5G5HA

Escherichia coli periplasmic aldehyde oxidase r440h mutant
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
173
structure length
173
Chain Sequence
AATPAPEIMPLTLKVNGKTEQLEVDTRTTLLDTLRENLHLIGTKKGCDHGQCGACTVLVNGRRLNACLTLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTSGQICSSVAVLKEIQDGIPSHVTVDLVSAPETTADEIRERMSGNICRCGAYANILAAIEDAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE XANTHINE DEHYDROGENASE YAGT IRON-SULFUR-BINDING SUB
publication title The Escherichia Coli Periplasmic Aldehyde Oxidoreductase is an Exceptional Member of the Xanthine Oxidase Family of Molybdoenzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 48
structure length 173
sequence length 173
ec nomenclature ec 1.2.99.6: Carboxylate reductase.
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 5g5hA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5g5hA01
3AE1B 1L6VA 3AEBB 1FXIA 3FAHA 1NYQA 2MJ3A 3AE5B 3AEEB 2WU5B 1UWMA 1ZXIA 4US8A 2H89B 1JRPA 3VRBB 3AV8A 1RWSA 1RM6C 2DBYA 1FFUA 4C7YA 2BS2B 3AEGB 5EE0A 5H92C 1T3QA 2M56B 3NVZA 4KX6B 1V8CA 2WDQB 4US9A 1N5WA 1WYGA 2KAJA 5EE9A 1FIQA 1FRRA 4YT0B 1DOXA 1ZP0B 3AEFB 2Y5CA 3LXFA 1N63A 1L6UA 2BS3B 1V97A 1FFVA 1WRIA 3SFDB 1JALA 1CJEA 2N0SB 1I7HA 2BS4B 1NVID 1ZOYB 5G5GA 1E9MA 1PFDA 3HRDD 2AX5A 2WDRB 1FXAA 1QLBB 1N5XA 2MH7A 4A9AA 2M19A 1B9RA 4YTNB 1XLQA 1QOFA 3AM9A 1ZUD2 1R7SA 4YXDB 1DOYA 1JROA 3B2FA 1EWYC 4WWMA 3NVYA 2MJEA 3AEAB 1YJJA 2JQRB 4JWSC 2WQYB 1VLBA 1NENB 2H88B 3AE2B 3AE9B 5EE1A 2OHFA 1N60A 2L52A 1DOIA 5C3JB 5AUKA 2KMMA 2E3TA 2WDVB 1TJEA 3NRZA 1JWAD 2K9XA 1QOBA 1QF6A 1N62A 1JW9D 1OQQA 2CJOA 3AB5A 3AECB 3P1MA 3RPFC 3P4PB 4C7ZA 5EE3A 1NEKB 4LTUA 3PO0A 1J7BA 1YQ3B 2G1EA 3AMZA 2WLBA 3P4RB 4YTPB 1XLOA 2W3SA 4ZHPA 1KF6B 1VJKA 3NS1A 1XO3A 2BT6A 3L4PA 3NVVA 1NYRA 1WXQA 1QOGA 1PDXA 1RFKA 3W9CB 2PKOA 1FRDA 3ABVB 1IUEA 1JWBD 2WU2B 1TYGB 3B9JA 1SIJA 2QJLA 3EUB2 5GXGB 1KRHA 3VRAB 3HUIA 3VR9B 1N61A 4YTMB 1SB3C 1OFFA 4WQMA 2WS3B 1QT9A 2W3RA 1XLPA 3LB8C 2B76B 1DGJA 5G5HA 1XLNA 3AE7B 4N6EB 4FXCA 4HROA 4USAA 3AN1A 2W54A 1E7PB 4C80A 1PUTA 2HTME 2WP9B 3DWMA 3P4SB 5C2TB 1GPXA 3DWGC 3P63A 3NVWA 4HRSA 3AH7A 3AE4B 5MPOA 4ZOHC 1ROEA 1L5PA 2QIEB 2LEKA 2L83A 3AE6B 1FM0D 1OQRA 1YQ4B 3VR8B 4JX1C 1FMAD 2DWQA 3CIRB 1WWTA 1KFYB 2PIAA 1J7AA 1WGKA 3AE3B 3W5VB 3SFEB 1VDVA 3WCQA 3P4QB 1E10A 2MJDA 1J7CA 1E6EB 1RYJA 4YSYB 3FC4A 2EKIA 4YSZB 1QOAA 1TKGA 2JX5A 1F0ZA 2K22A 3W5UB 4P6VF 1A70A 3CWIA 2PVOD 3BIID 3KWLA 2CJNA 3SR6A 1AYFA 3ZYYX 1E0ZA 1JQ4A 4ITKA 3ETRA 1NI3A 1TKYA 2ACZB 3B2GA 3AE8B 3HVZA 2PVGC 2FBWB 5H8YE 2W55A 4YSXB 1TKEA 4ZHOA 4JWUC 1FO4A 1GAQB 2K5PA 1CZPA 1AWDA 1L0VB 4IDIA 4N59A 4N58A 1YJIA 3AEDB 2Q5WD 5AUIA 2CU3A 1SF0A
chains in the Genus database with same CATH superfamily
3M8RA 1NK8A 2FUHB 2C2DA 3OGUA 3PREA 4KIKA 3FAHA 2F3NA 1A6SA 5I4DA 4HJKA 2FMQA 1F2RI 1OEYJ 1WMHB 2IA6A 4ZRJA 5DCNA 1FFUA 4DDGD 2BVCA 8ICZA 1T3QA 2WXFA 2WDQB 1N5WA 1WYGA 3IP4B 2K60A 2ZG6A 2BR0A 4ARIA 4YT0B 1WUDA 4LNIA 2DENB 3C2LA 4DOBA 4QJFB 5KFOA 2WNMA 1T5XD 4YXJA 2HOQA 2R8IA 5DPRA 3C1ZA 4KLQA 1PZNA 2KIWA 1PVQA 3QC8B 3APDA 2REXA 2KKCA 1KFSA 3AU6A 3UPQA 1FCLA 4IRDA 3MFIA 1X9SA 3RR7A 4EEWA 1E8YA 3NOBA 4Z6DA 4M8NA 4RPYA 1S0VA 2H88B 3L10B 1XF5L 1GOZA 2Y0SF 1K5OA 1Q10A 3U30A 4I2DA 4ED0A 1ZPSA 3T9LA 4DFPA 1Z2MA 2HCFA 3KYDD 2A1AA 4OJOA 5BPCA 1ZQUA 1J7BA 3UI3A 4WJNA 4OZCA 4C8LA 4I2IA 1SXDA 4NLGA 4GGQA 4M6WB 5CTRC 3LVWA 2F1HA 3BVMA 2FCQA 1NYRA 2KYWA 2MX2A 4CYEA 2A1JB 4I27A 3PHWB 4GOCA 4J9QA 3LJ3A 1TTNA 2J6UA 2EKEC 2AQ3B 4WQMA 1XSNA 2E6XA 3PRPB 4NJCA 2W3RA 1EU4A 2R8JA 2KKPA 2AGOA 4ECZA 2CHXA 4FBUA 3V6EB 5KAIU 5J2KA 4DL3A 2NPTB 2YMQA 5DBBA 2O6KA 5DDYA 2JVCA 2L00B 5BO4B 5J0RA 4RQNA 5KFYA 1E8WA 1WR6E 4WJ3B 1XNSA 3L17A 2VIXA 3A0BU 1UELA 5HMLA 1KBUA 1IG6A 2KWDA 5KFUA 3NZUA 2NBWB 2XC9A 2AL6A 2DX5B 1JXLA 3TBLD 1A70A 1GUAB 1BNOA 4OVVA 1V49A 1H8CA 2NO4A 4O3QA 2QARB 5AKEA 4Y2RA 2HBLA 1V81A 1TAMA 2EZYA 2ALZA 3V61A 4JWUC 3T5JA 1FO4A 1UBIA 4O3RA 1WX9A 4EBDA 4ANXA 3JPSA 4RF1A 5J0PA 4NM1A 2FIFA 2EQYA 2VA8A 3EFCA 1JWMD 2N1VA 2KD0A 1PUZA 1WWVA 2GBRA 8ICMA 2WGSA 3C19A 2JEJA 2ZPNA 2DYMA 4TUPA 2RRDA 2WB1C 2R8GA 2BPCA 2HDOA 4ZDVA 1IXRA 3SMVA 1WRIA 2G09A 2A19A 3M62B 4IWPA 4BOZB 5D3IB 3QUTA 5J2BA 3C5GA 2C2EA 1NVID 1ZOYB 1Y88A 5KFBA 5DDMA 3ONSA 5CWRA 2WXQA 3TKAA 2ISOA 4A9AA 4BKSA 1B9RA 2FJ6A 3TFSA 3HIZA 3N97B 3AM9A 4JV0A 1ZUD2 5D94A 4IQWA 1JROA 4Y2UA 2WXKA 5KFIA 3NVYA 4BJQA 4LJOB 4KZCA 3VFKA 5KFCA 3VCBA 2P6RA 2D6FC 1KRPA 4A20A 2WDVB 4GDLA 3AULA 8ICEA 3P42A 4I28A 4HPLB 1AROP 2NRTA 4KMOB 1HQRD 1TZOA 1WM3A 1P7DA 4E0DA 4YMMA 1UHUA 1YOVB 1C4AA 1TBEA 2JY6A 3IG8A 3P4RB 3V72A 2FPMA 2MBQA 1NKCA 2ASDA 2BBCA 2Q4TA 2M4NA 4RF0A 3F2CA 2KV2A 2HDEA 3IAM1 1KM7A 1ET9A 3THVA 5HI1A 2HW3A 2XK5B 4F92B 3ZDMC 4UB1A 1T0YA 2QB0A 3ECIA 3B1LX 3UQAA 1N61A 2LKYA 1QSLA 7ICLA 5CA7A 1RQLA 4Q43A 1C1YB 3GIJA 2ATLA 1XSLA 4W9IA 2W04A 3J9CA 4XDCA 4EX6A 5AHXA 3DWMA 5C2TB 3ZUNA 3VUXA 4HYKA 4R66A 3K1RB 3NVWA 1ZETA 4B9NA 4KLEA 3Q8AA 4CQNA 1ECWA 3WAOA 4J9PA 2JRZA 4KLIA 2WAQC 1WF9A 5EOZA 3H4BA 4XQ8A 2KVZA 4F91B 4X57B 5TR5A 2LXCA 9ICOA 3ZW3A 3A1QB 5DG7A 3UXNA 1WH3A 2KN4A 4EKUA 1VZ7A 1KFYB 2V4IB 1S0MA 1WFYA 3KQ4A 3SI8A 2XVTA 4DSKA 1G6JA 3DVNU 2HJ8A 3U26A 3SU8X 4I2EA 1E10A 3HM6X 4CRXA 2RDBC 3KZIU 4MHVA 3BWUD 2QLTA 5JU5A 2K22A 4XDDA 5AZGA 1D5ZC 4C4VA 1ZJNA 8ICJA 2ZPYA 3KFUF 2QDFA 3N1ZC 5TSSA 1ZQVA 8ICXA 2AXTU 4Y2YA 5E79U 3SDLC 2H3FA 4JK1A 5DGBA 5AKJA 8ICGA 2HD5B 3PX6A 3LWMA 2F8LA 1YX5B 2VA3A 3I28A 4DHJD 3Q8KA 2QSDA 3JPRA 3Q8EA 3ZQ4A 1Z00A 3IV6A 2KFNA 5T8IA 1ZD2P 2EAPA 3N3KB 3SEBA 3WALA 9ICQA 3PS6A 1L0VB 5JTIA 4GDKA 5IA7A 3TJPA 3WK8A 4LNKA 3EA6A 1U4AA 4PHEA 3PVXA 4XUSA 7ICSA 2KN5A 2JXTA 2OYYA 1V2YA 2L05A 3Q8CA 4HVBA 2M56B 2NMQA 2P6UA 5AI0A 4O3NA 4EELA 3WKDA 3RNGC 2JH7A 3T3NA 2JWUA 1B43A 1AQ6A 5KG4A 5KTQA 2KQ7A 3TACB 1KFTA 2Y5CA 3NY5A 4P0QA 1LM8B 1TS5A 1MVKA 2GRIA 2KQSA 2KN7A 5KG6A 2DKZA 4WQOB 2BYEA 2LXAA 1FXTB 3BS7A 1P7FA 4TQSA 5ALEA 2Z0EB 2J4XA 4OHJA 2ZNVC 3GIIA 2KKVA 3QE9Y 8ICSA 5GTIU 3QQ8B 3RF9A 8ICBA 4FHKA 3P2BA 3AQEA 2AHOB 3H0MB 1DOIA 4F93B 1RG6A 4DS4A 3C23A 1TJEA 1QF6A 2WF5A 2B21A 3GZFA 5BOMA 4QZ8A 4RM9A 1NEKB 4HEA1 4RH6A 2K4PA 2G06A 1WMHA 1UF0A 2A4ZA 3GV8B 3M63B 4YTPB 3U7DA 3PX0A 4Q2JA 4TV3A 2YMLA 3OSPA 2BT6A 2NO5A 2PTLA 3NVVA 3RI7C 2LGSA 4FADA 3C29A 1ZQWA 9ICVA 4RT2A 3MDCA 3IG3A 3MHSD 4MH0E 1SIJA 1KQQA 2KLCA 3VUYA 5C5JA 3EGRA 1XT9B 1J8CA 1OW5A 5KT5A 1XLPA 2IGHA 4HLEA 4NXZA 4IC9A 3Q8PB 1EUVB 3R9KA 4M04A 1MJDA 1PYWD 4N6EB 4EFOA 3I5JC 2OJWA 4RQ6A 2LMRA 1E7PB 1HE8A 4CGZA 1ZXHA 3HKZF 2E1EA 1RYRA 7ICEA 5AEKB 4ZOHC 3GIMA 2XY7A 1WE7A 2RPQA 2PE9A 4GIVA 1RYUA 4LNNA 2ES6A 4RT3A 1Q46A 1FM0D 3VDZA 4ELTA 4DSLA 5KFLA 9ICXA 4IOIE 1CI4A 1LKYB 2VH1A 2KFZA 1V5OA 2JZ3B 3WCQA 1E8ZA 4IM3A 3Q8FA 1E6EB 3QZ7A 4GN1A 4HDOA 4I2JA 1TFRA 4IQUA 8ICYA 4K81A 2NV3A 4M6WA 1O03A 1U9LA 3T8MA 3KWLA 2EZXA 5HG2A 2A1JA 5ALNA 1HA5A 2KMCA 2C2RA 3CSFA 1QQ7A 3S6JA 3VTVA 4LDTD 1NKBA 4LZGA 5H8YE 2Y5PA 2N9EB 3GOEA 3OTQA 4UAVA 5H2FU 3QIJA 4RFBA 4P1CC 5J2CA 2YMMA 9ICNA 2IY1B 4EBEA 3RJHA 4GXBA 1JI7A 4O5CA 2K1FA 2MRLA 1ZQBA 4RNAA 2LPEA 5IIKA 4RQMA 5EWGA 4J9RA 1F5SA 2NPTA 3LDZE 4AS1A 3GQCA 1WYWB 4EZKA 2IDYA 4O0IA 2K39A 4W9DA 3IN5A 8ICKA 3PHXB 2IBIB 2W43A 2KSOB 1WM2A 1Z5SB 3OAWA 1WXVA 3NG0A 4RZRA 2N0SB 2Q0ZX 1VJ5A 1TGZB 2BS4B 3Q8QB 3IT6B 5HMMA 1ZQNA 2NBVB 2MH7A 2O2VB 2KZZA 2EAOA 3TADC 5C23A 2QARA 1E90A 1XQQA 1LXDA 4MEXA 1E7VA 5KFQA 1MG4A 1TS3A 4NAWB 3ZO5B 5BOLA 3ZI4A 2R8KA 3UGBB 3RNBC 2XO7A 3F2DA 3AE9B 1J2NA 2OHFA 3WAMA 2IZVB 2N9PC 5AUKA 5ALVA 1SL1A 2WYQA 2OEDA 2GO7A 3PW0A 3F53A 1TK5A 4YMOA 2R8HA 1OGWA 3NGDA 2G08A 3GE3C 1Z1BA 2J0KA 2KFJA 1RFAA 1X66A 1SV4A 5IIOA 2AJQA 3EC8A 3PT2B 2RDGA 4B0MA 2IJ0A 2W3SA 4MGZE 4FN2A 5ALUA 3RR8A 3RFAA 1TY0A 4DEZA 2GBNA 5JUMA 2WXHA 3O13A 4K3BA 2BYFA 3PMNA 3DV9A 3D2SA 1OEYA 4XX5A 2QJLA 4M8MA 3KLSX 5GXGB 3MR2A 4DOCA 2KX3A 2RDHA 3DBHI 3HUIA 5KG7A 1XS9D 2WXRA 3A9JB 2W03A 1WWUA 2WS3B 1YMHE 5KFAA 2L0TA 1GNUA 2AQ1B 3VC8A 5HHDG 3HPOA 2QCZA 5G5HA 4OZBA 3PZDA 5KFXA 3UQBA 2C7HA 4W9GA 3F5AA 3Q2AC 4TSSA 3MBYA 2VANA 3EFUA 4LK0M 2NS5A 3ZLZA 5C1ZA 3RB6A 3ZNHB 3BQ7A 2L83A 5E6NA 1L4ZB 1MQ2A 4JX1C 2F2AB 2F76X 2HBKA 2WHIA 3OHBA 1X1MA 4F5QA 3A4RA 2PIAA 1WGKA 4R8UB 2MBOA 1BPEA 3R2IA 2RD0A 2P35A 1PK1B 5AKZA 2CU1A 4HAIA 3DHHC 4HPMB 1ZOLA 5J8YA 4FZMA 2PJHA 5LLIA 2N7EA 2CPRA 2F77X 3B0XA 2JRIB 2HHUA 4ITKA 3TEZA 1QH9A 3MDAA 3MC1A 3DBLB 2IO2B 1X9XA 2XK5A 1V1PB 1L8LA 3CRXA 4Z6CA 4YSXB 3IG5A 1TKEA 3RNAC 4J9OA 4NM2A 1GAQB 2JT4B 2OEHA 1L5UA 2K5PA 4ZYSA 1LO5D 4IDIA 2BWES 3AE1B 3ZDEA 2E1FA 3AEBB 1K8RB 3U4EG 1X6JA 3AE5B 5KG1A 1EWCA 4DOAA 4US8A 4BWMA 4MF2A 3AXCA 5D49A 1RM6C 3M7DA 2MUTB 4F5RA 5EE0A 4ANWA 1DRGA 5ALSA 3ZD8A 4DXAB 1FPYA 5EE9A 1WJUA 4Q44A 3A1QA 4NLBA 3M9NB 2HMXA 1NJXA 5HR7A 1EF5A 2CHZA 1STEA 4ED6A 1BPZA 5CRXA 3SFDB 2UVVA 4UB5A 2JU6X 3L16A 3TEXA 4OO1J 4DSEA 4NPNA 1UNSA 1E9MA 5ALQA 5JH5C 3H7PB 1FXAA 1ZQOA 2YB4A 4OD0A 4NLNA 3EW9A 1XLQA 1QOFA 3GZNI 3WANA 4RNOA 5HNKA 4NAMA 4F2SA 2E8OA 1U49A 1C76A 1MHXA 1XC9A 4BKGA 1UT5A 4FA6A 2DYBA 2LRUA 4URKA 5F9LA 2IOFK 3TMPB 1S3SG 4DSFA 2HSZA 3TI0A 