5G5HA

Escherichia coli periplasmic aldehyde oxidase r440h mutant
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
173
structure length
173
Chain Sequence
AATPAPEIMPLTLKVNGKTEQLEVDTRTTLLDTLRENLHLIGTKKGCDHGQCGACTVLVNGRRLNACLTLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTSGQICSSVAVLKEIQDGIPSHVTVDLVSAPETTADEIRERMSGNICRCGAYANILAAIEDAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Escherichia Coli Periplasmic Aldehyde Oxidoreductase is an Exceptional Member of the Xanthine Oxidase Family of Molybdoenzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords PUTATIVE XANTHINE DEHYDROGENASE YAGT IRON-SULFUR-BINDING SUB
total genus 48
structure length 173
sequence length 173
ec nomenclature ec 1.2.99.6: Carboxylate reductase.
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 5g5hA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5g5hA01
1E10A 1B9RA 2N0SB 3VR8B 4YXDB 1WRIA 1SIJA 4WQMA 1GAQB 1XLPA 2WDQB 2MH7A 1VLBA 3AEAB 1JALA 2WP9B 2MJEA 1QT9A 1TYGB 5AUIA 3SFEB 4HRSA 1OQQA 3AE1B 2G1EA 1ZP0B 1E0ZA 3HVZA 5GXGB 1N61A 1FO4A 1WYGA 2CJNA 1NYQA 2WDVB 1F0ZA 2L83A 2AX5A 3ABVB 4USAA 2QIEB 3B2GA 1ROEA 2BT6A 1TKEA 2OHFA 4YSZB 1JRPA 4C7ZA 1CJEA 1OQRA 2B76B 1L0VB 3NRZA 1KRHA 1NEKB 2H89B 1N5WA 3P4RB 1ZXIA 3AN1A 2E3TA 3AE6B 4FXCA 5C3JB 1V97A 3AEEB 5G5HA 1DGJA 1E7PB 2Q5WD 3AB5A 2JQRB 2K22A 1QOBA 3AE3B 3WCQA 3L4PA 3LXFA 2CJOA 3AE5B 4JX1C 3AEFB 3B9JA 1E9MA 1NYRA 4P6VF 2BS3B 4JWSC 4WWMA 2EKIA 2BS4B 3DWMA 2W54A 3P4QB 2LEKA 1WXQA 3VRBB 1PUTA 1T3QA 2PVOD 3P4SB 1AYFA 3AEBB 2H88B 1RM6C 4LTUA 3VRAB 4N58A 1XLOA 2FBWB 3VR9B 1J7AA 3EUB2 4YT0B 2PKOA 1YQ4B 4HROA 1FRDA 1XO3A 1SF0A 1YJIA 2CU3A 3AEGB 1TJEA 1N5XA 4YTPB 1JW9D 1TKYA 2WDRB 5EE1A 1FMAD 3CWIA 1FM0D 5EE0A 2PIAA 3AE8B 1FFUA 2MJDA 3KWLA 5MPOA 5AUKA 4JWUC 2WLBA 3LB8C 1N60A 1NI3A 2PVGC 5H92C 1WGKA 3AE7B 3PO0A 1CZPA 1J7CA 3FAHA 1FXIA 3RPFC 3ZYYX 2KAJA 3NVZA 1A70A 3ETRA 1NENB 4YSXB 2WQYB 1ZUD2 2HTME 4ZHPA 1QF6A 1PFDA 1JWBD 3NVWA 1N63A 1L6VA 1FRRA 2W3RA 2W55A 3NVYA 2W3SA 4YTNB 1N62A 1L6UA 4N59A 2K9XA 4YTMB 2ACZB 3W5UB 1DOXA 1XLNA 3AMZA 3AM9A 1VDVA 3FC4A 1RWSA 3AE2B 3HUIA 4N6EB 1FFVA 1QOGA 1QLBB 3CIRB 3SR6A 2WU2B 1R7SA 1IUEA 1ZOYB 2L52A 2M56B 1PDXA 3NVVA 1L5PA 2JX5A 5C2TB 3NS1A 2WS3B 4US9A 4C80A 3SFDB 1GPXA 1YJJA 2M19A 2DBYA 3AEDB 1JROA 2Y5CA 3AE4B 4US8A 3AECB 1V8CA 4ITKA 2WU5B 1OFFA 1RYJA 4IDIA 1KF6B 1UWMA 1QOAA 2BS2B 3AV8A 3B2FA 3P63A 1WWTA 2K5PA 4KX6B 1FXAA 1DOYA 1NVID 1AWDA 4C7YA 1FIQA 1KFYB 1JWAD 3W9CB 1E6EB 1RFKA 2KMMA 2QJLA 4YSYB 3P4PB 1VJKA 5EE3A 3P1MA 5H8YE 1JQ4A 4ZOHC 1I7HA 2DWQA 1QOFA 1XLQA 3DWGC 3W5VB 5EE9A 1J7BA 1YQ3B 1TKGA 3BIID 4A9AA 4ZHOA 1DOIA 3HRDD 1EWYC 5G5GA 3AE9B 1SB3C 3AH7A 2MJ3A
chains in the Genus database with same CATH superfamily
4KGSA 4HKQA 1SKSA 4YXDB 2WYQA 4PL1A 5ALMA 5E6PA 1ZQHA 3K4GA 2G07A 5ALDA 3P42A 3BY4B 4ZRIA 2HD5B 2WB1F 3MC1A 4O5CA 3OTQA 4TUPA 3ISBA 2WF5A 3RJEA 1ZP0B 1WYGA 1V6EA 3S2AA 3G6YA 1KN5A 1ZYQA 4FBJB 3RF9A 4RQ7A 1HTOA 2ASDA 3HM3A 1ZQMA 4ELUA 1CI4A 4YXJA 3P4RB 1RRBA 3QU7A 3RT3B 5I4DA 3BQ1A 2EZYA 1XU4A 1L8LA 4O5EA 5HR7A 4F71A 2FNJB 2LYHA 2JPHA 4II2B 3TJPA 1T7PA 2L00B 3Q8MA 2CJOA 3B9JA 2KMCA 2MP2B 3LWLA 3E56A 1V85A 2W8LA 2KX3A 4AOFA 3O65B 1MI0A 9ICOA 2SEBD 2D10A 4LCDE 4TV3A 4MH8A 2BB5A 5D46A 1B43A 2C2RA 3T3NA 5BMHA 5KFHA 5AM3A 3BK2A 2KJ8A 1YQ4B 2PXIA 5DPTA 4EOYA 2IHNA 4ELVA 1Z19A 4LLGM 1ACCA 1QCKA 4IM0A 2IA6A 2H3IA 4Y2QA 1MHXA 9ICIA 4D2KA 2JZPA 2XGQA 1ZQCA 1OGWA 1BPYA 4HXDA 4E0DA 1FFUA 4KGRA 4ECYA 5HNKA 4ECTA 4IRDA 2A1JA 1OEYA 4M6WB 2DYMA 3CF6E 1WRDB 3RFZB 8ICCA 1XEEA 1SGHA 4ELTA 2KWDA 4F4WA 2PFQA 5DB6A 4M9JA 3W1YA 3ETRA 1WE6A 2LHTA 1KBUA 3HJEA 2F44A 2F77X 3NVWA 3EW9A 1ZQWA 4O0IA 3P2BA 3RH6A 4YR2A 3WK9A 4QIWC 3MFGA 3M7DA 4QZBA 1T5XD 2ACZB 3BQTA 2ZCCA 5KFFA 4YD1A 1HJPA 5IIOA 1FFVA 9ICRA 2N4FA 4P7IA 5F3XB 3CIRB 4CGZA 2Y5PA 4DQSA 1ZOYB 4UAYA 4M9LA 2M56B 3KD3A 2LYBA 3LVVA 4DHJB 4IQTA 5KFCA 1HE8A 2UYZB 3N7SC 1WJUA 3DPDA 1XWLA 1MFWA 1HA5A 4AS1A 1KQQA 4GDLA 3D6JA 2IOFA 5ALNA 4ITKA 2WU5B 4ZRQA 4EFOA 2YTUA 1D9DA 4PHPA 1ZQRA 2G08A 1WWTA 2K5PA 4MGYE 4WAFA 3QHTA 4P0PA 2LXAA 3SAGA 7ICIA 1NVID 4YD2A 4XX5A 5D4BA 2SAKA 3ZO5B 2QJLA 3ICXA 4F4ZA 3P4PB 3RUIB 9ICAA 1SV0A 2BGWA 4LNOA 1JQ4A 1WXVA 3CMMB 1A76A 5EWGA 1DK2A 2LASA 3ED5A 1YZ7A 2NBWB 4ZHOA 1I42A 2N1RA 2LVQA 4NWIA 2JY6A 1SJED 2CHZA 1KH0A 3VR8B 3NHEB 3AI5A 3SMVA 5HI1A 1SIJA 4TURA 3PT2B 1J8CA 2ZIVB 4MSMB 3MC0B 2JH1A 3PSFA 1WR1A 4ICAA 4I6NB 3VTUA 3NOBA 4W9GA 1X9XA 2WF9A 4RGTA 4Q8EA 9ICPA 2DNFA 4KLTA 5AKLA 2ZNVB 1WZ3A 5AIBA 4W9CA 2IOHA 4USAA 4DCCA 4YSZB 2J0KA 2IBKA 4KKJA 1IBXB 3ZDMC 4XDDA 8ICNA 2C9WB 3NRZA 2I1QA 1H4RA 2EAPA 3AE6B 3TEYA 5C3JB 4PT5A 2GOWA 5AKXA 1TTNA 1NK8A 2HOIA 2ZIUA 4J6IA 3LVWA 2MUTB 1MQ2A 3GB1A 3ZJTA 3SQIA 9ICKA 3LXFA 3Q3NC 2INDC 3URYA 3T5JA 4RQMA 2W04A 4XE0A 1E9MA 4QWCA 3V05A 4QAYA 3L10B 5AZGA 3VVWB 2KZRA 4YL8A 2OH2A 1ZQKA 3ZRCA 2VANA 1D4BA 3N7PD 2LJIA 2DGZA 4KSLC 2KHQA 2IO3B 5BYSA 4ANXA 5AM2A 1S0MA 4NLKA 2I1JA 1IP9A 4ECVA 4HWIB 2Y0SC 1TKYA 3KHHA 2O6VB 3EHVA 3N1YC 3RCZA 1X9SA 2X38A 9ICSA 2FCMA 3V6JA 4BJQA 4O3PA 2I2YA 5B66U 3OGUA 2C2DA 4I28A 4OZAA 2WWZA 4BVUC 3PHWB 5H92C 5TR5A 1TGZB 2DLBA 3N4MB 4EX7A 4YR0A 3X23A 3MP9A 4DFDA 2L3ZA 3I57A 3PPAA 4DLGA 3OSPA 4BKSD 2WX1A 1KTKA 4DXFA 2UU7A 2W3SA 3HILA 3W1SA 1ZQYA 4Y2VA 2JRHA 3T5HA 3TQ1A 1F1HA 3HP6A 4HJKA 1BPBA 3SYZA 1L7OA 2GBRA 4GDKB 3AUOA 3C5GA 1OQYA 2JEFA 4FLHA 1YJJA 4DL2A 1T0SC 3SV4A 3GV8B 2K8BB 1UELA 2F1HA 4BBNC 1E8XA 2L8JA 4EBDA 3HT3A 4IDIA 4O3QA 2BS2B 3V6HA 2MBHA 5HP4A 1X1MA 4Y2YA 3L16A 4F2SA 2Z0EB 5FR3A 3GFKB 4F92B 4E71A 1XSNA 5KT4A 3H8HA 1D3ZA 1K51A 4IS7A 3GZNB 2KE7A 3OJ3A 5JHBA 5LXIB 7ICUA 1UZXB 4FS2A 2NTSA 2KWVB 2HBMA 3HRDD 4WJOA 1O03A 5KT5A 1KFTA 2V4RA 3KZIU 3IG5A 1NK0A 5J8YC 1BPDA 1LM8B 2RPVA 1D8LA 1IGCA 4PYZA 2DFLA 4RUCA 2WDQB 4LNIA 5AZHA 3JPSA 4DS4A 1FCLA 2Y1JA 3KUZA 2FMQA 4G9BA 2WP9B 4Z6EA 3JSVB 1C3TA 3IFWB 2AJQA 3RJKA 2MBOA 4OZCA 1ZD4A 2WDTB 5AUIA 3KH0A 4RF1A 4YQWA 2FIDA 4PS8A 2ICIA 1ZQNA 1ZQZA 4ANWA 5DGAA 1WFYA 2LXCA 4NXZA 3WK4A 4TQRA 5KG0A 1YNTE 1VZ8A 4O1NA 3TEXA 2XNAC 3BVGA 4PGQA 1T6BX 2JQRB 5B5EU 1MN8A 2RDBC 3AE3B 3HIZA 1XO1A 3PZPA 3VH3B 4LVSA 1RDFA 1U4BA 1ZRMA 1BPEA 2JYTA 3JSVA 2JRZA 1L5UA 3HVDA 2L5YA 2REXA 2W43A 1PVQA 3H9DA 3P4QB 3VC8A 1K5OA 4KVGB 4NL9C 3PGEA 3ZJVA 5IIKA 3ZNHB 3DHHC 1NDDA 4W9IA 4TMAB 2MCNB 3UIOB 2HW3A 3MFIA 4YT0B 2PKOA 3NZUA 1J19A 5ALYA 5J0PA 1IBXA 1JW9D 2RMMA 5J2GA 4WJ3B 3IT4B 2WLBA 3UM9A 3LB8C 1EM7A 4R66A 4JV0A 4YMOA 1T3NA 4OJPA 1BNPA 4IL6U 4F5PA 2XY7A 1ZQGA 2G9HD 2F1JA 1ZUD2 3IAM1 3ONSA 1K53A 3V7KA 3Q6BA 3IM1A 4UB3A 4I2EA 2D3CA 3C29A 1T94A 2JYEA 4BOZB 1HIWA 4YTMB 4G0NB 4FA6A 2KDEB 5J2DA 2LVOA 1ED1A 1XLNA 2KKCA 4MJSA 3W1SC 3JVZX 2GBJA 1WYWB 3ZD8A 1GJZA 5BO4B 3ZQ4A 2CHWA 2DBYA 3NUHB 4AJWA 3DQVA 2YQEA 3AECB 3T3FA 4PZOA 1JI7A 2J6UA 2QB0A 2L05A 1KF6B 1QOAA 9ICXA 3VUXA 2H5XA 3ETLA 3A4RA 4M0AA 2G5IB 2OCEA 3H40A 2KMMA 4RZRA 2O6VA 4HKZE 3FYHA 1S1QB 2XN9C 8ICWA 4TQ0A 2PW9A 5J8YA 1EWYC 1D9FA 4OO1J 2YEPB 5KFZA 5J2HA 1SXDA 2YLMA 2PLPA 4HAIA 1UCVA 1QH9A 5DB9A 3PR5B 2MX2A 2K60A 3MGIA 4F5QA 3AEAB 4RUAA 4CQNA 2FCNA 3TFSA 1TYGB 3SFEB 2C7MB 3CP8A 3DBHI 3DDCB 3L0WB 4DSFA 7ICVA 3ABVB 2EELA 3C1ZA 2NPTA 4IOIE 1GB4A 3GP7A 3A0HU 3RN9C 2QMTA 4AYBC 2XICA 5CR0A 2TSSA 3M6KA 3QEBZ 4K3BA 3QUTA 5LLIA 2E3TA 3H7SA 3Q8QB 1PGAA 2W7OA 1JWUD 1V97A 5G5HA 4OJ6A 2Z8LA 1GC7A 3WKBA 5H2FU 2GBKA 4FULA 2ZTDA 5L1KA 4H2AA 2EH9A 1TK0A 3H7PA 4IWQA 1PUZA 5KFKA 2W11A 5KT7A 1SXEA 4RT3A 5KFLA 2B3AA 2NR2A 3I63C 2KTRA 2N9EB 5AI5A 4MF2A 1WX9A 3ISDA 2E8PA 1UPHA 4PK1A 2KOBA 3VHTC 1SE9A 3TSSA 1WGDA 4F3OA 3B0YA 4TKNA 1YZ6A 2K6DB 1WZ0A 4YTPB 4RPZA 4WWPA 5AM1A 5EE1A 4KLOA 1WXMA 4AP9A 4EBEA 1B1ZA 2J0JA 3Q3OC 3T79A 2CHXA 1ZE3D 2FLPA 4EZKA 2KP7A 4JWUC 1TY2A 1UWXA 2GO7A 2JWUA 3OJSA 1WGKA 2ZIVA 4LJOB 2ZPNA 2R8KA 4QWBA 5ALUA 1V5OA 9ICVA 4IC7B 1XCTL 1ZQAA 3IHQB 5DG9A 2IHMA 2PKEA 3ECIA 5J0OA 2NRXA 1YIWA 2INPE 4IM3A 5CHVC 2ZJAA 2ZTCA 3NVYA 1TFRA 5F9NA 1E8ZA 3K9PB 3QJZA 4ANVA 1GO3F 4DQPA 4AUQC 5HHDG 2ZW1A 1KLGD 2BW2A 5AK5A 4ED6A 2KJ6A 1L4ZB 2GLSA 4KX3A 1KM7A 3K9OB 1Q3UA 2ON8A 2KDIA 4ZYSA 5JUMA 4URKA 2LHDA 2D2QA 2AL6A 3JPQA 3QAQA 1OFFA 4G3XB 4BWMA 4BKGA 3N7RC 2QC8A 3NZSA 3L5KA 2I1KA 4KX6B 4P2HA 1JXEA 1U4AA 4NNJB 3RNBC 3A0BU 5FKAC 2BKFA 3U7ZA 2CPRA 1C77A 3LYYA 4CRXA 1NNLA 4I2AA 3ZIMA 4YSYB 2N9PC 2HHTA 4ZOHC 1TS2A 3V7LA 3O13A 4O3RA 5KFJA 2XVTA 1Z1BA 1R4NB 4CCHA 1D6EC 1PGBA 2XI9A 3RMKC 4JQWC 1J2NA 4BXOA 5E6OA 5KT2A 3QA8A 2XY6A 2BQUA 2ZNVC 3KWVA 4ACOA 3PW7A 1QT9A 1LKYB 4ED1A 5TSSA 7ICEA 3LYSA 1N2XA 3AE1B 2Y9UA 1QLNA 2LUMA 4LDTB 2G4SA 2QHOA 1FNUA 1SE4A 2ZXHA 4PS3A 3ZNGC 3RZWC 1JRPA 2JXJA 4UASA 1BPZA 1CJEA 4BOSC 3UXOA 5KFXA 3QARA 3GZFA 4LNKA 4PHEA 2LGSA 3RJJA 4KLEA 5CTRC 1DGJA 8ICYA 2KQ4X 4C0ZA 2M0NA 3ALRA 4NM2A 4GC7A 9ICMA 4WH4A 1L7YA 4CF3A 4UBBA 3V61A 3H7PB 4CE6A 4DL5A 4EEYA 2FMSA 4OD0A 4EZJA 3HW8A 4BKSA 1MA7A 2JUOA 4XYCA 4OCZA 5ALSA 1KSPA 2H88B 4QWAA 1C7YA 2Y1IA 4LTUA 2MRPA 1C78A 3Q8KA 5J0TA 3PRPB 2LM4A 4FN2A 5ALTA 1NK5A 2NBUA 4O3MA 2I38A 4RGOS 2ZPYA 3KYDD 2D07B 3TEZA 2KKPA 2IDYA 3M9MB 3DCGA 5KHQA 5ALOA 3C5FA 