5G5HA

Escherichia coli periplasmic aldehyde oxidase r440h mutant
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
173
structure length
173
Chain Sequence
AATPAPEIMPLTLKVNGKTEQLEVDTRTTLLDTLRENLHLIGTKKGCDHGQCGACTVLVNGRRLNACLTLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTSGQICSSVAVLKEIQDGIPSHVTVDLVSAPETTADEIRERMSGNICRCGAYANILAAIEDAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE XANTHINE DEHYDROGENASE YAGT IRON-SULFUR-BINDING SUB
publication title The Escherichia Coli Periplasmic Aldehyde Oxidoreductase is an Exceptional Member of the Xanthine Oxidase Family of Molybdoenzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 48
structure length 173
sequence length 173
ec nomenclature ec 1.2.99.6: Carboxylate reductase.
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 5g5hA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5g5hA01
1QT9A 3HRDD 5EE9A 2WDVB 3BIID 1TKEA 4LTUA 2H88B 3AE3B 1CZPA 3NRZA 1TKGA 2DBYA 1RFKA 3P4SB 3P4RB 3FAHA 2BS4B 3AECB 1RM6C 4C7ZA 1PDXA 1F0ZA 2L52A 3ZYYX 3AE1B 3NVWA 3AB5A 5G5GA 4YXDB 4YTMB 5H92C 1ZP0B 3EUB2 1NEKB 1E6EB 1PUTA 3AE6B 1WWTA 1XLPA 1FRRA 1YJJA 2BT6A 2W55A 1UWMA 2OHFA 4JWSC 4P6VF 2MJDA 1DOXA 3CWIA 2K9XA 3VR8B 1A70A 1JQ4A 1FXAA 3AE9B 3NVVA 1QOFA 2CJOA 2ACZB 1JWAD 1YQ4B 3AE5B 3P4QB 1FM0D 3PO0A 1NI3A 3ABVB 3AEGB 1XO3A 2WS3B 4US9A 1KRHA 1XLOA 1ZXIA 1E7PB 2W3RA 3AM9A 1FRDA 1QOAA 4IDIA 3W5UB 1TKYA 4ZHOA 2WDQB 1V97A 1SIJA 1XLQA 1TYGB 2FBWB 2H89B 3AEAB 1NVID 3AE7B 2M56B 1L6VA 1N5WA 4USAA 1YQ3B 2WQYB 5G5HA 2CJNA 4N6EB 1FIQA 2PVGC 1N5XA 2Q5WD 3HVZA 3VRBB 2WU5B 3SR6A 3DWMA 1JWBD 1E0ZA 1I7HA 1N62A 2PKOA 1CJEA 5AUIA 5GXGB 3AE2B 3B9JA 3AEBB 4US8A 2W3SA 3AEFB 1B9RA 2QJLA 3LB8C 2L83A 2N0SB 1V8CA 1ROEA 2WDRB 2WLBA 1XLNA 1T3QA 1J7CA 1JW9D 4KX6B 2W54A 3ETRA 3DWGC 1J7BA 1FFVA 2BS3B 1J7AA 3AMZA 2WU2B 4ITKA 4HRSA 4N58A 