2ZUCA 5J2JA 4QNLA 1CMXB 2K25A 1JW9D 2JGAA 2CJOA 4B6JA 3HWTA 3RT3B 4KN4A 4QW8A 4M9HA 1BPYA 4IR1A 1L3UA 3P4PB 2H3ZA 3R3MA 2ASJA 2N4FA 2J0MA 3E58A 4MGIE 2HI0A 5DQHA 1XLOA 2ZTCA 2IOFA 2RP5A 3CW2C 1VJKA 2EELA 2DGZA 3KUDB 5JXVA 1M4VA 5KFJA 1XO1A 3JYUA 3QX1A 3OPXA 1TYGB 2PXIA 5EWEA 3L08A 4NL9C 8ICPA 1NOMA 1L4DB 4K7WA 3HJEA 4REZA 2OWOA 1NK4A 5ALOA 4JE3B 2QC8A 5DBCA 4DO9A 4UW9A 1XD3B 1K52A 1TVAA 2EZZA 3AE7B 1MSWD 4HROA 2KE7A 3PLUA 1A0PA 4R65A 4K4GA 3ENEA 2Y5BB 2W9CB 1ZQXA 1H38A 5AKGA 2D3BA 1XSPA 1V1OA 1P7EA 2YVCA 1KLNA 1F77A 1JMSA 1L5PA 2RSUA 1X42A 4KLGA 2CR5A 1C4PA 5KG3A 4RQ2A 5BMIA 1OQRA 5E6JA 4JB3A 4PZNA 3BVZA 1MC8A 2G4SA 2NBUA 3RFZB 2KO3A 2BDUA 2JR5A 5DB9A 4MGYE 3M95A 2Y3AA 2JX5A 5ALMA 2JV3A 3QEAZ 3N4MB 4P6VF 1WG8A 4J9SA 1TAUA 3SR6A 5L1JA 3RNFC 1OTRB 1TKYA 3NASA 4KITB 1I35A 3UQ0A 2WB1F 4FS2A 1RZTA 1T0QC 5KHQA 3PR5B 1HEKA 2W55A 1UGMA 1Z19A 3ZTDA 3JPOA 2LUEA 3VQIA 2HOFA 4BDPA 2W11A 4BVUC 3M1YA 1M6YA 4KX6B 1D8LA 3WK7A 1L3SA 3RNEC 1FD6A 2N9XA 3W1SC 1F2RC 1JRPA 4M9GA 1RWSA 2QHOA 3KKAA 2PMZC 4TUQA 3ZGZA 5ALTA 2XY6A 4UAUA 3MGHA 4A55A 9ICRA 2IPKD 2SAKA 1IBXB 2KJ6A 1LKYA 4DFJA 1L6UA 1Q1OA 4UASA 1V97A 4KLLA 3C8YA 2WF9A 1JALA 5CJ7A 3BQ2A 2LI5A 2DL0A 1MI0A 1XCTL 4GC7A 4N9F4 3DQVA 2NYVA 2AX5A 4S17A 4RQ0A 7ICPA 3RJIA 3RH5A 2I2YA 2H3QA 3JPNA 2KXJA 2LVQA 4I6LB 3DVGX 2GMIC 4DHJB 3QU7A 5AI9A 3NZSA 1N60A 2DUYA 2HHXA 4HPPA 2K9XA 3HM3A 3ZDAA 4F4YA 4NWIA 3VTUA 4PYZA 4B9VA 4Q8FA 2B6GA 4YCXA 3K9OB 5ALRA 4HKZE 2WWZA 2LZ6A 4TQ0A 4YL8A 3PO0A 2JSVX 1TK8A 3C1YA 4R63A 4KVGB 2INPE 1T0RC 5L83A 5D46A 3TQ1A 3VXWA 2WAQF 1BVSA 3URYA 2KJHB 2KSOA 5DB8A 2XIDA 5IILA 4DSIA 1R4NI 5BMHA 5J18A 3O65B 4MSQB 3PO5A 8ICIA 4WJOA 4O3MA 4W9EA 2FLPA 1ZQEA 4B0EA 2D2QA 2O2VA 2J52A 2WP9B 2YX8A 1AW7A 4G3IA 1K53A 2PI4A 2BCUA 4HRSA 3AH7A 2KLGA 1A77A 4NAWA 2O6VB 1UT8A 1WGYA 3KZXA 2QIEB 1U47A 4DQPA 4F1SA 5KFZA 2NTSA 4P0PB 4DHZE 2BW2A 8ICTA 3TL5A 4E3CA 3BS5B 3CP8A 4IS7A 4PS7A 2ICIA 5T14A 3AE3B 4FJYA 2FLNA 4C8KA 3M6KA 3ONNA 1VCBA 3H4DA 3NJTA 1ZQJA 2PVOD 2F44A 2XN9C 2JMGA 3TFRA 1E0ZA 1TS2A 3L54A 4I2FA 2A5UA 1Z4NA 4A90A 3QARA 1BNPA 2OCEA 1L7MA 4PGXA 3I76A 3KD3A 3A9JA 4TURA 2DLBA 5KFDA 2BQUA 2L76A 1V80A 2KIVA 2Q5WD 2FCNA 4U7CA 1WJNA 1V6EA 4KLUA 3V6CB 1FNVA 1ZD5A 2MEKA 4ZRQA 5JRTA 2K6QA 3VTWA 1ZQQA 2H89B 4BWJA 3PW7A 1BPXA 1T94A 1S97A 2GBJA 4DBGA 1DXSA 4F4WA 2KAJA 3WK9A 3K1ZA 7ICMA 1IYFA 1K51A 2ZVOA 4DXGA 3AEFB 5DLGA 1CEZA 4R8UA 1WSPA 2AWTA 5J0YA 3BYYB 1CJEA 1PK1A 2KD1A 2V1YA 2HBJA 3BVGA 1I7HA 5BYSA 2G0AA 2ON8A 2N9KA 5G5GA 3IRUA 4KZ0A 4RU9A 2C7MB 2WDRB 1QLBB 4TUUA 4PH5A 3JPQA 1ZYQA 1GO3F 3ORYA 1TS4A 2LBOA 1V1PA 4IWQA 3HILA 3NUHB 2WDTB 1VLBA 3OJ3A 3Q8RB 4LDTB 1JUDA 3T5LA 4YWGG 3VAWA 1GG3A 4OJ6A 3A0HU 4OZAA 5ALIA 2WXIA 4C8MA 1BXTA 1CQVA 1ZQYA 2LRWA 5CP2A 1QOBA 2BHNA 4YQWA 5L9XA 4G0NB 2BPFA 2KTRB 3PV1A 2INNE 4LTUA 3L3FX 1TK0A 4OJPA 3PW5A 2DAFA 2YEPB 3T3FA 2KDMA 3SD5A 2WLBA 2MUTA 3KH0A 3JPPA 2KT7A 4IRCA 3O0FA 5KFFA 2MSED 3BYTB 5C0YA 5ALPA 1WGDA 5J2AA 5AM0A 4YD1A 4NQKE 1IUEA 3C21A 3GE8C 4II3B 5K4LA 4C4SA 4UAYA 5AKHA 5ALGA 4DQIA 1JCKB 3SYZA 3Q69A 2E5SA 2ZUBA 3H7PA 1XLNA 2QMTA 4C4TA 5IIMA 2X38A 2K8AA 4QWAA 2HTME 5J0OA 4KLOA 5KFEA 1KTKA 2JHDA 2K8CB 5MPOA 4JWNA 1GC6A 1ROEA 4RGMA 4B9UA 2K6DB 4RPXA 3J81j 2C9WB 2LEKA 4ANUA 5B66U 3R7QA 4YR3A 2M0XA 3VHTC 5LXHA 4UBCA 3WAPA 1Q5WB 3PPAA 2BKEA 4RQ3A 3DVNV 3H6NA 3P4QB 2K3UA 1NNLA 1TKGA 3K75D 1C77A 5CB1A 2ASQA 4K4HA 4YP3A 4IW0A 1AN8A 2EANA 2LHDA 4FE3A 2LFIA 3ETRA 4HDQA 5D4BA 2ZUDA 5HR6A 4IQTA 3AE8B 2D3CA 2G45B 3LYYA 7ICTA 1ISNA 1ZDXA 2GLEA 1ZQSA 1CZPA 4M0AA 4N59A 1UZXB 3QEBZ 5DPWA 2Y1IA 2JF5A 5D6JB 2MJ3A 2W9CA 2ZCCA 2RDIA 3UIPB 3RJKA 4EOYA 4EENA 3R66C 2KFKB 3RBDA 3GU3A 4J9NA 1YNTE 9ICSA 3QU4A 2JEFA 3OHAA 3M3JA 3X0WA 1WXMA 5AICA 1Y56A 2BQRA 2HJ1A 4DL5A 5DBAA 1ZQTA 2ZIXB 4O1NA 4QWDA 4K3CA 4GFJA 4M47A 3ZXRA 1ZQZA 4E74A 2G3QB 3V7LA 3NS8A 3W1YA 4PGQA 1B0XA 1D9FA 4H2AA 2ZJAA 3WKEA 1QILA 5KFKA 3CSTA 2A3VA 1EWYC 2LM4A 4RUCA 2KC2A 4P7IA 3OJUA 2QB1A 3H7SA 3KWVA 1WE6A 1NENB 3N9YC 4ICAA 5C3JB 4G3XB 1WX7A 3CNHA 3QZ8A 2JZPA 3RN9C 1QQ6A 3DDCB 2PE6B 2YB1A 1NI2A 4EYHB 3D2NA 2MA9B 4LCDE 4AUQC 3X23A 5F3XB 2G5HB 3V7KA 4ECXA 1R4MI 2G4DB 2ZJ8A 1PDXA 3GV7B 4DS5A 2MRPA 1IBXA 2BPGA 1EO6A 2YEPF 2UVWA 1L8OA 1YX6B 4GLXA 2BYVE 4UQGA 2O6VD 2V3NA 4P2HA 1A76A 1KRHA 2ZIUB 3A4SC 1DGSA 2LHEA 1EF1A 3SZ2A 4O9MA 1VR9A 1P3QU 4LNFA 2N1WA 3NUQA 3TANA 2FDRA 3ZVVA 2OM6A 2BQQA 1U48A 9ICFA 4UARA 4KGRA 4ECRA 5AKKA 3KHHA 4J3OD 3QJZA 5BYRA 3UXPA 4NZLB 5HHIA 2ZTDA 1JRUA 3OLMD 4DQOC 1KH0A 3SQIA 4QZDA 8ICRA 3M9OB 1UA0A 1WJ6A 2IOHA 2W9NA 3C28A 5E6PA 4WJQA 3C0RB 4A3PA 5KG0A 2LMCA 4MH8A 2ZIWB 1L2NA 3CWIA 1SZHA 1NK6A 1E5WA 3Q14C 2MBEA 3QU9A 4I2CA 4AP9A 3B2GA 1NK9A 5KHOA 3ZDDA 2NCNA 2CN1A 1C79A 2R61A 2K4HA 4UB6U 1XWLA 2D3DA 2JZBB 4WJPA 3ALBA 4RQ7A 4G11A 3D2QA 3V6HA 4XE0A 2CU3A 3H9DA 4KGSA 3V6KA 1YN5A 2HHTA 4HWIB 1OUQA 3M6ZA 1V9PA 2O6VA 3APFA 3KW5B 1QLNA 2G5IB 4W9LA 2H3VA 1SEBD 4OJLA 4US9A 2RDJA 2QILA 5FK9C 4P0PA 4YD2A 3JPTA 2KP7A 1FRRA 2KJ8A 3BS5A 4EEKA 5L95C 5JHBA 4ED3A 1WGRA 2K8BB 3RULA 2EAMA 1SKRA 1E7UA 4MDKE 3SV4A 5CX3A 2M9NA 1VZ8A 3HRDD 1BPDA 4JV2A 3Q3OC 1PVRA 4JLCA 5J0XA 3PZPA 5KT4A 4QWCA 3RD2A 2PFNA 2TSSA 3PSTA 4M9LA 4DF8A 1SJED 2NRWA 4UAWA 4MELA 1ZQKA 3N32A 4C8NA 4F2RA 3QUQA 3AI5A 3UIOB 3AL0B 2IYDB 4HCNB 5J0UA 2BF8B 4EZ9A 4ICUA 2IMWP 3EZ5A 1QZEA 3NRZA 1S5LU 1S0NA 2WXMA 3AB5A 3Q3NC 1YD8U 1P9DU 3Q3MC 4C7ZA 2WHEA 5EE3A 1JXEA 3L13A 2NRZA 3WK4A 1SV0A 1NJZA 1S76D 1NBFC 1NJWA 2G1EA 3KYCD 4ECWA 4GB9A 1MHHE 3Q8SB 4LLGM 4RGTA 5LNK1 5HFYA 1MN8A 3ED5A 3L0WB 3H0RB 3MHZA 1YZ6A 2W7PA 4MT5A 2M0NA 1JWBD 1EXNA 3DEEA 2KVCA 1LGRA 4MF8A 5AK6A 4IRKA 2VJ5A 3CYMA 2V4QA 2LJIA 5ALLA 3LB8C 3UXOA 2UVRA 3PGEA 1WXSA 4DQRA 5LXIB 1L7OA 1HJPA 1WCLA 8ICQA 1BMLC 4IKGA 3AU4A 3WIMA 3SV3A 4RGNA 4KLMA 4KLJA 2I9GA 8ICFA 3RJJA 1F9JA 1KOTA 4MEMA 1ZGUB 5KFWA 2Y9TA 3RZFA 1TE2A 1VDVA 2KTRA 2C60A 1L0YB 1RYJA 1N6ZA 3W5UB 1ESFA 5FR3A 4M2YA 5KT3A 4QZGA 9ICGA 4RM8A 4WURA 1RXVA 1KFDA 3ZRCA 2R18A 2KJ9A 2NTTA 1FNWA 3HVZA 4BBNF 4I6NB 4NJ8A 4WWNA 3UMGA 3UMBA 1DOQA 5FKAC 4N58A 4EBCA 2GOWA 1SF0A 2K89A 1L6VA 1XU4A 3ML9A 1Y8RC 4MEYA 4F4ZA 4I2AA 4I2HA 2K8CA 5FR6A 3PNCA 4B9LA 4GU2A 5GMVA 2XGPA 3AV8A 4OCZA 4NLKA 1SL2A 3ZDCA 4C0ZA 2KWCA 2RQ5A 4K7SA 1ZQFA 4KX5A 4KN7A 1S0OA 3RRGA 4NV0A 4GXKA 4DK5A 5D2MB 3H7IA 4EYIB 2HHSA 2CS4A 3UINB 2WTFA 2OH2A 1QSSA 1FFVA 2BKFA 2MHJA 3BZCA 3CMMB 5J2EA 1P98A 2ZJ5A 4J9MA 4OVZA 5KT7A 2VJ4A 4ECTA 4NY0A 3N28A 5KL1B 3SAFA 4BAXA 4UB4A 4YTNB 3QUBA 3BY4B 3K4GA 4YMNA 3OJ4B 4AYBC 4W9CA 4WWPA 1R7SA 3RZWC 7ICKA 4L1BA 3HK0A 5J2RA 9ICLA 4WWMA 4CF4A 2GBKA 2JQRB 2ZTEA 3T5HA 4ECSA 5ALKA 4QWBA 3HP6A 2JEIA 1NK0A 1CRXA 4QZCA 4B95A 4KDIC 3RPFC 2I1QA 5AM5A 1T7PA 4P4PA 5KG2A 3PSFA 2YMPA 2L7RA 5L1MA 1ZQLA 1ZQGA 4S0RA 3EPIA 4EE2A 1GB4A 2D3AA 4QZBA 2KFKA 2HBMA 1QOGA 2ZVNA 5J8YC 2EDUA 3KHLA 1WI0A 3N30A 4HK2A 3ABVB 3TEYA 4O5KA 1IIPA 3V6JA 5EDSA 5IOIA 1L7PA 1Q8KA 3KVFB 3MFHA 5ALXA 4A8EA 2E8PA 3K9PB 2ZIXA 1ZQDA 1QT9A 1YN3A 1TIFA 3KHGA 2F8KA 1AARA 1L3VA 3PX4A 3HKZC 2ASLA 4CDGA 4MM3B 2ONQA 4L2YA 2I5HA 2H3IA 3G6YA 4AWJA 1EM7A 2W8KA 1I4GA 1FEHA 3C2MA 1N56A 7ICHA 2JRHA 2JZZA 3GIKA 7ICJA 5DG8A 3N20C 4EZLA 1UPHA 3H8MA 1YQ4B 4BZAA 3QA8A 5ALFA 4PYUA 3PR4A 2LM1A 2MU2A 1D4BA 2MJDA 4WH4A 1F0ZA 4RQ4A 2LGIA 4JIOU 3GDXA 4JGHB 4QW9A 4CO7A 1ZKHA 3PY8A 3Q6BA 2MWSB 2KWUB 2N7JA 3KUCB 2BZFA 5J17A 3GFKB 2ZIUA 1DYQA 1C20A 2E8NA 2KMDA 4KX3A 2I1JA 3EPGA 3QUCA 5AKIA 3DDHA 2IO1B 1F44A 1AWDA 3WKBA 1TV9A 1YJIA 5J0QA 3M8SA 3Q8BA 3IFWB 2HE7A 2GOLA 2ZXHA 2JXJA 1T8EA 1LQBA 4PT5A 3MP9A 1BT0A 3WU2U 3L5KA 1SGGA 1ZD4A 2DBYA 3RTVA 2P66A 2KDBA 4B9KA 1N48A 2V9HA 9ICJA 1S1QB 3WA0A 4C56C 1VRAB 3I63C 1NDDA 2AQ2B 3GV5B 4ELUA 1QSYA 4BX9C 2W8LA 2JUOA 2INCC 1UWXA 2BB5A 2DHZA 4Q45A 2ODGA 1J97A 2ZNVB 2ZIWA 1DK3A 2FCSA 2Z7JA 5BYQA 4Z6EA 1RQNA 2CHWA 3E0FA 2WF7A 4D2KA 4K7UA 2JYEA 3OWEB 2W9MA 3H40A 3ZNGC 2KC1A 4I29A 3VUWA 1I4QA 5IINA 5IKCM 3AEAB 1B4FA 9ICKA 3BK1A 3B0YA 1SXTA 2X8XX 2JZBA 4F5OA 4OVUA 4NLZA 8ICWA 1I4RA 2LD9A 1Z3EB 2DYOA 3DBSA 4JPSA 3GB1A 3FDSA 2N1RA 1OQQA 3P1MA 4GIBA 4PL1A 5AKLA 2AQ4A 3PO4A 4KLTA 3ZJTA 2M17A 2GBMA 3PSIA 1V86A 4GXJA 5GTHU 4F8CB 3N7PD 2HHWA 2LASA 2EMSA 2Z8LA 4QZAA 2DAJA 4Y2PA 1RFKA 1KJTA 1L7YA 2AEHA 5G2NA 2YN4A 2K8BA 2KACA 3APCA 3D6JA 2V0GA 3VRAB 4OJ5A 4KSLC 3QYPA 3RRHA 1KW4A 1YIWA 4QZ9A 5E6OA 5CHGA 4KKJA 1DGJA 4XA5A 8ICUA 1TY2A 2DZJA 1KL9A 2JWZA 4C80A 2JYTA 1ZW7A 1SKWA 2KK8A 5ALJA 3AU5A 7ICQA 3QXGA 2BGWA 4PGYA 4RCOA 3VR8B 2BWFA 3I1YA 1EU3A 3KKAC 7ICOA 4ED8A 3FYHA 2IHMA 2K0PA 1C3TA 2CXYA 1J7AA 2FCMA 4M02A 4WIPA 2C22A 9ICEA 2ZJDA 3T5KA 3TAQA 2KDEB 3RB4A 3R7RA 3F5EA 3R8BA 2WF8A 3WK5A 1UQVA 3AU2A 5KFNA 2HOIA 1X2IA 3PLVA 1HEZE 4GMVA 4DCCA 3U2SC 4DDID 3PW2A 5IAAC 2ACZB 3WKCA 1Q3UA 3JVZX 1ZDVA 5J0TA 4NJ6A 2ZXIA 3QU5A 2KOXA 4QZFA 2LYBA 3V3XA 7ICFA 4M00A 3SAGA 4XWTA 5JHAA 2AQ0A 2LYHA 4CE6A 5J2IA 4I2BA 3ZNZB 2DPIA 1SKSA 8ICHA 1WGGA 1WXAA 4YFKA 2BCQA 4LNOA 1GJZA 4HXDA 2BTEA 4YN4A 5CHWA 1FXIA 3TCAA 1ZE3D 1F1HA 5DQGA 3AEEB 4DF4A 3A9KB 4YXMA 1M94A 1D9DA 4FBJB 2IGGA 4WAAA 1C9FA 2W82A 1FCCC 4QZHA 2MLBA 2R2QA 4F3OA 1JIHA 2K4IA 