2R61A 3BZDB 3QUBA 1N60A 2KG5A 4J3OD 4DXAB 3PO0A 2C2EA 3I1YA 1K1QA 1C4PA 2LUEA 2KOXA 3Q3FA 3DVNU 3ZGZA 1BXTA 3C2KA 4WWOA 3A9KA 4J9QA 1HEKA 4GLXA 4I6PA 1X40A 2D8CA 4JE3B 1QILA 3MC9A 2W3RA 1EU3A 2GMIC 5D7GA 5AK6A 3ZTDA 2UVRA 2N7JA 4N59A 3L54A 2EAOA 1V9JA 3GE8C 5FP0A 4HCPB 4M02A 4I27A 2ODGA 3SR6A 2MQJA 2YMMA 1ZJNA 2I5HA 3NG0A 4GB9A 3UXPA 4NM1A 5KHOA 3DBLB 2K8CB 4YN4A 2KN7A 1RYUA 3MFHA 1L7PA 4RMAA 1F52A 2ASQA 2BPCA 1EWCA 1P1AA 3J9CA 2W8KA 1OTRB 2PE6B 1S5LU 8ICMA 4QIWF 1AWDA 2ZW0A 1CMXB 1TT5B 2KK0A 1KDHA 2WNMA 1UGJA 3PW2A 3UQAA 1I35A 2V4LA 3P1MA 3GU3A 3IVFA 5CWRA 1ZQTA 4EEKA 1KKXA 1I4QA 1TKGA 3BIID 4J9MA 1WIAA 1KLVA 1SB3C 4PS7A 2KZMA 2BCVA 3NTUA 1TS5A 3WU2U 4UB4A 4F4YA 3PSPA 1NK7A 1ZQDA 3PSIA 3FILA 4LDTD 2W9NA 1WRIA 2KC1A 4MFFA 4KLGA 4R65A 2W9CB 4I2CA 1UA1A 4BX9C 5KG4A 5CP2A 1ZQIA 2ZUBA 4B9UA 3KW5B 4I2BA 2OJWA 2R8GA 1TVAA 4NY0A 4UARA 4RH6A 4B0EA 2ES6A 3H0LB 1QKZA 3QNMA 4ECXA 4K4HA 4QW8A 1ZXIA 1X2IA 3SZ2A 1ZRNA 4WIPA 2BCSA 4EEWA 4C4VB 4J9LA 2CU1A 5J2EA 2D5GA 4KMOB 3NUQA 3QE9Y 2VKQA 2CR5A 3WALA 2KD1A 1TV9A 9ICQA 1V1PA 3BDPA 2M4NA 1S76D 3VXWA 2E8NA 2LRUA 1X9WA 3WAMA 4M8NA 1T3QA 5ALZA 3PVXA 2PVOD 1WM3A 1YX5B 2BYFA 1R4NI 4FJYA 3BZCA 1Y8RC 3DHGC 4M0WA 4ED3A 2HDOA 2DF4B 2W7PA 1FMAD 1UH6A 3PTFC 3U2SC 4RNOA 3OJUA 1L7NA 4GLSC 2R2OA 2HJ8A 1FNVA 1GOZA 4ICUA 2L32A 4PJ0U 4EENA 8ICHA 1Z00B 2KJ9A 1SJHD 4JMUA 3TMPB 2BVCA 1A70A 2G06A 2FAZA 1LXDA 4WWNA 3PZDA 5E6NA 2E5SA 4NLCA 4GXJA 3S6JA 2WQYB 3OHAA 1F77A 2JF5A 1JWBD 3CSTA 1HTQA 2XBBC 3PLVA 5KFNA 3I28A 3W2DA 5HHIA 5KFDA 3RJGA 4YMNA 3BS5A 4DBGA 3MR6A 1CRXA 1L8OA 4LNNA 2N1WA 3UXNA 3KLSX 4GIVA 3TL5A 1FD6A 1QOGA 2WXNA 4CYEA 1X42A 1ET6A 1OW5A 4YVZA 5J2KA 1L5PA 1DXSA 3Q3JA 4DL3A 4C4TA 1T0YA 1T8EA 3KUCB 5DDMA 2JMGA 2A4ZA 2D11A 8ICJA 1BT0A 2ZIWA 5IO9A 1YQBA 1YMHE 4EX6A 3RB4A 1IGDA 4ECQA 1WMHA 8ICSA 5ALRA 1RYRA 3WANA 4QZDA 4GC6A 1ZOLA 4MDKE 2KICA 1E6EB 3AU5A 2ZJ5A 4G3IA 1VJKA 2A5UA 2JVCA 1EUVB 5KFOA 2MEKA 4EYHB 4IG7B 1B4FA 5L83A 5J0QA 2NRVA 1V38A 2LMCA 3RNFC 2FE9A 2ISOA 2BYEA 2FI1A 3B1LX 2E6XA 5KFVA 1RXVA 1MG8A 1ZPSA 4ED2A 3QZ7A 4KLMA 3QUCA 4KSKC 3SD7A 4NLBA 3Q14C 1E8WA 2BF8B 1L3SA 2GBNA 2WXFA 1ECWA 4DSIA 2KFKB 2BTEA 1JRUA 1XLPA 5IILA 3TUOA 3HHMA 2CS4A 3G6XA 3C1YA 2PMZF 2J0MA 2GOLA 2HHVA 5DG7A 1E0ZA 3OSNA 2IMWP 1S0VA 3M9NB 4UQGA 1WXSA 1ROEA 3MR3A 4IQUA 4IR9A 3ZUNA 1UT8A 5KFRA 4MEMA 1WWUA 4FS1A 1MQ3A 1ISNA 1V9PA 5AM4A 2UVUA 4B9TA 4P1CC 2DZJA 4DHZE 5KFAA 4ECUA 4FBUA 3BZKA 2WX0A 4UAZA 4F93B 4KLDA 4RQ6A 2PJHA 2HJ1A 4B9NA 3GIKA 2KJ5A 4ZDVA 3QIJA 5KFMA 1S0NA 4IQWA 1H38A 1HXYD 4I2DA 4JWNA 5KFBA 3UGBB 4CDGA 4Q45A 2XGPA 1QZEA 4WJPA 2P35A 3HPOA 2H3FA 3MDAA 1U49A 1L3TA 1LB2B 1YJIA 4GMVA 4IWOA 2XK5B 4WJNA 3QU5A 2WFAA 3LJ3A 1NOMA 1Q8KA 4QZFA 4QZIA 1C4CA 2KZ3A 3U30A 3DDHA 3KWLA 2RDGA 5AKIA 5AUKA 2NS5A 1TAUA 3KUDB 1SWWA 2KWCA 3AE7B 4AP4C 2KVZA 5J0YA 4O3OA 4FJVB 2VA8A 4YR3A 1EO6A 5C5JA 2JH7A 2OJRA 3IHPC 1A77A 4GXKA 2VH1A 3R7RA 4U7CA 3V72A 4UW9A 4KLIA 1PFDA 3M95A 4EELA 4F8CB 1YOVB 2GWSA 1L6VA 3NJTA 1ZQ1C 2G0AA 4UB5A 3MHSD 3MTNB 3C23A 4TUQA 2F8LA 1XNSA 1U45A 4B0MA 5IIJA 2RQ5A 1LGRA 2H3QA 3KHLA 2M17A 4NJ7A 3RNEC 1J0GA 4C80A 3R9KA 4I29A 1JROA 1U9LA 3OHBA 4M0WB 3M63B 1G6JA 2AL3A 2WXPA 3EA6A 5D6JB 4B6WA 7ICSA 4BFRA 1D8BA 7ICKA 2BKRB 4DSJA 2ASJA 2WAQF 1PVRA 2WGSA 5EE3A 3D2SA 4YXMA 1LV5A 5H8YE 4NLGA 3I3TB 1V49A 3F2DA 1I7HA 2DZKA 5DBCA 3D2NA 4JWMA 4ZRPA 1UT5A 4OVZA 2AQ2B 2DKXA 1AW7A 3BJYA 1XSLA 4S17A 5IINA 1DK3A 5CA7A 2KMAA 4AQ7A 2KSOA 3PX6A 1DYQA 1VLBA 3Q8AA 2NTTA 4MEYA 9ICNA 1QTMA 2MSNA 3M1YA 3PO4A 2PI5A 2ONQA 4MACA 3PHXB 4A20A 1PGXA 2C60A 1N61A 2CJNA 3AULA 4NPNA 2WHEA 1Q0WB 2AX5A 4KLSA 2K25A 4JK1A 1ZETA 2BT6A 2QIEB 2KXJA 1URJA 4F50A 4C7ZA 1K1SA 3DOWA 1IYFA 1TS3A 1L2NA 4MGIE 2KLCA 3AXCA 2KO3A 1WGGA 4UB2A 5KFEA 5IKCM 2D3GA 1TIFA 1P98A 3BYTB 2JEGA 4EE2A 3L4PA 1UNSA 3NGDA 3IN5A 1JX4A 3MJ5A 2ZIXA 8ICOA 8ICBA 5IIIA 1YN4A 3PSEB 3SU8X 2L76A 1Y88A 3VDZA 2L0FA 2VJ4A 3EYZA 2W9MA 4RT2A 4PGYA 4RPXA 3LDAA 7ICRA 3I5JC 7ICTA 5DCNA 4R8UA 4L23A 3VAWA 2FBWB 3MR2A 4P4MA 2VJ5A 1XSPA 4HROA 2WXQA 1ZQVA 4J9OA 4OVVA 3WKDA 1N5XA 1M6YA 2GI9A 2KTFA 2ZJDA 2KD0A 2PIAA 4PYUA 2MJDA 4GN1A 5AKJA 4ECZA 5FK9C 2RPQA 1RQLA 3GDXA 2E8MA 1S3SG 2NBVB 5J18A 1F9JA 2B6GA 5DB8A 4JV1A 1UUPA 2BDUA 1JUDA 1S10A 3RRHA 3IG8A 3IAS1 2FPKA 5DQGA 3GILA 8ICEA 5D2MB 5DLGA 3MJWA 1XS9D 2LFIA 1NKEA 4JL9A 1HUOA 1L3VA 4OJ5A 4O5KA 2DZIA 2N1VA 1N62A 3OPXA 5DQHA 4M9HA 2ZXIA 3EZ5A 4KGTA 4M6WA 5KT6A 4RNNA 1ZD5A 1VRAB 2LPEA 2QDFA 2EZXA 3RNCC 3UQ0A 4IUMB 4MSQB 4MHVA 4PH5A 4M01A 1NJXA 1D5ZC 3BINA 3RAXA 5L1IA 2QKQA 2BZFA 2M19A 2CKHB 5G55A 4GDLB 4RCOA 1UWMA 3PV1A 2KSOB 3BQ7A 2AGQA 2M8SA 4XC2A 4UAWA 2BQ3A 4KDIC 1JIHA 1SBBB 3DBRI 1TS4A 3PZ8A 4FADA 5JHAA 2H3VA 1B0XA 4K7UA 3I9V1 4KZCA 4NJCA 2MSED 4Q44A 3SENA 5KG2A 4F7ZA 3V6EB 3PRZA 3PNCA 4MEXA 1KLNA 4FFDA 4TQ1A 2CXYA 2YB4A 2J6SA 1XLQA 4RM8A 5AI0A 1J7BA 1TBEA 3TAPA 4A8EA 2PPHA 2AQ0A 2FLLA 3NZ3A 2C7HA 4MH0E 2ZZPB 5G5GA 5C1ZA 2PFPA 1MSWD 3AH7A 5L1JA 3B0XA 2VA3A 3EC8A 1WH3A 2WXJA 4I6LB 4K4GA 2MW5A 4W9JA 1V1OA 4O3NA 2MH7A 3IRUA 3PMNA 1TK8A 3FM9A 5E79U 5CJ7A 2KWUB 5F9LA 1WX7A 2AYOB 2HI0A 3HVZA 4GXBA 5GXGB 1FO4A 1E7UA 1NYQA 1E7VA 4FZMA 1V80A 4II3B 1F0ZA 1ZD3A 1UA0A 1GNUA 1SZPA 4KN7A 4KLQA 5ALJA 3U4EG 5AI9A 4M47A 4R63A 3U26A 1U47A 4KKIA 4F5NA 2QSDA 4LK0M 1FXTB 2JEJA 3TANA 7ICJA 1UBQA 2RD0A 2WXOA 2KN5A 2DKZA 4KLHA 9ICUA 1QQRA 1M4VA 1WR6E 2BDPA 4BGDA 4DQRA 5JZEB 4ED0A 4A90A 4ECRA 3QQ8B 2WXKA 3DVGX 5AM0A 1SIFA 2OM6A 5CHFA 3A33B 1C20A 3MC8A 2VZKB 9ICJA 9ICHA 4LZDA 3TI0A 3L13A 3C8YA 1K52A 1Q5WB 1D5XC 1XO3A 3QCAA 3ZDTA 4QZAA 2KTQA 4C4SA 1V2YA 4ZRJA 4DSLA 2WDRB 3UI3A 2NRTA 1LVHA 3E9SA 3APFA 5J2AA 1VZ7A 1GB1A 4DF8A 1FXIA 2ZIXB 3UMBA 3SDLC 2KYWA 4HPLB 2QCZA 7ICFA 8ICKA 3QX7A 1DRGA 2W82A 3G6VA 2HBKA 5ALFA 1N63A 3R66C 4XGAB 3EFCA 4HDOA 3WK6A 2IGDA 3TIXA 2HBJA 5EOZA 4W9EA 2V4IB 2Z59B 1WF9A 2K9XA 2HSZA 3TCAA 2KC2A 1DOXA 4NQLB 1X66A 3VQIA 4F4KA 4EKUA 2XCPA 1J97A 4B9KA 5KFIA 1PDXA 5C2TB 3UF8A 3BQ0A 1XT9B 4DL7A 3ZDCA 1MVKA 5KAIU 5IIMA 3BK1A 4MT5A 5AIAA 3IDWA 5KG3A 1K50A 1V8CA 4KDLB 5AHXA 3R8BA 3HKZF 3TFRA 1RYJA 1WGHA 3B2FA 1KLUD 3KYCD 4Y2UA 1YX6B 2KTRB 3GE3C 5LXHA 4HPMB 4G50A 5KFGA 1Z4NA 5BMIA 3C2LA 3ZJUA 2DPJA 1KTQA 3TARA 1UF0A 2KJRA 2KDFB 2V9HA 3MR5A 1NBFC 7ICHA 1IG6A 1QSYA 4RGMA 4MM3A 1IM4A 2R18A 4LJPB 4KLUA 3BVMA 3TAQA 2AEHA 2MJ3A 2WTFA 3Q8BA 4KIKA 1E10A 2N0SB 3JPOA 4KX5A 1ZQFA 2QB1A 2FUHB 3SAHA 1QQ6A 5AI4A 5JH5C 2V3PA 2IO1B 1X6IA 1L3UA 2B0CA 2K8AA 4RNMA 4P4OA 2KK8A 4F8RA 2O6KA 5DLFA 1X6JA 2MBBB 5BYQA 3L17A 3BQ2A 2V9WA 2KX0A 4GOCA 5ALHA 2JV3A 3NRWA 7ICGA 4B95A 5D3IB 1N5WA 3QX1A 1NK9A 4MGKE 4P4PA 2NVUI 3DBHB 4DXGA 3B0AA 1ZQUA 4E3CA 4F5RA 3H8JA 2BS3B 2C22A 1N48A 9ICFA 3DWMA 5AKYA 2CN1A 2JXXA 2OEDA 4Y2JA 4NL9A 4YP3A 3IXSA 3ZI4A 4DWIA 3VRBB 1PUTA 2RRDA 2LMRA 1VZ6A 4XWTA 2P6RA 1XLOA 5T14A 1JWSD 4MJSB 1SV4A 5IAAC 3ZVVA 1C9FA 2V3NA 5J2IA 3Q3MC 4IW0A 3ALBA 3PS6A 3AE8B 1WUDA 4NAWA 3RH4A 4YCXA 2NMQA 4M9GA 8ICXA 3ZTCA 2ASLA 1MPEA 3EECA 3M9OB 1SZHA 1I4GA 1JMSA 5G2NA 1CZPA 1J7CA 2EMSA 1TZOA 2MBQA 2RR9A 4ARCA 4Q8FA 2C5LC 2KAJA 1NKCA 5JRTA 1IIPA 1NENB 2LM1A 3GV7B 3BYYB 2MA1A 4F1SA 1NI2A 4QWDA 1NZPA 2QB0B 3TADC 4BDPA 5DPWA 2PMVA 1CK1A 2HHQA 1UD7A 5AEKB 4UB6U 4F2RA 3ZDDA 1D5MC 1ZGUB 5KFWA 4N6EB 3AM9A 1RWSA 1WM2A 2J53A 3D32A 4DK5A 2FDRA 1F0MA 3GQCA 2FPMA 3PX4A 2F8KA 1QLBB 1R7SA 2IY1B 3MABA 1HZ5A 2L52A 2G3QB 2J4XA 2AQ4A 4K7WA 5KG7A 4BBNF 2WS3B 3SFDB 2PI4A 3UQBA 5LNK1 8ICQA 3AE4B 3H1UA 5HG2A 2FMPA 3HWTA 5J2BA 4FHJA 2BPSA 3ZNID 1AN8A 2C7NB 2KLGA 1P3QU 2R8IA 5CHGA 1ZQOA 1WCNA 4A3OA 2K1FA 2PE9A 4KLJA 3FKYA 2V3SA 1KFDA 3GOEA 3DWGC 3MBYA 5HMLA 2N9LA 2NPTB 4W9DA 4J9KA 4A3PA 1KOTA 2EKEC 5BYRA 4LJXA 1SL0A 2A19A 1UHUA 2G4DB 1RYSA 1WJ6A 2QEJC 4DOBA 5KG5A 1SKWA 2K8BA 5AM5A 4QWEA 4XUSA 3RR7A 2MJEA 1RXWA 8ICRA 1WGRA 3R3MA 3M62B 2XEWA 4KN4A 5KTQA 4BAXA 2G1EA 1V81A 1ZQJA 1T0RC 2HE7A 2N9KA 5TZVA 4UDUC 4GGQA 2BWFA 3RULA 5IN7A 1OQRA 3M8SA 1I4RA 4FZNA 2AU0A 3QXGA 4EZLA 1C1YB 4JPSA 3AEEB 3ORYA 1RPLA 2PFOA 1L0XB 1SKRA 2Q5WD 3AB5A 3WCQA 4GU2A 2GBMA 2M1MA 1NYRA 8ICLA 4C56C 1NK4A 4ZH4A 4U6PA 2OEHA 4I2GA 2RSUA 3C21A 2NCNA 4OW0A 3H8SA 4RU9A 8ICFA 3RB6A 2BYVE 1CEZA 4DFKA 2K3UA 2MA9B 2YB1A 3VRAB 2O2VA 1N56A 2LKYA 4RQ1A 1PVPA 4NY8A 4F91B 2ZJ8A 3H4BA 5C0YA 3AEGB 3HM6X 3QU9A 4F72A 1R4MB 3EGRA 3JPNA 2KFZA 5CHWA 3U52E 2K4EA 2LGYA 2KHVA 2KQ7A 5DDYA 4RQ4A 2KANA 2N7EA 2QILA 1B22A 1YJ1A 1ZDXA 3N1ZC 4M8MA 2LBOA 3QWZB 4DS5A 7ICNA 4B9MA 4DF4A 1LO5D 2F2AB 3EFUA 4RQ3A 2OOBB 2RDHA 2AGOA 4A55A 3RRGA 1ZQXA 1JXLA 2MLBA 2LI5A 4J9PA 3Q8PB 3PMLA 3N30A 3GV5B 2DX5B 2KT7A 3FC4A 1N6ZA 2ZVOA 2F1IA 4B9LA 1BNOA 4XRHA 1FPYA 2VRRB 4LNFA 3Q8FA 3SEBA 3UINB 3R2TA 4KIKB 5ALVA 1NJYA 1KRPA 2Q4TA 3H0RB 2E1FA 2Y5CA 3M3JA 2FE8A 4W9LA 3JPTA 2Y9TA 4JLCA 2WF7A 3UMCA 2LVPA 8ICTA 2JZZA 1S97A 4O9MA 2WXLA 3DBLI 4Y2SA 1UGMA 1MC8A 5C23A 3VTWA 1BMLC 4Y2XA 3SEIA 5AKHA 2AXTU 5ALPA 3F2CA 1AARA 4NJ6A 3VH4B 2AH5A 2R8JA 2XK5A 2VA2A 5J0XA 1KJTA 4FJZA 3W5VB 2XCAA 1YQ3B 4B9SA 4QW9A 3RI7C 9ICBA 1DOIA 3FILB 3ML9A 5AKEA 3A9JB 3C0RB 4JUZA 1TE2A 1TKDA 3PZ7A 3CRXA 1OXJA 3EPGA 3DBSA 1ZD2P 1WI0A 1Z00A 