  1V9W A;  1LBK A;  3KP8 A;  2PGT A;  4MDC A;  3WGE A;  1YF1 A;  3GKX A;  1X5D A;  2B3S A;  3HD5 A;  3BD2 A;  4I2T A;  2H0G A;  4L0U A;  5IOW A;  2NBS A;  1FOH A;  3TJB A;  3KEB A;  2CVK A;  3ISO A;  4WKW A;  5DDL A;  1JFU A;  5FHI A;  2LRN A;  5D9X A;  5DVB A;  4K8M A;  1OKD A;  5CYY A;  1ERT A;  1A24 A;  4TOP A;  8GSS A;  1B9X C;  4OFT A;  1WE0 A;  3A3T A;  2FUG 2;  3IDV A;  1TRW A;  2LKU A;  4ZL7 A;  5DJL A;  3EPT A;  4XTS A;  4IJI A;  2BMX A;  2LQQ A;  4AKH A;  2WCI A;  3F6D A;  5HR0 A;  3FZ9 A;  2VO4 A;  4NV5 A;  4O32 A;  1XPV A;  2V6K A;  2HSH A;  2R4V A;  4ZL9 A;  2HRN A;  1NHO A;  1A2J A;  1YF0 A;  1JLW A;  2E2G A;  4MPG A;  1LU4 A;  2CAQ A;  1T00 A;  2C3T A;  4A5P A;  1GL8 A;  3LOR A;  1JZR A;  4NWY A;  4G9H A;  4PXO A;  2OBI A;  2TRC P;  2DIY A;  1ILO A;  1ML6 A;  4AJ7 A;  5ECM B;  1BQ7 A;  2CVB A;  1GTB A;  2VL3 A;  2WJU A;  4X4J A;  2PVQ A;  4ZXG A;  2NTO A;  2RUE A;  3ZIJ A;  2ZNM A;  1F3B A;  2VLT A;  2HT9 A;  1FVK A;  4EDZ A;  2H0I A;  4HEA 2;  1N25 A;  3TJG A;  5CP1 A;  5F05 A;  1JZD A;  4G0I A;  5ECS A;  2IIY A;  4MJC A;  4ACS A;  3L0H A;  1EEJ A;  1F3A A;  5J41 A;  2X64 A;  2ZUP A;  1X5E A;  2K6V A;  1EV9 A;  2YP6 A;  5IMF A;  3TRP A;  3FRC A;  3FKF A;  4MH2 A;  2C3Q A;  2MBT A;  3KGK A;  3EIN A;  1V58 A;  4HDE A;  3F3Q A;  6GSX A;  3MWH A;  1THO A;  3UAR A;  4WF4 A;  5J5N A;  1URM A;  1GSE A;  2JZR A;  2A4V A;  4GXZ A;  1PQN A;  5ID2 B;  2JAD A;  4KND A;  2K8S A;  1ERU A;  4Z7X A;  4GST A;  3H8Q A;  3DVX A;  4G0L A;  4YAV A;  6GSV A;  3UEM A;  2FWG A;  2WB9 A;  2GVP A;  2HYX A;  3GSS A;  4MPF A;  2VL2 C;  4XS1 A;  4LL1 B;  2AJQ B;  5F0G A;  3TKS A;  3V1W A;  3KTL A;  3LEF A;  3TKP A;  3LW9 A;  4ZBA A;  3C71 A;  1S3C A;  4PQH A;  3GX0 A;  5FT3 A;  3PPU A;  5IM9 A;  2HRK A;  2DJ1 A;  4KX4 A;  1I9D A;  3ED3 A;  2H01 A;  2HSM B;  4K0N A;  1RW1 A;  1V98 A;  5B8A A;  4V2M A;  1PL1 A;  1ERW A;  1SD8 A;  3J7Y b;  1TRS A;  2QC7 A;  5IMA A;  4FH8 A;  3DXB A;  1PMT A;  2F51 A;  4OO4 A;  5J9B A;  3ERG A;  5ABR A;  13GS A;  3FR9 A;  1OE8 A;  2RM5 A;  2H76 