3ZNID 2YQEA 2V4RA 1X40A 3H8SA 2WXOA 3RNCC 3LWLA 2VA2A 9ICPA 3ZDBA 4FBTA 3EHVA 2KNBA 9ICCA 3DHGC 4PJ0U 3EWAA 3SENA 3QAQA 1RPLA 2DZMA 3DBHB 4QZIA 9ICBA 4PPXA 2WXLA 7ICIA 4MGKE 4ARCA 5L1IA 4KTQA 2IHNA 3Q8MA 1WX8A 2OXOA 2H5XA 3RYTA 3G6VA 3UM9A 2LYAA 5EE1A 4NY8A 1J19A 2WXNA 2J7QB 2L52A 4WWOA 3HHMA 3DBRB 7ICRA 4QZEA 1I42A 1SL0A 1YJ1A 3Q3JA 5AM4A 4OW0A 4Y2QA 2CKHB 1V38A 1B1ZA 2LUMA 4BKSD 3PZ7A 5TZVA 3RMKC 2XBBC 3HVDA 5IP4D 2RHFA 2N9LA 5IN7A 4XRHA 2MP2B 2W9BB 2J6SA 4DL7A 1IP9A 2DNFA 1ZQPA 2L8JA 1UGJA 4KDLB 2BDPA 4ED2A 2RPVA 1ZJMA 4U6PA 1UBQA 2GH1A 4BGDA 2G07A 2KICA 3QU2A 3B0AA 2FMPA 4FXCA 4AQ7A 2Z59B 4PS8A 2CRXA 1GPXA 1KSPA 3IBEA 5AIBA 5ALHA 2LVPA 3P63A 1WCNA 3UMCA 3AE4B 1TT5B 5J2FA 3AE6B 2QEJC 1MFWA 2EH9A 4W9FA 1ZRNA 4DL4A 3PRMB 3HT3A 3LVVA 1NK5A 3PTFC 5KL8B 2J0JA 2FNJB 5KT6A 4IWOA 3FC4A 4MFCA 2EKIA 1QOAA 4DWFA 2LWPA 4ZRIA 3TSSA 4IC7B 2DF4B 1MG8A 2J42A 1WR1A 2CJNA 5D3DA 1NI3A 7ICNA 2I6XA 4F71A 2PFQA 5KFPA 5DPTA 2FBWB 3GZNB 4QIWC 4P1BC 2K4EA 4DFMA 1RXWA 2PFOA 4WAFA 9ICIA 3ICXA 4DFKA 2YLMA 4MFAA 4MM3A 1X6IA 5AUIA 3BZDB 4QWEA 2AL3A 2LJ5A 4YR0A 2KDFB 1UWMA 5HHHA 4R64A 1PVPA 2YTUA 1RYSA 2HTHA 2LVOA 5CHVC 3DCGA 3I9V1 3VRBB 5DQIA 2JH1A 1BGXT 4O3PA 4PL2A 3HX0A 1FIQA 1L7NA 2XI9A 1ENFA 1JWSD 4XWWA 3NTUA 2BYTA 3GILA 1DOXA 1N63A 4B9SA 2BS3B 5IIIA 4MSMB 3QK0A 2KANA 1YN4A 4UB2A 4NLCA 2XCPA 1P1AA 3QX7A 2D11A 1HXYD 4A8XC 5KFRA 3RAQA 4UB3A 3DBLI 4EUTA 7ICUA 3F2BA 3TIXA 1N5XA 3T3OA 4ECQA 1ZQMA 1IV8A 3KOOA 3PVLA 4B6WA 2AYOB 1NZPA 4ELVA 3BZKA 2Y1JA 3KUZA 4PHPA 1SBBB 2D5GA 3NZ3A 5AK4A 4FZLA 2KTFA 3V7JA 2HHVA 3SEIA 3BQ1A 1GB1A 3CF6E 2D10A 3IXSA 2KMMA 5AIAA 2M1MA 1SWVA 3U8ZA 5TISU 3ZRFA 3TEWA 3C2KA 4MJSB 7ICVA 2W7OA 1ZQCA 4RQ5A 2FUG1 3PSEB 9ICAA 2NR2A 1F0MA 3MR6A 1Q0WB 4BKTA 1YQ3B 2KZRA 5DPSA 3AMZA 3C5FA 4TKNA 4M9JA 5ALDA 4Y2JA 2KVRA 5D7GA 2KOBA 3JSVB 4Q8EA 2V9WA 1C78A 1WXQA 3ZXVA 2NRXA 3B9JA 4UAZA 3BDPA 1WZ0A 3H1UA 3EUB2 4IG7B 3VR9B 2Y0SC 1E8XA 4XGAB 3FILB 3S2AA 4FJZA 2B76B 1K1QA 4C00A 4ACFA 1T3NA 2KHWB 3ETLA 1J0GA 7ICGA 5J2DA 2AGPA 1QKZA 3GP7A 1T0SC 8ICCA 1MPEA 2KX0A 2KEYA 4F72A 2C28A 1C7YA 9ICUA 2M8SA 4Y2VA 5HKHA 2Y9UA 4FULA 4Y2SA 5AI5A 4KLSA 1FMAD 4E71A 3KBBA 4O5EA 1COOA 5KFSA 4DFDA 4JMUA 2LGYA 3SFEB 4G9BA 1UD7A 1LVHA 2XY5A 1SGHA 1QQRA 4LJPB 3W2DA 3V62A 1MA7A 3ISBA 5AK3A 5HP4A 4M0WB 1WJ4A 5KT2A 4M01A 1JQ4A 5AM1A 2AU0A 4P4MA 2J53A 1H4RA 1D5XC 9ICHA 2IBKA 2KWVB 2ZCBA 3IT4B 3ALRA 2PW9A 3H8HA 3ML8A 3ZIMA 4ZHOA 4RUAA 1LV5A 4JV1A 2L3ZA 3B08A 1UCVA 1D3ZA 3H8JA 3BQ0A 3ZDTA 1C4CA 3SAHA 1NYQA 4ICVA 3RJGA 2PKEA 2M0AA 2KHVA 2XGQA 1TAQA 4GC6A 3SHQA 4AYBF 1ZXIA 4PS3A 3ZKJC 4AP4C 3MGVA 3AEGB 2ZW0A 3NVZA 3QWZB 4Z6FA 1ACCA 2KDIA 3RJFA 1ZP0B 2Z0DB 3H8WA 4ECVA 4CHKA 1KLVA 4BFRA 4TUSA 1QCKA 2L0FA 2WXGA 1X9MA 1ZQRA 2BB6A 2KJ5A 5ALYA 4ED1A 4K1RB 1R4NB 2V4LA 1PFDA 3IVFA 5AZFA 2FAZA 1I4HA 1B22A 1NKEA 3IHQB 2WXJA 3BINA 3VH4B 3JW0X 3R2TA 2KTQA 4J03A 2PPHA 1SWWA 2MJEA 3ZD9A 1D6EC 2KG5A 4NJ7A 2WQYB 3MC9A 1BPBA 1D5MC 4UBBA 4JWMA 4RNNA 2FLLA 1PK3A 1Z1VA 4C4RA 4YR2A 3MR5A 2L5YA 2LHTA 3MGIA 4IQVA 2ISPA 1JWAD 2ZIVB 2MAXA 1SIFA 1SJHD 1U4BA 3N7RC 4BXOB 2PEAA 2D07B 2NVUI 4K4IA 3TARA 2AH5A 3A9KA 5DLFA 4NQLB 4ZRPA 2INDC 4PK1A 3BQTA 5AM2A 2I1KA 5AKYA 8ICVA 1PGBA 2KNJA 3LK9A 1FRDA 4KV2A 4GLSC 4XZ4A 1GC7A 3MJWA 5G55A 4P4OA 3RB0A 1SB3C 5A0LA 1ZQAA 3TADA 2BCSA 2ZW1A 1PGXA 1WZ3A 3NHEB 2KVSA 1DK2A 2MBHA 8ICNA 4EEYA 1JWUD 2WX0A 4GSWA 2LGXA 4F4KA 4USAA 2LI6A 3DVGY 5KFVA 4II2B 4EZJA 3P4SB 4KIKB 4LJXA 1S10A 4ED7A 3DWGC 5AI8A 5AK5A 3T79A 5ALZA 1ED1A 1FEZA 3OSNA 2DPJA 8ICOA 1KLUD 1CUKA 3SD7A 3WKAA 1WWTA 3IAS1 2VZKB 4KSKC 4IM0A 3BK2A 1XCQL 1J7CA 1WY8A 2UU7A 1N2XA 3EECA 3VH3B 2R2OA 1OQYA 3PZ8A 2IO0B 1RAXA 1D8YA 4F7ZA 1Z4OA 1Q3VA 1X9WA 3BIID 4FHJA 5CR0A 1XO0A 2FIDA 4MFFA 1JMLA 4KKIA 2MP2A 5AZHA 1SZPA 2W9BA 2PVGC 1HUZA 1S77D 2MA1A 2OJRA 1PGAA 3U7ZA 4Y2TA 3RH4A 2BCRA 2UVUA 3QHTA 5J0WA 9ICTA 2KJRA 3AEDB 4ASWC 4KMUA 5KFHA 4W9JA 2PI5A 4JUZA 3HW8A 2WU5B 1XXGA 3E2EA 4ZYNA 3AUOA 4C7YA 5KFMA 2XNAC 3UQ2A 2SEBD 1V8CA 3E9SA 4FS1A 1SV0C 4ECYA 1HIWA 1KN5A 4QAYA 2JEGA 2MSNA 1UUPA 2PMZF 4MACA 3AQFA 3M9MB 3I3TB 2KZMA 3LXFA 3MC8A 4TQ1A 2BCVA 4I6PA 5DKWA 1K50A 2DZIA 1YT3A 3LDAA 1WIAA 1S9FA 2DQNB 1U45A 2ZEQA 4I2GA 2KHQA 4AOFA 1ZQ1C 4EZ6A 2JXXA 5AI4A 4RNMA 3OJSA 2M19A 2JPHA 4XYCA 3MR3A 2BQ3A 4KLDA 2FE9A 1ZRMA 1SE4A 3V60A 4YXDB 4A6QA 1SE3A 2WFAA 3B2FA 1L3TA 4YG2A 2HHQA 2I38A 3FM9A 1I4PA 2B3AA 1S8OA 3U52E 8ICLA 4JWSC 1NZBA 4BUGA 3AE2B 5KNIA 2V3SA 4AJYB 2E3TA 2BKRB 2OOBB 1ET6A 2KK0A 1N62A 9ICMA 5F9NA 9ICWA 3AECB 3N1XC 4HKQA 1IGDA 3DBRI 1KEJA 5KFGA 2BPSA 4CF5A 1IM4A 1TKDA 1HZ5A 3V05A 1SXEA 4YVZA 1KKXA 1KF6B 3NS1A 5J2GA 3Q3FA 4X5VA 3W9CB 3NRWA 4UB8U 4DWIA 2LGDA 1RLFA 3IHPC 1YQBA 1JX4A 3MABA 2WF6A 1LB2B 4CCHA 2GI9A 4YTMB 4DQSA 2HVIA 4M9NA 1CK1A 3D32A 3AN1A 4PZOA 2W54A 1PUTA 3G6XA 4B9MA 1BUIC 1VZ6A 4L23A 4NNJB 1TZ1A 3I57A 4W9KA 5CHFA 1COKA 1HUOA 3ZJVA 4C8OA 5L1KA 2GLSA 2DWQA 3CIRB 3MFGA 3UF8A 2KMAA 3VVWB 4MJSA 4BOSC 3W5VB 1J2MA 3KHRA 2G9HD 3RBEA 4Y2XA 5KAFU 1SE9A 4YSZB 2XCAA 4ZH4A 1JN3A 2FMSA 2PMVA 4J9LA 1UA1A 1LFDA 3PMLA 2VKQA 4NL9A 3PW4A 2WX1A 3JSVA 2FE8A 4FJVB 4RGOS 3ZYYX 3MC0B 2MBBB 4O3OA 2DZKA 4TMAB 3PSPA 1QTMA 3PRZA 3RAXA 3MTNB 5IIJA 2N7DA 2MQJA 3EYZA 4UATA 1IGCA 2UYZB 2F1IA 3IM1A 3ISDA 3FILA 1KLGD 4JL9A 4JQWC 4ECUA 2GWSA 1V5TA 4GDLB 2QKQA 2XEWA 3DOWA 2E8MA 2RR9A 5B5EU 1URJA 2WXPA 2NRVA 2C7NB 4ZRKA 3E56A 4A3OA 4F5NA 5H92C 2BS2B 4IUMB 1O08A 1NJYA 5KG5A 1XEEA 1A5RA 2PFPA 1NK7A 2D8CA 4O3SA 3KTQA 1K1SA 1T6BX 2KQ4X 2ZZPB 4G50A 1F52A 3LYSA 1R4MB 1D8BA 2D3GA 2C5LC 2QB0B 2DKXA 3RCZA 4F5PA 2V3PA 3ZJUA 1V85A 4FLHA 1RDFA 3RB3A 4KLHA 4M0WA 1KDHA 1L6NA 3FKYA 1HZ6A 1SE2A 3PV8A 2VRRB 3N7SC 3ISCA 3DHIC 4XC2A 3IDWA 1DOYA 4RQ1A 4F4XA 5DB7A 3N1YC 1YJJA 4FO6A 2IGDA 2K8HA 1PQSA 5CEHA 4LZDA 3A33B 3Q8LA 2DFLA 3OG5A 4ANVA 3W1SA 2BGFA 5DGAA 1VD2A 4RQ8A 4RMAA 1UH6A 3BJYA 2W9AA 2L1AA 5EWFA 1OXJA 4DQQA 2VH2A 4C4VB 3RUIB 4ZHPA 2RMMA 2RLTA 2UWQA 1P0RA 5L1LA 1XO3A 3L4PA 3GS2A 4EX7A 5KFTA 4IM2A 4FZNA 2PKOA 1YZ7A 3WK6A 3AEVA 2IY0B 2WU2B 4P16A 3ZTCA 5J2HA 4RPZA 4CNQA 4W9HA 4ACOA 5JZEB 4DSJA 3QCAA 1Z00B 1OFFA 4TQRA 2GB1A 1FNUA 4PHDA 4B9TA 2IO3B 1I4XA 4CF3A 1T4GA 4F8RA 1WGHA 5J29A 4GDKB 2B0CA 2VZKD 4DLEA 4PHAA 8ICAA 1WRDB 4HJGE 4R3DA 5ALWA 4IR9A 1V9JA 1L0XB 5FP0A 1QQ5A 1ZD3A 4KGTA 5J0SA 5DB6A 3DPDA 2KZ3A 2L32A 2F1JA 4QIWF 4F50A 2FI1A 4GXIA 1ZQIA 5IO9A 4IL6U 2ZIVA 2RGFA 4AJWA 4P0QB 4DL6A 1HTQA 3MJ5A 2FPKA 1HTOA 4DHZB 2EMTA 4YSYB 5AI6A 4BXOA 2YY6A 1SSNA 4LVSA 3H0LB 5DG9A 4J6IA 4DXFA 1MQ3A 2MW5A 3RJEA 2ESEA 4DLGA 1AYFA 2J6TA 4BBNC 4UDUC 4FFDA 1IPGA 5AKXA 2FPLA 3TUOA 2AGQA 3QNMA 1ZQHA 1KTQA 3TAPA 2HVHA 5AM3A 4DL2A 4HCPB 2XICA 5BMGA 2MCNB 3RH6A 4KLFA 4J9KA 1RRBA 2PLPA
chains in the Genus database with same CATH topology
3AE1B 4KGSA 3AEBB 3U4EG 3FAHA 3AE5B 1YN5A 5I4DA 1EWCA 1UWMA 4US8A 1F2RI 3VRBB 1RM6C 3I9V1 1FFUA 5EE0A 1T3QA 1SEBD 2QILA 4US9A 2WDQB 2WXFA 1N5WA 1WYGA 5EE9A 5FK9C 1FIQA 1FRRA 4ARIA 1ENFA 1JWSD 4YT0B 4XWWA 2BYTA 1DOXA 1STEA 1N63A 2BS3B 3SFDB 2WNMA 1T5XD 1YN4A 2JU6X 3TEXA 1UNSA 1HXYD 4A8XC 1E9MA 1VZ8A 3HRDD 3T3OA 1FXAA 1N5XA 1XLQA 1QOFA 4NAMA 2TSSA 1C76A 1FCLA 1MHXA 1SJED 1SBBB 2D5GA 3NZ3A 2H88B 1GB1A 1XF5L 1GOZA 3IXSA 2KMMA 1Q10A 3TEWA 3NRZA 1ZPSA 1JW9D 2CJOA 2WXMA 3AB5A 2FUG1 3P4PB 4C7ZA 5EE3A 3UI3A 1J7BA 1YQ3B 4OZCA 2G1EA 3AMZA 1XLOA 1MHHE 1VJKA 2EELA 3BVMA 4LLGM 5D7GA 1NYRA 4RGTA 5LNK1 1C78A 1WXQA 5HFYA 3MHZA 1M4VA 4MT5A 1JWBD 1TYGB 3B9JA 3EUB2 1L4DB 3VR9B 2AQ3B 4REZA 4WQMA 2E6XA 3FILB 4JE3B 2W3RA 4NJCA 2LJIA 3LB8C 1EU4A 2B76B 1K52A 3AE7B 4HROA 1QKZA 3GP7A 1MPEA 1V1OA 1P7EA 1F77A 1BMLC 1L5PA 4IKGA 4RGNA 1C4PA 5BMIA 1OQRA 5E6JA 1FMAD 3BVZA 3RFZB 3SFEB 1VDVA 2KWDA 1L0YB 1RYJA 2Y3AA 1QQRA 3W2DA 2JX5A 3W5UB 4P6VF 1A70A 1ESFA 5FR3A 4WURA 3SR6A 1JQ4A 1TKYA 2NTTA 1FNWA 2J53A 3HVZA 1D5XC 2W55A 3IT4B 2PW9A 3H8HA 4ZHOA 4JWUC 1FO4A 3VQIA 5FKAC 4N58A 4KX6B 1SF0A 4RF1A 1L6VA 1C4CA 1NYQA 1FD6A 2M0AA 1JWMD 1ZXIA 1F2RC 1JRPA 3AV8A 1RWSA 3AEGB 2ZW0A 3NVZA 3ZGZA 2DYMA 4A55A 1ACCA 2IPKD 2SAKA 1IBXB 1ZP0B 1L6UA 1V97A 1FFVA 1WRIA 3C8YA 1JALA 5D3IB 2WXGA 1MI0A 1NVID 1XCTL 1ZOYB 4OVZA 2BB6A 1PFDA 2AX5A 2WXQA 1B9RA 4A9AA 1I4HA 4YTNB 2WXJA 3AM9A 1ZUD2 3R2TA 2I2YA 1R7SA 4L1BA 1JROA 2WXKA 4WWMA 3NVYA 2MJEA 1D6EC 2JQRB 2WQYB 1D5MC 1N60A 2WDVB 2K9XA 1JWAD 3RPFC 3P42A 4HKZE 4TQ0A 1SJHD 1HQRD 1TZOA 3PO0A 2JSVX 1C4AA 3P4RB 4ZRPA 4EE2A 1GB4A 2INPE 2BBCA 1QOGA 4RF0A 3URYA 1PGBA 3TEYA 1FRDA 2HDEA 3ABVB 3IAM1 4GLSC 1ET9A 5HI1A 5BMHA 1N61A 1SB3C 2ZW1A 1QT9A 1PGXA 1YN3A 1JWUD 4B0EA 3J9CA 4MM3B 4L2YA 2ONQA 4USAA 4XDCA 2J52A 2WP9B 3DWMA 1EM7A 1I4GA 3P4SB 5C2TB 1AW7A 1FEHA 3DWGC 1K53A 3NVWA 4HRSA 3AH7A 3Q8AA 4CQNA 2QIEB 1KLUD 1YQ4B 2NTSA 2BW2A 2KN4A 1WWTA 1VZ7A 3IAS1 1KFYB 2ICIA 2VZKB 2V4IB 3AE3B 3KQ4A 3BK2A 1XCQL 2MJDA 1J7CA 1D4BA 1E10A 4WH4A 1F0ZA 2LGIA 3PZ8A 3BWUD 4XDDA 2K22A 1D5ZC 5AUIA 2PVOD 3BIID 2XN9C 5TSSA 1E0ZA 1TS2A 2N7JA 1JMLA 4KKIA 4A90A 2PVGC 2QSDA 1DYQA 3Q8EA 3ZQ4A 1PGAA 3U7ZA 5T8IA 2DLBA 3SEBA 1AWDA 1L0VB 1YJIA 3Q8BA 3AEDB 2Q5WD 1FNVA 4PT5A 3EA6A 2MEKA 3MP9A 2WU5B 4ZRQA 2H89B 2JXTA 1XXGA 