2N9XA 2AQ1B 3GZNI 2LWPA 1Z4OA 4IR1A 1J2MA 1ZKHA 2JGAA 2WDVB 2P6UA 4BWJA 8ICUA 1GC6A 2ZIWB 1PQSA 2L83A 4WQOB 3R7QA 2HTHA 4DLEA 4DOAA 3PX0A 2B76B 1MJDA 4I2HA 5KFQA 2J52A 2O2VB 4GDKA 1WG8A 1AQ6A 3RB0A 2XIDA 2K89A 2KVSA 2K6QA 5J0SA 3PY8A 4RQ8A 2PTLA 4NAWB 5J17A 1PK1A 3AEFB 2BR0A 3IV6A 1R4MI 2HVHA 2IGHA 4WWMA 3WKAA 2FIFA 1CQVA 2YMLA 2JT4B 4IM2A 4YFKA 4DFMA 3RBEA 1L0YB 2E1EA 3I76A 1WX8A 1YN3A 4P0PB 3P4SB 3AEBB 1RM6C 2WF8A 2D6FC 5L9XA 4DEZA 3ZW3A 3A9KB 3CW2C 2HHWA 1Z2MA 3N20C 2PFNA 3RFAA 1TJEA 5IOIA 1BUIC 3H0MB 2GB1A 1FM0D 3RJIA 1D8YA 4M00A 4TSSA 4UAUA 1ZQBA 4NJ8A 4CF5A 2IO0B 1SL1A 3RJFA 2MP2A 3ZYYX 7ICPA 1SGGA 3CSFA 2W03A 2D3AA 3KBBA 3SI8A 4RQ5A 1YD8U 4YSXB 3RNAC 4C8NA 4G11A 3UIPB 4ZHPA 3UMGA 1QF6A 3AU4A 2KMDA 3OWEB 2GLEA 1EU4A 4NZLB 4PGXA 3ISCA 4MM3B 3ZXVA 4NLZA 1Q1OA 1SWVA 1UQVA 5DGBA 2KJHB 3AL0B 3BVZA 2I9GA 3OAWA 4RQ2A 3AMZA 3AU2A 1WJ4A 4C00A 3Q8CA 4F5OA 3PREA 4Q43A 2JX5A 4DFJA 2KV2A 3NS1A 4DDID 5KFSA 4PHDA 2ZTEA 4DQIA 1JCKB 1SEBD 2MBEA 2N7DA 3A1QB 4J9RA 3NASA 2VZKD 2HBLA 3E0FA 1NJZA 2WF6A 5ALKA 1FXAA 1A0PA 5BPCA 2P66A 1DOYA 4DHZB 4EZ6A 4ARIA 2KACA 4P0QB 2X8XX 1JWAD 3W9CB 4Z6DA 2KIVA 5D94A 3VUYA 5DKWA 4OJOA 5ALWA 2YY6A 4HPPA 1PK1B 4ED8A 1KW4A 4Y2PA 3SAFA 3KOOA 1COKA 4IWPA 5J2CA 5JXVA 2K0PA 3H8MA 4F4XA 4DO9A 1JN3A 1UBIA 1V86A 5D3DA 2V0GA 1A5RA 1GAQB 1GUAB 3AEVA 1LKYA 4FHKA 1K8RB 2Q0ZX 1F5SA 5DB7A 4GXIA 4CF4A 1WSPA 4XDCA 1QQ5A 4QJFB 3E2EA 3EWAA 2CRXA 1PK3A 8ICGA 3Q2AC 3VTVA 3V62A 4N9F4 3B2GA 1Q46A 2LGXA 1E90A 3TACB 1L0VB 2M0XA 5KL1B 2JXTA 2AGPA 9ICCA 1NJWA 3AN1A 1F2RI 2G45B 4Z6CA 2ZCBA 3KFUF 2RDIA 4QNLA 4QZHA 1WXAA 4RM9A 4KMUA 5KL8B 2MUTA 5J2JA 3PR4A 3K1ZA 8ICVA 2ZUDA 4YMMA 2MHJA 2IJ0A 1SE3A 3B08A 3DVGY 2K39A 3ZKJC 1JWMD 2V4QA 3FDSA 1AROP 2W54A 3IT6B 1TY0A 3T8MA 2NYVA 4GFJA 4W9HA 1ZJMA 3LDZE 3K1RB 3TKAA 1RQNA 1E8YA 2HVIA 3EUB2 4C4RA 2HOFA 7ICMA 2J7QB 1TAMA 2KN4A 2OYYA 3E58A 2G09A 4Z6FA 2K8HA 1IXRA 2OXOA 2WB1C 1S9FA 2NRZA 3RYTA 4TQSA 3SHQA 4BUGA 2ZIUB 3A4SC 4HDQA 2WXIA 4QZ8A 3C28A 2W9AA 2BCRA 2YN4A 2LD9A 5KG1A 1TZ1A 3F53A 3QZ8A 3MGHA 2W9BA 3GIJA 3JPRA 4BXOB 5ALQA 3NVZA 5GTIU 2UVVA 2O6VD 3RAQA 5KG6A 2L7RA 5IA7A 3K75D 4HCNB 3C2MA 1ZW7A 2JZBB 4CNQA 4FBTA 3WAOA 1Q10A 2J42A 2LZ6A 4WAAA 4YTNB 2DENB 1V5TA 2BB6A 1L6UA 2KFNA 2L0TA 2DYBA 3HK0A 3W5UB 5CB1A 1VDVA 4P0QA 3HUIA 3PV8A 3IP4B 5AKKA 1JMLA 1ZQSA 1FCCC 5ALIA 4HVBA 3N28A 1PZNA 2IY0B 1LFDA 5KFUA 1HQRD 2ZG6A 2M0AA 1ENFA 3KVFB 3QUQA 3RB3A 2FCSA 3EPIA 2JWZA 1XF5L 1NZBA 3AV8A 1RZTA 2ISPA 2IBIB 8ICZA 2A1AA 2JZBA 5EWEA 2EDUA 1FIQA 8ICIA 5ALGA 3V7JA 5CX3A 4QZEA 3AU6A 7ICQA 2XY5A 1MG4A 1RFKA 2Y5BB 4L2YA 2D3DA 4C8MA 5L1MA 3Q8SB 4RQNA 4JIOU 1QOFA 1O08A 4MF8A 3RTVA 1ZQQA 3JYUA 3H7IA 2FUG1 2HDEA 4J9NA 2KNBA 5L95C 1SV0C 1Y56A 2K8CA 2QLTA 1B9RA 1IV8A 4ICVA 3O0FA 2WXMA 2OWOA 5CEHA 1JALA 2A3VA 1TAQA 5HKHA 3M8RA 2V1YA 2ZUCA 3JW0X 4MGZE 1FEZA 5AKZA 3Q8LA 4I2FA 3NY5A 3OJ4B 1L7MA 2HMXA 1I4XA 1KRHA 1OUQA 3Q69A 4K81A 2JSVX 3AQFA 1TK5A 4ECWA 2K22A 3GS2A 1QOBA 3N32A 3H4DA 4MFAA 3AE5B 2HCFA 4GIBA 4JX1C 1Z1VA 5GMVA 2DZMA 4K1RB 1XC9A 2BS4B 2VIXA 2KFJA 5KT3A 2LGIA 1I4PA 4E74A 3SD5A 4A8XC 2EQYA 1VCBA 1P7DA 1WXQA 3ML8A 1DGSA 4C8KA 2I6XA 3TEWA 3Q8EA 1AYFA 2AWTA 2YX8A 4DL6A 2HHXA 3WA0A 4N58A 1SSNA 4B6JA 4ZRKA 4YWGG 2NO5A 1FRDA 2CU3A 2DAFA 4DDGD 2Z0DB 4REZA 2FLNA 1XQQA 4BZAA 4DQQA 3CWIA 5EE0A 5DBAA 2ZEQA 4NQKE 4PPXA 3CNHA 4DOCA 1I4HA 2RHFA 4EUTA 5J0UA 5L1LA 2W9BB 3N97B 2IOFK 3WAPA 2EZZA 5TISU 3KKAC 3L08A 2YEPF 9ICEA 1FRRA 2LI6A 2W55A 5KAFU 3KQ4A 2BCUA 2ATLA 4K7SA 2YMQA 2D3BA 2H3ZA 2XO7A 2JU6X 2DUYA 1WE7A 3AE2B 4KLFA 1Z3EB 4EYIB 1GG3A 1ZQPA 4TUSA 2UVWA 1IUEA 1WJNA 2AQ3B 3ONNA 2WXHA 4DFPA 3NVVA 4ZYNA 5J29A 1QSLA 4IC9A 2NO4A 2Z7JA 5BMGA 2KEYA 2JRIB 2LGDA 3RJHA 3V60A 2WHIA 2Y0SF 2GRIA 3HKZC 1T0QC 2KQSA 3QYPA 3WKEA 2HHUA 1QQ7A 3KZXA 4IQVA 2J6TA 4C7YA 1RFAA 4RFBA 2DYOA 1A6SA 2C28A 1VR9A 2Y3AA 2BPFA 3KHGA 4NAMA 5D49A 2INNE 3IG3A 1C4AA 3NS8A 3F2BA 2FJ6A 4A9AA 5EWFA 1ESFA 8ICPA 1MHHE 3Q8RB 3BWUD 2LRWA 2RDJA 2IGGA 2ESEA 7ICOA 3PLUA 2WAQC 4PL2A 5A0LA 2QARB 4JV2A 7ICLA 9ICWA 4ECSA 4EZ9A 2M9NA 2LHEA 4HRSA 4RF0A 2JHDA 2GH1A 5ALLA 1QSSA 5HHHA 1NKBA 9ICGA 3T5LA 4KITB 1PYWD 3RZFA 1DOQA 2DL0A 1ZQEA 2YMPA 1TKEA 2EMTA 3VUWA 4S0RA 3H6NA 2E8OA 3ZDEA 5AICA 1NEKB 4R8UB 5J2FA 1U48A 3IBEA 2RGFA 3GIIA 1E7PB 3JPPA 4PHAA 4RQ0A 3F5AA 4R64A 2R2QA 3A9JA 3MHZA 4C8LA 4RPYA 1SL2A 3PRMB 2KIWA 4M04A 5EDSA 3PVLA 1VJ5A 3RD2A 3H8WA 4UAVA 4P6VF 3QK0A 2IZVB 3A1QA 5HMMA 5DPRA 3LK9A 1L6NA 5T8IA 2LEKA 1COOA 2BGFA 3RBDA 4FO6A 3ENEA 5K4LA 1XXGA 1HEZE 3VR9B 3LWMA 1P7EA 1J7AA 4ASWC 1KEJA 2HHSA 4DQOC 2MU2A 3MDCA 3KHRA 1SF0A 3T9LA 3V6CB 1RAXA 3QEAZ 1FNWA 1M94A 4L1BA 5AI8A 3PSTA 4WURA 4YG2A 1ZDVA 3N1XC 4C4VA 2WXRA 1LQBA 1NI3A 1EXNA 3V6KA 4IRCA 3FAHA 4M9NA 3RPFC 2EAMA 4HYKA 3ZDBA 5J0WA 3DEEA 4KTQA 5AI6A 2F3NA 3WKCA 3ZDAA 3C19A 2KZZA 5FR6A 2IO2B 2DPIA 4HJGE 3ZD9A 1WWVA 1KFSA 4FZLA 4HEA1 3N3KB 1OEYJ 4MELA 3WIMA 3R2IA 2AHOB 4KZ0A 1T4GA 4C8OA 3D2QA 4OJLA 3UPQA 2MRLA 4UBCA 3ZNZB 2INCC 3PW5A 2BBCA 1F44A 1VD2A 2IYDB 3HX0A 4US9A 2MAXA 1GPXA 3AEDB 2BQRA 2YVCA 4CO7A 2BQQA 4DWFA 4I2IA 1BPXA 3P63A 2KFKA 2DQNB 8ICAA 1CUKA 4K4IA 1S8OA 1ZXHA 3WK7A 1S0OA 2BCQA 4M2YA 2MWSB 5AKGA 3CYMA 3DVNV 3AQEA 4K3CA 4P16A 5KFTA 5EE9A 5HR6A 1HUZA 3N9YC 2WXGA 4FE3A 2L1AA 3AE9B 4ANUA 4QZCA 9ICLA 4ED7A 4W9KA 1F2RC 3ZXRA 1WCLA 4CHKA 4AWJA 3DHIC 1NK6A 4GSWA 4JGHB 1KL9A 3DBRB 1WMHB 4WQMA 2KDBA 1C79A 4O3SA 1SXTA 1E5WA 3X0WA 2QARA 1V1PB 3T5KA 2NRWA 4XZ4A 2JZ3B 4BKTA 1OQQA 1STEA 3WK5A 1RG6A 3PW0A 3V3XA 2VH2A 5AK4A 4UB1A 4IKGA 1ET9A 4TUUA 4W9FA 2OHFA 4JB3A 5GTHU 4DHJD 5KFPA 2BHNA 2K4HA 2F76X 4B9VA 2UWQA 4MFCA 2H89B 2KKVA 3RH5A 3QC8B 5DG8A 4FXCA 4IRKA 3DV9A 4J03A 5JTIA 5ALXA 1WY8A 3OLMD 1C76A 5DQIA 2R8HA 4KV2A 2JR5A 4UATA 4EBCA 5J0RA 2KNJA 2IPKD 5CRXA 4R3DA 2RLTA 3KTQA 4A6QA 4JWSC 2EKIA 1S77D 4Q2JA 4X57B 2K4IA 4Y2RA 4X5VA 2A1JB 2KDMA 4QZ9A 3M6ZA 3MGVA 2XC9A 1XD3B 1EF1A 3RNGC 5KFYA 1BGXT 5DBBA 5BOLA 1IPGA 3GIMA 4XWWA 1L4DB 3J81j 3RR8A 2ALZA 2FPLA 4I2JA 4HLEA 2B21A 3QU4A 4OVUA 3APCA 1BVSA 5MPOA 2BYTA 4QZGA 2PVGC 4OHJA 2W9CA 4LZGA 2LYAA 3UQ2A 4P1BC 2RP5A 2KVCA 3TADA 3ZLZA 5HFYA 9ICTA 5JU5A 2DHZA 3APDA 2HTME 4DL4A 3T3OA 4Y2TA 2BWES 4NV0A 3PW4A 2HOQA 5E6JA 1X9MA 5J2RA 2KVRA 2LJ5A 2FCQA 3WK8A 3THVA 2BPGA 3KKAA 5AZFA 5AK3A 3SV3A 2JEIA 1FEHA 3L3FX 2PMZC 3BS5B 1XO0A 2K4PA 4OZBA 1P0RA 2ZVNA 4UB8U 2WU2B 4J9SA 4AYBF 4ACFA 2G5HB 3F5EA 4DSEA 3VFKA 3PO5A 4DSKA 5KNIA 2KHWB 1WGYA 4US8A 4WJQA 2BKEA 1H8CA 4HK2A 1ZQLA 1RLFA 3ZRFA 5ALEA 4NLNA 1P9DU 4RNAA 5IP4D 2EANA 1KFYB 1Z5SB 4PZNA 4XQ8A 1SE2A 3VCBA 1HZ6A 3TBLD 1XCQL 2DAJA 4RGNA 3BS7A 1YT3A 2DWQA 3U8ZA 3OG5A 1YN5A 5BOMA 1Q3VA 3QU2A 4XA5A 1P7FA 2NV3A 4AJYB 3U7DA 4KLLA 5DPSA 1EF5A 2PEAA
chains in the Genus database with same CATH topology
4KGSA 4HKQA 2WXJA 5D3DA 4YXDB 2V0GA 1GAQB 1V1OA 2MH7A 3KWVA 1QT9A 3P42A 1WSPA 4XDCA 5TSSA 3AE1B 1ZP0B 3HVZA 5GXGB 1FO4A 1WYGA 2LUMA 1NYQA 1F0ZA 1FNUA 3B2GA 1SE4A 1JRPA 1CJEA 1L0VB 3U4EG 2JXTA 3P4RB 3AN1A 1F2RI 4KKIA 5I4DA 2QSDA 1DGJA 4LK0M 2KQ4X 4WH4A 2WXOA 2IJ0A 2CJOA 1SE3A 3B9JA 3E56A 1QQRA 1M4VA 1JWMD 2W54A 3IT6B 4A90A 1MI0A 1TY0A 2WXKA 2SEBD 4MH8A 2BB5A 2H88B 3T3NA 2VZKB 4LTUA 5BMHA 1C78A 3BK2A 3EUB2 3C8YA 1YQ4B 1K52A 1D5XC 1XO3A 2I38A 4LLGM 1ACCA 4RGOS 2KN4A 2WDRB 3UI3A 1MHXA 4D2KA 2JZPA 3E9SA 3TEZA 2IDYA 1FFUA 4KGRA 1VZ7A 2DYMA 2WXIA 2R61A 3BZDB 3RFZB 1N60A 4J3OD 1GB1A 1XEEA 3PO0A 1FXIA 2KWDA 1C4PA 3ZGZA 1BXTA 3NVZA 3ETRA 4JE3B 2W82A 3NVWA 1N63A 1QILA 2W3RA 1Q10A 2J42A 2IGDA 1EU3A 5D7GA 3MFGA 4YTNB 2BB6A 1T5XD 2N7JA 1L6UA 2V4IB 2K9XA 4N59A 2ACZB 3W5UB 1DOXA 1VDVA 3HUIA 3VQIA 1FFVA 3CIRB 3SR6A 2Y5PA 1JMLA 1ZOYB 2M56B 1FCCC 1PDXA 5C2TB 1HA5A 1MVKA 1HQRD 2M0AA 3BK1A 4MT5A 1ENFA 4AS1A 1K50A 1V8CA 4ITKA 2WU5B 4ZRQA 3R8BA 1RYJA 1EWCA 1XF5L 3AV8A 3B2FA 3J9CA 1WWTA 2K5PA 1KLUD 4WAFA 1NVID 5BMIA 1AWDA 2ZW0A 1FIQA 3ZJUA 2SAKA 1RFKA 2QJLA 2WNMA 1UGJA 3P4PB 4L2YA 3P1MA 1JQ4A 1QOFA 1I4QA 1TKGA 3BIID 4RGMA 4ZHOA 2FUG1 2HDEA 1SB3C 1Y56A 3BVMA 3Q8BA 2MJ3A 1SJED 1TS5A 1B9RA 1E10A 1KH0A 2N0SB 3FILA 3VR8B 2WXMA 1WRIA 5HI1A 1SIJA 3MC0B 1JALA 2V3PA 4RGTA 5BYQA 4RH6A 4USAA 4B0EA 4YSZB 1QKZA 4KKJA 1IBXB 5D3IB 4XDDA 3NRZA 1I4XA 1KRHA 1N5WA 1ZXIA 3AE6B 3Q69A 3TEYA 5C3JB 4PT5A 2JSVX 4WIPA 4DXGA 2K22A 3GB1A 1QOBA 3GS2A 3ZJTA 3LXFA 3URYA 3AE5B 2D5GA 4JX1C 4XE0A 1E9MA 2BS3B 3V05A 1V1PA 2BS4B 3DWMA 2LGIA 1I4PA 2OEDA 3IXSA 4A8XC 1D4BA 1WXQA 3VRBB 1PUTA 3TEWA 1T3QA 3Q8EA 2PVOD 1AYFA 1VZ6A 2LJIA 4XWTA 4N58A 1SSNA 1XLOA 5BYSA 1JWSD 4YWGG 1FRDA 4M0WA 2CU3A 4REZA 1C9FA 2V3NA 1TKYA 1FMAD 3CWIA 2X38A 5EE0A 3AE8B 3U2SC 2I2YA 2NMQA 4GLSC 1I4HA 4OZAA 1MPEA 1FNVA 1GOZA 5H92C 2DLBA 1I4GA 2L32A 1CZPA 1J7CA 1SJHD 1TZOA 4ARCA 2KAJA 1A70A 3MP9A 1NENB 2WQYB 3I57A 3BYYB 1F77A 1JWBD 2YEPF 1KTKA 4DXFA 1FRRA 2W55A 2PMVA 2W3SA 3W2DA 3KQ4A 1CK1A 3W1SA 1D5MC 2JU6X 4N6EB 3AM9A 3AE2B 3KLSX 1RWSA 2J53A 1FD6A 1QOGA 1QLBB 2WXNA 1R7SA 1IUEA 2AQ3B 2L52A 1HZ5A 2WXHA 1ET6A 3NVVA 2J4XA 1L5PA 4GDKB 2WS3B 3SFDB 1YJJA 5LNK1 5BMGA 3AE4B 5HG2A 4IDIA 1AN8A 2BS2B 2GRIA 1YMHE 1IGDA 5FR3A 4C7YA 4RFBA 2DYOA 1E6EB 3H8HA 1VR9A 2Y3AA 