A;  4GSS A;  1WJK A;  3CXG A;  1J08 A;  3D6I A;  1EGO A;  4WEY A;  2GZY A;  1O8X A;  4HZ2 A;  2DLX A;  1MDK A;  1O81 A;  4RI7 A;  4TR4 A;  4E8H A;  1YDK A;  1E6B A;  1PD2 1;  3G7I A;  3HZ8 A;  5IPG A;  4N0Z A;  5J3R A;  2IMK A;  1O8W A;  4RQR A;  1TOF A;  4WET A;  1GLP A;  2FGX A;  4F0C A;  3MDK A;  4O5U A;  1BYE A;  3LSZ A;  4BL7 A;  1XFL A;  3LJR A;  2X4A A;  1XZO A;  1EOG A;  2H72 A;  1UN2 A;  4KSO A;  3F8U A;  3CTG A;  4N0V A;  2EFH A;  2HRF A;  3QAW A;  1TI3 A;  4OO5 A;  1Q4J A;  5CRD A;  4HJM A;  1GUK A;  5J4V A;  5LD0 A;  2DC5 A;  2B6M A;  3N9J A;  1AUC A;  3EU3 A;  4L8E A;  4LA1 A;  5H5R A;  3QDN A;  5ENU A;  4O92 A;  2YWO A;  5DCH A;  2LJA A;  2QSI A;  4EIP A;  4G19 A;  3I69 A;  4TRX A;  2FWF A;  3M0F A;  2PBJ A;  4O5Q A;  3ME7 A;  1DE1 A;  3FYG A;  4DSR A;  3FZ5 A;  1C72 A;  1PN9 A;  4G01 A;  5E59 A;  2IFQ A;  2VAF A;  3ZIT A;  4HUA A;  1GUL A;  1T7P B;  4TKY A;  2P31 A;  1U6T A;  1SJZ A;  4HOJ A;  1ZMA A;  4IBP A;  3TKR A;  1NHY A;  4ULX A;  4V2N A;  1MEK A;  4IP1 A;  3GUR A;  2X49 A;  5D9V A;  4D73 A;  2YWM A;  3RPP A;  4IW9 A;  3QFB C;  4HI7 A;  1TXX A;  5A34 A;  2RUF A;  1GH2 A;  3W6G A;  4Q5N A;  3TOU A;  1R5A A;  1HQO A;  3D21 A;  18GS A;  1EOH A;  2V1M A;  3HDC A;  1GSS A;  3VWX A;  4RUV A;  1V40 A;  3TJF A;  2V6O A;  3GHA A;  4JZQ A;  3ZFB A;  3KTB A;  1AQX A;  3CSJ A;  2IJY A;  1A8Y A;  4X0X A;  4CY6 A;  2GT5 A;  3WT2 A;  4PTS A;  3BCK A;  2R0G A;  3FHK A;  5C00 A;  4EDY A;  2FNO A;  2IME A;  2JL4 A;  3HJM A;  3ZRD A;  3VUR A;  2AB6 A;  4EKZ A;  1GSY A;  4CHS A;  4ECC A;  2B5Y A;  3VI7 A;  1J0F A;  5A4U A;  2IWT A;  2OE3 A;  2OAD A;  5EPF A;  1SKW B;  4WBR D;  1G6W A;  2DJ3 A;  2WS2 A;  2H1A A;  2E2M A;  3EMX A;  2PMT A;  2ZCT A;  1VF3 A;  3D22 A;  2IFQ B;  3FMW A;  2JAC A;  1GLQ A;  2KOK A;  3C7M A;  5B6N A;  4K7N A;  2HNL A;  3BBY A;  3KMN A;  1WOU A;  9GSS A;  2ON7 A;  1OE7 A;  5ECN B;  5DQY A;  3U5R E;  3W8S A;  1FOV A;  4KE3 A;  3C73 A;  4D73 B;  1GSU A;  1O85 A;  1GUH A;  4DSQ A;  1W4V A;  2DSA A;  3GX8 A;  4X43 A;  2MMA A;  2YAN A;  4PGT