2DBYA 3Q8CA 4C7YA 2XNAC 2M56B 2NMQA 2SEBD 1V8CA 3E9SA 3T3NA 2KAJA 2JWUA 1UUPA 1K51A 4MACA 4C56C 1VRAB 3AEFB 2AQ2B 2Y5CA 3LXFA 4DXGA 5JXVA 4TQ1A 1WSPA 1K50A 1TS5A 1MVKA 1UWXA 1CJEA 2BB5A 2GRIA 3BYYB 3BVGA 1I7HA 5BYSA 2ON8A 2N9KA 5G5GA 5BYQA 2WDRB 1QLBB 1P7FA 2M19A 2J4XA 4D2KA 1SE4A 2JYEA 3OWEB 4OHJA 4YXDB 4A6QA 1SE3A 1TS4A 1I4QA 3B2FA 1V1PA 2I38A 1I4PA 3AEAB 3NUHB 3U52E 4JWSC 3BK1A 1VLBA 1SXTA 3AE2B 4YWGG 1I4RA 1DOIA 4OZAA 2DYOA 2E3TA 2WXIA 3GB1A 4JPSA 1BXTA 1CQVA 1TJEA 1ET6A 1QF6A 1QOBA 1N62A 1OQQA 3AECB 4HKQA 3P1MA 1IGDA 1NEKB 2INNE 2YEPB 4HEA1 4LTUA 4RH6A 3ZJTA 1HZ5A 2KDMA 2WLBA 3V05A 4YTPB 4Q2JA 1KF6B 2PTLA 3NS1A 2BT6A 2Z8LA 3NVVA 3BYTB 1RFKA 3W9CB 1IUEA 1SIJA 2KACA 2V0GA 2GI9A 3VRAB 4YTMB 3EGRA 2IGHA 1XLPA 4KKJA 1JCKB 1DGJA 3Q69A 1TY2A 1PYWD 1XLNA 1CK1A 2QMTA 4N6EB 3AN1A 2X38A 2W54A 1E7PB 4C80A 1PUTA 2HTME 2JYTA 1BUIC 1KTKA 1VZ6A 1ZXHA 4L23A 5MPOA 4ZOHC 1ROEA 3I57A 4RGMA 2LEKA 3ZJVA 1FM0D 4RCOA 3VR8B 4IOIE 2DWQA 1EU3A 3CIRB 3MFGA 2K0PA 1J7AA 3W5VB 4WIPA 3WCQA 3P4QB 2K3UA 2G9HD 1E6EB 3Q8FA 4YSZB 1TKGA 1C77A 3R8BA 2PMVA 1AN8A 3KWLA 2LHDA 2FE8A 3ZYYX 1HEZE 2LFIA 4RGOS 5HG2A 3U2SC 1HA5A 3MC0B 3ETRA 2ACZB 1ZDVA 3AE8B 4TMAB 3V3XA 5H8YE 3LYYA 2Y5PA 4XWTA 1ZDXA 1IGCA 3FILA 4RFBA 1KLGD 1CZPA 4N59A 4GDLB 2BTEA 1FXIA 1ZE3D 4RNAA 2MJ3A 3AEEB 2WXPA 3E56A 5H92C 4AS1A 2BS2B 2IDYA 1XEEA 1YNTE 2IGGA 1C9FA 2W82A 1FCCC 1T6BX 2KQ4X 1Y56A 2WXOA 2N0SB 2BS4B 2V3PA 3ZJUA 4O1NA 3IT6B 4M0WA 2MH7A 1HZ6A 1SE2A 2WXLA 4ARCA 4H2AA 1QILA 1DOYA 1TS3A 1EWYC 4NAWB 1YJJA 2IGDA 3KWVA 1NENB 5EE1A 2WXNA 3N9YC 3AE9B 2OHFA 2L52A 5C3JB 5AUKA 3W1SA 2OEDA 2JZPA 4OW0A 2L1AA 1B1ZA 2LUMA 4B0MA 2RDGA 3PZ7A 2IJ0A 2W3SA 4ZHPA 2RMMA 3HVDA 1XO3A 3L4PA 3GS2A 2N9LA 1TY0A 1PDXA 2WXHA 3O13A 2PKOA 1IBXA 2WU2B 2YEPF 4P16A 2QJLA 2V3NA 3KLSX 1KRHA 2RDHA 3HUIA 5GXGB 1OFFA 2WXRA 1UGJA 2GB1A 2WS3B 1FNUA 2LHEA 2RPVA 1YMHE 1I4XA 2AQ1B 1VR9A 5HHDG 5G5HA 4GDKB 4OZBA 4FXCA 4AQ7A 2VZKD 4R3DA 4HJGE 1GPXA 1L0XB 4KGTA 3P63A 4TSSA 3AE4B 4KGRA 4LK0M 4J3OD 5BYRA 2L32A 2L83A 4NZLB 3AE6B 2QEJC 1L4ZB 4JX1C 4DQOC 1KH0A 2PIAA 1WGKA 3R2IA 3MJ5A 4YSYB 3FC4A 2EKIA 1QOAA 1SSNA 2LMCA 3TSSA 4DXFA 4MH8A 3CWIA 2J42A 3BZDB 2CJNA 1AYFA 4ITKA 5D3DA 1NI3A 4UDUC 3TEZA 3B2GA 1C79A 1V1PB 2R61A 3TUOA 2FBWB 4YSXB 4WAFA 1TKEA 1GAQB 2K5PA 5BMGA 4ZYSA 2PLPA 1LO5D 4IDIA 4XE0A 2CU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE1 B;  1L6V A;  3AEB B;  1FXI A;  3FAH A;  1NYQ A;  2MJ3 A;  3AE5 B;  3AEE B;  2WU5 B;  1UWM A;  1ZXI A;  4US8 A;  2H89 B;  1JRP A;  3VRB B;  3AV8 A;  1RWS A;  1RM6 C;  2DBY A;  1FFU A;  4C7Y A;  2BS2 B;  3AEG B;  5EE0 A;  5H92 C;  1T3Q A;  2M56 B;  3NVZ A;  4KX6 B;  1V8C A;  2WDQ B;  4US9 A;  1N5W A;  1WYG A;  2KAJ A;  5EE9 A;  1FIQ A;  1FRR A;  4YT0 B;  1DOX A;  1ZP0 B;  3AEF B;  2Y5C A;  3LXF A;  1N63 A;  1L6U A;  2BS3 B;  1V97 A;  1FFV A;  1WRI A;  3SFD B;  1JAL A;  1CJE A;  2N0S B;  1I7H A;  2BS4 B;  1NVI D;  1ZOY B;  5G5G A;  1E9M A;  1PFD A;  3HRD D;  2AX5 A;  2WDR B;  1FXA A;  1QLB B;  1N5X A;  2MH7 A;  4A9A A;  2M19 A;  1B9R A;  4YTN B;  1XLQ A;  1QOF A;  3AM9 A;  1ZUD 2;  1R7S A;  4YXD B;  1DOY A;  1JRO A;  3B2F A;  1EWY C;  4WWM A;  3NVY A;  2MJE A;  3AEA B;  1YJJ A;  2JQR B;  4JWS C;  2WQY B;  1VLB A;  1NEN B;  2H88 B;  3AE2 B;  3AE9 B;  5EE1 A;  2OHF A;  1N60 A;  2L52 A;  1DOI A;  5C3J B;  5AUK A;  2KMM A;  2E3T A;  2WDV B;  1TJE A;  3NRZ A;  1JWA D;  2K9X A;  1QOB A;  1QF6 A;  1N62 A;  1JW9 D;  1OQQ A;  2CJO A;  3AB5 A;  3AEC B;  3P1M A;  3RPF C;  3P4P B;  4C7Z A;  5EE3 A;  1NEK B;  4LTU A;  3PO0 A;  1J7B A;  1YQ3 B;  2G1E A;  3AMZ A;  2WLB A;  3P4R B;  4YTP B;  1XLO A;  2W3S A;  4ZHP A;  1KF6 B;  1VJK A;  3NS1 A;  1XO3 A;  2BT6 A;  3L4P A;  3NVV A;  1NYR A;  1WXQ A;  1QOG A;  1PDX A;  1RFK A;  3W9C B;  2PKO A;  1FRD A;  3ABV B;  1IUE A;  1JWB D;  2WU2 B;  1TYG B;  3B9J A;  1SIJ A;  2QJL A;  3EUB 2;  5GXG B;  1KRH A;  3VRA B;  3HUI A;  3VR9 B;  1N61 A;  4YTM B;  1SB3 C;  1OFF A;  4WQM A;  2WS3 B;  1QT9 A;  2W3R A;  1XLP A;  3LB8 C;  2B76 B;  1DGJ A;  5G5H A;  1XLN A;  3AE7 B;  4N6E B;  4FXC A;  4HRO A;  4USA A;  3AN1 A;  2W54 A;  1E7P B;  4C80 A;  1PUT A;  2HTM E;  2WP9 B;  3DWM A;  3P4S B;  5C2T B;  1GPX A;  3DWG C;  3P63 A;  3NVW A;  4HRS A;  3AH7 A;  3AE4 B;  5MPO A;  4ZOH C;  1ROE A;  1L5P A;  2QIE B;  2LEK A;  2L83 A;  3AE6 B;  1FM0 D;  1OQR A;  1YQ4 B;  3VR8 B;  4JX1 C;  1FMA D;  2DWQ A;  3CIR B;  1WWT A;  1KFY B;  2PIA A;  1J7A A;  1WGK A;  3AE3 B;  3W5V B;  3SFE B;  1VDV A;  3WCQ A;  3P4Q B;  1E10 A;  2MJD A;  1J7C A;  1E6E B;  1RYJ A;  4YSY B;  3FC4 A;  2EKI A;  4YSZ B;  1QOA A;  1TKG A;  2JX5 A;  1F0Z A;  2K22 A;  3W5U B;  4P6V F;  1A70 A;  3CWI A;  2PVO D;  3BII D;  3KWL A;  2CJN A;  3SR6 A;  1AYF A;  3ZYY X;  1E0Z A;  1JQ4 A;  4ITK A;  3ETR A;  1NI3 A;  1TKY A;  2ACZ B;  3B2G A;  3AE8 B;  3HVZ A;  2PVG C;  2FBW B;  5H8Y E;  2W55 A;  4YSX B;  1TKE A;  4ZHO A;  4JWU C;  1FO4 A;  1GAQ B;  2K5P A;  1CZP A;  1AWD A;  1L0V B;  4IDI A;  4N59 A;  4N58 A;  1YJI A;  3AED B;  2Q5W D;  5AUI A;  2CU3 A;  1SF0 A; 
#chains in the Genus database with same CATH topology
 3M8R A;  1NK8 A;  2FUH B;  2C2D A;  3OGU A;  3PRE A;  4KIK A;  3FAH A;  2F3N A;  1A6S A;  5I4D A;  4HJK A;  2FMQ A;  1F2R I;  1OEY J;  1WMH B;  2IA6 A;  4ZRJ A;  5DCN A;  1FFU A;  4DDG D;  2BVC A;  8ICZ A;  1T3Q A;  2WXF A;  2WDQ B;  1N5W A;  1WYG A;  3IP4 B;  2K60 A;  2ZG6 A;  2BR0 A;  4ARI A;  4YT0 B;  1WUD A;  4LNI A;  2DEN B;  3C2L A;  4DOB A;  4QJF B;  5KFO A;  2WNM A;  1T5X D;  4YXJ A;  2HOQ A;  2R8I A;  5DPR A;  3C1Z A;  4KLQ A;  1PZN A;  2KIW A;  1PVQ A;  3QC8 B;  3APD A;  2REX A;  2KKC A;  1KFS A;  3AU6 A;  3UPQ A;  1FCL A;  4IRD A;  3MFI A;  1X9S A;  3RR7 A;  4EEW A;  1E8Y A;  3NOB A;  4Z6D A;  4M8N A;  4RPY A;  1S0V A;  2H88 B;  3L10 B;  1XF5 L;  1GOZ A;  2Y0S F;  1K5O A;  1Q10 A;  3U30 A;  4I2D A;  4ED0 A;  1ZPS A;  3T9L A;  4DFP A;  1Z2M A;  2HCF A;  3KYD D;  2A1A A;  4OJO A;  5BPC A;  1ZQU A;  1J7B A;  3UI3 A;  4WJN A;  4OZC A;  4C8L A;  4I2I A;  1SXD A;  4NLG A;  4GGQ A;  4M6W B;  5CTR C;  3LVW A;  2F1H A;  3BVM A;  2FCQ A;  1NYR A;  2KYW A;  2MX2 A;  4CYE A;  2A1J B;  4I27 A;  3PHW B;  4GOC A;  4J9Q A;  3LJ3 A;  1TTN A;  2J6U A;  2EKE C;  2AQ3 B;  4WQM A;  1XSN A;  2E6X A;  3PRP B;  4NJC A;  2W3R A;  1EU4 A;  2R8J A;  2KKP A;  2AGO A;  4ECZ A;  2CHX A;  4FBU A;  3V6E B;  5KAI U;  5J2K A;  4DL3 A;  2NPT B;  2YMQ A;  5DBB A;  2O6K A;  5DDY A;  2JVC A;  2L00 B;  5BO4 B;  5J0R A;  4RQN A;  5KFY A;  1E8W A;  1WR6 E;  4WJ3 B;  1XNS A;  3L17 A;  2VIX A;  3A0B U;  1UEL A;  5HML A;  1KBU A;  1IG6 A;  2KWD A;  5KFU A;  3NZU A;  2NBW B;  2XC9 A;  2AL6 A;  2DX5 B;  1JXL A;  3TBL D;  1A70 A;  1GUA B;  1BNO A;  4OVV A;  1V49 A;  1H8C A;  2NO4 A;  4O3Q A;  2QAR B;  5AKE A;  4Y2R A;  2HBL A;  1V81 A;  1TAM A;  2EZY A;  2ALZ A;  3V61 A;  4JWU C;  3T5J A;  1FO4 A;  1UBI A;  4O3R A;  1WX9 A;  4EBD A;  4ANX A;  3JPS A;  4RF1 A;  5J0P A;  4NM1 A;  2FIF A;  2EQY A;  2VA8 A;  3EFC A;  1JWM D;  2N1V A;  2KD0 A;  1PUZ A;  1WWV A;  2GBR A;  8ICM A;  2WGS A;  3C19 A;  2JEJ A;  2ZPN A;  2DYM A;  4TUP A;  2RRD A;  2WB1 C;  2R8G A;  2BPC A;  2HDO A;  4ZDV A;  1IXR A;  3SMV A;  1WRI A;  2G09 A;  2A19 A;  3M62 B;  4IWP A;  4BOZ B;  5D3I B;  3QUT A;  5J2B A;  3C5G A;  2C2E A;  1NVI D;  1ZOY B;  1Y88 A;  5KFB A;  5DDM A;  3ONS A;  5CWR A;  2WXQ A;  3TKA A;  2ISO A;  4A9A A;  4BKS A;  1B9R A;  2FJ6 A;  3TFS A;  3HIZ A;  3N97 B;  3AM9 A;  4JV0 A;  1ZUD 2;  5D94 A;  4IQW A;  1JRO A;  4Y2U A;  2WXK A;  5KFI A;  3NVY A;  4BJQ A;  4LJO B;  4KZC A;  3VFK A;  5KFC A;  3VCB A;  2P6R A;  2D6F C;  1KRP A;  4A20 A;  2WDV B;  4GDL A;  3AUL A;  8ICE A;  3P42 A;  4I28 A;  4HPL B;  1ARO P;  2NRT A;  4KMO B;  1HQR D;  1TZO A;  1WM3 A;  1P7D A;  4E0D A;  4YMM A;  1UHU A;  1YOV B;  1C4A A;  1TBE A;  2JY6 A;  3IG8 A;  3P4R B;  3V72 A;  2FPM A;  2MBQ A;  1NKC A;  2ASD A;  2BBC A;  2Q4T A;  2M4N A;  4RF0 A;  3F2C A;  2KV2 A;  2HDE A;  3IAM 1;  1KM7 A;  1ET9 A;  3THV A;  5HI1 A;  2HW3 A;  2XK5 B;  4F92 B;  3ZDM C;  4UB1 A;  1T0Y A;  2QB0 A;  3ECI A;  3B1L X;  3UQA A;  1N61 A;  2LKY A;  1QSL A;  7ICL A;  5CA7 A;  1RQL A;  4Q43 A;  1C1Y B;  3GIJ A;  2ATL A;  1XSL A;  4W9I A;  2W04 A;  3J9C A;  4XDC A;  4EX6 A;  5AHX A;  3DWM A;  5C2T B;  3ZUN A;  3VUX A;  4HYK A;  4R66 A;  3K1R B;  3NVW A;  1ZET A;  4B9N A;  4KLE A;  3Q8A A;  4CQN A;  1ECW A;  3WAO A;  4J9P A;  2JRZ A;  4KLI A;  2WAQ C;  1WF9 A;  5EOZ A;  3H4B A;  4XQ8 A;  2KVZ A;  4F91 B;  4X57 B;  5TR5 A;  2LXC A;  9ICO A;  3ZW3 A;  3A1Q B;  5DG7 A;  3UXN A;  1WH3 A;  2KN4 A;  4EKU A;  1VZ7 A;  1KFY B;  2V4I B;  1S0M A;  1WFY A;  3KQ4 A;  3SI8 A;  2XVT A;  4DSK A;  1G6J A;  3DVN U;  2HJ8 A;  3U26 A;  3SU8 X;  4I2E A;  1E10 A;  3HM6 X;  4CRX A;  2RDB C;  3KZI U;  4MHV A;  3BWU D;  2QLT A;  5JU5 A;  2K22 A;  4XDD A;  5AZG A;  1D5Z C;  4C4V A;  1ZJN A;  8ICJ A;  2ZPY A;  3KFU F;  2QDF A;  3N1Z C;  5TSS A;  1ZQV A;  8ICX A;  2AXT