1VJKA 1K51A 4NAMA 2MEKA 2INNE 2LMCA 1C4AA 3DWGC 4A9AA 2E6XA 1ZPSA 2N9LA 2NTSA 3HRDD 1ESFA 5BYRA 1MHHE 2QEJC 3BWUD 2WXFA 2RPVA 2IGGA 1IGCA 2BTEA 1XLPA 2WDQB 3TUOA 1FCLA 2WP9B 2MJEA 4OZCA 5AUIA 2LHEA 4HRSA 4RF1A 1E0ZA 2G1EA 4RF0A 2ICIA 2N9KA 4UDUC 1PYWD 1ROEA 1TKEA 1OQRA 1I4RA 1NEKB 1YNTE 1VZ8A 4JPSA 3AEEB 4O1NA 1E7PB 1L0XB 2Q5WD 2XNAC 1T6BX 3AB5A 2JQRB 3BVGA 3MHZA 3AE3B 3TEXA 3WCQA 1NYRA 4P6VF 4C56C 2JYTA 3HVDA 4OW0A 3P4QB 5T8IA 2LEKA 3ZJVA 2K3UA 1HXYD 3VRAB 1XXGA 1HEZE 4TMAB 3VR9B 1P7EA 1J7AA 4YT0B 2PKOA 4DQOC 1SF0A 1YJIA 3AEGB 1IBXA 1FNWA 3EGRA 1JW9D 2RMMA 3U52E 4L1BA 4WURA 1C4CA 1ZDVA 3KWLA 2RDGA 3IT4B 5AUKA 2WLBA 2WXRA 3LB8C 1EM7A 1NI3A 2QILA 3AE7B 3FAHA 3RPFC 1ZDXA 2G9HD 1LO5D 1ZUD2 2RDHA 3IAM1 1PFDA 4A55A 1K53A 1L6VA 4HJGE 2JYEA 4HEA1 4YTMB 3R2IA 1XLNA 3FC4A 4B0MA 3SEBA 3Q8FA 2BBCA 3ZQ4A 3R2TA 4US9A 4C80A 1GPXA 2DBYA 3AEDB 3NUHB 1JROA 2Y5CA 3AECB 2WXPA 3EA6A 2FE8A 1KF6B 1QOAA 3P63A 2WXLA 1ZXHA 1BMLC 2KMMA 5EE3A 4HKZE 5H8YE 2XN9C 4P16A 1I7HA 4TQ0A 3W5VB 2PW9A 1YQ3B 4ZRPA 5EE9A 1DOIA 3FILB 2WXGA 2AQ2B 1EWYC 3N9YC 4OVZA 1AW7A 2L1AA 3AE9B 2YEPB 1F2RC 3PZ7A 4AQ7A 2PLPA 1DYQA 4WQMA 1C79A 1VLBA 1SXTA 3Q8AA 3AEAB 2AQ1B 2NTTA 1V1PB 4CQNA 1TYGB 3SFEB 4MACA 2ONQA 1OQQA 1STEA 1PGXA 1N61A 2CJNA 2WDVB 2L83A 3V3XA 2AX5A 3ABVB 4IKGA 2EELA 1GB4A 1ET9A 2QIEB 4IOIE 3GP7A 2BT6A 2OHFA 2QMTA 4C7ZA 2B76B 1TS3A 2TSSA 2H89B 2J52A 2E3TA 1PGAA 4FXCA 1JWUD 1V97A 5G5HA 2Z8LA 1C76A 3BYTB 2PTLA 4NAWB 4EE2A 3L4PA 1UNSA 2IPKD 3AEFB 3MJ5A 2IGHA 4R3DA 4H2AA 4A6QA 4JWSC 4WWMA 2EKIA 1YN4A 4Q2JA 1CQVA 2KDMA 1L0YB 1YN3A 3P4SB 3AEBB 1RM6C 4L23A 2FBWB 3TSSA 4XWWA 4HROA 2WXQA 1L4DB 1TJEA 1N5XA 4YTPB 1BUIC 2GB1A 5EE1A 1FM0D 1B1ZA 2GI9A 2PIAA 1ZE3D 2MJDA 5MPOA 5FK9C 2BYTA 4TSSA 4JWUC 1TY2A 1UWXA 2JWUA 2PVGC 1WGKA 4OHJA 3ZYYX 1UUPA 5HFYA 1XCTL 3IAS1 4YSXB 2HTME 4ZHPA 3T3OA 1QF6A 3OWEB 4NZLB 1EU4A 2LFIA 2INPE 4MM3B 5E6JA 3NVYA 1N62A 5HHDG 3BVZA 2ZW1A 4KGTA 3AMZA 1FEHA 1KLGD 2BW2A 1VRAB 4OZBA 3Q8CA 2WU2B 1L4ZB 1D5ZC 2JX5A 2ON8A 3NS1A 4ZYSA 2LHDA 2M19A 4GDLB 4US8A 1JCKB 1SEBD 4RCOA 1OFFA 2VZKD 1UWMA 4KX6B 4RNAA 1SBBB 3PZ8A 5FKAC 1FXAA 1TS4A 3U7ZA 1DOYA 1C77A 3LYYA 4NJCA 1KFYB 2KACA 3I9V1 1JWAD 1SE2A 3W9CB 4ARIA 1HZ6A 4YSYB 1XCQL 4RGNA 4TQ1A 4ZOHC 1TS2A 2DWQA 1XLQA 3O13A 1J7BA 1YN5A 1P7FA 3NZ3A 1D6EC 1PGBA 5G5GA 3AH7A 5JXVA 2K0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E10 A;  1B9R A;  2N0S B;  3VR8 B;  4YXD B;  1WRI A;  1SIJ A;  4WQM A;  1GAQ B;  1XLP A;  2WDQ B;  2MH7 A;  1VLB A;  3AEA B;  1JAL A;  2WP9 B;  2MJE A;  1QT9 A;  1TYG B;  5AUI A;  3SFE B;  4HRS A;  1OQQ A;  3AE1 B;  2G1E A;  1ZP0 B;  1E0Z A;  3HVZ A;  5GXG B;  1N61 A;  1FO4 A;  1WYG A;  2CJN A;  1NYQ A;  2WDV B;  1F0Z A;  2L83 A;  2AX5 A;  3ABV B;  4USA A;  2QIE B;  3B2G A;  1ROE A;  2BT6 A;  1TKE A;  2OHF A;  4YSZ B;  1JRP A;  4C7Z A;  1CJE A;  1OQR A;  2B76 B;  1L0V B;  3NRZ A;  1KRH A;  1NEK B;  2H89 B;  1N5W A;  3P4R B;  1ZXI A;  3AN1 A;  2E3T A;  3AE6 B;  4FXC A;  5C3J B;  1V97 A;  3AEE B;  5G5H A;  1DGJ A;  1E7P B;  2Q5W D;  3AB5 A;  2JQR B;  2K22 A;  1QOB A;  3AE3 B;  3WCQ A;  3L4P A;  3LXF A;  2CJO A;  3AE5 B;  4JX1 C;  3AEF B;  3B9J A;  1E9M A;  1NYR A;  4P6V F;  2BS3 B;  4JWS C;  4WWM A;  2EKI A;  2BS4 B;  3DWM A;  2W54 A;  3P4Q B;  2LEK A;  1WXQ A;  3VRB B;  1PUT A;  1T3Q A;  2PVO D;  3P4S B;  1AYF A;  3AEB B;  2H88 B;  1RM6 C;  4LTU A;  3VRA B;  4N58 A;  1XLO A;  2FBW B;  3VR9 B;  1J7A A;  3EUB 2;  4YT0 B;  2PKO A;  1YQ4 B;  4HRO A;  1FRD A;  1XO3 A;  1SF0 A;  1YJI A;  2CU3 A;  3AEG B;  1TJE A;  1N5X A;  4YTP B;  1JW9 D;  1TKY A;  2WDR B;  5EE1 A;  1FMA D;  3CWI A;  1FM0 D;  5EE0 A;  2PIA A;  3AE8 B;  1FFU A;  2MJD A;  3KWL A;  5MPO A;  5AUK A;  4JWU C;  2WLB A;  3LB8 C;  1N60 A;  1NI3 A;  2PVG C;  5H92 C;  1WGK A;  3AE7 B;  3PO0 A;  1CZP A;  1J7C A;  3FAH A;  1FXI A;  3RPF C;  3ZYY X;  2KAJ A;  3NVZ A;  1A70 A;  3ETR A;  1NEN B;  4YSX B;  2WQY B;  1ZUD 2;  2HTM E;  4ZHP A;  1QF6 A;  1PFD A;  1JWB D;  3NVW A;  1N63 A;  1L6V A;  1FRR A;  2W3R A;  2W55 A;  3NVY A;  2W3S A;  4YTN B;  1N62 A;  1L6U A;  4N59 A;  2K9X A;  4YTM B;  2ACZ B;  3W5U B;  1DOX A;  1XLN A;  3AMZ A;  3AM9 A;  1VDV A;  3FC4 A;  1RWS A;  3AE2 B;  3HUI A;  4N6E B;  1FFV A;  1QOG A;  1QLB B;  3CIR B;  3SR6 A;  2WU2 B;  1R7S A;  1IUE A;  1ZOY B;  2L52 A;  2M56 B;  1PDX A;  3NVV A;  1L5P A;  2JX5 A;  5C2T B;  3NS1 A;  2WS3 B;  4US9 A;  4C80 A;  3SFD B;  1GPX A;  1YJJ A;  2M19 A;  2DBY A;  3AED B;  1JRO A;  2Y5C A;  3AE4 B;  4US8 A;  3AEC B;  1V8C A;  4ITK A;  2WU5 B;  1OFF A;  1RYJ A;  4IDI A;  1KF6 B;  1UWM A;  1QOA A;  2BS2 B;  3AV8 A;  3B2F A;  3P63 A;  1WWT A;  2K5P A;  4KX6 B;  1FXA A;  1DOY A;  1NVI D;  1AWD A;  4C7Y A;  1FIQ A;  1KFY B;  1JWA D;  3W9C B;  1E6E B;  1RFK A;  2KMM A;  2QJL A;  4YSY B;  3P4P B;  1VJK A;  5EE3 A;  3P1M A;  5H8Y E;  1JQ4 A;  4ZOH C;  1I7H A;  2DWQ A;  1QOF A;  1XLQ A;  3DWG C;  3W5V B;  5EE9 A;  1J7B A;  1YQ3 B;  1TKG A;  3BII D;  4A9A A;  4ZHO A;  1DOI A;  3HRD D;  1EWY C;  5G5G A;  3AE9 B;  1SB3 C;  3AH7 A;  2MJ3 A; 
#chains in the Genus database with same CATH topology
 4KGS A;  4HKQ A;  1SKS A;  4YXD B;  2WYQ A;  4PL1 A;  5ALM A;  5E6P A;  1ZQH A;  3K4G A;  2G07 A;  5ALD A;  3P42 A;  3BY4 B;  4ZRI A;  2HD5 B;  2WB1 F;  3MC1 A;  4O5C A;  3OTQ A;  4TUP A;  3ISB A;  2WF5 A;  3RJE A;  1ZP0 B;  1WYG A;  1V6E A;  3S2A A;  3G6Y A;  1KN5 A;  1ZYQ A;  4FBJ B;  3RF9 A;  4RQ7 A;  1HTO A;  2ASD A;  3HM3 A;  1ZQM A;  4ELU A;  1CI4 A;  4YXJ A;  3P4R B;  1RRB A;  3QU7 A;  3RT3 B;  5I4D A;  3BQ1 A;  2EZY A;  1XU4 A;  1L8L A;  4O5E A;  5HR7 A;  4F71 A;  2FNJ B;  2LYH A;  2JPH A;  4II2 B;  3TJP A;  1T7P A;  2L00 B;  3Q8M A;  2CJO A;  3B9J A;  2KMC A;  2MP2 B;  3LWL A;  3E56 A;  1V85 A;  2W8L A;  2KX3 A;  4AOF A;  3O65 B;  1MI0 A;  9ICO A;  2SEB D;  2D10 A;  4LCD E;  4TV3 A;  4MH8 A;  2BB5 A;  5D46 A;  1B43 A;  2C2R A;  3T3N A;  5BMH A;  5KFH A;  5AM3 A;  3BK2 A;  2KJ8 A;  1YQ4 B;  2PXI A;  5DPT A;  4EOY A;  2IHN A;  4ELV A;  1Z19 A;  4LLG M;  1ACC A;  1QCK A;  4IM0 A;  2IA6 A;  2H3I A;  4Y2Q A;  1MHX A;  9ICI A;  4D2K A;  2JZP A;  2XGQ A;  1ZQC A;  1OGW A;  1BPY A;  4HXD A;  4E0D A;  1FFU A;  4KGR A;  4ECY A;  5HNK A;  4ECT A;  4IRD A;  2A1J A;  1OEY A;  4M6W B;  2DYM A;  3CF6 E;  1WRD B;  3RFZ B;  8ICC A;  1XEE A;  1SGH A;  4ELT A;  2KWD A;  4F4W A;  2PFQ A;  5DB6 A;  4M9J A;  3W1Y A;  3ETR A;  1WE6 A;  2LHT A;  1KBU A;  3HJE A;  2F44 A;  2F77 X;  3NVW A;  3EW9 A;  1ZQW A;  4O0I A;  3P2B A;  3RH6 A;  4YR2 A;  3WK9 A;  4QIW C;  3MFG A;  3M7D A;  4QZB A;  1T5X D;  2ACZ B;  3BQT A;  2ZCC A;  5KFF A;  4YD1 A;  1HJP A;  5IIO A;  1FFV A;  9ICR A;  2N4F A;  4P7I A;  5F3X B;  3CIR B;  4CGZ A;  2Y5P A;  4DQS A;  1ZOY B;  4UAY A;  4M9L A;  2M56 B;  3KD3 A;  2LYB A;  3LVV A;  4DHJ B;  4IQT A;  5KFC A;  1HE8 A;  2UYZ B;  3N7S C;  1WJU A;  3DPD A;  1XWL A;  1MFW A;  1HA5 A;  4AS1 A;  1KQQ A;  4GDL A;  3D6J A;  2IOF A;  5ALN A;  4ITK A;  2WU5 B;  4ZRQ A;  4EFO A;  2YTU A;  1D9D A;  4PHP A;  1ZQR A;  2G08 A;  1WWT A;  2K5P A;  4MGY E;  4WAF A;  3QHT A;  4P0P A;  2LXA A;  3SAG A;  7ICI A;  1NVI D;  4YD2 A;  4XX5 A;  5D4B A;  2SAK A;  3ZO5 B;  2QJL A;  3ICX A;  4F4Z A;  3P4P B;  3RUI B;  9ICA A;  1SV0 A;  2BGW A;  4LNO A;  1JQ4 A;  1WXV A;  3CMM B;  1A76 A;  5EWG A;  1DK2 A;  2LAS A;  3ED5 A;  1YZ7 A;  2NBW B;  4ZHO A;  1I42 A;  2N1R A;  2LVQ A;  4NWI A;  2JY6 A;  1SJE D;  2CHZ A;  1KH0 A;  3VR8 B;  3NHE B;  3AI5 A;  3SMV A;  5HI1 A;  1SIJ A;  4TUR A;  3PT2 B;  1J8C A;  2ZIV B;  4MSM B;  3MC0 B;  2JH1 A;  3PSF A;  1WR1 A;  4ICA A;  4I6N B;  3VTU A;  3NOB A;  4W9G A;  1X9X A;  2WF9 A;  4RGT A;  4Q8E A;  9ICP A;  2DNF A;  4KLT A;  5AKL A;  2ZNV B;  1WZ3 A;  5AIB A;  4W9C A;  2IOH A;  4USA A;  4DCC A;  4YSZ B;  2J0K A;  2IBK A;  4KKJ A;  1IBX B;  3ZDM C;  4XDD A;  8ICN A;  2C9W B;  3NRZ A;  2I1Q A;  1H4R A;  2EAP A;  3AE6 B;  3TEY A;  5C3J B;  4PT5 A;  2GOW A;  5AKX A;  1TTN A;  1NK8 A;  2HOI A;  2ZIU A;  4J6I A;  3LVW A;  2MUT B;  1MQ2 A;  3GB1 A;  3ZJT A;  3SQI A;  9ICK A;  3LXF A;  3Q3N C;  2IND C;  3URY A;  3T5J A;  4RQM A;  2W04 A;  4XE0 A;  1E9M A;  4QWC A;  3V05 A;  4QAY A;  3L10 B;  5AZG A;  3VVW B;  2KZR A;  4YL8 A;  2OH2 A;  1ZQK A;  3ZRC A;  2VAN A;  1D4B A;  3N7P D;  2LJI A;  2DGZ A;  4KSL C;  2KHQ A;  2IO3 B;  5BYS A;  4ANX A;  5AM2 A;  1S0M A;  4NLK A;  2I1J A;  1IP9 A;  4ECV A;  4HWI B;  2Y0S C;  1TKY A;  3KHH A;  2O6V B;  3EHV A;  3N1Y C;  3RCZ A;  1X9S A;  2X38 A;  9ICS A;  2FCM A;  3V6J A;  4BJQ A;  4O3P A;  2I2Y A;  5B66 U;  3OGU A;  2C2D A;  4I28 A;  4OZA A;  2WWZ A;  4BVU C;  3PHW B;  5H92 C;  5TR5 A;  1TGZ B;  2DLB A;  3N4M B;  4EX7 A;  4YR0 A;  3X23 A;  3MP9 A;  4DFD A;  2L3Z A;  3I57 A;  3PPA A;  4DLG A;  3OSP A;  4BKS D;  2WX1 A;  1KTK A;  4DXF A;  2UU7 A;  2W3S A;  3HIL A;  3W1S A;  1ZQY A;  4Y2V A;  2JRH A;  3T5H A;  3TQ1 A;  1F1H A;  3HP6 A;  4HJK A;  1BPB A;  3SYZ A;  1L7O A;  2GBR A;  4GDK B;  3AUO A;  3C5G