3AH7A 3VR9B 1OQQA 2Y5CA 1AWDA 1WYGA 1WGKA 2K22A 3WCQA 1NYQA 1QF6A 3NVZA 2G1EA 3NS1A 4FXCA 1FO4A 1RWSA 4JX1C 5H8YE 2K5PA 1GPXA 1VLBA 4ZOHC 1E9MA 1FXIA 1SF0A 1DGJA 2EKIA 3CIRB 3B2GA 3LXFA 1PFDA 1JRPA 1VDVA 1NYRA 1SB3C 4ZHPA 3B2FA 3FC4A 3P4PB 2JQRB 3NVYA 4YSXB 2BS2B 1OFFA 2MJ3A 1JROA 3P63A 4YT0B 2AX5A 1R7SA 4C80A 1QOGA 3AEEB 4WWMA 1E10A 1FMAD 1IUEA 1KFYB 5C2TB 1WXQA 4YSZB 2JX5A 1N60A 1NENB 1ZOYB 1VJKA 4YTPB 1L0VB 5EE1A 1JALA 3P1MA 1RYJA 4YTNB 3L4PA 3AV8A 3RPFC 4HROA 2KAJA 1KF6B 3KWLA 1AYFA 2CU3A 3AE4B 3AE8B 4WQMA 1EWYC 3HUIA 1OQRA 2LEKA 2B76B 1N61A 2MH7A 3AN1A 1L6UA 4JWUC 4YSYB 3SFEB 2DWQA 2QIEB 1DOYA 1ZUD2 2E3TA 5AUKA 1TJEA 3SFDB 4C7YA 3W5VB 1L5PA 1GAQB 4N59A 3W9CB 5EE0A 3AEDB 5EE3A 3VRAB 2M19A 2PVOD 2KMMA 5MPOA 2MJEA 1FFUA 1WRIA 2HTME 2WP9B 4A9AA 1DOIA 1QOBA 2PIAA 1N63A 5C3JB 1YJIA 1QLBB
chains in the Genus database with same CATH superfamily
2RLTA 2JVCA 2WXGA 5L1MA 4MGKE 4Y2YA 2KX0A 1SSNA 2MU2A 9ICSA 2WXPA 3NRZA 4Z6DA 4I29A 2BQ3A 3RJIA 2HBKA 3IDWA 1V38A 4PS7A 1YX5B 2O6VA 4UW9A 2J6TA 3IFWB 3TI0A 2DF4B 4HLEA 2N9LA 4B9SA 7ICLA 2LGIA 5J0OA 3TANA 3ZXVA 3TUOA 3URYA 1T0SC 1NK8A 2KYWA 1UBIA 4P6VF 2PJHA 1E7VA 5FP0A 2KTFA 2D3GA 3DOWA 3RNEC 2F8KA 2SAKA 4FJYA 2LGSA 4DFPA 3PV1A 2K4PA 3KLSX 2XCAA 2FMPA 3B1LX 3E0FA 4KGSA 3MJ5A 4AP4C 1WGDA 3D2QA 2IO1B 1TAUA 1TIFA 4CE6A 4TURA 3P2BA 5ALDA 1XCTL 2WQYB 4QJFB 5J2AA 5KFHA 1BPBA 4DS5A 2LM1A 3AU6A 3VRBB 3DHIC 2HVIA 1GNUA 3ORYA 2ES6A 2GBKA 2I1QA 3KD3A 2BCQA 2AL6A 2BF8B 3V6JA 4J9QA 2HDEA 1FCCC 3ZNID 4DL4A 1C79A 9ICVA 1KBUA 3MGVA 7ICNA 7ICUA 2BHNA 5IINA 2W04A 2JZPA 3ED5A 4RQ2A 4DL5A 3V7KA 1UD7A 1Z1BA 4F4KA 3U52E 1UH6A 3VR9B 5HFYA 1OQQA 8ICNA 3QCAA 3U30A 2J42A 2RMMA 3PMLA 3ZW3A 4JX1C 3U7ZA 2V1YA 3M62B 1IIPA 3QU5A 5BOLA 4J9PA 2R8KA 1CI4A 3B2GA 1OEYA 3LXFA 4IQUA 4KITB 4IQTA 7ICSA 1NYRA 1MHHE 1QQ6A 4GSWA 5AI9A 1FEHA 3NVYA 1V9PA 1KH0A 