U;  4Y2Y A;  5E79 U;  3SDL C;  2H3F A;  4JK1 A;  5DGB A;  5AKJ A;  8ICG A;  2HD5 B;  3PX6 A;  3LWM A;  2F8L A;  1YX5 B;  2VA3 A;  3I28 A;  4DHJ D;  3Q8K A;  2QSD A;  3JPR A;  3Q8E A;  3ZQ4 A;  1Z00 A;  3IV6 A;  2KFN A;  5T8I A;  1ZD2 P;  2EAP A;  3N3K B;  3SEB A;  3WAL A;  9ICQ A;  3PS6 A;  1L0V B;  5JTI A;  4GDK A;  5IA7 A;  3TJP A;  3WK8 A;  4LNK A;  3EA6 A;  1U4A A;  4PHE A;  3PVX A;  4XUS A;  7ICS A;  2KN5 A;  2JXT A;  2OYY A;  1V2Y A;  2L05 A;  3Q8C A;  4HVB A;  2M56 B;  2NMQ A;  2P6U A;  5AI0 A;  4O3N A;  4EEL A;  3WKD A;  3RNG C;  2JH7 A;  3T3N A;  2JWU A;  1B43 A;  1AQ6 A;  5KG4 A;  5KTQ A;  2KQ7 A;  3TAC B;  1KFT A;  2Y5C A;  3NY5 A;  4P0Q A;  1LM8 B;  1TS5 A;  1MVK A;  2GRI A;  2KQS A;  2KN7 A;  5KG6 A;  2DKZ A;  4WQO B;  2BYE A;  2LXA A;  1FXT B;  3BS7 A;  1P7F A;  4TQS A;  5ALE A;  2Z0E B;  2J4X A;  4OHJ A;  2ZNV C;  3GII A;  2KKV A;  3QE9 Y;  8ICS A;  5GTI U;  3QQ8 B;  3RF9 A;  8ICB A;  4FHK A;  3P2B A;  3AQE A;  2AHO B;  3H0M B;  1DOI A;  4F93 B;  1RG6 A;  4DS4 A;  3C23 A;  1TJE A;  1QF6 A;  2WF5 A;  2B21 A;  3GZF A;  5BOM A;  4QZ8 A;  4RM9 A;  1NEK B;  4HEA 1;  4RH6 A;  2K4P A;  2G06 A;  1WMH A;  1UF0 A;  2A4Z A;  3GV8 B;  3M63 B;  4YTP B;  3U7D A;  3PX0 A;  4Q2J A;  4TV3 A;  2YML A;  3OSP A;  2BT6 A;  2NO5 A;  2PTL A;  3NVV A;  3RI7 C;  2LGS A;  4FAD A;  3C29 A;  1ZQW A;  9ICV A;  4RT2 A;  3MDC A;  3IG3 A;  3MHS D;  4MH0 E;  1SIJ A;  1KQQ A;  2KLC A;  3VUY A;  5C5J A;  3EGR A;  1XT9 B;  1J8C A;  1OW5 A;  5KT5 A;  1XLP A;  2IGH A;  4HLE A;  4NXZ A;  4IC9 A;  3Q8P B;  1EUV B;  3R9K A;  4M04 A;  1MJD A;  1PYW D;  4N6E B;  4EFO A;  3I5J C;  2OJW A;  4RQ6 A;  2LMR A;  1E7P B;  1HE8 A;  4CGZ A;  1ZXH A;  3HKZ F;  2E1E A;  1RYR A;  7ICE A;  5AEK B;  4ZOH C;  3GIM A;  2XY7 A;  1WE7 A;  2RPQ A;  2PE9 A;  4GIV A;  1RYU A;  4LNN A;  2ES6 A;  4RT3 A;  1Q46 A;  1FM0 D;  3VDZ A;  4ELT A;  4DSL A;  5KFL A;  9ICX A;  4IOI E;  1CI4 A;  1LKY B;  2VH1 A;  2KFZ A;  1V5O A;  2JZ3 B;  3WCQ A;  1E8Z A;  4IM3 A;  3Q8F A;  1E6E B;  3QZ7 A;  4GN1 A;  4HDO A;  4I2J A;  1TFR A;  4IQU A;  8ICY A;  4K81 A;  2NV3 A;  4M6W A;  1O03 A;  1U9L A;  3T8M A;  3KWL A;  2EZX A;  5HG2 A;  2A1J A;  5ALN A;  1HA5 A;  2KMC A;  2C2R A;  3CSF A;  1QQ7 A;  3S6J A;  3VTV A;  4LDT D;  1NKB A;  4LZG A;  5H8Y E;  2Y5P A;  2N9E B;  3GOE A;  3OTQ A;  4UAV A;  5H2F U;  3QIJ A;  4RFB A;  4P1C C;  5J2C A;  2YMM A;  9ICN A;  2IY1 B;  4EBE A;  3RJH A;  4GXB A;  1JI7 A;  4O5C A;  2K1F A;  2MRL A;  1ZQB A;  4RNA A;  2LPE A;  5IIK A;  4RQM A;  5EWG A;  4J9R A;  1F5S A;  2NPT A;  3LDZ E;  4AS1 A;  3GQC A;  1WYW B;  4EZK A;  2IDY A;  4O0I A;  2K39 A;  4W9D A;  3IN5 A;  8ICK A;  3PHX B;  2IBI B;  2W43 A;  2KSO B;  1WM2 A;  1Z5S B;  3OAW A;  1WXV A;  3NG0 A;  4RZR A;  2N0S B;  2Q0Z X;  1VJ5 A;  1TGZ B;  2BS4 B;  3Q8Q B;  3IT6 B;  5HMM A;  1ZQN A;  2NBV B;  2MH7 A;  2O2V B;  2KZZ A;  2EAO A;  3TAD C;  5C23 A;  2QAR A;  1E90 A;  1XQQ A;  1LXD A;  4MEX A;  1E7V A;  5KFQ A;  1MG4 A;  1TS3 A;  4NAW B;  3ZO5 B;  5BOL A;  3ZI4 A;  2R8K A;  3UGB B;  3RNB C;  2XO7 A;  3F2D A;  3AE9 B;  1J2N A;  2OHF A;  3WAM A;  2IZV B;  2N9P C;  5AUK A;  5ALV A;  1SL1 A;  2WYQ A;  2OED A;  2GO7 A;  3PW0 A;  3F53 A;  1TK5 A;  4YMO A;  2R8H A;  1OGW A;  3NGD A;  2G08 A;  3GE3 C;  1Z1B A;  2J0K A;  2KFJ A;  1RFA A;  1X66 A;  1SV4 A;  5IIO A;  2AJQ A;  3EC8 A;  3PT2 B;  2RDG A;  4B0M A;  2IJ0 A;  2W3S A;  4MGZ E;  4FN2 A;  5ALU A;  3RR8 A;  3RFA A;  1TY0 A;  4DEZ A;  2GBN A;  5JUM A;  2WXH A;  3O13 A;  4K3B A;  2BYF A;  3PMN A;  3DV9 A;  3D2S A;  1OEY A;  4XX5 A;  2QJL A;  4M8M A;  3KLS X;  5GXG B;  3MR2 A;  4DOC A;  2KX3 A;  2RDH A;  3DBH I;  3HUI A;  5KG7 A;  1XS9 D;  2WXR A;  3A9J B;  2W03 A;  1WWU A;  2WS3 B;  1YMH E;  5KFA A;  2L0T A;  1GNU A;  2AQ1 B;  3VC8 A;  5HHD G;  3HPO A;  2QCZ A;  5G5H A;  4OZB A;  3PZD A;  5KFX A;  3UQB A;  2C7H A;  4W9G A;  3F5A A;  3Q2A C;  4TSS A;  3MBY A;  2VAN A;  3EFU A;  4LK0 M;  2NS5 A;  3ZLZ A;  5C1Z A;  3RB6 A;  3ZNH B;  3BQ7 A;  2L83 A;  5E6N A;  1L4Z B;  1MQ2 A;  4JX1 C;  2F2A B;  2F76 X;  2HBK A;  2WHI A;  3OHB A;  1X1M A;  4F5Q A;  3A4R A;  2PIA A;  1WGK A;  4R8U B;  2MBO A;  1BPE A;  3R2I A;  2RD0 A;  2P35 A;  1PK1 B;  5AKZ A;  2CU1 A;  4HAI A;  3DHH C;  4HPM B;  1ZOL A;  5J8Y A;  4FZM A;  2PJH A;  5LLI A;  2N7E A;  2CPR A;  2F77 X;  3B0X A;  2JRI B;  2HHU A;  4ITK A;  3TEZ A;  1QH9 A;  3MDA A;  3MC1 A;  3DBL B;  2IO2 B;  1X9X A;  2XK5 A;  1V1P B;  1L8L A;  3CRX A;  4Z6C A;  4YSX B;  3IG5 A;  1TKE A;  3RNA C;  4J9O A;  4NM2 A;  1GAQ B;  2JT4 B;  2OEH A;  1L5U A;  2K5P A;  4ZYS A;  1LO5 D;  4IDI A;  2BWE S;  3AE1 B;  3ZDE A;  2E1F A;  3AEB B;  1K8R B;  3U4E G;  1X6J A;  3AE5 B;  5KG1 A;  1EWC A;  4DOA A;  4US8 A;  4BWM A;  4MF2 A;  3AXC A;  5D49 A;  1RM6 C;  3M7D A;  2MUT B;  4F5R A;  5EE0 A;  4ANW A;  1DRG A;  5ALS A;  3ZD8 A;  4DXA B;  1FPY A;  5EE9 A;  1WJU A;  4Q44 A;  3A1Q A;  4NLB A;  3M9N B;  2HMX A;  1NJX A;  5HR7 A;  1EF5 A;  2CHZ A;  1STE A;  4ED6 A;  1BPZ A;  5CRX A;  3SFD B;  2UVV A;  4UB5 A;  2JU6 X;  3L16 A;  3TEX A;  4OO1 J;  4DSE A;  4NPN A;  1UNS A;  1E9M A;  5ALQ A;  5JH5 C;  3H7P B;  1FXA A;  1ZQO A;  2YB4 A;  4OD0 A;  4NLN A;  3EW9 A;  1XLQ A;  1QOF A;  3GZN I;  3WAN A;  4RNO A;  5HNK A;  4NAM A;  4F2S A;  2E8O A;  1U49 A;  1C76 A;  1MHX A;  1XC9 A;  4BKG A;  1UT5 A;  4FA6 A;  2DYB A;  2LRU A;  4URK A;  5F9L A;  2IOF K;  3TMP B;  1S3S G;  4DSF A;  2HSZ A;  3TI0 A;  2ZUC A;  5J2J A;  4QNL A;  1CMX B;  2K25 A;  1JW9 D;  2JGA A;  2CJO A;  4B6J A;  3HWT A;  3RT3 B;  4KN4 A;  4QW8 A;  4M9H A;  1BPY A;  4IR1 A;  1L3U A;  3P4P B;  2H3Z A;  3R3M A;  2ASJ A;  2N4F A;  2J0M A;  3E58 A;  4MGI E;  2HI0 A;  5DQH A;  1XLO A;  2ZTC A;  2IOF A;  2RP5 A;  3CW2 C;  1VJK A;  2EEL A;  2DGZ A;  3KUD B;  5JXV A;  1M4V A;  5KFJ A;  1XO1 A;  3JYU A;  3QX1 A;  3OPX A;  1TYG B;  2PXI A;  5EWE A;  3L08 A;  4NL9 C;  8ICP A;  1NOM A;  1L4D B;  4K7W A;  3HJE A;  4REZ A;  2OWO A;  1NK4 A;  5ALO A;  4JE3 B;  2QC8 A;  5DBC A;  4DO9 A;  4UW9 A;  1XD3 B;  1K52 A;  1TVA A;  2EZZ A;  3AE7 B;  1MSW D;  4HRO A;  2KE7 A;  3PLU A;  1A0P A;  4R65 A;  4K4G A;  3ENE A;  2Y5B B;  2W9C B;  1ZQX A;  1H38 A;  5AKG A;  2D3B A;  1XSP A;  1V1O A;  1P7E A;  2YVC A;  1KLN A;  1F77 A;  1JMS A;  1L5P A;  2RSU A;  1X42 A;  4KLG A;  2CR5 A;  1C4P A;  5KG3 A;  4RQ2 A;  5BMI A;  1OQR A;  5E6J A;  4JB3 A;  4PZN A;  3BVZ A;  1MC8 A;  2G4S A;  2NBU A;  3RFZ B;  2KO3 A;  2BDU A;  2JR5 A;  5DB9 A;  4MGY E;  3M95 A;  2Y3A A;  2JX5 A;  5ALM A;  2JV3 A;  3QEA Z;  3N4M B;  4P6V F;  1WG8 A;  4J9S A;  1TAU A;  3SR6 A;  5L1J A;  3RNF C;  1OTR B;  1TKY A;  3NAS A;  4KIT B;  1I35 A;  3UQ0 A;  2WB1 F;  4FS2 A;  1RZT A;  1T0Q C;  5KHQ A;  3PR5 B;  1HEK A;  2W55 A;  1UGM A;  1Z19 A;  3ZTD A;  3JPO A;  2LUE A;  3VQI A;  2HOF A;  4BDP A;  2W11 A;  4BVU C;  3M1Y A;  1M6Y A;  4KX6 B;  1D8L A;  3WK7 A;  1L3S A;  3RNE C;  1FD6 A;  2N9X A;  3W1S C;  1F2R C;  1JRP A;  4M9G A;  1RWS A;  2QHO A;  3KKA A;  2PMZ C;  4TUQ A;  3ZGZ A;  5ALT A;  2XY6 A;  4UAU A;  3MGH A;  4A55 A;  9ICR A;  2IPK D;  2SAK A;  1IBX B;  2KJ6 A;  1LKY A;  4DFJ A;  1L6U A;  1Q1O A;  4UAS A;  1V97 A;  4KLL A;  3C8Y A;  2WF9 A;  1JAL A;  5CJ7 A;  3BQ2 A;  2LI5 A;  2DL0 A;  1MI0 A;  1XCT L;  4GC7 A;  4N9F 4;  3DQV A;  2NYV A;  2AX5 A;  4S17 A;  4RQ0 A;  7ICP A;  3RJI A;  3RH5 A;  2I2Y A;  2H3Q A;  3JPN A;  2KXJ A;  2LVQ A;  4I6L B;  3DVG X;  2GMI C;  4DHJ B;  3QU7 A;  5AI9 A;  3NZS A;  1N60 A;  2DUY A;  2HHX A;  4HPP A;  2K9X A;  3HM3 A;  3ZDA A;  4F4Y A;  4NWI A;  3VTU A;  4PYZ A;  4B9V A;  4Q8F A;  2B6G A;  4YCX A;  3K9O B;  5ALR A;  4HKZ E;  2WWZ A;  2LZ6 A;  4TQ0 A;  4YL8 A;  3PO0 A;  2JSV X;  1TK8 A;  3C1Y A;  4R63 A;  4KVG B;  2INP E;  1T0R C;  5L83 A;  5D46 A;  3TQ1 A;  3VXW A;  2WAQ F;  1BVS A;  3URY A;  2KJH B;  2KSO A;  5DB8 A;  2XID A;  5IIL A;  4DSI A;  1R4N I;  5BMH A;  5J18 A;  3O65 B;  4MSQ B;  3PO5 A;  8ICI A;  4WJO A;  4O3M A;  4W9E A;  2FLP A;  1ZQE A;  4B0E A;  2D2Q A;  2O2V A;  2J52 A;  2WP9 B;  2YX8 A;  1AW7 A;  4G3I A;  1K53 A;  2PI4 A;  2BCU A;  4HRS A;  3AH7 A;  2KLG A;  1A77 A;  4NAW A;  2O6V B;  1UT8 A;  1WGY A;  3KZX A;  2QIE B;  1U47 A;  4DQP A;  4F1S A;  5KFZ A;  2NTS A;  4P0P B;  4DHZ E;  2BW2 A;  8ICT A;  3TL5 A;  4E3C A;  3BS5 B;  3CP8 A;  4IS7 A;  4PS7 A;  2ICI A;  5T14 A;  3AE3 B;  4FJY A;  2FLN A;  4C8K A;  3M6K A;  3ONN A;  1VCB A;  3H4D A;  3NJT A;  1ZQJ A;  2PVO D;  2F44 A;  2XN9 C;  2JMG A;  3TFR A;  1E0Z A;  1TS2 A;  3L54 A;  4I2F A;  2A5U A;  1Z4N A;  4A90 A;  3QAR A;  1BNP A;  2OCE A;  1L7M A;  4PGX A;  3I76 A;  3KD3 A;  3A9J A;  4TUR A;  2DLB A;  5KFD A;  2BQU A;  2L76 A;  1V80 A;  2KIV A;  2Q5W D;  2FCN A;  4U7C A;  1WJN A;  1V6E A;  4KLU A;  3V6C B;  1FNV A;  1ZD5 A;  2MEK A;  4ZRQ A;  5JRT A;  2K6Q A;  3VTW A;  1ZQQ A;  2H89 B;  4BWJ A;  3PW7 A;  1BPX A;  1T94 A;  1S97 A;  2GBJ A;  4DBG A;  1DXS A;  4F4W A;  2KAJ A;  3WK9 A;  