A;  1OQY A;  2JEF A;  4FLH A;  1YJJ A;  4DL2 A;  1T0S C;  3SV4 A;  3GV8 B;  2K8B B;  1UEL A;  2F1H A;  4BBN C;  1E8X A;  2L8J A;  4EBD A;  3HT3 A;  4IDI A;  4O3Q A;  2BS2 B;  3V6H A;  2MBH A;  5HP4 A;  1X1M A;  4Y2Y A;  3L16 A;  4F2S A;  2Z0E B;  5FR3 A;  3GFK B;  4F92 B;  4E71 A;  1XSN A;  5KT4 A;  3H8H A;  1D3Z A;  1K51 A;  4IS7 A;  3GZN B;  2KE7 A;  3OJ3 A;  5JHB A;  5LXI B;  7ICU A;  1UZX B;  4FS2 A;  2NTS A;  2KWV B;  2HBM A;  3HRD D;  4WJO A;  1O03 A;  5KT5 A;  1KFT A;  2V4R A;  3KZI U;  3IG5 A;  1NK0 A;  5J8Y C;  1BPD A;  1LM8 B;  2RPV A;  1D8L A;  1IGC A;  4PYZ A;  2DFL A;  4RUC A;  2WDQ B;  4LNI A;  5AZH A;  3JPS A;  4DS4 A;  1FCL A;  2Y1J A;  3KUZ A;  2FMQ A;  4G9B A;  2WP9 B;  4Z6E A;  3JSV B;  1C3T A;  3IFW B;  2AJQ A;  3RJK A;  2MBO A;  4OZC A;  1ZD4 A;  2WDT B;  5AUI A;  3KH0 A;  4RF1 A;  4YQW A;  2FID A;  4PS8 A;  2ICI A;  1ZQN A;  1ZQZ A;  4ANW A;  5DGA A;  1WFY A;  2LXC A;  4NXZ A;  3WK4 A;  4TQR A;  5KG0 A;  1YNT E;  1VZ8 A;  4O1N A;  3TEX A;  2XNA C;  3BVG A;  4PGQ A;  1T6B X;  2JQR B;  5B5E U;  1MN8 A;  2RDB C;  3AE3 B;  3HIZ A;  1XO1 A;  3PZP A;  3VH3 B;  4LVS A;  1RDF A;  1U4B A;  1ZRM A;  1BPE A;  2JYT A;  3JSV A;  2JRZ A;  1L5U A;  3HVD A;  2L5Y A;  2REX A;  2W43 A;  1PVQ A;  3H9D A;  3P4Q B;  3VC8 A;  1K5O A;  4KVG B;  4NL9 C;  3PGE A;  3ZJV A;  5IIK A;  3ZNH B;  3DHH C;  1NDD A;  4W9I A;  4TMA B;  2MCN B;  3UIO B;  2HW3 A;  3MFI A;  4YT0 B;  2PKO A;  3NZU A;  1J19 A;  5ALY A;  5J0P A;  1IBX A;  1JW9 D;  2RMM A;  5J2G A;  4WJ3 B;  3IT4 B;  2WLB A;  3UM9 A;  3LB8 C;  1EM7 A;  4R66 A;  4JV0 A;  4YMO A;  1T3N A;  4OJP A;  1BNP A;  4IL6 U;  4F5P A;  2XY7 A;  1ZQG A;  2G9H D;  2F1J A;  1ZUD 2;  3IAM 1;  3ONS A;  1K53 A;  3V7K A;  3Q6B A;  3IM1 A;  4UB3 A;  4I2E A;  2D3C A;  3C29 A;  1T94 A;  2JYE A;  4BOZ B;  1HIW A;  4YTM B;  4G0N B;  4FA6 A;  2KDE B;  5J2D A;  2LVO A;  1ED1 A;  1XLN A;  2KKC A;  4MJS A;  3W1S C;  3JVZ X;  2GBJ A;  1WYW B;  3ZD8 A;  1GJZ A;  5BO4 B;  3ZQ4 A;  2CHW A;  2DBY A;  3NUH B;  4AJW A;  3DQV A;  2YQE A;  3AEC B;  3T3F A;  4PZO A;  1JI7 A;  2J6U A;  2QB0 A;  2L05 A;  1KF6 B;  1QOA A;  9ICX A;  3VUX A;  2H5X A;  3ETL A;  3A4R A;  4M0A A;  2G5I B;  2OCE A;  3H40 A;  2KMM A;  4RZR A;  2O6V A;  4HKZ E;  3FYH A;  1S1Q B;  2XN9 C;  8ICW A;  4TQ0 A;  2PW9 A;  5J8Y A;  1EWY C;  1D9F A;  4OO1 J;  2YEP B;  5KFZ A;  5J2H A;  1SXD A;  2YLM A;  2PLP A;  4HAI A;  1UCV A;  1QH9 A;  5DB9 A;  3PR5 B;  2MX2 A;  2K60 A;  3MGI A;  4F5Q A;  3AEA B;  4RUA A;  4CQN A;  2FCN A;  3TFS A;  1TYG B;  3SFE B;  2C7M B;  3CP8 A;  3DBH I;  3DDC B;  3L0W B;  4DSF A;  7ICV A;  3ABV B;  2EEL A;  3C1Z A;  2NPT A;  4IOI E;  1GB4 A;  3GP7 A;  3A0H U;  3RN9 C;  2QMT A;  4AYB C;  2XIC A;  5CR0 A;  2TSS A;  3M6K A;  3QEB Z;  4K3B A;  3QUT A;  5LLI A;  2E3T A;  3H7S A;  3Q8Q B;  1PGA A;  2W7O A;  1JWU D;  1V97 A;  5G5H A;  4OJ6 A;  2Z8L A;  1GC7 A;  3WKB A;  5H2F U;  2GBK A;  4FUL A;  2ZTD A;  5L1K A;  4H2A A;  2EH9 A;  1TK0 A;  3H7P A;  4IWQ A;  1PUZ A;  5KFK A;  2W11 A;  5KT7 A;  1SXE A;  4RT3 A;  5KFL A;  2B3A A;  2NR2 A;  3I63 C;  2KTR A;  2N9E B;  5AI5 A;  4MF2 A;  1WX9 A;  3ISD A;  2E8P A;  1UPH A;  4PK1 A;  2KOB A;  3VHT C;  1SE9 A;  3TSS A;  1WGD A;  4F3O A;  3B0Y A;  4TKN A;  1YZ6 A;  2K6D B;  1WZ0 A;  4YTP B;  4RPZ A;  4WWP A;  5AM1 A;  5EE1 A;  4KLO A;  1WXM A;  4AP9 A;  4EBE A;  1B1Z A;  2J0J A;  3Q3O C;  3T79 A;  2CHX A;  1ZE3 D;  2FLP A;  4EZK A;  2KP7 A;  4JWU C;  1TY2 A;  1UWX A;  2GO7 A;  2JWU A;  3OJS A;  1WGK A;  2ZIV A;  4LJO B;  2ZPN A;  2R8K A;  4QWB A;  5ALU A;  1V5O A;  9ICV A;  4IC7 B;  1XCT L;  1ZQA A;  3IHQ B;  5DG9 A;  2IHM A;  2PKE A;  3ECI A;  5J0O A;  2NRX A;  1YIW A;  2INP E;  4IM3 A;  5CHV C;  2ZJA A;  2ZTC A;  3NVY A;  1TFR A;  5F9N A;  1E8Z A;  3K9P B;  3QJZ A;  4ANV A;  1GO3 F;  4DQP A;  4AUQ C;  5HHD G;  2ZW1 A;  1KLG D;  2BW2 A;  5AK5 A;  4ED6 A;  2KJ6 A;  1L4Z B;  2GLS A;  4KX3 A;  1KM7 A;  3K9O B;  1Q3U A;  2ON8 A;  2KDI A;  4ZYS A;  5JUM A;  4URK A;  2LHD A;  2D2Q A;  2AL6 A;  3JPQ A;  3QAQ A;  1OFF A;  4G3X B;  4BWM A;  4BKG A;  3N7R C;  2QC8 A;  3NZS A;  3L5K A;  2I1K A;  4KX6 B;  4P2H A;  1JXE A;  1U4A A;  4NNJ B;  3RNB C;  3A0B U;  5FKA C;  2BKF A;  3U7Z A;  2CPR A;  1C77 A;  3LYY A;  4CRX A;  1NNL A;  4I2A A;  3ZIM A;  4YSY B;  2N9P C;  2HHT A;  4ZOH C;  1TS2 A;  3V7L A;  3O13 A;  4O3R A;  5KFJ A;  2XVT A;  1Z1B A;  1R4N B;  4CCH A;  1D6E C;  1PGB A;  2XI9 A;  3RMK C;  4JQW C;  1J2N A;  4BXO A;  5E6O A;  5KT2 A;  3QA8 A;  2XY6 A;  2BQU A;  2ZNV C;  3KWV A;  4ACO A;  3PW7 A;  1QT9 A;  1LKY B;  4ED1 A;  5TSS A;  7ICE A;  3LYS A;  1N2X A;  3AE1 B;  2Y9U A;  1QLN A;  2LUM A;  4LDT B;  2G4S A;  2QHO A;  1FNU A;  1SE4 A;  2ZXH A;  4PS3 A;  3ZNG C;  3RZW C;  1JRP A;  2JXJ A;  4UAS A;  1BPZ A;  1CJE A;  4BOS C;  3UXO A;  5KFX A;  3QAR A;  3GZF A;  4LNK A;  4PHE A;  2LGS A;  3RJJ A;  4KLE A;  5CTR C;  1DGJ A;  8ICY A;  2KQ4 X;  4C0Z A;  2M0N A;  3ALR A;  4NM2 A;  4GC7 A;  9ICM A;  4WH4 A;  1L7Y A;  4CF3 A;  4UBB A;  3V61 A;  3H7P B;  4CE6 A;  4DL5 A;  4EEY A;  2FMS A;  4OD0 A;  4EZJ A;  3HW8 A;  4BKS A;  1MA7 A;  2JUO A;  4XYC A;  4OCZ A;  5ALS A;  1KSP A;  2H88 B;  4QWA A;  1C7Y A;  2Y1I A;  4LTU A;  2MRP A;  1C78 A;  3Q8K A;  5J0T A;  3PRP B;  2LM4 A;  4FN2 A;  5ALT A;  1NK5 A;  2NBU A;  4O3M A;  2I38 A;  4RGO S;  2ZPY A;  3KYD D;  2D07 B;  3TEZ A;  2KKP A;  2IDY A;  3M9M B;  3DCG A;  5KHQ A;  5ALO A;  3C5F A;  2R61 A;  3BZD B;  3QUB A;  1N60 A;  2KG5 A;  4J3O D;  4DXA B;  3PO0 A;  2C2E A;  3I1Y A;  1K1Q A;  1C4P A;  2LUE A;  2KOX A;  3Q3F A;  3DVN U;  3ZGZ A;  1BXT A;  3C2K A;  4WWO A;  3A9K A;  4J9Q A;  1HEK A;  4GLX A;  4I6P A;  1X40 A;  2D8C A;  4JE3 B;  1QIL A;  3MC9 A;  2W3R A;  1EU3 A;  2GMI C;  5D7G A;  5AK6 A;  3ZTD A;  2UVR A;  2N7J A;  4N59 A;  3L54 A;  2EAO A;  1V9J A;  3GE8 C;  5FP0 A;  4HCP B;  4M02 A;  4I27 A;  2ODG A;  3SR6 A;  2MQJ A;  2YMM A;  1ZJN A;  2I5H A;  3NG0 A;  4GB9 A;  3UXP A;  4NM1 A;  5KHO A;  3DBL B;  2K8C B;  4YN4 A;  2KN7 A;  1RYU A;  3MFH A;  1L7P A;  4RMA A;  1F52 A;  2ASQ A;  2BPC A;  1EWC A;  1P1A A;  3J9C A;  2W8K A;  1OTR B;  2PE6 B;  1S5L U;  8ICM A;  4QIW F;  1AWD A;  2ZW0 A;  1CMX B;  1TT5 B;  2KK0 A;  1KDH A;  2WNM A;  1UGJ A;  3PW2 A;  3UQA A;  1I35 A;  2V4L A;  3P1M A;  3GU3 A;  3IVF A;  5CWR A;  1ZQT A;  4EEK A;  1KKX A;  1I4Q A;  1TKG A;  3BII D;  4J9M A;  1WIA A;  1KLV A;  1SB3 C;  4PS7 A;  2KZM A;  2BCV A;  3NTU A;  1TS5 A;  3WU2 U;  4UB4 A;  4F4Y A;  3PSP A;  1NK7 A;  1ZQD A;  3PSI A;  3FIL A;  4LDT D;  2W9N A;  1WRI A;  2KC1 A;  4MFF A;  4KLG A;  4R65 A;  2W9C B;  4I2C A;  1UA1 A;  4BX9 C;  5KG4 A;  5CP2 A;  1ZQI A;  2ZUB A;  4B9U A;  3KW5 B;  4I2B A;  2OJW A;  2R8G A;  1TVA A;  4NY0 A;  4UAR A;  4RH6 A;  4B0E A;  2ES6 A;  3H0L B;  1QKZ A;  3QNM A;  4ECX A;  4K4H A;  4QW8 A;  1ZXI A;  1X2I A;  3SZ2 A;  1ZRN A;  4WIP A;  2BCS A;  4EEW A;  4C4V B;  4J9L A;  2CU1 A;  5J2E A;  2D5G A;  4KMO B;  3NUQ A;  3QE9 Y;  2VKQ A;  2CR5 A;  3WAL A;  2KD1 A;  1TV9 A;  9ICQ A;  1V1P A;  3BDP A;  2M4N A;  1S76 D;  3VXW A;  2E8N A;  2LRU A;  1X9W A;  3WAM A;  4M8N A;  1T3Q A;  5ALZ A;  3PVX A;  2PVO D;  1WM3 A;  1YX5 B;  2BYF A;  1R4N I;  4FJY A;  3BZC A;  1Y8R C;  3DHG C;  4M0W A;  4ED3 A;  2HDO A;  2DF4 B;  2W7P A;  1FMA D;  1UH6 A;  3PTF C;  3U2S C;  4RNO A;  3OJU A;  1L7N A;  4GLS C;  2R2O A;  2HJ8 A;  1FNV A;  1GOZ A;  4ICU A;  2L32 A;  4PJ0 U;  4EEN A;  8ICH A;  1Z00 B;  2KJ9 A;  1SJH D;  4JMU A;  3TMP B;  2BVC A;  1A70 A;  2G06 A;  2FAZ A;  1LXD A;  4WWN A;  3PZD A;  5E6N A;  2E5S A;  4NLC A;  4GXJ A;  3S6J A;  2WQY B;  3OHA A;  1F77 A;  2JF5 A;  1JWB D;  3CST A;  1HTQ A;  2XBB C;  3PLV A;  5KFN A;  3I28 A;  3W2D A;  5HHI A;  5KFD A;  3RJG A;  4YMN A;  3BS5 A;  4DBG A;  3MR6 A;  1CRX A;  1L8O A;  4LNN A;  2N1W A;  3UXN A;  3KLS X;  4GIV A;  3TL5 A;  1FD6 A;  1QOG A;  2WXN A;  4CYE A;  1X42 A;  1ET6 A;  1OW5 A;  4YVZ A;  5J2K A;  1L5P A;  1DXS A;  3Q3J A;  4DL3 A;  4C4T A;  1T0Y A;  1T8E A;  3KUC B;  5DDM A;  2JMG A;  2A4Z A;  2D11 A;  8ICJ A;  1BT0 A;  2ZIW A;  5IO9 A;  1YQB A;  1YMH E;  4EX6 A;  3RB4 A;  1IGD A;  4ECQ A;  1WMH A;  8ICS A;  5ALR A;  1RYR A;  3WAN A;  4QZD A;  4GC6 A;  1ZOL A;  4MDK E;  2KIC A;  1E6E B;  3AU5 A;  2ZJ5 A;  4G3I A;  1VJK A;  2A5U A;  2JVC A;  1EUV B;  5KFO A;  2MEK A;  4EYH B;  4IG7 B;  1B4F A;  5L83 A;  5J0Q A;  2NRV A;  1V38 A;  2LMC A;  3RNF C;  2FE9 A;  2ISO A;  2BYE A;  2FI1 A;  3B1L X;  2E6X A;  5KFV A;  1RXV A;  1MG8 A;  1ZPS A;  4ED2 A;  3QZ7 A;  4KLM A;  3QUC A;  4KSK C;  3SD7 A;  4NLB A;  3Q14 C;  1E8W A;  2BF8 B;  1L3S A;  2GBN A;  2WXF A;  1ECW A;  4DSI A;  2KFK B;  2BTE A;  1JRU A;  1XLP A;  5IIL A;  3TUO A;  3HHM A;  2CS4 A;  3G6X A;  3C1Y A;  2PMZ F;  2J0M A;  2GOL A;  2HHV A;  5DG7 A;  1E0Z A;  3OSN A;  2IMW P;  1S0V A;  3M9N B;  4UQG A;  1WXS A;  1ROE A;  3MR3 A;  4IQU A;  4IR9 A;  3ZUN A;  1UT8 A;  5KFR A;  4MEM A;  