A;  5A34 B;  2CQ9 A;  1ST9 A;  3HJP A;  2N5A A;  1EEM A;  1FB6 A;  2YWN A;  4O5R A;  4ID0 A;  2C8U A;  4F82 A;  1TRU A;  4JR6 A;  1WRY A;  22GS A;  3TJJ A;  4XS4 A;  1NW2 A;  4PNG A;  5DAK A;  1FB0 A;  2HZE B;  3IXR A;  4FYB A;  1UC7 A;  5CRH A;  1SK1 A;  4WF5 A;  2F3M A;  3CRU A;  4JRR A;  1Z9H A;  2H73 A;  2GDR A;  2OBK A;  1SK0 A;  3VWW A;  3APS A;  4HZ4 A;  2FCH A;  3O3T A;  1A2M A;  3QAV A;  3GIX A;  4IN0 A;  1BED A;  4N11 A;  3TDG A;  3VLN A;  2H19 A;  2C0E A;  4ISD A;  1K3O A;  2C1Y A;  2FHE A;  1SEN A;  4EVM A;  1E2Y A;  1KTE A;  5DAL A;  1UVZ A;  5G2Z A;  2DML A;  3O76 A;  4G2E A;  2IN3 A;  4V1A p;  1TK5 B;  2CVD A;  4FO5 A;  4PUF C;  3ZLP A;  3CSI A;  2VCZ A;  1BG1 A;  3CYN A;  4XRD A;  1YEX A;  12GS A;  2VKZ G;  3VFI A;  1QMV A;  5E4W A;  4HU7 A;  2A4H A;  4XIH A;  2P0G A;  2HSN B;  1JZO A;  2XPD A;  5G1K A;  1K0O A;  3L78 A;  4OFM A;  1YJ6 A;  1XXU A;  3QD9 A;  3MNG A;  4H86 A;  2DMM A;  4POL A;  1VF4 A;  1ZYN A;  2WZ9 A;  2OKA A;  5HFG A;  2GQK A;  2DKI A;  2GZP A;  2GS3 A;  5D8I A;  2VCV A;  2REM A;  1SU9 A;  5AN1 A;  5AGY A;  3FZ4 A;  4XHM A;  4EIQ A;  2A2R A;  5GST A;  3DIE A;  3KJY A;  2H74 A;  3PR8 A;  3GKM A;  1K0A A;  1TU8 A;  5DBQ A;  2GSQ A;  1O7U A;  5B7C A;  4XS4 B;  3EVI A;  2C3N A;  3IE3 A;  4MJA A;  2QA1 A;  4QL9 A;  4IKH A;  4KDY A;  2O87 A;  5BRT A;  5KOX A;  2IMD A;  1RQM A;  4K9Z A;  2H6X A;  1OVN A;  2I4A A;  4MMM A;  1DSB A;  2XC2 A;  3DRN A;  3HKR A;  4GF0 A;  1F6M C;  1TI1 A;  3RBT A;  3QPM A;  1Z5Y E;  5IO2 A;  2HE3 A;  2L59 A;  2B1K A;  4TR1 A;  4KAE A;  2K9F A;  3L9S A;  4MK3 A;  2QA2 A;  2DJ2 A;  2MMN A;  4TW5 A;  2MMO A;  3KM6 A;  1SL2 B;  3AY8 A;  6GSW A;  2E7P A;  2XPE A;  1H4O A;  3E3E A;  3G7Y A;  3IAS 2;  3ZML A;  3H93 A;  1VF1 A;  4OCE A;  3W8J A;  4EXJ A;  2L6C A;  4LMV A;  4AGS A;  3QR6 A;  1SL1 B;  1VGL A;  1PKZ A;  4AKI A;  1U3A A;  4BVX A;  3CMI A;  4NHW A;  3TUE A;  4ECI A;  2R37 A;  2YV9 A;  5ELA A;  2VL2 A;  3LXZ A;  3H79 A;  4YQV A;  1TK8 B;  5ECI B;  1OYJ A;  5GZZ B;  1PX7 A;  4Q5Q A;  4GLT A;  3UMA A;  1AXD