3K1Z A;  7ICM A;  1IYF A;  1K51 A;  2ZVO A;  4DXG A;  3AEF B;  5DLG A;  1CEZ A;  4R8U A;  1WSP A;  2AWT A;  5J0Y A;  3BYY B;  1CJE A;  1PK1 A;  2KD1 A;  2V1Y A;  2HBJ A;  3BVG A;  1I7H A;  5BYS A;  2G0A A;  2ON8 A;  2N9K A;  5G5G A;  3IRU A;  4KZ0 A;  4RU9 A;  2C7M B;  2WDR B;  1QLB B;  4TUU A;  4PH5 A;  3JPQ A;  1ZYQ A;  1GO3 F;  3ORY A;  1TS4 A;  2LBO A;  1V1P A;  4IWQ A;  3HIL A;  3NUH B;  2WDT B;  1VLB A;  3OJ3 A;  3Q8R B;  4LDT B;  1JUD A;  3T5L A;  4YWG G;  3VAW A;  1GG3 A;  4OJ6 A;  3A0H U;  4OZA A;  5ALI A;  2WXI A;  4C8M A;  1BXT A;  1CQV A;  1ZQY A;  2LRW A;  5CP2 A;  1QOB A;  2BHN A;  4YQW A;  5L9X A;  4G0N B;  2BPF A;  2KTR B;  3PV1 A;  2INN E;  4LTU A;  3L3F X;  1TK0 A;  4OJP A;  3PW5 A;  2DAF A;  2YEP B;  3T3F A;  2KDM A;  3SD5 A;  2WLB A;  2MUT A;  3KH0 A;  3JPP A;  2KT7 A;  4IRC A;  3O0F A;  5KFF A;  2MSE D;  3BYT B;  5C0Y A;  5ALP A;  1WGD A;  5J2A A;  5AM0 A;  4YD1 A;  4NQK E;  1IUE A;  3C21 A;  3GE8 C;  4II3 B;  5K4L A;  4C4S A;  4UAY A;  5AKH A;  5ALG A;  4DQI A;  1JCK B;  3SYZ A;  3Q69 A;  2E5S A;  2ZUB A;  3H7P A;  1XLN A;  2QMT A;  4C4T A;  5IIM A;  2X38 A;  2K8A A;  4QWA A;  2HTM E;  5J0O A;  4KLO A;  5KFE A;  1KTK A;  2JHD A;  2K8C B;  5MPO A;  4JWN A;  1GC6 A;  1ROE A;  4RGM A;  4B9U A;  2K6D B;  4RPX A;  3J81 j;  2C9W B;  2LEK A;  4ANU A;  5B66 U;  3R7Q A;  4YR3 A;  2M0X A;  3VHT C;  5LXH A;  4UBC A;  3WAP A;  1Q5W B;  3PPA A;  2BKE A;  4RQ3 A;  3DVN V;  3H6N A;  3P4Q B;  2K3U A;  1NNL A;  1TKG A;  3K75 D;  1C77 A;  5CB1 A;  2ASQ A;  4K4H A;  4YP3 A;  4IW0 A;  1AN8 A;  2EAN A;  2LHD A;  4FE3 A;  2LFI A;  3ETR A;  4HDQ A;  5D4B A;  2ZUD A;  5HR6 A;  4IQT A;  3AE8 B;  2D3C A;  2G45 B;  3LYY A;  7ICT A;  1ISN A;  1ZDX A;  2GLE A;  1ZQS A;  1CZP A;  4M0A A;  4N59 A;  1UZX B;  3QEB Z;  5DPW A;  2Y1I A;  2JF5 A;  5D6J B;  2MJ3 A;  2W9C A;  2ZCC A;  2RDI A;  3UIP B;  3RJK A;  4EOY A;  4EEN A;  3R66 C;  2KFK B;  3RBD A;  3GU3 A;  4J9N A;  1YNT E;  9ICS A;  3QU4 A;  2JEF A;  3OHA A;  3M3J A;  3X0W A;  1WXM A;  5AIC A;  1Y56 A;  2BQR A;  2HJ1 A;  4DL5 A;  5DBA A;  1ZQT A;  2ZIX B;  4O1N A;  4QWD A;  4K3C A;  4GFJ A;  4M47 A;  3ZXR A;  1ZQZ A;  4E74 A;  2G3Q B;  3V7L A;  3NS8 A;  3W1Y A;  4PGQ A;  1B0X A;  1D9F A;  4H2A A;  2ZJA A;  3WKE A;  1QIL A;  5KFK A;  3CST A;  2A3V A;  1EWY C;  2LM4 A;  4RUC A;  2KC2 A;  4P7I A;  3OJU A;  2QB1 A;  3H7S A;  3KWV A;  1WE6 A;  1NEN B;  3N9Y C;  4ICA A;  5C3J B;  4G3X B;  1WX7 A;  3CNH A;  3QZ8 A;  2JZP A;  3RN9 C;  1QQ6 A;  3DDC B;  2PE6 B;  2YB1 A;  1NI2 A;  4EYH B;  3D2N A;  2MA9 B;  4LCD E;  4AUQ C;  3X23 A;  5F3X B;  2G5H B;  3V7K A;  4ECX A;  1R4M I;  2G4D B;  2ZJ8 A;  1PDX A;  3GV7 B;  4DS5 A;  2MRP A;  1IBX A;  2BPG A;  1EO6 A;  2YEP F;  2UVW A;  1L8O A;  1YX6 B;  4GLX A;  2BYV E;  4UQG A;  2O6V D;  2V3N A;  4P2H A;  1A76 A;  1KRH A;  2ZIU B;  3A4S C;  1DGS A;  2LHE A;  1EF1 A;  3SZ2 A;  4O9M A;  1VR9 A;  1P3Q U;  4LNF A;  2N1W A;  3NUQ A;  3TAN A;  2FDR A;  3ZVV A;  2OM6 A;  2BQQ A;  1U48 A;  9ICF A;  4UAR A;  4KGR A;  4ECR A;  5AKK A;  3KHH A;  4J3O D;  3QJZ A;  5BYR A;  3UXP A;  4NZL B;  5HHI A;  2ZTD A;  1JRU A;  3OLM D;  4DQO C;  1KH0 A;  3SQI A;  4QZD A;  8ICR A;  3M9O B;  1UA0 A;  1WJ6 A;  2IOH A;  2W9N A;  3C28 A;  5E6P A;  4WJQ A;  3C0R B;  4A3P A;  5KG0 A;  2LMC A;  4MH8 A;  2ZIW B;  1L2N A;  3CWI A;  1SZH A;  1NK6 A;  1E5W A;  3Q14 C;  2MBE A;  3QU9 A;  4I2C A;  4AP9 A;  3B2G A;  1NK9 A;  5KHO A;  3ZDD A;  2NCN A;  2CN1 A;  1C79 A;  2R61 A;  2K4H A;  4UB6 U;  1XWL A;  2D3D A;  2JZB B;  4WJP A;  3ALB A;  4RQ7 A;  4G11 A;  3D2Q A;  3V6H A;  4XE0 A;  2CU3 A;  3H9D A;  4KGS A;  3V6K A;  1YN5 A;  2HHT A;  4HWI B;  1OUQ A;  3M6Z A;  1V9P A;  2O6V A;  3APF A;  3KW5 B;  1QLN A;  2G5I B;  4W9L A;  2H3V A;  1SEB D;  4OJL A;  4US9 A;  2RDJ A;  2QIL A;  5FK9 C;  4P0P A;  4YD2 A;  3JPT A;  2KP7 A;  1FRR A;  2KJ8 A;  3BS5 A;  4EEK A;  5L95 C;  5JHB A;  4ED3 A;  1WGR A;  2K8B B;  3RUL A;  2EAM A;  1SKR A;  1E7U A;  4MDK E;  3SV4 A;  5CX3 A;  2M9N A;  1VZ8 A;  3HRD D;  1BPD A;  4JV2 A;  3Q3O C;  1PVR A;  4JLC A;  5J0X A;  3PZP A;  5KT4 A;  4QWC A;  3RD2 A;  2PFN A;  2TSS A;  3PST A;  4M9L A;  4DF8 A;  1SJE D;  2NRW A;  4UAW A;  4MEL A;  1ZQK A;  3N32 A;  4C8N A;  4F2R A;  3QUQ A;  3AI5 A;  3UIO B;  3AL0 B;  2IYD B;  4HCN B;  5J0U A;  2BF8 B;  4EZ9 A;  4ICU A;  2IMW P;  3EZ5 A;  1QZE A;  3NRZ A;  1S5L U;  1S0N A;  2WXM A;  3AB5 A;  3Q3N C;  1YD8 U;  1P9D U;  3Q3M C;  4C7Z A;  2WHE A;  5EE3 A;  1JXE A;  3L13 A;  2NRZ A;  3WK4 A;  1SV0 A;  1NJZ A;  1S76 D;  1NBF C;  1NJW A;  2G1E A;  3KYC D;  4ECW A;  4GB9 A;  1MHH E;  3Q8S B;  4LLG M;  4RGT A;  5LNK 1;  5HFY A;  1MN8 A;  3ED5 A;  3L0W B;  3H0R B;  3MHZ A;  1YZ6 A;  2W7P A;  4MT5 A;  2M0N A;  1JWB D;  1EXN A;  3DEE A;  2KVC A;  1LGR A;  4MF8 A;  5AK6 A;  4IRK A;  2VJ5 A;  3CYM A;  2V4Q A;  2LJI A;  5ALL A;  3LB8 C;  3UXO A;  2UVR A;  3PGE A;  1WXS A;  4DQR A;  5LXI B;  1L7O A;  1HJP A;  1WCL A;  8ICQ A;  1BML C;  4IKG A;  3AU4 A;  3WIM A;  3SV3 A;  4RGN A;  4KLM A;  4KLJ A;  2I9G A;  8ICF A;  3RJJ A;  1F9J A;  1KOT A;  4MEM A;  1ZGU B;  5KFW A;  2Y9T A;  3RZF A;  1TE2 A;  1VDV A;  2KTR A;  2C60 A;  1L0Y B;  1RYJ A;  1N6Z A;  3W5U B;  1ESF A;  5FR3 A;  4M2Y A;  5KT3 A;  4QZG A;  9ICG A;  4RM8 A;  4WUR A;  1RXV A;  1KFD A;  3ZRC A;  2R18 A;  2KJ9 A;  2NTT A;  1FNW A;  3HVZ A;  4BBN F;  4I6N B;  4NJ8 A;  4WWN A;  3UMG A;  3UMB A;  1DOQ A;  5FKA C;  4N58 A;  4EBC A;  2GOW A;  1SF0 A;  2K89 A;  1L6V A;  1XU4 A;  3ML9 A;  1Y8R C;  4MEY A;  4F4Z A;  4I2A A;  4I2H A;  2K8C A;  5FR6 A;  3PNC A;  4B9L A;  4GU2 A;  5GMV A;  2XGP A;  3AV8 A;  4OCZ A;  4NLK A;  1SL2 A;  3ZDC A;  4C0Z A;  2KWC A;  2RQ5 A;  4K7S A;  1ZQF A;  4KX5 A;  4KN7 A;  1S0O A;  3RRG A;  4NV0 A;  4GXK A;  4DK5 A;  5D2M B;  3H7I A;  4EYI B;  2HHS A;  2CS4 A;  3UIN B;  2WTF A;  2OH2 A;  1QSS A;  1FFV A;  2BKF A;  2MHJ A;  3BZC A;  3CMM B;  5J2E A;  1P98 A;  2ZJ5 A;  4J9M A;  4OVZ A;  5KT7 A;  2VJ4 A;  4ECT A;  4NY0 A;  3N28 A;  5KL1 B;  3SAF A;  4BAX A;  4UB4 A;  4YTN B;  3QUB A;  3BY4 B;  3K4G A;  4YMN A;  3OJ4 B;  4AYB C;  4W9C A;  4WWP A;  1R7S A;  3RZW C;  7ICK A;  4L1B A;  3HK0 A;  5J2R A;  9ICL A;  4WWM A;  4CF4 A;  2GBK A;  2JQR B;  2ZTE A;  3T5H A;  4ECS A;  5ALK A;  4QWB A;  3HP6 A;  2JEI A;  1NK0 A;  1CRX A;  4QZC A;  4B95 A;  4KDI C;  3RPF C;  2I1Q A;  5AM5 A;  1T7P A;  4P4P A;  5KG2 A;  3PSF A;  2YMP A;  2L7R A;  5L1M A;  1ZQL A;  1ZQG A;  4S0R A;  3EPI A;  4EE2 A;  1GB4 A;  2D3A A;  4QZB A;  2KFK A;  2HBM A;  1QOG A;  2ZVN A;  5J8Y C;  2EDU A;  3KHL A;  1WI0 A;  3N30 A;  4HK2 A;  3ABV B;  3TEY A;  4O5K A;  1IIP A;  3V6J A;  5EDS A;  5IOI A;  1L7P A;  1Q8K A;  3KVF B;  3MFH A;  5ALX A;  4A8E A;  2E8P A;  3K9P B;  2ZIX A;  1ZQD A;  1QT9 A;  1YN3 A;  1TIF A;  3KHG A;  2F8K A;  1AAR A;  1L3V A;  3PX4 A;  3HKZ C;  2ASL A;  4CDG A;  4MM3 B;  2ONQ A;  4L2Y A;  2I5H A;  2H3I A;  3G6Y A;  4AWJ A;  1EM7 A;  2W8K A;  1I4G A;  1FEH A;  3C2M A;  1N56 A;  7ICH A;  2JRH A;  2JZZ A;  3GIK A;  7ICJ A;  5DG8 A;  3N20 C;  4EZL A;  1UPH A;  3H8M A;  1YQ4 B;  4BZA A;  3QA8 A;  5ALF A;  4PYU A;  3PR4 A;  2LM1 A;  2MU2 A;  1D4B A;  2MJD A;  4WH4 A;  1F0Z A;  4RQ4 A;  2LGI A;  4JIO U;  3GDX A;  4JGH B;  4QW9 A;  4CO7 A;  1ZKH A;  3PY8 A;  3Q6B A;  2MWS B;  2KWU B;  2N7J A;  3KUC B;  2BZF A;  5J17 A;  3GFK B;  2ZIU A;  1DYQ A;  1C20 A;  2E8N A;  2KMD A;  4KX3 A;  2I1J A;  3EPG A;  3QUC A;  5AKI A;  3DDH A;  2IO1 B;  1F44 A;  1AWD A;  3WKB A;  1TV9 A;  1YJI A;  5J0Q A;  3M8S A;  3Q8B A;  3IFW B;  2HE7 A;  2GOL A;  2ZXH A;  2JXJ A;  1T8E A;  1LQB A;  4PT5 A;  3MP9 A;  1BT0 A;  3WU2 U;  3L5K A;  1SGG A;  1ZD4 A;  2DBY A;  3RTV A;  2P66 A;  2KDB A;  4B9K A;  1N48 A;  2V9H A;  9ICJ A;  1S1Q B;  3WA0 A;  4C56 C;  1VRA B;  3I63 C;  1NDD A;  2AQ2 B;  3GV5 B;  4ELU A;  1QSY A;  4BX9 C;  2W8L A;  2JUO A;  2INC C;  1UWX A;  2BB5 A;  2DHZ A;  4Q45 A;  2ODG A;  1J97 A;  2ZNV B;  2ZIW A;  1DK3 A;  2FCS A;  2Z7J A;  5BYQ A;  4Z6E A;  1RQN A;  2CHW A;  3E0F A;  2WF7 A;  4D2K A;  4K7U A;  2JYE A;  3OWE B;  2W9M A;  3H40 A;  3ZNG C;  2KC1 A;  4I29 A;  3VUW A;  1I4Q A;  5IIN A;  5IKC M;  3AEA B;  1B4F A;  9ICK A;  3BK1 A;  3B0Y A;  1SXT A;  2X8X X;  2JZB A;  4F5O A;  4OVU A;  4NLZ A;  8ICW A;  1I4R A;  2LD9 A;  1Z3E B;  2DYO A;  3DBS A;  4JPS A;  3GB1 A;  3FDS A;  2N1R A;  1OQQ A;  3P1M A;  4GIB A;  4PL1 A;  5AKL A;  2AQ4 A;  3PO4 A;  4KLT A;  3ZJT A;  2M17 A;  2GBM A;  3PSI A;  1V86 A;  4GXJ A;  5GTH U;  4F8C B;  3N7P D;  2HHW A;  2LAS A;  2EMS A;  2Z8L A;  4QZA A;  2DAJ A;  4Y2P A;  1RFK A;  1KJT A;  1L7Y A;  2AEH A;  5G2N A;  2YN4 A;  2K8B A;  2KAC A;  3APC A;  3D6J A;  2V0G A;  3VRA B;  4OJ5 A;  4KSL C;  3QYP A;  3RRH A;  1KW4 A;  1YIW A;  4QZ9 A;  5E6O A;  5CHG A;  4KKJ A;  1DGJ A;  4XA5 A;  8ICU A;  1TY2 A;  2DZJ A;  1KL9 A;  2JWZ A;  4C80 A;  2JYT A;  1ZW7 A;  1SKW A;  2KK8 A;  5ALJ A;  3AU5 A;  7ICQ A;  