1WWU A;  4FS1 A;  1MQ3 A;  1ISN A;  1V9P A;  5AM4 A;  2UVU A;  4B9T A;  4P1C C;  2DZJ A;  4DHZ E;  5KFA A;  4ECU A;  4FBU A;  3BZK A;  2WX0 A;  4UAZ A;  4F93 B;  4KLD A;  4RQ6 A;  2PJH A;  2HJ1 A;  4B9N A;  3GIK A;  2KJ5 A;  4ZDV A;  3QIJ A;  5KFM A;  1S0N A;  4IQW A;  1H38 A;  1HXY D;  4I2D A;  4JWN A;  5KFB A;  3UGB B;  4CDG A;  4Q45 A;  2XGP A;  1QZE A;  4WJP A;  2P35 A;  3HPO A;  2H3F A;  3MDA A;  1U49 A;  1L3T A;  1LB2 B;  1YJI A;  4GMV A;  4IWO A;  2XK5 B;  4WJN A;  3QU5 A;  2WFA A;  3LJ3 A;  1NOM A;  1Q8K A;  4QZF A;  4QZI A;  1C4C A;  2KZ3 A;  3U30 A;  3DDH A;  3KWL A;  2RDG A;  5AKI A;  5AUK A;  2NS5 A;  1TAU A;  3KUD B;  1SWW A;  2KWC A;  3AE7 B;  4AP4 C;  2KVZ A;  5J0Y A;  4O3O A;  4FJV B;  2VA8 A;  4YR3 A;  1EO6 A;  5C5J A;  2JH7 A;  2OJR A;  3IHP C;  1A77 A;  4GXK A;  2VH1 A;  3R7R A;  4U7C A;  3V72 A;  4UW9 A;  4KLI A;  1PFD A;  3M95 A;  4EEL A;  4F8C B;  1YOV B;  2GWS A;  1L6V A;  3NJT A;  1ZQ1 C;  2G0A A;  4UB5 A;  3MHS D;  3MTN B;  3C23 A;  4TUQ A;  2F8L A;  1XNS A;  1U45 A;  4B0M A;  5IIJ A;  2RQ5 A;  1LGR A;  2H3Q A;  3KHL A;  2M17 A;  4NJ7 A;  3RNE C;  1J0G A;  4C80 A;  3R9K A;  4I29 A;  1JRO A;  1U9L A;  3OHB A;  4M0W B;  3M63 B;  1G6J A;  2AL3 A;  2WXP A;  3EA6 A;  5D6J B;  4B6W A;  7ICS A;  4BFR A;  1D8B A;  7ICK A;  2BKR B;  4DSJ A;  2ASJ A;  2WAQ F;  1PVR A;  2WGS A;  5EE3 A;  3D2S A;  4YXM A;  1LV5 A;  5H8Y E;  4NLG A;  3I3T B;  1V49 A;  3F2D A;  1I7H A;  2DZK A;  5DBC A;  3D2N A;  4JWM A;  4ZRP A;  1UT5 A;  4OVZ A;  2AQ2 B;  2DKX A;  1AW7 A;  3BJY A;  1XSL A;  4S17 A;  5IIN A;  1DK3 A;  5CA7 A;  2KMA A;  4AQ7 A;  2KSO A;  3PX6 A;  1DYQ A;  1VLB A;  3Q8A A;  2NTT A;  4MEY A;  9ICN A;  1QTM A;  2MSN A;  3M1Y A;  3PO4 A;  2PI5 A;  2ONQ A;  4MAC A;  3PHX B;  4A20 A;  1PGX A;  2C60 A;  1N61 A;  2CJN A;  3AUL A;  4NPN A;  2WHE A;  1Q0W B;  2AX5 A;  4KLS A;  2K25 A;  4JK1 A;  1ZET A;  2BT6 A;  2QIE B;  2KXJ A;  1URJ A;  4F50 A;  4C7Z A;  1K1S A;  3DOW A;  1IYF A;  1TS3 A;  1L2N A;  4MGI E;  2KLC A;  3AXC A;  2KO3 A;  1WGG A;  4UB2 A;  5KFE A;  5IKC M;  2D3G A;  1TIF A;  1P98 A;  3BYT B;  2JEG A;  4EE2 A;  3L4P A;  1UNS A;  3NGD A;  3IN5 A;  1JX4 A;  3MJ5 A;  2ZIX A;  8ICO A;  8ICB A;  5III A;  1YN4 A;  3PSE B;  3SU8 X;  2L76 A;  1Y88 A;  3VDZ A;  2L0F A;  2VJ4 A;  3EYZ A;  2W9M A;  4RT2 A;  4PGY A;  4RPX A;  3LDA A;  7ICR A;  3I5J C;  7ICT A;  5DCN A;  4R8U A;  4L23 A;  3VAW A;  2FBW B;  3MR2 A;  4P4M A;  2VJ5 A;  1XSP A;  4HRO A;  2WXQ A;  1ZQV A;  4J9O A;  4OVV A;  3WKD A;  1N5X A;  1M6Y A;  2GI9 A;  2KTF A;  2ZJD A;  2KD0 A;  2PIA A;  4PYU A;  2MJD A;  4GN1 A;  5AKJ A;  4ECZ A;  5FK9 C;  2RPQ A;  1RQL A;  3GDX A;  2E8M A;  1S3S G;  2NBV B;  5J18 A;  1F9J A;  2B6G A;  5DB8 A;  4JV1 A;  1UUP A;  2BDU A;  1JUD A;  1S10 A;  3RRH A;  3IG8 A;  3IAS 1;  2FPK A;  5DQG A;  3GIL A;  8ICE A;  5D2M B;  5DLG A;  3MJW A;  1XS9 D;  2LFI A;  1NKE A;  4JL9 A;  1HUO A;  1L3V A;  4OJ5 A;  4O5K A;  2DZI A;  2N1V A;  1N62 A;  3OPX A;  5DQH A;  4M9H A;  2ZXI A;  3EZ5 A;  4KGT A;  4M6W A;  5KT6 A;  4RNN A;  1ZD5 A;  1VRA B;  2LPE A;  2QDF A;  2EZX A;  3RNC C;  3UQ0 A;  4IUM B;  4MSQ B;  4MHV A;  4PH5 A;  4M01 A;  1NJX A;  1D5Z C;  3BIN A;  3RAX A;  5L1I A;  2QKQ A;  2BZF A;  2M19 A;  2CKH B;  5G55 A;  4GDL B;  4RCO A;  1UWM A;  3PV1 A;  2KSO B;  3BQ7 A;  2AGQ A;  2M8S A;  4XC2 A;  4UAW A;  2BQ3 A;  4KDI C;  1JIH A;  1SBB B;  3DBR I;  1TS4 A;  3PZ8 A;  4FAD A;  5JHA A;  2H3V A;  1B0X A;  4K7U A;  3I9V 1;  4KZC A;  4NJC A;  2MSE D;  4Q44 A;  3SEN A;  5KG2 A;  4F7Z A;  3V6E B;  3PRZ A;  3PNC A;  4MEX A;  1KLN A;  4FFD A;  4TQ1 A;  2CXY A;  2YB4 A;  2J6S A;  1XLQ A;  4RM8 A;  5AI0 A;  1J7B A;  1TBE A;  3TAP A;  4A8E A;  2PPH A;  2AQ0 A;  2FLL A;  3NZ3 A;  2C7H A;  4MH0 E;  2ZZP B;  5G5G A;  5C1Z A;  2PFP A;  1MSW D;  3AH7 A;  5L1J A;  3B0X A;  2VA3 A;  3EC8 A;  1WH3 A;  2WXJ A;  4I6L B;  4K4G A;  2MW5 A;  4W9J A;  1V1O A;  4O3N A;  2MH7 A;  3IRU A;  3PMN A;  1TK8 A;  3FM9 A;  5E79 U;  5CJ7 A;  2KWU B;  5F9L A;  1WX7 A;  2AYO B;  2HI0 A;  3HVZ A;  4GXB A;  5GXG B;  1FO4 A;  1E7U A;  1NYQ A;  1E7V A;  4FZM A;  1V80 A;  4II3 B;  1F0Z A;  1ZD3 A;  1UA0 A;  1GNU A;  1SZP A;  4KN7 A;  4KLQ A;  5ALJ A;  3U4E G;  5AI9 A;  4M47 A;  4R63 A;  3U26 A;  1U47 A;  4KKI A;  4F5N A;  2QSD A;  4LK0 M;  1FXT B;  2JEJ A;  3TAN A;  7ICJ A;  1UBQ A;  2RD0 A;  2WXO A;  2KN5 A;  2DKZ A;  4KLH A;  9ICU A;  1QQR A;  1M4V A;  1WR6 E;  2BDP A;  4BGD A;  4DQR A;  5JZE B;  4ED0 A;  4A90 A;  4ECR A;  3QQ8 B;  2WXK A;  3DVG X;  5AM0 A;  1SIF A;  2OM6 A;  5CHF A;  3A33 B;  1C20 A;  3MC8 A;  2VZK B;  9ICJ A;  9ICH A;  4LZD A;  3TI0 A;  3L13 A;  3C8Y A;  1K52 A;  1Q5W B;  1D5X C;  1XO3 A;  3QCA A;  3ZDT A;  4QZA A;  2KTQ A;  4C4S A;  1V2Y A;  4ZRJ A;  4DSL A;  2WDR B;  3UI3 A;  2NRT A;  1LVH A;  3E9S A;  3APF A;  5J2A A;  1VZ7 A;  1GB1 A;  4DF8 A;  1FXI A;  2ZIX B;  3UMB A;  3SDL C;  2KYW A;  4HPL B;  2QCZ A;  7ICF A;  8ICK A;  3QX7 A;  1DRG A;  2W82 A;  3G6V A;  2HBK A;  5ALF A;  1N63 A;  3R66 C;  4XGA B;  3EFC A;  4HDO A;  3WK6 A;  2IGD A;  3TIX A;  2HBJ A;  5EOZ A;  4W9E A;  2V4I B;  2Z59 B;  1WF9 A;  2K9X A;  2HSZ A;  3TCA A;  2KC2 A;  1DOX A;  4NQL B;  1X66 A;  3VQI A;  4F4K A;  4EKU A;  2XCP A;  1J97 A;  4B9K A;  5KFI A;  1PDX A;  5C2T B;  3UF8 A;  3BQ0 A;  1XT9 B;  4DL7 A;  3ZDC A;  1MVK A;  5KAI U;  5IIM A;  3BK1 A;  4MT5 A;  5AIA A;  3IDW A;  5KG3 A;  1K50 A;  1V8C A;  4KDL B;  5AHX A;  3R8B A;  3HKZ F;  3TFR A;  1RYJ A;  1WGH A;  3B2F A;  1KLU D;  3KYC D;  4Y2U A;  1YX6 B;  2KTR B;  3GE3 C;  5LXH A;  4HPM B;  4G50 A;  5KFG A;  1Z4N A;  5BMI A;  3C2L A;  3ZJU A;  2DPJ A;  1KTQ A;  3TAR A;  1UF0 A;  2KJR A;  2KDF B;  2V9H A;  3MR5 A;  1NBF C;  7ICH A;  1IG6 A;  1QSY A;  4RGM A;  4MM3 A;  1IM4 A;  2R18 A;  4LJP B;  4KLU A;  3BVM A;  3TAQ A;  2AEH A;  2MJ3 A;  2WTF A;  3Q8B A;  4KIK A;  1E10 A;  2N0S B;  3JPO A;  4KX5 A;  1ZQF A;  2QB1 A;  2FUH B;  3SAH A;  1QQ6 A;  5AI4 A;  5JH5 C;  2V3P A;  2IO1 B;  1X6I A;  1L3U A;  2B0C A;  2K8A A;  4RNM A;  4P4O A;  2KK8 A;  4F8R A;  2O6K A;  5DLF A;  1X6J A;  2MBB B;  5BYQ A;  3L17 A;  3BQ2 A;  2V9W A;  2KX0 A;  4GOC A;  5ALH A;  2JV3 A;  3NRW A;  7ICG A;  4B95 A;  5D3I B;  1N5W A;  3QX1 A;  1NK9 A;  4MGK E;  4P4P A;  2NVU I;  3DBH B;  4DXG A;  3B0A A;  1ZQU A;  4E3C A;  4F5R A;  3H8J A;  2BS3 B;  2C22 A;  1N48 A;  9ICF A;  3DWM A;  5AKY A;  2CN1 A;  2JXX A;  2OED A;  4Y2J A;  4NL9 A;  4YP3 A;  3IXS A;  3ZI4 A;  4DWI A;  3VRB B;  1PUT A;  2RRD A;  2LMR A;  1VZ6 A;  4XWT A;  2P6R A;  1XLO A;  5T14 A;  1JWS D;  4MJS B;  1SV4 A;  5IAA C;  3ZVV A;  1C9F A;  2V3N A;  5J2I A;  3Q3M C;  4IW0 A;  3ALB A;  3PS6 A;  3AE8 B;  1WUD A;  4NAW A;  3RH4 A;  4YCX A;  2NMQ A;  4M9G A;  8ICX A;  3ZTC A;  2ASL A;  1MPE A;  3EEC A;  3M9O B;  1SZH A;  1I4G A;  1JMS A;  5G2N A;  1CZP A;  1J7C A;  2EMS A;  1TZO A;  2MBQ A;  2RR9 A;  4ARC A;  4Q8F A;  2C5L C;  2KAJ A;  1NKC A;  5JRT A;  1IIP A;  1NEN B;  2LM1 A;  3GV7 B;  3BYY B;  2MA1 A;  4F1S A;  1NI2 A;  4QWD A;  1NZP A;  2QB0 B;  3TAD C;  4BDP A;  5DPW A;  2PMV A;  1CK1 A;  2HHQ A;  1UD7 A;  5AEK B;  4UB6 U;  4F2R A;  3ZDD A;  1D5M C;  1ZGU B;  5KFW A;  4N6E B;  3AM9 A;  1RWS A;  1WM2 A;  2J53 A;  3D32 A;  4DK5 A;  2FDR A;  1F0M A;  3GQC A;  2FPM A;  3PX4 A;  2F8K A;  1QLB B;  1R7S A;  2IY1 B;  3MAB A;  1HZ5 A;  2L52 A;  2G3Q B;  2J4X A;  2AQ4 A;  4K7W A;  5KG7 A;  4BBN F;  2WS3 B;  3SFD B;  2PI4 A;  3UQB A;  5LNK 1;  8ICQ A;  3AE4 B;  3H1U A;  5HG2 A;  2FMP A;  3HWT A;  5J2B A;  4FHJ A;  2BPS A;  3ZNI D;  1AN8 A;  2C7N B;  2KLG A;  1P3Q U;  2R8I A;  5CHG A;  1ZQO A;  1WCN A;  4A3O A;  2K1F A;  2PE9 A;  4KLJ A;  3FKY A;  2V3S A;  1KFD A;  3GOE A;  3DWG C;  3MBY A;  5HML A;  2N9L A;  2NPT B;  4W9D A;  4J9K A;  4A3P A;  1KOT A;  2EKE C;  5BYR A;  4LJX A;  1SL0 A;  2A19 A;  1UHU A;  2G4D B;  1RYS A;  1WJ6 A;  2QEJ C;  4DOB A;  5KG5 A;  1SKW A;  2K8B A;  5AM5 A;  4QWE A;  4XUS A;  3RR7 A;  2MJE A;  1RXW A;  8ICR A;  1WGR A;  3R3M A;  3M62 B;  2XEW A;  4KN4 A;  5KTQ A;  4BAX A;  2G1E A;  1V81 A;  1ZQJ A;  1T0R C;  2HE7 A;  2N9K A;  5TZV A;  4UDU C;  4GGQ A;  2BWF A;  3RUL A;  5IN7 A;  1OQR A;  3M8S A;  1I4R A;  4FZN A;  2AU0 A;  3QXG A;  4EZL A;  1C1Y B;  4JPS A;  3AEE B;  3ORY A;  1RPL A;  2PFO A;  1L0X B;  1SKR A;  2Q5W D;  3AB5 A;  3WCQ A;  4GU2 A;  2GBM A;  2M1M A;  1NYR A;  8ICL A;  4C56 C;  1NK4 A;  4ZH4 A;  4U6P A;  2OEH A;  4I2G A;  2RSU A;  3C21 A;  2NCN A;  4OW0 A;  3H8S A;  4RU9 A;  8ICF A;  3RB6 A;  2BYV E;  1CEZ A;  4DFK A;  2K3U A;  2MA9 B;  2YB1 A;  3VRA B;  2O2V A;  1N56 A;  2LKY A;  4RQ1 A;  1PVP A;  4NY8 A;  4F91 B;  2ZJ8 A;  3H4B A;  5C0Y A;  3AEG B;  3HM6 X;  3QU9 A;  4F72 A;  1R4M B;  3EGR A;  3JPN A;  2KFZ A;  5CHW A;  3U52 E;  2K4E A;  2LGY A;  2KHV A;  2KQ7 A;  5DDY A;  4RQ4 A;  2KAN A;  2N7E A;  2QIL A;  1B22 A;  1YJ1 A;  1ZDX A;  3N1Z C;  4M8M A;  2LBO A;  3QWZ B;  4DS5 A;  7ICN A;  