3T5JA 2FIFA 1L7NA 3RJJA 3P63A 3RJFA 2G9HD 3AEEB 3T3OA 1WJ4A 4RFBA 4ANUA 2FMSA 4DOBA 2GOLA 3MC9A 5D46A 1E7UA 4C8OA 4ECRA 4C8MA 8ICLA 4KKIA 4PHPA 2RP5A 5DPSA 1I42A 1ZGUB 4KVGB 1KF6B 2HBMA 3N28A 2WXOA 5KFAA 4B9TA 3F5EA 1V85A 2J7QB 3QYPA 4JWUC 1BGXT 2LMCA 1K1QA 1ZUD2 2WXNA 3EFCA 2ZIXA 5KFMA 1UUPA 4M6WA 4FBUA 4A55A 3PZ7A 3QEBZ 8ICIA 5J0PA 1E90A 5AI5A 2I9GA 1BUIC 1WRIA 2R8JA 2ZIXB 1NOMA 4DFMA 1ZD5A 9ICHA 1R4MI 2WGSA 4KX6B 2KN7A 5KG3A 3M63B 1DOQA 1PUZA 4YD1A 3PR4A 3UXNA 1NK9A 1ET6A 2LI5A 4K3CA 4JK1A 4LZGA 2KTQA 3C1YA 1TS4A 1HZ5A 4C4SA 4HKZE 3R9KA 1HEKA 3DPDA 4B95A 1WI0A 3JPOA 9ICQA 4JV2A 3FDSA 4DQQA 1D5MC 3VFKA 3ZTDA 1JQ4A 4PL1A 1PK1B 4EUTA 2KC2A 1V1OA 4NZLB 2MBEA 5J0QA 3Q3JA 1NK0A 3NZUA 4J9LA 2QARB 3OGUA 3NY5A 7ICTA 4LNFA 4EZKA 3Q8MA 2ZNVC 2A1AA 2LASA 4N6EB 2WFAA 8ICPA 5DPTA 3R7QA 4HVBA 1JN3A 2KKVA 3M8SA 1X9WA 2LVPA 1BT0A 4W9KA 4CO7A 3ZIMA 2EANA 2R8HA 2QJLA 3LB8C 4OJ5A 2BTEA 1KL9A 4XDCA 2QCZA 2FUHB 3APDA 1ED1A 5J2JA 3UIPB 3ETRA 4WURA 1E8WA 2BQRA 3OAWA 3LVWA 1S76D 2IJ0A 2JHDA 1ZQPA 4A8EA 2HSZA 3WK5A 1AWDA 5AIBA 1I4PA 2KVRA 2Y5CA 4YMNA 2DQNB 4HDQA 4DQIA 3VUXA 2AHOB 4ACFA 2N7EA 3VTVA 3VTWA 2CRXA 2VA2A 5DG7A 3PPAA 2KN5A 3OSNA 3AI5A 2E8OA 2IHNA 2LXCA 3PVLA 2VRRB 2FPKA 5KG5A 3UMCA 4B0MA 1UA1A 4YT0B 5TSSA 3KHGA 4AWJA 2A19A 2XI9A 3C1ZA 1ZQBA 2A1JA 1YT3A 2HOQA 2I6XA 1TZ1A 1NENB 2Z0EB 2KFNA 1A6SA 1F2RI 5DCNA 3P1MA 5HHHA 3TIXA 3AQEA 3JVZX 1S9FA 1K1SA 1ZQEA 1OXJA 2DUYA 5KL8B 4EE2A 3BZKA 4J9OA 1OQRA 4XYCA 2DAJA 5HI1A 4RPZA 5F9NA 2DWQA 3B0YA 4OZCA 2CN1A 1Q10A 4RQ6A 4PHAA 1NZPA 3VUYA 2L0TA 3BVGA 2HMXA 1Z4OA 2OYYA 2ZIVA 2INPE 3VH4B 4LNOA 2QEJC 3ZNHB 4NY8A 2WF7A 3M6ZA 5KT2A 3PGEA 1ZQVA 1NJZA 2PIAA 3ZGZA 3H8SA 1LXDA 1R4MB 1UT5A 4MEMA 7ICGA 1MVKA 2ZIVB 1IGDA 3W1SC 4OVUA 3VHTC 2HHSA 1XO1A 1J19A 3G6VA 2WYQA 4P0PB 1E8YA 1MFWA 2K3UA 4QAYA 5J17A 1AROP 2XICA 2X8XX 4QIWC 4CRXA 1DXSA 