3QXG A;  2BGW A;  4PGY A;  4RCO A;  3VR8 B;  2BWF A;  3I1Y A;  1EU3 A;  3KKA C;  7ICO A;  4ED8 A;  3FYH A;  2IHM A;  2K0P A;  1C3T A;  2CXY A;  1J7A A;  2FCM A;  4M02 A;  4WIP A;  2C22 A;  9ICE A;  2ZJD A;  3T5K A;  3TAQ A;  2KDE B;  3RB4 A;  3R7R A;  3F5E A;  3R8B A;  2WF8 A;  3WK5 A;  1UQV A;  3AU2 A;  5KFN A;  2HOI A;  1X2I A;  3PLV A;  1HEZ E;  4GMV A;  4DCC A;  3U2S C;  4DDI D;  3PW2 A;  5IAA C;  2ACZ B;  3WKC A;  1Q3U A;  3JVZ X;  1ZDV A;  5J0T A;  4NJ6 A;  2ZXI A;  3QU5 A;  2KOX A;  4QZF A;  2LYB A;  3V3X A;  7ICF A;  4M00 A;  3SAG A;  4XWT A;  5JHA A;  2AQ0 A;  2LYH A;  4CE6 A;  5J2I A;  4I2B A;  3ZNZ B;  2DPI A;  1SKS A;  8ICH A;  1WGG A;  1WXA A;  4YFK A;  2BCQ A;  4LNO A;  1GJZ A;  4HXD A;  2BTE A;  4YN4 A;  5CHW A;  1FXI A;  3TCA A;  1ZE3 D;  1F1H A;  5DQG A;  3AEE B;  4DF4 A;  3A9K B;  4YXM A;  1M94 A;  1D9D A;  4FBJ B;  2IGG A;  4WAA A;  1C9F A;  2W82 A;  1FCC C;  4QZH A;  2MLB A;  2R2Q A;  4F3O A;  1JIH A;  2K4I A;  3ZNI D;  2YQE A;  2V4R A;  1X40 A;  3H8S A;  2WXO A;  3RNC C;  3LWL A;  2VA2 A;  9ICP A;  3ZDB A;  4FBT A;  3EHV A;  2KNB A;  9ICC A;  3DHG C;  4PJ0 U;  3EWA A;  3SEN A;  3QAQ A;  1RPL A;  2DZM A;  3DBH B;  4QZI A;  9ICB A;  4PPX A;  2WXL A;  7ICI A;  4MGK E;  4ARC A;  5L1I A;  4KTQ A;  2IHN A;  3Q8M A;  1WX8 A;  2OXO A;  2H5X A;  3RYT A;  3G6V A;  3UM9 A;  2LYA A;  5EE1 A;  4NY8 A;  1J19 A;  2WXN A;  2J7Q B;  2L52 A;  4WWO A;  3HHM A;  3DBR B;  7ICR A;  4QZE A;  1I42 A;  1SL0 A;  1YJ1 A;  3Q3J A;  5AM4 A;  4OW0 A;  4Y2Q A;  2CKH B;  1V38 A;  1B1Z A;  2LUM A;  4BKS D;  3PZ7 A;  5TZV A;  3RMK C;  2XBB C;  3HVD A;  5IP4 D;  2RHF A;  2N9L A;  5IN7 A;  4XRH A;  2MP2 B;  2W9B B;  2J6S A;  4DL7 A;  1IP9 A;  2DNF A;  1ZQP A;  2L8J A;  1UGJ A;  4KDL B;  2BDP A;  4ED2 A;  2RPV A;  1ZJM A;  4U6P A;  1UBQ A;  2GH1 A;  4BGD A;  2G07 A;  2KIC A;  3QU2 A;  3B0A A;  2FMP A;  4FXC A;  4AQ7 A;  2Z59 B;  4PS8 A;  2CRX A;  1GPX A;  1KSP A;  3IBE A;  5AIB A;  5ALH A;  2LVP A;  3P63 A;  1WCN A;  3UMC A;  3AE4 B;  1TT5 B;  5J2F A;  3AE6 B;  2QEJ C;  1MFW A;  2EH9 A;  4W9F A;  1ZRN A;  4DL4 A;  3PRM B;  3HT3 A;  3LVV A;  1NK5 A;  3PTF C;  5KL8 B;  2J0J A;  2FNJ B;  5KT6 A;  4IWO A;  3FC4 A;  4MFC A;  2EKI A;  1QOA A;  4DWF A;  2LWP A;  4ZRI A;  3TSS A;  4IC7 B;  2DF4 B;  1MG8 A;  2J42 A;  1WR1 A;  2CJN A;  5D3D A;  1NI3 A;  7ICN A;  2I6X A;  4F71 A;  2PFQ A;  5KFP A;  5DPT A;  2FBW B;  3GZN B;  4QIW C;  4P1B C;  2K4E A;  4DFM A;  1RXW A;  2PFO A;  4WAF A;  9ICI A;  3ICX A;  4DFK A;  2YLM A;  4MFA A;  4MM3 A;  1X6I A;  5AUI A;  3BZD B;  4QWE A;  2AL3 A;  2LJ5 A;  4YR0 A;  2KDF B;  1UWM A;  5HHH A;  4R64 A;  1PVP A;  2YTU A;  1RYS A;  2HTH A;  2LVO A;  5CHV C;  3DCG A;  3I9V 1;  3VRB B;  5DQI A;  2JH1 A;  1BGX T;  4O3P A;  4PL2 A;  3HX0 A;  1FIQ A;  1L7N A;  2XI9 A;  1ENF A;  1JWS D;  4XWW A;  3NTU A;  2BYT A;  3GIL A;  1DOX A;  1N63 A;  4B9S A;  2BS3 B;  5III A;  4MSM B;  3QK0 A;  2KAN A;  1YN4 A;  4UB2 A;  4NLC A;  2XCP A;  1P1A A;  3QX7 A;  2D11 A;  1HXY D;  4A8X C;  5KFR A;  3RAQ A;  4UB3 A;  3DBL I;  4EUT A;  7ICU A;  3F2B A;  3TIX A;  1N5X A;  3T3O A;  4ECQ A;  1ZQM A;  1IV8 A;  3KOO A;  3PVL A;  4B6W A;  2AYO B;  1NZP A;  4ELV A;  3BZK A;  2Y1J A;  3KUZ A;  4PHP A;  1SBB B;  2D5G A;  3NZ3 A;  5AK4 A;  4FZL A;  2KTF A;  3V7J A;  2HHV A;  3SEI A;  3BQ1 A;  1GB1 A;  3CF6 E;  2D10 A;  3IXS A;  2KMM A;  5AIA A;  2M1M A;  1SWV A;  3U8Z A;  5TIS U;  3ZRF A;  3TEW A;  3C2K A;  4MJS B;  7ICV A;  2W7O A;  1ZQC A;  4RQ5 A;  2FUG 1;  3PSE B;  9ICA A;  2NR2 A;  1F0M A;  3MR6 A;  1Q0W B;  4BKT A;  1YQ3 B;  2KZR A;  5DPS A;  3AMZ A;  3C5F A;  4TKN A;  4M9J A;  5ALD A;  4Y2J A;  2KVR A;  5D7G A;  2KOB A;  3JSV B;  4Q8E A;  2V9W A;  1C78 A;  1WXQ A;  3ZXV A;  2NRX A;  3B9J A;  4UAZ A;  3BDP A;  1WZ0 A;  3H1U A;  3EUB 2;  4IG7 B;  3VR9 B;  2Y0S C;  1E8X A;  4XGA B;  3FIL B;  3S2A A;  4FJZ A;  2B76 B;  1K1Q A;  4C00 A;  4ACF A;  1T3N A;  2KHW B;  3ETL A;  1J0G A;  7ICG A;  5J2D A;  2AGP A;  1QKZ A;  3GP7 A;  1T0S C;  8ICC A;  1MPE A;  2KX0 A;  2KEY A;  4F72 A;  2C28 A;  1C7Y A;  9ICU A;  2M8S A;  4Y2V A;  5HKH A;  2Y9U A;  4FUL A;  4Y2S A;  5AI5 A;  4KLS A;  1FMA D;  4E71 A;  3KBB A;  4O5E A;  1COO A;  5KFS A;  4DFD A;  4JMU A;  2LGY A;  3SFE B;  4G9B A;  1UD7 A;  1LVH A;  2XY5 A;  1SGH A;  1QQR A;  4LJP B;  3W2D A;  3V62 A;  1MA7 A;  3ISB A;  5AK3 A;  5HP4 A;  4M0W B;  1WJ4 A;  5KT2 A;  4M01 A;  1JQ4 A;  5AM1 A;  2AU0 A;  4P4M A;  2J53 A;  1H4R A;  1D5X C;  9ICH A;  2IBK A;  2KWV B;  2ZCB A;  3IT4 B;  3ALR A;  2PW9 A;  3H8H A;  3ML8 A;  3ZIM A;  4ZHO A;  4RUA A;  1LV5 A;  4JV1 A;  2L3Z A;  3B08 A;  1UCV A;  1D3Z A;  3H8J A;  3BQ0 A;  3ZDT A;  1C4C A;  3SAH A;  1NYQ A;  4ICV A;  3RJG A;  2PKE A;  2M0A A;  2KHV A;  2XGQ A;  1TAQ A;  4GC6 A;  3SHQ A;  4AYB F;  1ZXI A;  4PS3 A;  3ZKJ C;  4AP4 C;  3MGV A;  3AEG B;  2ZW0 A;  3NVZ A;  3QWZ B;  4Z6F A;  1ACC A;  2KDI A;  3RJF A;  1ZP0 B;  2Z0D B;  3H8W A;  4ECV A;  4CHK A;  1KLV A;  4BFR A;  4TUS A;  1QCK A;  2L0F A;  2WXG A;  1X9M A;  1ZQR A;  2BB6 A;  2KJ5 A;  5ALY A;  4ED1 A;  4K1R B;  1R4N B;  2V4L A;  1PFD A;  3IVF A;  5AZF A;  2FAZ A;  1I4H A;  1B22 A;  1NKE A;  3IHQ B;  2WXJ A;  3BIN A;  3VH4 B;  3JW0 X;  3R2T A;  2KTQ A;  4J03 A;  2PPH A;  1SWW A;  2MJE A;  3ZD9 A;  1D6E C;  2KG5 A;  4NJ7 A;  2WQY B;  3MC9 A;  1BPB A;  1D5M C;  4UBB A;  4JWM A;  4RNN A;  2FLL A;  1PK3 A;  1Z1V A;  4C4R A;  4YR2 A;  3MR5 A;  2L5Y A;  2LHT A;  3MGI A;  4IQV A;  2ISP A;  1JWA D;  2ZIV B;  2MAX A;  1SIF A;  1SJH D;  1U4B A;  3N7R C;  4BXO B;  2PEA A;  2D07 B;  2NVU I;  4K4I A;  3TAR A;  2AH5 A;  3A9K A;  5DLF A;  4NQL B;  4ZRP A;  2IND C;  4PK1 A;  3BQT A;  5AM2 A;  2I1K A;  5AKY A;  8ICV A;  1PGB A;  2KNJ A;  3LK9 A;  1FRD A;  4KV2 A;  4GLS C;  4XZ4 A;  1GC7 A;  3MJW A;  5G55 A;  4P4O A;  3RB0 A;  1SB3 C;  5A0L A;  1ZQA A;  3TAD A;  2BCS A;  2ZW1 A;  1PGX A;  1WZ3 A;  3NHE B;  2KVS A;  1DK2 A;  2MBH A;  8ICN A;  4EEY A;  1JWU D;  2WX0 A;  4GSW A;  2LGX A;  4F4K A;  4USA A;  2LI6 A;  3DVG Y;  5KFV A;  4II2 B;  4EZJ A;  3P4S B;  4KIK B;  4LJX A;  1S10 A;  4ED7 A;  3DWG C;  5AI8 A;  5AK5 A;  3T79 A;  5ALZ A;  1ED1 A;  1FEZ A;  3OSN A;  2DPJ A;  8ICO A;  1KLU D;  1CUK A;  3SD7 A;  3WKA A;  1WWT A;  3IAS 1;  2VZK B;  4KSK C;  4IM0 A;  3BK2 A;  1XCQ L;  1J7C A;  1WY8 A;  2UU7 A;  1N2X A;  3EEC A;  3VH3 B;  2R2O A;  1OQY A;  3PZ8 A;  2IO0 B;  1RAX A;  1D8Y A;  4F7Z A;  1Z4O A;  1Q3V A;  1X9W A;  3BII D;  4FHJ A;  5CR0 A;  1XO0 A;  2FID A;  4MFF A;  1JML A;  4KKI A;  2MP2 A;  5AZH A;  1SZP A;  2W9B A;  2PVG C;  1HUZ A;  1S77 D;  2MA1 A;  2OJR A;  1PGA A;  3U7Z A;  4Y2T A;  3RH4 A;  2BCR A;  2UVU A;  3QHT A;  5J0W A;  9ICT A;  2KJR A;  3AED B;  4ASW C;  4KMU A;  5KFH A;  4W9J A;  2PI5 A;  4JUZ A;  3HW8 A;  2WU5 B;  1XXG A;  3E2E A;  4ZYN A;  3AUO A;  4C7Y A;  5KFM A;  2XNA C;  3UQ2 A;  2SEB D;  1V8C A;  3E9S A;  4FS1 A;  1SV0 C;  4ECY A;  1HIW A;  1KN5 A;  4QAY A;  2JEG A;  2MSN A;  1UUP A;  2PMZ F;  4MAC A;  3AQF A;  3M9M B;  3I3T B;  2KZM A;  3LXF A;  3MC8 A;  4TQ1 A;  2BCV A;  4I6P A;  5DKW A;  1K50 A;  2DZI A;  1YT3 A;  3LDA A;  1WIA A;  1S9F A;  2DQN B;  1U45 A;  2ZEQ A;  4I2G A;  2KHQ A;  4AOF A;  1ZQ1 C;  4EZ6 A;  2JXX A;  5AI4 A;  4RNM A;  3OJS A;  2M19 A;  2JPH A;  4XYC A;  3MR3 A;  2BQ3 A;  4KLD A;  2FE9 A;  1ZRM A;  1SE4 A;  3V60 A;  4YXD B;  4A6Q A;  1SE3 A;  2WFA A;  3B2F A;  1L3T A;  4YG2 A;  2HHQ A;  2I38 A;  3FM9 A;  1I4P A;  2B3A A;  1S8O A;  3U52 E;  8ICL A;  4JWS C;  1NZB A;  4BUG A;  3AE2 B;  5KNI A;  2V3S A;  4AJY B;  2E3T A;  2BKR B;  2OOB B;  1ET6 A;  2KK0 A;  1N62 A;  9ICM A;  5F9N A;  9ICW A;  3AEC B;  3N1X C;  4HKQ A;  1IGD A;  3DBR I;  1KEJ A;  5KFG A;  2BPS A;  4CF5 A;  1IM4 A;  1TKD A;  1HZ5 A;  3V05 A;  1SXE A;  4YVZ A;  1KKX A;  1KF6 B;  3NS1 A;  5J2G A;  3Q3F A;  4X5V A;  3W9C B;  3NRW A;  4UB8 U;  4DWI A;  2LGD A;  1RLF A;  3IHP C;  1YQB A;  1JX4 A;  3MAB A;  2WF6 A;  1LB2 B;  4CCH A;  2GI9 A;  4YTM B;  4DQS A;  2HVI A;  4M9N A;  1CK1 A;  3D32 A;  3AN1 A;  4PZO A;  2W54 A;  1PUT A;  3G6X A;  4B9M A;  1BUI C;  1VZ6 A;  4L23 A;  4NNJ B;  1TZ1 A;  3I57 A;  4W9K A;  5CHF A;  1COK A;  1HUO A;  3ZJV A;  4C8O A;  5L1K A;  2GLS A;  2DWQ A;  3CIR B;  3MFG A;  3UF8 A;  2KMA A;  3VVW B;  4MJS A;  4BOS C;  3W5V B;  1J2M A;  3KHR A;  2G9H D;  3RBE A;  4Y2X A;  5KAF U;  1SE9 A;  4YSZ B;  2XCA A;  4ZH4 A;  1JN3 A;  2FMS A;  2PMV A;  4J9L A;  1UA1 A;  1LFD A;  3PML A;  2VKQ A;  4NL9 A;  3PW4 A;  2WX1 A;  3JSV A;  2FE8 A;  4FJV B;  4RGO S;  3ZYY X;  3MC0 B;  2MBB B;  4O3O A;  2DZK A;  4TMA B;  3PSP A;  1QTM A;  3PRZ A;  3RAX A;  3MTN B;  5IIJ A;  2N7D A;  2MQJ A;  3EYZ A;  4UAT A;  1IGC A;  2UYZ B;  2F1I A;  3IM1 A;  3ISD A;  3FIL A;  1KLG D;  4JL9 A;  4JQW C;  4ECU A;  2GWS A;  1V5T A;  4GDL B;  2QKQ A;  2XEW A;  3DOW A;  2E8M A;  2RR9 A;  5B5E U;  1URJ A;  2WXP A;  2NRV A;  2C7N B;  4ZRK A;  3E56 A;  4A3O A;  4F5N