4B9M A;  4DF4 A;  1LO5 D;  2F2A B;  3EFU A;  4RQ3 A;  2OOB B;  2RDH A;  2AGO A;  4A55 A;  3RRG A;  1ZQX A;  1JXL A;  2MLB A;  2LI5 A;  4J9P A;  3Q8P B;  3PML A;  3N30 A;  3GV5 B;  2DX5 B;  2KT7 A;  3FC4 A;  1N6Z A;  2ZVO A;  2F1I A;  4B9L A;  1BNO A;  4XRH A;  1FPY A;  2VRR B;  4LNF A;  3Q8F A;  3SEB A;  3UIN B;  3R2T A;  4KIK B;  5ALV A;  1NJY A;  1KRP A;  2Q4T A;  3H0R B;  2E1F A;  2Y5C A;  3M3J A;  2FE8 A;  4W9L A;  3JPT A;  2Y9T A;  4JLC A;  2WF7 A;  3UMC A;  2LVP A;  8ICT A;  2JZZ A;  1S97 A;  4O9M A;  2WXL A;  3DBL I;  4Y2S A;  1UGM A;  1MC8 A;  5C23 A;  3VTW A;  1BML C;  4Y2X A;  3SEI A;  5AKH A;  2AXT U;  5ALP A;  3F2C A;  1AAR A;  4NJ6 A;  3VH4 B;  2AH5 A;  2R8J A;  2XK5 A;  2VA2 A;  5J0X A;  1KJT A;  4FJZ A;  3W5V B;  2XCA A;  1YQ3 B;  4B9S A;  4QW9 A;  3RI7 C;  9ICB A;  1DOI A;  3FIL B;  3ML9 A;  5AKE A;  3A9J B;  3C0R B;  4JUZ A;  1TE2 A;  1TKD A;  3PZ7 A;  3CRX A;  1OXJ A;  3EPG A;  3DBS A;  1ZD2 P;  1WI0 A;  1Z00 A;  2N9X A;  2AQ1 B;  3GZN I;  2LWP A;  1Z4O A;  4IR1 A;  1J2M A;  1ZKH A;  2JGA A;  2WDV B;  2P6U A;  4BWJ A;  8ICU A;  1GC6 A;  2ZIW B;  1PQS A;  2L83 A;  4WQO B;  3R7Q A;  2HTH A;  4DLE A;  4DOA A;  3PX0 A;  2B76 B;  1MJD A;  4I2H A;  5KFQ A;  2J52 A;  2O2V B;  4GDK A;  1WG8 A;  1AQ6 A;  3RB0 A;  2XID A;  2K89 A;  2KVS A;  2K6Q A;  5J0S A;  3PY8 A;  4RQ8 A;  2PTL A;  4NAW B;  5J17 A;  1PK1 A;  3AEF B;  2BR0 A;  3IV6 A;  1R4M I;  2HVH A;  2IGH A;  4WWM A;  3WKA A;  2FIF A;  1CQV A;  2YML A;  2JT4 B;  4IM2 A;  4YFK A;  4DFM A;  3RBE A;  1L0Y B;  2E1E A;  3I76 A;  1WX8 A;  1YN3 A;  4P0P B;  3P4S B;  3AEB B;  1RM6 C;  2WF8 A;  2D6F C;  5L9X A;  4DEZ A;  3ZW3 A;  3A9K B;  3CW2 C;  2HHW A;  1Z2M A;  3N20 C;  2PFN A;  3RFA A;  1TJE A;  5IOI A;  1BUI C;  3H0M B;  2GB1 A;  1FM0 D;  3RJI A;  1D8Y A;  4M00 A;  4TSS A;  4UAU A;  1ZQB A;  4NJ8 A;  4CF5 A;  2IO0 B;  1SL1 A;  3RJF A;  2MP2 A;  3ZYY X;  7ICP A;  1SGG A;  3CSF A;  2W03 A;  2D3A A;  3KBB A;  3SI8 A;  4RQ5 A;  1YD8 U;  4YSX B;  3RNA C;  4C8N A;  4G11 A;  3UIP B;  4ZHP A;  3UMG A;  1QF6 A;  3AU4 A;  2KMD A;  3OWE B;  2GLE A;  1EU4 A;  4NZL B;  4PGX A;  3ISC A;  4MM3 B;  3ZXV A;  4NLZ A;  1Q1O A;  1SWV A;  1UQV A;  5DGB A;  2KJH B;  3AL0 B;  3BVZ A;  2I9G A;  3OAW A;  4RQ2 A;  3AMZ A;  3AU2 A;  1WJ4 A;  4C00 A;  3Q8C A;  4F5O A;  3PRE A;  4Q43 A;  2JX5 A;  4DFJ A;  2KV2 A;  3NS1 A;  4DDI D;  5KFS A;  4PHD A;  2ZTE A;  4DQI A;  1JCK B;  1SEB D;  2MBE A;  2N7D A;  3A1Q B;  4J9R A;  3NAS A;  2VZK D;  2HBL A;  3E0F A;  1NJZ A;  2WF6 A;  5ALK A;  1FXA A;  1A0P A;  5BPC A;  2P66 A;  1DOY A;  4DHZ B;  4EZ6 A;  4ARI A;  2KAC A;  4P0Q B;  2X8X X;  1JWA D;  3W9C B;  4Z6D A;  2KIV A;  5D94 A;  3VUY A;  5DKW A;  4OJO A;  5ALW A;  2YY6 A;  4HPP A;  1PK1 B;  4ED8 A;  1KW4 A;  4Y2P A;  3SAF A;  3KOO A;  1COK A;  4IWP A;  5J2C A;  5JXV A;  2K0P A;  3H8M A;  4F4X A;  4DO9 A;  1JN3 A;  1UBI A;  1V86 A;  5D3D A;  2V0G A;  1A5R A;  1GAQ B;  1GUA B;  3AEV A;  1LKY A;  4FHK A;  1K8R B;  2Q0Z X;  1F5S A;  5DB7 A;  4GXI A;  4CF4 A;  1WSP A;  4XDC A;  1QQ5 A;  4QJF B;  3E2E A;  3EWA A;  2CRX A;  1PK3 A;  8ICG A;  3Q2A C;  3VTV A;  3V62 A;  4N9F 4;  3B2G A;  1Q46 A;  2LGX A;  1E90 A;  3TAC B;  1L0V B;  2M0X A;  5KL1 B;  2JXT A;  2AGP A;  9ICC A;  1NJW A;  3AN1 A;  1F2R I;  2G45 B;  4Z6C A;  2ZCB A;  3KFU F;  2RDI A;  4QNL A;  4QZH A;  1WXA A;  4RM9 A;  4KMU A;  5KL8 B;  2MUT A;  5J2J A;  3PR4 A;  3K1Z A;  8ICV A;  2ZUD A;  4YMM A;  2MHJ A;  2IJ0 A;  1SE3 A;  3B08 A;  3DVG Y;  2K39 A;  3ZKJ C;  1JWM D;  2V4Q A;  3FDS A;  1ARO P;  2W54 A;  3IT6 B;  1TY0 A;  3T8M A;  2NYV A;  4GFJ A;  4W9H A;  1ZJM A;  3LDZ E;  3K1R B;  3TKA A;  1RQN A;  1E8Y A;  2HVI A;  3EUB 2;  4C4R A;  2HOF A;  7ICM A;  2J7Q B;  1TAM A;  2KN4 A;  2OYY A;  3E58 A;  2G09 A;  4Z6F A;  2K8H A;  1IXR A;  2OXO A;  2WB1 C;  1S9F A;  2NRZ A;  3RYT A;  4TQS A;  3SHQ A;  4BUG A;  2ZIU B;  3A4S C;  4HDQ A;  2WXI A;  4QZ8 A;  3C28 A;  2W9A A;  2BCR A;  2YN4 A;  2LD9 A;  5KG1 A;  1TZ1 A;  3F53 A;  3QZ8 A;  3MGH A;  2W9B A;  3GIJ A;  3JPR A;  4BXO B;  5ALQ A;  3NVZ A;  5GTI U;  2UVV A;  2O6V D;  3RAQ A;  5KG6 A;  2L7R A;  5IA7 A;  3K75 D;  4HCN B;  3C2M A;  1ZW7 A;  2JZB B;  4CNQ A;  4FBT A;  3WAO A;  1Q10 A;  2J42 A;  2LZ6 A;  4WAA A;  4YTN B;  2DEN B;  1V5T A;  2BB6 A;  1L6U A;  2KFN A;  2L0T A;  2DYB A;  3HK0 A;  3W5U B;  5CB1 A;  1VDV A;  4P0Q A;  3HUI A;  3PV8 A;  3IP4 B;  5AKK A;  1JML A;  1ZQS A;  1FCC C;  5ALI A;  4HVB A;  3N28 A;  1PZN A;  2IY0 B;  1LFD A;  5KFU A;  1HQR D;  2ZG6 A;  2M0A A;  1ENF A;  3KVF B;  3QUQ A;  3RB3 A;  2FCS A;  3EPI A;  2JWZ A;  1XF5 L;  1NZB A;  3AV8 A;  1RZT A;  2ISP A;  2IBI B;  8ICZ A;  2A1A A;  2JZB A;  5EWE A;  2EDU A;  1FIQ A;  8ICI A;  5ALG A;  3V7J A;  5CX3 A;  4QZE A;  3AU6 A;  7ICQ A;  2XY5 A;  1MG4 A;  1RFK A;  2Y5B B;  4L2Y A;  2D3D A;  4C8M A;  5L1M A;  3Q8S B;  4RQN A;  4JIO U;  1QOF A;  1O08 A;  4MF8 A;  3RTV A;  1ZQQ A;  3JYU A;  3H7I A;  2FUG 1;  2HDE A;  4J9N A;  2KNB A;  5L95 C;  1SV0 C;  1Y56 A;  2K8C A;  2QLT A;  1B9R A;  1IV8 A;  4ICV A;  3O0F A;  2WXM A;  2OWO A;  5CEH A;  1JAL A;  2A3V A;  1TAQ A;  5HKH A;  3M8R A;  2V1Y A;  2ZUC A;  3JW0 X;  4MGZ E;  1FEZ A;  5AKZ A;  3Q8L A;  4I2F A;  3NY5 A;  3OJ4 B;  1L7M A;  2HMX A;  1I4X A;  1KRH A;  1OUQ A;  3Q69 A;  4K81 A;  2JSV X;  3AQF A;  1TK5 A;  4ECW A;  2K22 A;  3GS2 A;  1QOB A;  3N32 A;  3H4D A;  4MFA A;  3AE5 B;  2HCF A;  4GIB A;  4JX1 C;  1Z1V A;  5GMV A;  2DZM A;  4K1R B;  1XC9 A;  2BS4 B;  2VIX A;  2KFJ A;  5KT3 A;  2LGI A;  1I4P A;  4E74 A;  3SD5 A;  4A8X C;  2EQY A;  1VCB A;  1P7D A;  1WXQ A;  3ML8 A;  1DGS A;  4C8K A;  2I6X A;  3TEW A;  3Q8E A;  1AYF A;  2AWT A;  2YX8 A;  4DL6 A;  2HHX A;  3WA0 A;  4N58 A;  1SSN A;  4B6J A;  4ZRK A;  4YWG G;  2NO5 A;  1FRD A;  2CU3 A;  2DAF A;  4DDG D;  2Z0D B;  4REZ A;  2FLN A;  1XQQ A;  4BZA A;  4DQQ A;  3CWI A;  5EE0 A;  5DBA A;  2ZEQ A;  4NQK E;  4PPX A;  3CNH A;  4DOC A;  1I4H A;  2RHF A;  4EUT A;  5J0U A;  5L1L A;  2W9B B;  3N97 B;  2IOF K;  3WAP A;  2EZZ A;  5TIS U;  3KKA C;  3L08 A;  2YEP F;  9ICE A;  1FRR A;  2LI6 A;  2W55 A;  5KAF U;  3KQ4 A;  2BCU A;  2ATL A;  4K7S A;  2YMQ A;  2D3B A;  2H3Z A;  2XO7 A;  2JU6 X;  2DUY A;  1WE7 A;  3AE2 B;  4KLF A;  1Z3E B;  4EYI B;  1GG3 A;  1ZQP A;  4TUS A;  2UVW A;  1IUE A;  1WJN A;  2AQ3 B;  3ONN A;  2WXH A;  4DFP A;  3NVV A;  4ZYN A;  5J29 A;  1QSL A;  4IC9 A;  2NO4 A;  2Z7J A;  5BMG A;  2KEY A;  2JRI B;  2LGD A;  3RJH A;  3V60 A;  2WHI A;  2Y0S F;  2GRI A;  3HKZ C;  1T0Q C;  2KQS A;  3QYP A;  3WKE A;  2HHU A;  1QQ7 A;  3KZX A;  4IQV A;  2J6T A;  4C7Y A;  1RFA A;  4RFB A;  2DYO A;  1A6S A;  2C28 A;  1VR9 A;  2Y3A A;  2BPF A;  3KHG A;  4NAM A;  5D49 A;  2INN E;  3IG3 A;  1C4A A;  3NS8 A;  3F2B A;  2FJ6 A;  4A9A A;  5EWF A;  1ESF A;  8ICP A;  1MHH E;  3Q8R B;  3BWU D;  2LRW A;  2RDJ A;  2IGG A;  2ESE A;  7ICO A;  3PLU A;  2WAQ C;  4PL2 A;  5A0L A;  2QAR B;  4JV2 A;  7ICL A;  9ICW A;  4ECS A;  4EZ9 A;  2M9N A;  2LHE A;  4HRS A;  4RF0 A;  2JHD A;  2GH1 A;  5ALL A;  1QSS A;  5HHH A;  1NKB A;  9ICG A;  3T5L A;  4KIT B;  1PYW D;  3RZF A;  1DOQ A;  2DL0 A;  1ZQE A;  2YMP A;  1TKE A;  2EMT A;  3VUW A;  4S0R A;  3H6N A;  2E8O A;  3ZDE A;  5AIC A;  1NEK B;  4R8U B;  5J2F A;  1U48 A;  3IBE A;  2RGF A;  3GII A;  1E7P B;  3JPP A;  4PHA A;  4RQ0 A;  3F5A A;  4R64 A;  2R2Q A;  3A9J A;  3MHZ A;  4C8L A;  4RPY A;  1SL2 A;  3PRM B;  2KIW A;  4M04 A;  5EDS A;  3PVL A;  1VJ5 A;  3RD2 A;  3H8W A;  4UAV A;  4P6V F;  3QK0 A;  2IZV B;  3A1Q A;  5HMM A;  5DPR A;  3LK9 A;  1L6N A;  5T8I A;  2LEK A;  1COO A;  2BGF A;  3RBD A;  4FO6 A;  3ENE A;  5K4L A;  1XXG A;  1HEZ E;  3VR9 B;  3LWM A;  1P7E A;  1J7A A;  4ASW C;  1KEJ A;  2HHS A;  4DQO C;  2MU2 A;  3MDC A;  3KHR A;  1SF0 A;  3T9L A;  3V6C B;  1RAX A;  3QEA Z;  1FNW A;  1M94 A;  4L1B A;  5AI8 A;  3PST A;  4WUR A;  4YG2 A;  1ZDV A;  3N1X C;  4C4V A;  2WXR A;  1LQB A;  1NI3 A;  1EXN A;  3V6K A;  4IRC A;  3FAH A;  4M9N A;  3RPF C;  2EAM A;  4HYK A;  3ZDB A;  5J0W A;  3DEE A;  4KTQ A;  5AI6 A;  2F3N A;  3WKC A;  3ZDA A;  3C19 A;  2KZZ A;  5FR6 A;  2IO2 B;  2DPI A;  4HJG E;  3ZD9 A;  1WWV A;  1KFS A;  4FZL A;  4HEA 1;  3N3K B;  1OEY J;  4MEL A;  3WIM A;  3R2I A;  2AHO B;  4KZ0 A;  1T4G A;  4C8O A;  3D2Q A;  4OJL A;  3UPQ A;  2MRL A;  4UBC A;  3ZNZ B;  2INC C;  3PW5 A;  2BBC A;  1F44 A;  1VD2 A;  2IYD B;  3HX0 A;  4US9 A;  2MAX A;  1GPX A;  3AED B;  2BQR A;  2YVC A;  4CO7 A;  2BQQ A;  4DWF A;  4I2I A;  1BPX A;  3P63 A;  2KFK A;  2DQN B;  8ICA A;  1CUK A;  4K4I A;  1S8O A;  1ZXH A;  3WK7 A;  1S0O A;  2BCQ A;  4M2Y A;  2MWS B;  5AKG A;  3CYM A;  3DVN V;  3AQE A;  4K3C A;  4P16 A;  5KFT A;  5EE9 A;  5HR6 A;  1HUZ A;  3N9Y C;  2WXG A;  4FE3 A;  2L1A A;  3AE9 B;  4ANU A;  4QZC A;  9ICL A;  4ED7 A;  4W9K A;  1F2R C;  3ZXR A;  1WCL A;  4CHK A;  4AWJ A;  3DHI C;  1NK6 A;  4GSW A;  4JGH B;  1KL9 A;  3DBR B;  1WMH B;  4WQM A;  2KDB A;  1C79 