1QSSA 4EKUA 1WH3A 4I28A 3RNGC 3BK1A 1WWTA 1YJJA 2FE9A 3EYZA 2ZVNA 1I4QA 2MBQA 2AGQA 4K81A 1SXDA 1WX9A 4RM9A 3ZO5B 2ICIA 4L1BA 1TK0A 4EYHB 4HCPB 2KP7A 4C8KA 4US9A 4PPXA 2VANA 1P3QU 1QOAA 4O3SA 2HHUA 2BB5A 3IAS1 1TKYA 2R61A 2KNBA 1HQRD 4YR2A 4MFCA 2ZZPB 3V6EB 1KM7A 1N5WA 4USAA 2O6VD 4HK2A 3VTUA 3NUQA 2JZZA 3AU4A 3SR6A 2JEJA 8ICXA 5ALXA 1IV8A 4RT2A 4QZBA 2JEIA 3RJEA 2MUTA 8ICFA 2CPRA 1YMHE 5GXGB 3QA8A 1XT9B 4YXJA 3H0RB 2P6RA 5ALTA 1ZRNA 1JRUA 2N0SB 3VXWA 1V49A 1X2IA 4R64A 1X40A 2WLBA 5J0UA 4B6WA 2K4HA 2MUTB 2Y1JA 2KZ3A 3IT4B 1A76A 4JQWC 4I2JA 1Y88A 1QSYA 4M9HA 4EZ6A 2H3ZA 2QSDA 2YB4A 4YWGG 1J8CA 1GO3F 1EXNA 3KFUF 2MRPA 4CHKA 4OD0A 4MELA 3ZDBA 2JU6X 3NVZA 3SAHA 4XA5A 2G1EA 4IUMB 3WK7A 2WDTB 5TR5A 5H8YE 4R63A 2KIWA 1PVRA 2YB1A 1ZQMA 3GDXA 1VDVA 1F5SA 1A0PA 4KGRA 1YX6B 5AM0A 1XXGA 2WNMA 4DDID 2Q0ZX 2QKQA 2NO4A 2MJ3A 1F1HA 2NBVB 1L6NA 2EAPA 1YNTE 2K6DB 3TAPA 3I5JC 3QX7A 2H3IA 4ED6A 1IUEA 2BGFA 2OEDA 2V3PA 3M6KA 1N60A 3MR2A 1FXTB 1S8OA 2F8LA 5ALPA 4I2BA 3N7SC 2W8KA 4F4XA 2KAJA 4BX9C 2NRTA 1L4ZB 3MHSD 2MH7A 2G45B 3UI3A 3WU2U 1Z00A 1TVAA 1BPXA 3Q8RB 4XX5A 4C7YA 5L9XA 1L5PA 4P16A 1XSNA 4N59A 4NJCA 3AQFA 3QUQA 5KFPA 5IILA 2MJEA 4UATA 1Z00B 4EENA 4GLXA 1ZDXA 5DB9A 4I27A 3ZTCA 5JZEB 1STEA 2KEYA 3DHGC 1JX4A 5EE9A 3RNCC 4K4GA 3AE3B 3TSSA 3V62A 2HDOA 2D3AA 5J2HA 2ISPA 1C4CA 2NV3A 1PDXA 2ESEA 2CHXA 1HJPA 3HPOA 9ICCA 1SWWA 3OPXA 4QZIA 3OHAA 4OCZA 2L1AA 3AB5A 4DFDA 4GU2A 4NLKA 1ZXHA 4LNIA 4ECTA 1TK8A 1LKYB 3QZ8A 4E0DA 1FNVA 2TSSA 3M3JA 2AJQA 4HJGE 4UB6U 1UA0A 3RB4A 4F5OA 3PREA 2ACZB 3CMMB 3L17A 5DQHA 3Q8LA 2KMDA 2FJ6A 3TEYA 2LUEA 3AEGB 1XO3A 3HKZF 3CSTA 4BJQA 1C4PA 2F1JA 3IT6B 3KWVA 9ICBA 4F4WA 2H89B 2JMGA 4F5NA 1NVID 1WUDA 4DQSA 3V6CB 4GXIA 5ALGA 2AQ4A 7ICKA 1E8ZA 3VQIA 4RNNA 3SQIA 3RJKA 2LZ6A 2ZUBA 4MSMB 4NLCA 2PKOA 2E6XA 2WXMA 3AE2B 1XSLA 3TADA 1WIAA 1S0VA 2F76X 3Q8FA 