A;  5H92 C;  2BS2 B;  4IUM B;  1O08 A;  1NJY A;  5KG5 A;  1XEE A;  1A5R A;  2PFP A;  1NK7 A;  2D8C A;  4O3S A;  3KTQ A;  1K1S A;  1T6B X;  2KQ4 X;  2ZZP B;  4G50 A;  1F52 A;  3LYS A;  1R4M B;  1D8B A;  2D3G A;  2C5L C;  2QB0 B;  2DKX A;  3RCZ A;  4F5P A;  2V3P A;  3ZJU A;  1V85 A;  4FLH A;  1RDF A;  3RB3 A;  4KLH A;  4M0W A;  1KDH A;  1L6N A;  3FKY A;  1HZ6 A;  1SE2 A;  3PV8 A;  2VRR B;  3N7S C;  3ISC A;  3DHI C;  4XC2 A;  3IDW A;  1DOY A;  4RQ1 A;  4F4X A;  5DB7 A;  3N1Y C;  1YJJ A;  4FO6 A;  2IGD A;  2K8H A;  1PQS A;  5CEH A;  4LZD A;  3A33 B;  3Q8L A;  2DFL A;  3OG5 A;  4ANV A;  3W1S A;  2BGF A;  5DGA A;  1VD2 A;  4RQ8 A;  4RMA A;  1UH6 A;  3BJY A;  2W9A A;  2L1A A;  5EWF A;  1OXJ A;  4DQQ A;  2VH2 A;  4C4V B;  3RUI B;  4ZHP A;  2RMM A;  2RLT A;  2UWQ A;  1P0R A;  5L1L A;  1XO3 A;  3L4P A;  3GS2 A;  4EX7 A;  5KFT A;  4IM2 A;  4FZN A;  2PKO A;  1YZ7 A;  3WK6 A;  3AEV A;  2IY0 B;  2WU2 B;  4P16 A;  3ZTC A;  5J2H A;  4RPZ A;  4CNQ A;  4W9H A;  4ACO A;  5JZE B;  4DSJ A;  3QCA A;  1Z00 B;  1OFF A;  4TQR A;  2GB1 A;  1FNU A;  4PHD A;  4B9T A;  2IO3 B;  1I4X A;  4CF3 A;  1T4G A;  4F8R A;  1WGH A;  5J29 A;  4GDK B;  2B0C A;  2VZK D;  4DLE A;  4PHA A;  8ICA A;  1WRD B;  4HJG E;  4R3D A;  5ALW A;  4IR9 A;  1V9J A;  1L0X B;  5FP0 A;  1QQ5 A;  1ZD3 A;  4KGT A;  5J0S A;  5DB6 A;  3DPD A;  2KZ3 A;  2L32 A;  2F1J A;  4QIW F;  4F50 A;  2FI1 A;  4GXI A;  1ZQI A;  5IO9 A;  4IL6 U;  2ZIV A;  2RGF A;  4AJW A;  4P0Q B;  4DL6 A;  1HTQ A;  3MJ5 A;  2FPK A;  1HTO A;  4DHZ B;  2EMT A;  4YSY B;  5AI6 A;  4BXO A;  2YY6 A;  1SSN A;  4LVS A;  3H0L B;  5DG9 A;  4J6I A;  4DXF A;  1MQ3 A;  2MW5 A;  3RJE A;  2ESE A;  4DLG A;  1AYF A;  2J6T A;  4BBN C;  4UDU C;  4FFD A;  1IPG A;  5AKX A;  2FPL A;  3TUO A;  2AGQ A;  3QNM A;  1ZQH A;  1KTQ A;  3TAP A;  2HVH A;  5AM3 A;  4DL2 A;  4HCP B;  2XIC A;  5BMG A;  2MCN B;  3RH6 A;  4KLF A;  4J9K A;  1RRB A;  2PLP A; 
#chains in the Genus database with same CATH homology
 3AE1 B;  4KGS A;  3AEB B;  3U4E G;  3FAH A;  3AE5 B;  1YN5 A;  5I4D A;  1EWC A;  1UWM A;  4US8 A;  1F2R I;  3VRB B;  1RM6 C;  3I9V 1;  1FFU A;  5EE0 A;  1T3Q A;  1SEB D;  2QIL A;  4US9 A;  2WDQ B;  2WXF A;  1N5W A;  1WYG A;  5EE9 A;  5FK9 C;  1FIQ A;  1FRR A;  4ARI A;  1ENF A;  1JWS D;  4YT0 B;  4XWW A;  2BYT A;  1DOX A;  1STE A;  1N63 A;  2BS3 B;  3SFD B;  2WNM A;  1T5X D;  1YN4 A;  2JU6 X;  3TEX A;  1UNS A;  1HXY D;  4A8X C;  1E9M A;  1VZ8 A;  3HRD D;  3T3O A;  1FXA A;  1N5X A;  1XLQ A;  1QOF A;  4NAM A;  2TSS A;  1C76 A;  1FCL A;  1MHX A;  1SJE D;  1SBB B;  2D5G A;  3NZ3 A;  2H88 B;  1GB1 A;  1XF5 L;  1GOZ A;  3IXS A;  2KMM A;  1Q10 A;  3TEW A;  3NRZ A;  1ZPS A;  1JW9 D;  2CJO A;  2WXM A;  3AB5 A;  2FUG 1;  3P4P B;  4C7Z A;  5EE3 A;  3UI3 A;  1J7B A;  1YQ3 B;  4OZC A;  2G1E A;  3AMZ A;  1XLO A;  1MHH E;  1VJK A;  2EEL A;  3BVM A;  4LLG M;  5D7G A;  1NYR A;  4RGT A;  5LNK 1;  1C78 A;  1WXQ A;  5HFY A;  3MHZ A;  1M4V A;  4MT5 A;  1JWB D;  1TYG B;  3B9J A;  3EUB 2;  1L4D B;  3VR9 B;  2AQ3 B;  4REZ A;  4WQM A;  2E6X A;  3FIL B;  4JE3 B;  2W3R A;  4NJC A;  2LJI A;  3LB8 C;  1EU4 A;  2B76 B;  1K52 A;  3AE7 B;  4HRO A;  1QKZ A;  3GP7 A;  1MPE A;  1V1O A;  1P7E A;  1F77 A;  1BML C;  1L5P A;  4IKG A;  4RGN A;  1C4P A;  5BMI A;  1OQR A;  5E6J A;  1FMA D;  3BVZ A;  3RFZ B;  3SFE B;  1VDV A;  2KWD A;  1L0Y B;  1RYJ A;  2Y3A A;  1QQR A;  3W2D A;  2JX5 A;  3W5U B;  4P6V F;  1A70 A;  1ESF A;  5FR3 A;  4WUR A;  3SR6 A;  1JQ4 A;  1TKY A;  2NTT A;  1FNW A;  2J53 A;  3HVZ A;  1D5X C;  2W55 A;  3IT4 B;  2PW9 A;  3H8H A;  4ZHO A;  4JWU C;  1FO4 A;  3VQI A;  5FKA C;  4N58 A;  4KX6 B;  1SF0 A;  4RF1 A;  1L6V A;  1C4C A;  1NYQ A;  1FD6 A;  2M0A A;  1JWM D;  1ZXI A;  1F2R C;  1JRP A;  3AV8 A;  1RWS A;  3AEG B;  2ZW0 A;  3NVZ A;  3ZGZ A;  2DYM A;  4A55 A;  1ACC A;  2IPK D;  2SAK A;  1IBX B;  1ZP0 B;  1L6U A;  1V97 A;  1FFV A;  1WRI A;  3C8Y A;  1JAL A;  5D3I B;  2WXG A;  1MI0 A;  1NVI D;  1XCT L;  1ZOY B;  4OVZ A;  2BB6 A;  1PFD A;  2AX5 A;  2WXQ A;  1B9R A;  4A9A A;  1I4H A;  4YTN B;  2WXJ A;  3AM9 A;  1ZUD 2;  3R2T A;  2I2Y A;  1R7S A;  4L1B A;  1JRO A;  2WXK A;  4WWM A;  3NVY A;  2MJE A;  1D6E C;  2JQR B;  2WQY B;  1D5M C;  1N60 A;  2WDV B;  2K9X A;  1JWA D;  3RPF C;  3P42 A;  4HKZ E;  4TQ0 A;  1SJH D;  1HQR D;  1TZO A;  3PO0 A;  2JSV X;  1C4A A;  3P4R B;  4ZRP A;  4EE2 A;  1GB4 A;  2INP E;  2BBC A;  1QOG A;  4RF0 A;  3URY A;  1PGB A;  3TEY A;  1FRD A;  2HDE A;  3ABV B;  3IAM 1;  4GLS C;  1ET9 A;  5HI1 A;  5BMH A;  1N61 A;  1SB3 C;  2ZW1 A;  1QT9 A;  1PGX A;  1YN3 A;  1JWU D;  4B0E A;  3J9C A;  4MM3 B;  4L2Y A;  2ONQ A;  4USA A;  4XDC A;  2J52 A;  2WP9 B;  3DWM A;  1EM7 A;  1I4G A;  3P4S B;  5C2T B;  1AW7 A;  1FEH A;  3DWG C;  1K53 A;  3NVW A;  4HRS A;  3AH7 A;  3Q8A A;  4CQN A;  2QIE B;  1KLU D;  1YQ4 B;  2NTS A;  2BW2 A;  2KN4 A;  1WWT A;  1VZ7 A;  3IAS 1;  1KFY B;  2ICI A;  2VZK B;  2V4I B;  3AE3 B;  3KQ4 A;  3BK2 A;  1XCQ L;  2MJD A;  1J7C A;  1D4B A;  1E10 A;  4WH4 A;  1F0Z A;  2LGI A;  3PZ8 A;  3BWU D;  4XDD A;  2K22 A;  1D5Z C;  5AUI A;  2PVO D;  3BII D;  2XN9 C;  5TSS A;  1E0Z A;  1TS2 A;  2N7J A;  1JML A;  4KKI A;  4A90 A;  2PVG C;  2QSD A;  1DYQ A;  3Q8E A;  3ZQ4 A;  1PGA A;  3U7Z A;  5T8I A;  2DLB A;  3SEB A;  1AWD A;  1L0V B;  1YJI A;  3Q8B A;  3AED B;  2Q5W D;  1FNV A;  4PT5 A;  3EA6 A;  2MEK A;  3MP9 A;  2WU5 B;  4ZRQ A;  2H89 B;  2JXT A;  1XXG A;  2DBY A;  3Q8C A;  4C7Y A;  2XNA C;  2M56 B;  2NMQ A;  2SEB D;  1V8C A;  3E9S A;  3T3N A;  2KAJ A;  2JWU A;  1UUP A;  1K51 A;  4MAC A;  4C56 C;  1VRA B;  3AEF B;  2AQ2 B;  2Y5C A;  3LXF A;  4DXG A;  5JXV A;  4TQ1 A;  1WSP A;  1K50 A;  1TS5 A;  1MVK A;  1UWX A;  1CJE A;  2BB5 A;  2GRI A;  3BYY B;  3BVG A;  1I7H A;  5BYS A;  2ON8 A;  2N9K A;  5G5G A;  5BYQ A;  2WDR B;  1QLB B;  1P7F A;  2M19 A;  2J4X A;  4D2K A;  1SE4 A;  2JYE A;  3OWE B;  4OHJ A;  4YXD B;  4A6Q A;  1SE3 A;  1TS4 A;  1I4Q A;  3B2F A;  1V1P A;  2I38 A;  1I4P A;  3AEA B;  3NUH B;  3U52 E;  4JWS C;  3BK1 A;  1VLB A;  1SXT A;  3AE2 B;  4YWG G;  1I4R A;  1DOI A;  4OZA A;  2DYO A;  2E3T A;  2WXI A;  3GB1 A;  4JPS A;  1BXT A;  1CQV A;  1TJE A;  1ET6 A;  1QF6 A;  1QOB A;  1N62 A;  1OQQ A;  3AEC B;  4HKQ A;  3P1M A;  1IGD A;  1NEK B;  2INN E;  2YEP B;  4HEA 1;  4LTU A;  4RH6 A;  3ZJT A;  1HZ5 A;  2KDM A;  2WLB A;  3V05 A;  4YTP B;  4Q2J A;  1KF6 B;  2PTL A;  3NS1 A;  2BT6 A;  2Z8L A;  3NVV A;  3BYT B;  1RFK A;  3W9C B;  1IUE A;  1SIJ A;  2KAC A;  2V0G A;  2GI9 A;  3VRA B;  4YTM B;  3EGR A;  2IGH A;  1XLP A;  4KKJ A;  1JCK B;  1DGJ A;  3Q69 A;  1TY2 A;  1PYW D;  1XLN A;  1CK1 A;  2QMT A;  4N6E B;  3AN1 A;  2X38 A;  2W54 A;  1E7P B;  4C80 A;  1PUT A;  2HTM E;  2JYT A;  1BUI C;  1KTK A;  1VZ6 A;  1ZXH A;  4L23 A;  5MPO A;  4ZOH C;  1ROE A;  3I57 A;  4RGM A;  2LEK A;  3ZJV A;  1FM0 D;  4RCO A;  3VR8 B;  4IOI E;  2DWQ A;  1EU3 A;  3CIR B;  3MFG A;  2K0P A;  1J7A A;  3W5V B;  4WIP A;  3WCQ A;  3P4Q B;  2K3U A;  2G9H D;  1E6E B;  3Q8F A;  4YSZ B;  1TKG A;  1C77 A;  3R8B A;  2PMV A;  1AN8 A;  3KWL A;  2LHD A;  2FE8 A;  3ZYY X;  1HEZ E;  2LFI A;  4RGO S;  5HG2 A;  3U2S C;  1HA5 A;  3MC0 B;  3ETR A;  2ACZ B;  1ZDV A;  3AE8 B;  4TMA B;  3V3X A;  5H8Y E;  3LYY A;  2Y5P A;  4XWT A;  1ZDX A;  1IGC A;  3FIL A;  4RFB A;  1KLG D;  1CZP A;  4N59 A;  4GDL B;  2BTE A;  1FXI A;  1ZE3 D;  4RNA A;  2MJ3 A;  3AEE B;  2WXP A;  3E56 A;  5H92 C;  4AS1 A;  2BS2 B;  2IDY A;  1XEE A;  1YNT E;  2IGG A;  1C9F A;  2W82 A;  1FCC C;  1T6B X;  2KQ4 X;  1Y56 A;  2WXO A;  2N0S B;  2BS4 B;  2V3P A;  3ZJU A;  4O1N A;  3IT6 B;  4M0W A;  2MH7 A;  1HZ6 A;  1SE2 A;  2WXL A;  4ARC A;  4H2A A;  1QIL A;  1DOY A;  1TS3 A;  1EWY C;  4NAW B;  1YJJ A;  2IGD A;  3KWV A;  1NEN B;  5EE1 A;  2WXN A;  3N9Y C;  3AE9 B;  2OHF A;  2L52 A;  5C3J B;  5AUK A;  3W1S A;  2OED A;  2JZP A;  4OW0 A;  2L1A A;  1B1Z A;  2LUM A;  4B0M A;  2RDG A;  3PZ7 A;  2IJ0 A;  2W3S A;  4ZHP A;  2RMM A;  3HVD A;  1XO3 A;  3L4P A;  3GS2 A;  2N9L A;  1TY0 A;  1PDX A;  2WXH A;  3O13 A;  2PKO A;  1IBX A;  2WU2 B;  2YEP F;  4P16 A;  2QJL A;  2V3N A;  3KLS X;  1KRH A;  2RDH A;  3HUI A;  5GXG B;  1OFF A;  2WXR A;  1UGJ A;  2GB1 A;  2WS3 B;  1FNU A;  2LHE A;  2RPV A;  1YMH E;  1I4X A;  2AQ1 B;  1VR9 A;  5HHD G;  5G5H A;  4GDK B;  4OZB A;  4FXC A;  4AQ7 A;  2VZK D;  4R3D A;  4HJG E;  1GPX A;  1L0X B;  4KGT A;  3P63 A;  4TSS A;  3AE4 B;  4KGR A;  4LK0 M;  4J3O D;  5BYR A;  2L32 A;  2L83 A;  4NZL B;  3AE6 B;  2QEJ C;  1L4Z B;  4JX1 C;  4DQO C;  1KH0 A;  2PIA A;  1WGK A;  3R2I A;  3MJ5 A;  4YSY B;  3FC4 A;  2EKI A;  1QOA A;  1SSN A;  2LMC A;  3TSS A;  4DXF A;  4MH8 A;  3CWI A;  2J42 A;  3BZD B;  2CJN A;  1AYF A;  4ITK A;  5D3D A;  1NI3 A;  4UDU C;  3TEZ A;  3B2G A;  1C79 A;  1V1P B;  2R61 A;  3TUO A;  2FBW B;  4YSX B;  4WAF A;  1TKE A;  1GAQ B;  2K5P A;  5BMG A;  4ZYS A;  2PLP A;  1LO5 D;  4IDI A;  4XE0 A;  2CU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...