A;  4O3S A;  1SXT A;  1E5W A;  3X0W A;  2QAR A;  1V1P B;  3T5K A;  2NRW A;  4XZ4 A;  2JZ3 B;  4BKT A;  1OQQ A;  1STE A;  3WK5 A;  1RG6 A;  3PW0 A;  3V3X A;  2VH2 A;  5AK4 A;  4UB1 A;  4IKG A;  1ET9 A;  4TUU A;  4W9F A;  2OHF A;  4JB3 A;  5GTH U;  4DHJ D;  5KFP A;  2BHN A;  2K4H A;  2F76 X;  4B9V A;  2UWQ A;  4MFC A;  2H89 B;  2KKV A;  3RH5 A;  3QC8 B;  5DG8 A;  4FXC A;  4IRK A;  3DV9 A;  4J03 A;  5JTI A;  5ALX A;  1WY8 A;  3OLM D;  1C76 A;  5DQI A;  2R8H A;  4KV2 A;  2JR5 A;  4UAT A;  4EBC A;  5J0R A;  2KNJ A;  2IPK D;  5CRX A;  4R3D A;  2RLT A;  3KTQ A;  4A6Q A;  4JWS C;  2EKI A;  1S77 D;  4Q2J A;  4X57 B;  2K4I A;  4Y2R A;  4X5V A;  2A1J B;  2KDM A;  4QZ9 A;  3M6Z A;  3MGV A;  2XC9 A;  1XD3 B;  1EF1 A;  3RNG C;  5KFY A;  1BGX T;  5DBB A;  5BOL A;  1IPG A;  3GIM A;  4XWW A;  1L4D B;  3J81 j;  3RR8 A;  2ALZ A;  2FPL A;  4I2J A;  4HLE A;  2B21 A;  3QU4 A;  4OVU A;  3APC A;  1BVS A;  5MPO A;  2BYT A;  4QZG A;  2PVG C;  4OHJ A;  2W9C A;  4LZG A;  2LYA A;  3UQ2 A;  4P1B C;  2RP5 A;  2KVC A;  3TAD A;  3ZLZ A;  5HFY A;  9ICT A;  5JU5 A;  2DHZ A;  3APD A;  2HTM E;  4DL4 A;  3T3O A;  4Y2T A;  2BWE S;  4NV0 A;  3PW4 A;  2HOQ A;  5E6J A;  1X9M A;  5J2R A;  2KVR A;  2LJ5 A;  2FCQ A;  3WK8 A;  3THV A;  2BPG A;  3KKA A;  5AZF A;  5AK3 A;  3SV3 A;  2JEI A;  1FEH A;  3L3F X;  2PMZ C;  3BS5 B;  1XO0 A;  2K4P A;  4OZB A;  1P0R A;  2ZVN A;  4UB8 U;  2WU2 B;  4J9S A;  4AYB F;  4ACF A;  2G5H B;  3F5E A;  4DSE A;  3VFK A;  3PO5 A;  4DSK A;  5KNI A;  2KHW B;  1WGY A;  4US8 A;  4WJQ A;  2BKE A;  1H8C A;  4HK2 A;  1ZQL A;  1RLF A;  3ZRF A;  5ALE A;  4NLN A;  1P9D U;  4RNA A;  5IP4 D;  2EAN A;  1KFY B;  1Z5S B;  4PZN A;  4XQ8 A;  1SE2 A;  3VCB A;  1HZ6 A;  3TBL D;  1XCQ L;  2DAJ A;  4RGN A;  3BS7 A;  1YT3 A;  2DWQ A;  3U8Z A;  3OG5 A;  1YN5 A;  5BOM A;  1Q3V A;  3QU2 A;  4XA5 A;  1P7F A;  2NV3 A;  4AJY B;  3U7D A;  4KLL A;  5DPS A;  1EF5 A;  2PEA A; 
#chains in the Genus database with same CATH homology
 4KGS A;  4HKQ A;  2WXJ A;  5D3D A;  4YXD B;  2V0G A;  1GAQ B;  1V1O A;  2MH7 A;  3KWV A;  1QT9 A;  3P42 A;  1WSP A;  4XDC A;  5TSS A;  3AE1 B;  1ZP0 B;  3HVZ A;  5GXG B;  1FO4 A;  1WYG A;  2LUM A;  1NYQ A;  1F0Z A;  1FNU A;  3B2G A;  1SE4 A;  1JRP A;  1CJE A;  1L0V B;  3U4E G;  2JXT A;  3P4R B;  3AN1 A;  1F2R I;  4KKI A;  5I4D A;  2QSD A;  1DGJ A;  4LK0 M;  2KQ4 X;  4WH4 A;  2WXO A;  2IJ0 A;  2CJO A;  1SE3 A;  3B9J A;  3E56 A;  1QQR A;  1M4V A;  1JWM D;  2W54 A;  3IT6 B;  4A90 A;  1MI0 A;  1TY0 A;  2WXK A;  2SEB D;  4MH8 A;  2BB5 A;  2H88 B;  3T3N A;  2VZK B;  4LTU A;  5BMH A;  1C78 A;  3BK2 A;  3EUB 2;  3C8Y A;  1YQ4 B;  1K52 A;  1D5X C;  1XO3 A;  2I38 A;  4LLG M;  1ACC A;  4RGO S;  2KN4 A;  2WDR B;  3UI3 A;  1MHX A;  4D2K A;  2JZP A;  3E9S A;  3TEZ A;  2IDY A;  1FFU A;  4KGR A;  1VZ7 A;  2DYM A;  2WXI A;  2R61 A;  3BZD B;  3RFZ B;  1N60 A;  4J3O D;  1GB1 A;  1XEE A;  3PO0 A;  1FXI A;  2KWD A;  1C4P A;  3ZGZ A;  1BXT A;  3NVZ A;  3ETR A;  4JE3 B;  2W82 A;  3NVW A;  1N63 A;  1QIL A;  2W3R A;  1Q10 A;  2J42 A;  2IGD A;  1EU3 A;  5D7G A;  3MFG A;  4YTN B;  2BB6 A;  1T5X D;  2N7J A;  1L6U A;  2V4I B;  2K9X A;  4N59 A;  2ACZ B;  3W5U B;  1DOX A;  1VDV A;  3HUI A;  3VQI A;  1FFV A;  3CIR B;  3SR6 A;  2Y5P A;  1JML A;  1ZOY B;  2M56 B;  1FCC C;  1PDX A;  5C2T B;  1HA5 A;  1MVK A;  1HQR D;  2M0A A;  3BK1 A;  4MT5 A;  1ENF A;  4AS1 A;  1K50 A;  1V8C A;  4ITK A;  2WU5 B;  4ZRQ A;  3R8B A;  1RYJ A;  1EWC A;  1XF5 L;  3AV8 A;  3B2F A;  3J9C A;  1WWT A;  2K5P A;  1KLU D;  4WAF A;  1NVI D;  5BMI A;  1AWD A;  2ZW0 A;  1FIQ A;  3ZJU A;  2SAK A;  1RFK A;  2QJL A;  2WNM A;  1UGJ A;  3P4P B;  4L2Y A;  3P1M A;  1JQ4 A;  1QOF A;  1I4Q A;  1TKG A;  3BII D;  4RGM A;  4ZHO A;  2FUG 1;  2HDE A;  1SB3 C;  1Y56 A;  3BVM A;  3Q8B A;  2MJ3 A;  1SJE D;  1TS5 A;  1B9R A;  1E10 A;  1KH0 A;  2N0S B;  3FIL A;  3VR8 B;  2WXM A;  1WRI A;  5HI1 A;  1SIJ A;  3MC0 B;  1JAL A;  2V3P A;  4RGT A;  5BYQ A;  4RH6 A;  4USA A;  4B0E A;  4YSZ B;  1QKZ A;  4KKJ A;  1IBX B;  5D3I B;  4XDD A;  3NRZ A;  1I4X A;  1KRH A;  1N5W A;  1ZXI A;  3AE6 B;  3Q69 A;  3TEY A;  5C3J B;  4PT5 A;  2JSV X;  4WIP A;  4DXG A;  2K22 A;  3GB1 A;  1QOB A;  3GS2 A;  3ZJT A;  3LXF A;  3URY A;  3AE5 B;  2D5G A;  4JX1 C;  4XE0 A;  1E9M A;  2BS3 B;  3V05 A;  1V1P A;  2BS4 B;  3DWM A;  2LGI A;  1I4P A;  2OED A;  3IXS A;  4A8X C;  1D4B A;  1WXQ A;  3VRB B;  1PUT A;  3TEW A;  1T3Q A;  3Q8E A;  2PVO D;  1AYF A;  1VZ6 A;  2LJI A;  4XWT A;  4N58 A;  1SSN A;  1XLO A;  5BYS A;  1JWS D;  4YWG G;  1FRD A;  4M0W A;  2CU3 A;  4REZ A;  1C9F A;  2V3N A;  1TKY A;  1FMA D;  3CWI A;  2X38 A;  5EE0 A;  3AE8 B;  3U2S C;  2I2Y A;  2NMQ A;  4GLS C;  1I4H A;  4OZA A;  1MPE A;  1FNV A;  1GOZ A;  5H92 C;  2DLB A;  1I4G A;  2L32 A;  1CZP A;  1J7C A;  1SJH D;  1TZO A;  4ARC A;  2KAJ A;  1A70 A;  3MP9 A;  1NEN B;  2WQY B;  3I57 A;  3BYY B;  1F77 A;  1JWB D;  2YEP F;  1KTK A;  4DXF A;  1FRR A;  2W55 A;  2PMV A;  2W3S A;  3W2D A;  3KQ4 A;  1CK1 A;  3W1S A;  1D5M C;  2JU6 X;  4N6E B;  3AM9 A;  3AE2 B;  3KLS X;  1RWS A;  2J53 A;  1FD6 A;  1QOG A;  1QLB B;  2WXN A;  1R7S A;  1IUE A;  2AQ3 B;  2L52 A;  1HZ5 A;  2WXH A;  1ET6 A;  3NVV A;  2J4X A;  1L5P A;  4GDK B;  2WS3 B;  3SFD B;  1YJJ A;  5LNK 1;  5BMG A;  3AE4 B;  5HG2 A;  4IDI A;  1AN8 A;  2BS2 B;  2GRI A;  1YMH E;  1IGD A;  5FR3 A;  4C7Y A;  4RFB A;  2DYO A;  1E6E B;  3H8H A;  1VR9 A;  2Y3A A;  1VJK A;  1K51 A;  4NAM A;  2MEK A;  2INN E;  2LMC A;  1C4A A;  3DWG C;  4A9A A;  2E6X A;  1ZPS A;  2N9L A;  2NTS A;  3HRD D;  1ESF A;  5BYR A;  1MHH E;  2QEJ C;  3BWU D;  2WXF A;  2RPV A;  2IGG A;  1IGC A;  2BTE A;  1XLP A;  2WDQ B;  3TUO A;  1FCL A;  2WP9 B;  2MJE A;  4OZC A;  5AUI A;  2LHE A;  4HRS A;  4RF1 A;  1E0Z A;  2G1E A;  4RF0 A;  2ICI A;  2N9K A;  4UDU C;  1PYW D;  1ROE A;  1TKE A;  1OQR A;  1I4R A;  1NEK B;  1YNT E;  1VZ8 A;  4JPS A;  3AEE B;  4O1N A;  1E7P B;  1L0X B;  2Q5W D;  2XNA C;  1T6B X;  3AB5 A;  2JQR B;  3BVG A;  3MHZ A;  3AE3 B;  3TEX A;  3WCQ A;  1NYR A;  4P6V F;  4C56 C;  2JYT A;  3HVD A;  4OW0 A;  3P4Q B;  5T8I A;  2LEK A;  3ZJV A;  2K3U A;  1HXY D;  3VRA B;  1XXG A;  1HEZ E;  4TMA B;  3VR9 B;  1P7E A;  1J7A A;  4YT0 B;  2PKO A;  4DQO C;  1SF0 A;  1YJI A;  3AEG B;  1IBX A;  1FNW A;  3EGR A;  1JW9 D;  2RMM A;  3U52 E;  4L1B A;  4WUR A;  1C4C A;  1ZDV A;  3KWL A;  2RDG A;  3IT4 B;  5AUK A;  2WLB A;  2WXR A;  3LB8 C;  1EM7 A;  1NI3 A;  2QIL A;  3AE7 B;  3FAH A;  3RPF C;  1ZDX A;  2G9H D;  1LO5 D;  1ZUD 2;  2RDH A;  3IAM 1;  1PFD A;  4A55 A;  1K53 A;  1L6V A;  4HJG E;  2JYE A;  4HEA 1;  4YTM B;  3R2I A;  1XLN A;  3FC4 A;  4B0M A;  3SEB A;  3Q8F A;  2BBC A;  3ZQ4 A;  3R2T A;  4US9 A;  4C80 A;  1GPX A;  2DBY A;  3AED B;  3NUH B;  1JRO A;  2Y5C A;  3AEC B;  2WXP A;  3EA6 A;  2FE8 A;  1KF6 B;  1QOA A;  3P63 A;  2WXL A;  1ZXH A;  1BML C;  2KMM A;  5EE3 A;  4HKZ E;  5H8Y E;  2XN9 C;  4P16 A;  1I7H A;  4TQ0 A;  3W5V B;  2PW9 A;  1YQ3 B;  4ZRP A;  5EE9 A;  1DOI A;  3FIL B;  2WXG A;  2AQ2 B;  1EWY C;  3N9Y C;  4OVZ A;  1AW7 A;  2L1A A;  3AE9 B;  2YEP B;  1F2R C;  3PZ7 A;  4AQ7 A;  2PLP A;  1DYQ A;  4WQM A;  1C79 A;  1VLB A;  1SXT A;  3Q8A A;  3AEA B;  2AQ1 B;  2NTT A;  1V1P B;  4CQN A;  1TYG B;  3SFE B;  4MAC A;  2ONQ A;  1OQQ A;  1STE A;  1PGX A;  1N61 A;  2CJN A;  2WDV B;  2L83 A;  3V3X A;  2AX5 A;  3ABV B;  4IKG A;  2EEL A;  1GB4 A;  1ET9 A;  2QIE B;  4IOI E;  3GP7 A;  2BT6 A;  2OHF A;  2QMT A;  4C7Z A;  2B76 B;  1TS3 A;  2TSS A;  2H89 B;  2J52 A;  2E3T A;  1PGA A;  4FXC A;  1JWU D;  1V97 A;  5G5H A;  2Z8L A;  1C76 A;  3BYT B;  2PTL A;  4NAW B;  4EE2 A;  3L4P A;  1UNS A;  2IPK D;  3AEF B;  3MJ5 A;  2IGH A;  4R3D A;  4H2A A;  4A6Q A;  4JWS C;  4WWM A;  2EKI A;  1YN4 A;  4Q2J A;  1CQV A;  2KDM A;  1L0Y B;  1YN3 A;  3P4S B;  3AEB B;  1RM6 C;  4L23 A;  2FBW B;  3TSS A;  4XWW A;  4HRO A;  2WXQ A;  1L4D B;  1TJE A;  1N5X A;  4YTP B;  1BUI C;  2GB1 A;  5EE1 A;  1FM0 D;  1B1Z A;  2GI9 A;  2PIA A;  1ZE3 D;  2MJD A;  5MPO A;  5FK9 C;  2BYT A;  4TSS A;  4JWU C;  1TY2 A;  1UWX A;  2JWU A;  2PVG C;  1WGK A;  4OHJ A;  3ZYY X;  1UUP A;  5HFY A;  1XCT L;  3IAS 1;  4YSX B;  2HTM E;  4ZHP A;  3T3O A;  1QF6 A;  3OWE B;  4NZL B;  1EU4 A;  2LFI A;  2INP E;  4MM3 B;  5E6J A;  3NVY A;  1N62 A;  5HHD G;  3BVZ A;  2ZW1 A;  4KGT A;  3AMZ A;  1FEH A;  1KLG D;  2BW2 A;  1VRA B;  4OZB A;  3Q8C A;  2WU2 B;  1L4Z B;  1D5Z C;  2JX5 A;  2ON8 A;  3NS1 A;  4ZYS A;  2LHD A;  2M19 A;  4GDL B;  4US8 A;  1JCK B;  1SEB D;  4RCO A;  1OFF A;  2VZK D;  1UWM A;  4KX6 B;  4RNA A;  1SBB B;  3PZ8 A;  5FKA C;  1FXA A;  1TS4 A;  3U7Z A;  1DOY A;  1C77 A;  3LYY A;  4NJC A;  1KFY B;  2KAC A;  3I9V 1;  1JWA D;  1SE2 A;  3W9C B;  4ARI A;  1HZ6 A;  4YSY B;  1XCQ L;  4RGN A;  4TQ1 A;  4ZOH C;  1TS2 A;  2DWQ A;  1XLQ A;  3O13 A;  1J7B A;  1YN5 A;  1P7F A;  3NZ3 A;  1D6E C;  1PGB A;  5G5G A;  3AH7 A;  5JXV A;  2K0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...