4BKGA 2YMQA 2OM6A 2JRIB 1M94A 4Q45A 4UB8U 2J6SA 5D2MB 4RQNA 2EMSA 3DDHA 5CHWA 1S0MA 3UXOA 2WTFA 2XY6A 1TS5A 4NLNA 4ANWA 3KZXA 4JUZA 3PSTA 2RPVA 3J81j 1UQVA 2ZJ5A 3RH6A 3M9NB 1LVHA 3I9V1 1WY8A 5F3XB 4EX7A 5TZVA 1FO4A 1RWSA 4DO9A 4ED2A 2LRWA 4QZFA 1WM2A 4DQPA 3UMBA 3HWTA 1YOVB 1V1PA 4Y2XA 1PFDA 3SAGA 2CXYA 5KFLA 4F91B 4XRHA 1KJTA 5EWGA 4M9LA 2C7HA 3I57A 4RH6A 3TCAA 4AJYB 1HUOA 4ELVA 1TGZB 2BS2B 1HIWA 3N32A 1ZW7A 2ZXHA 2AX5A 5KFYA 3LDZE 4JV0A 4K3BA 5KFNA 1SWVA 8ICZA 2PPHA 3FKYA 2JZ3B 1ZOYB 4O5EA 4RCOA 4YTNB 3U4EG 3QZ7A 1BPDA 2ZTDA 4DSEA 1D5XC 1FPYA 1ZJMA 4A3PA 4ZYNA 3I1YA 5T8IA 1KFSA 4Y2PA 3SHQA 2C2RA 4K7SA 5FK9C 3SFEB 5EWEA 3FILB 1B22A 4QZCA 1N48A 2M0NA 3CRXA 7ICMA 2N7JA 3C8YA 1S0OA 4KDIC 2XIDA 9ICRA 2FMQA 2KMMA 2BCSA 4JE3B 3PHXB 3UINB 2ASJA 5AZGA 3GIJA 4XQ8A 3RH4A 1EUVB 2C2DA 1T7PA 3KHRA 1BNPA 3RN9C 3OG5A 2FCNA 3F2BA 2DLBA 2WDVB 2V4LA 5BMHA 3AU2A 4Q8EA 3LWMA 2ZJDA 1ZRMA 3DBHI 4XDDA 8ICEA 2GOWA 5AKLA 2YX8A 4QW8A 5BOMA 3C5GA 4YFKA 3H40A 2ALZA 3MFGA 4C7ZA 2N9XA 2UU7A 3M95A 4DBGA 1V86A 2FCMA 5AEKB 4ZRPA 1K53A 2VA3A 3PV8A 1TE2A 3ONNA 3PNCA 3K4GA 4OZAA 1AQ6A 5H92C 1COOA 5AICA 4A90A 4P0QA 1OTRB 3VC8A 1QH9A 4FZMA 5JTIA 2N9KA 2W55A 1ZQFA 1L0YB 4RNMA 4KSKC 1F0MA 4QWEA 4G0NB 1NK4A 1RPLA 3V7JA 4U6PA 4GB9A 3F2DA 4PGXA 3MC8A 1NI3A 2KANA 2QMTA 4Y2JA 1XD3B 1XLOA 2WF9A 5ALUA 4KLSA 3F5AA 2IGGA 1I4XA 2RHFA 2EQYA 2BB6A 3AU5A 3IG8A 1YQ3B 2X38A 2KDIA 2GI9A 5AI8A 8ICAA 3FM9A 2PFNA 4G11A 1RFAA 4MACA 4Z6CA 2UVVA 4II2B 5AUIA 1CJEA 5AZHA 8ICMA 3BY4B 4O3QA 1JMSA 3AULA 2BKEA 2IYDB 3BZDB 4ZDVA 1K52A 2KIVA 4QNLA 9ICIA 1T0YA 2BPSA 2J53A 2AQ3B 4EZJA 4ZYSA 4BKSA 1KDHA 3M7DA 1MJDA 4B9KA 4C00A 2ISOA 2Y9UA 1A77A 5ALQA 7ICRA 1SXTA 2OCEA 3TARA 1WSPA 1TS3A 5ALYA 5ALRA 3HJEA 4O3PA 3PRMB 5CX3A 1SF0A 1V5TA 2LMRA 5A0LA 2G4DB 2WX1A 2IGHA 2F44A 1JCKB 3QE9Y 3PW5A 5DB7A 2Y0SF 3UMGA 4ACOA 4RNOA 4FBTA 