A;  3LYK A;  3P90 A;  1SKR B;  5D96 A;  3LFL A;  3TU3 B;  3IC8 A;  5A5K A;  1M2A A;  3KZQ A;  3TCO A;  4E8E A;  1SYX A;  1BF5 A;  4EL1 A;  1IYI A;  2LTK A;  2L57 A;  1RK4 A;  3J7Y k;  4GQC A;  3DGQ A;  2H1L A;  4BPY A;  1G6Y A;  2H30 A;  4AI6 A;  1GP1 A;  3U6V A;  3APO A;  1PN0 A;  4J2F A;  4PNF A;  3GRX A;  2ES7 A;  4GTU A;  5ECP B;  5ECO B;  2H6Z A;  2IL3 A;  2H6Y A;  5G31 A;  1BJX A;  4OCF A;  1OAZ A;  4XS6 A;  3IRA A;  5D93 A;  1N2A A;  3HMJ G;  4TR1 B;  2RII A;  3QOU A;  1XWC A;  2VD1 A;  2C0G A;  1QQ2 A;  2AAW A;  1OC9 A;  3QAG A;  3GKN A;  3ZFL A;  5HR1 A;  4DVC A;  3EYT A;  1SJI A;  2AHE A;  2K18 A;  1ABA A;  2WRT A;  2O5V A;  3E9J B;  4GSN A;  5IIZ A;  2O7K A;  1AQW A;  1T4Z A;  5D9W A;  3HVX A;  2XHF A;  1X0R A;  2CA8 A;  4BVX B;  1TRV A;  4KF9 A;  3DD3 A;  2B5E A;  2RLI A;  3G7J A;  3KXO A;  3LXT A;  1EV4 A;  2MYG A;  1KEB A;  3RAZ A;  1B8X A;  1XWB A;  2R2J A;  2EIQ A;  2P5Q A;  1XVW A;  2FD3 A;  2GSR A;  1TU7 A;  2IMF A;  2LS5 A;  4POB A;  1PX6 A;  5ECL B;  1TKD B;  5HFK A;  3VPQ A;  1YVL A;  4IHU A;  5HR2 A;  2X99 A;  1AC1 A;  2GST A;  1HYU A;  2D2Z A;  5A5H A;  5KN2 A;  4QL7 A;  5EY6 A;  2I3Y A;  3TKS E;  4KDU A;  1XWA A;  1Q98 A;  1VF2 A;  1ERV A;  2VIM A;  4I6X A;  1GUM A;  2VLV A;  2B1L A;  2HXK A;  4I8B A;  4HS1 A;  4MF5 A;  4PUA A;  4WXT A;  4KW6 A;  4TXO A;  2GT6 A;  2I1U A;  3UVT A;  3HYP A;  4V1A g;  2DKH A;  4OD7 A;  4G10 A;  4JU5 A;  3GA4 A;  3L4N A;  1GTI A;  4K7O A;  3LGC A;  1MD3 A;  1EP7 A;  4N10 A;  4I97 A;  2YWI A;  5KN3 A;  2P5R A;  4TXV A;  4PQ1 A;  2YJH A;  4EO3 A;  3ZIV A;  3R3E A;  4CY8 A;  4Q5R A;  2PVO C;  5IO0 A;  5J40 A;  4HU9 A;  1M2B A;  4KSM A;  4YKG A;  2EIR A;  4KCE A;  2HRK B;  3ME8 A;  6GST A;  4X1U A;  2JU5 A;  1U88 A;  1Z6N A;  4MP4 A;  5BMU A;  3KCM A;  1GTU A;  2X8H A;  1S3A A;  1XBS A;  1WPI A;  2MMZ A;  3FEU A;  2PU9 C;  2TIR A;  1K0B A;  3I43 A;  3C1R A;  3DYR A;  5B6M A;  5KN1 A;  3M9J A;  1G0T A;  1QFN A;  1A2L A;  1NSW A;  2H75 A;  1R26 A;  3LWA A;  3ZL5 A;  2HLS A;  1FW1 A;  2LNS A;  2PPT A;  16GS A;  2YOI