2W82A 1T0RC 2IDYA 4DLGA 5J0YA 4C4TA 1QQ7A 2WXLA 4I2IA 4R66A 2OJWA 9ICFA 3RAQA 1SE3A 1ZDVA 1KFYB 4DFJA 2MP2A 1WM3A 1VR9A 4BOZB 4BBNF 2WF6A 2JX5A 2QB1A 3IHPC 1J0GA 2W7OA 5CWRA 1UZXB 2PMVA 4KMUA 5KFIA 1WGGA 3N20C 3OSPA 4LVSA 1PQSA 2MP2B 3GB1A 4M9NA 4GLSC 4C8NA 3UIOB 4YN4A 5KT6A 2W9BA 3MP9A 2BQUA 4IW0A 2LHTA 3H8MA 4IM0A 4NM1A 2BVCA 1UELA 3DVNV 3R3MA 3ZJUA 1TJEA 2H3VA 4UBBA 1SE9A 3E2EA 1MPEA 4HYKA 3AXCA 3VDZA 5BPCA 5BYSA 3I76A 2KDMA 3W9CB 4C4VA 1FNUA 1Q8KA 2KICA 2EZYA 4IQVA 5AKXA 4PL2A 5IIMA 5ALNA 2OH2A 4KLUA 1UHUA 3AL0B 3TFSA 2N1WA 3ML9A 4HCNB 4ARIA 1WMHB 4GFJA 1BPZA 1QT9A 2ZJAA 1X6JA 3EC8A 4C4VB 3BS5A 3BIID 3MC0B 3H7PA 4RGNA 1L3TA 2BR0A 2NPTA 1PGAA 5DDMA 4KLTA 1IXRA 1MC8A 2E8PA 1OEYJ 3DBRB 3ONSA 1BMLC 3ZDMC 3RFAA 3TEZA 1JWMD 3UXPA 2NPTB 2AGPA 4O3RA 5G2NA 1X9XA 9ICJA 1V81A 2UVUA 2N9EB 5KFXA 2JXTA 1NEKB 1PYWD 4I6PA 3AE6B 2KTRA 1OW5A 2YMMA 2Y1IA 4JWSC 3H8WA 1NZBA 7ICFA 4NY0A 3UQBA 1A70A 4TKNA 1FXAA 2IOFA 1YQ4B 3OHBA 2KTRB 3H8JA 3ZKJC 1ZQRA 4UDUC 4ANXA 4IM3A 4MJSB 2W9CB 3RB3A 1FRDA 4MM3A 1DYQA 4REZA 1XLQA 2BW2A 4RQMA 3N9YC 3I28A 3NZSA 4M2YA 1ECWA 4PYUA 4W9FA 2WHIA 1EO6A 4G9BA 2NVUI 2JH7A 1B43A 1JWBD 3DWMA 1N62A 4W9DA 2DKXA 2JRZA 4DSIA 1LV5A 2O6VB 1XS9D 2BYVE 3HKZC 1DGSA 2ZIUA 4W9GA 5J2BA 2RQ5A 1J7CA 1L0XB 2FIDA 4F4ZA 1JW9D 5KFCA 3T9LA 3Q8CA 5AM1A 3C2KA 1S5LU 2XEWA 1WWUA 3JSVA 4YL8A 2DZJA 2KN4A 1QF6A 4RUCA 2GH1A 4OJ6A 5JHBA 2ASQA 8ICBA 4S0RA 3JSVB 4DQOC 5LXIB 2YQEA 5AI6A 2MA1A 2XK5A 4RPYA 1PVQA 3GQCA 3P4PB 2I5HA 2KSOA 4NM2A 3WAMA 4UB1A 4F5RA 2DPJA 1QSLA 3T8MA 3F2CA 3PO4A 1V9JA 4YSXB 1WX7A 2KFKA 2XK5B 4B9NA 1E10A 2KSOB 8ICGA 4IWPA 2C5LC 1XCQL 1QZEA 2L32A 3OJ4B 1VJKA 2K1FA 2KFKB 4M9JA 1TY2A 5IP4D 1RYJA 2MWSB 4J3OD 2A3VA 1SKRA 2IO2B 4HROA 1T3NA 3GU3A 1TBEA 1NNLA 4KTQA 3AE4B 3BWUD 3G6YA 2PE6B 2BWFA 2L76A 4KSLC 1PK3A 4WAFA 2KD0A 3C2LA 5C23A 4UB2A 4TUSA 3H4BA 2DZIA 