A;  2LJK A;  3FR3 A;  1TP9 A;  1AAZ A;  3ZYW A;  4ZBB A;  2O89 A;  4HQS A;  5KN0 A;  1HNB A;  3PH9 A;  3KMO A;  5B8B A;  1A0R P;  1ZYE A;  2FY6 A;  4WR4 A;  4DSS A;  5LNK e;  1YZX A;  3L9U A;  4NV2 A;  4NHZ A;  2V2G A;  4FYU A;  2MZC A;  1WWJ A;  4TXO B;  2BJX A;  1BG5 A;  1JLV A;  2PUK C;  4BL7 B;  3WYW A;  3HVS A;  5H5Q A;  1DE2 A;  3UVH A;  2OJL A;  2OE0 A;  1YKA A;  1NM3 A;  5COH A;  1TTZ A;  2EIO A;  20GS A;  4JED A;  4RI6 A;  4AJ8 A;  1THX A;  2F9S A;  2AYT A;  3ZMK A;  3A5I A;  1IYH A;  3IC4 A;  3MYD A;  2A2S A;  3D0Z A;  2R5G A;  2NVL A;  3IPZ A;  4IQ1 A;  1TDI A;  5HR3 A;  4KH7 A;  4MNN A;  2PER A;  4FQU A;  2VCX A;  2NPB A;  1PKW A;  5DJM A;  5ELG A;  3VWV A;  3F4S A;  4AKX B;  5G5E A;  2LJR A;  4IQA A;  1PL2 A;  3WGX A;  5D9T A;  2JZS A;  4OWY A;  4MZC A;  2VCW A;  4MJE A;  1AW9 A;  4DEJ A;  5CNW A;  5ECH B;  4GRF A;  1SVM A;  1LJR A;  4K1F A;  1PA3 A;  2VD0 A;  4JBB A;  3IHG A;  4K6X A;  4F0B A;  2GLR A;  1HNA A;  5JCG A;  1K3Y A;  2JSZ A;  4BVY A;  1OC8 A;  4POK A;  3GL3 A;  3VWU A;  4RQX A;  2V41 A;  3Q74 A;  1QXH A;  3RPN A;  4DSS B;  1GNW A;  2C4J A;  4GCI A;  2WDU A;  3CWG A;  1HD2 A;  3K8N A;  2N5B A;  4IP6 A;  3IR4 A;  4YQU A;  2R0P A;  3TRX A;  2CX3 A;  4NPB A;  1DUG A;  1GSF A;  3F4R A;  3C8E A;  2YZU A;  3HVV A;  3L9V A;  3QCP A;  1U87 A;  5CRE A;  1KBN A;  3D5J A;  1ZZY A;  2XBI A;  3TOT A;  3KD0 A;  1M99 A;  3FZA A;  4BWQ A;  3RDW A;  1G7E A;  3A2X A;  1SYR A;  4ILF A;  1XCC A;  1ZL9 A;  5G1L A;  4K7I A;  5EVO A;  6GSU A;  1KNG A;  3R2Q A;  3KH7 A;  4EF0 A;  1OKT A;  1T8E B;  1U3I A;  3HJO A;  1HNC A;  3OR5 A;  5ECK B;  5AIS A;  4MA9 A;  4ZB6 A;  4MF7 A;  2VLU A;  1FVJ A;  2YV7 A;  2UV8 G;  3TJK A;  2EFD A;  3TGZ A;  4ZB7 A;  4PQI A;  3ERF A;  4TN8 A;  1WP0 A;  2LRT A;  3LG6 A;  5GAP D;  2X8G A;  1ZOF A;  2ALB A;  3O6T A;  2M46 A;  4IVF A;  2YN1 A;  2HRA A;  2XBQ A;  5INY A;  1SL0 B;  2L6D A;  2I81 A;  4TR0 A;  2VL9 A;  5J47 A;  1SVO A;  2FLS A;  1BAY A;  2VCQ A;  3CSH A;  4YQM A;  1O6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...