4YSYB 2ZUDA 1F44A 2NS5A 2LGYA 2ODGA 1JIHA 3Q8AA 4QZ9A 3NOBA 2PVOD 5EDSA 5KHOA 3C19A 4P4OA 3UGBB 1XWLA 5ALWA 4DHJD 1UF0A 4AJWA 4KLOA 2WF5A 4DLEA 4YG2A 4DSJA 4KLEA 5J2RA 4OJLA 1RXWA 2G4SA 5I4DA 3BZCA 2IBKA 2JRHA 3RB0A 3D2SA 1RM6C 1ZQLA 1F0ZA 3QU2A 3EZ5A 2L5YA 2QC8A 3C0RB 2DL0A 3THVA 2PW9A 4CCHA 1NJYA 3BYTB 1SV0A 3O65B 1ZYQA 3C28A 3PZDA 4E74A 1PUTA 2BT6A 1FRRA 2KOXA 1QQ5A 3KKAC 5CHFA 4J9KA 1KEJA 1UBQA 1MN8A 2K9XA 4FE3A 4DDGD 5KL1B 2LHEA 4M9GA 3V72A 2KO3A 4M6WB 2JZBA 4GDLA 2W9NA 4AOFA 3EPIA 4O9MA 5KHQA 2J4XA 3TACB 4QZHA 2XY5A 4NLZA 4DL7A 2JYEA 4EX6A 4MFFA 5B5EU 2FBWB 2ZCBA 4RPXA 3T5KA 5KG7A 2BBCA 3TMPB 4Y2UA 4LJPB 5KT4A 2D3DA 2PFOA 4JWMA 5AI4A 4C4RA 3ISCA 2WU5B 2KJ5A 1U48A 2FPLA 1I7HA 2C7MB 2JWUA 3QK0A 4KDLB 1B9RA 5E6JA 4RQ7A 4MH8A 1X6IA 4F71A 1CMXB 4ICAA 2NRWA 3PRZA 4WJOA 4UASA 4XWWA 5BYQA 1XC9A 3QHTA 1WCLA 4PK1A 1FD6A 1KFTA 3SENA 4XZ4A 5J2GA 4LCDE 8ICRA 4OW0A 4K7WA 4ELTA 1WYGA 5AKIA 1ZJNA 2K22A 3SZ2A 1Z1VA 1LM8B 2VIXA 3W2DA 4S17A 3CW2C 4FXCA 5AK6A 5DGBA 3MGHA 2XVTA 1C4AA 2DNFA 5TISU 1D8BA 1D5ZC 1JRPA 2XN9C 1ZQDA 4WIPA 1PZNA 5DLFA 4CNQA 1P0RA 1H8CA 4PZNA 5KT5A 1WFYA 3RBEA 4D2KA 4ECYA 5KT3A 2HOIA 1FMAD 3FYHA 4ELUA 3Q14C 4LNNA 5C2TB 3SD5A 4BKSD 4BGDA 4ECUA 3I3TB 4ECVA 5EE1A 4WJPA 1JALA 3L4PA 4MF2A 5AZFA 2HHWA 4IWQA 1GOZA 3ZUNA 3N97B 1YQBA 2KKPA 4MGIE 2Y0SC 4ED0A 2ATLA 4IOIE 2JY6A 2YLMA 1MI0A 1HEZE 4LLGM 4EBEA 2EMTA 3ZJTA 2Z8LA 2HE7A 2B0CA 3B0AA 3L16A 4KZ0A 4P1CC 1QTMA 3N7PD 3ZDCA 4BBNC 1HTQA 2UWQA 2Z0DB 3GIMA 2GO7A 5KFDA 3M8RA 4DL6A 2WP9B 2DFLA 5KG6A 5AKJA 1ZD2P 3RTVA 5HR6A 5KFKA 1WYWB 3HHMA 1WG8A 3ZNGC 2O6KA 3QC8B 2FAZA 1JWSD 3P4SB 2H5XA 3MC1A 4FS2A 4FN2A 2AH5A 2Q4TA 1HUZA 2F77X 2A1JB 1LQBA 2DENB 2G5HB 3BYYB 2L52A 4DS4A 4XGAB 1COKA 2HJ1A 2EH9A 4IC9A 3PLUA 4PJ0U 3DQVA 2HHTA 4OHJA 3IM1A 3WA0A 3TEWA 5G5GA 5FR6A 5KFBA 5DBBA 5HHDG 5ALEA 3RUIB 3H6NA 4QWCA 3GFKB 2BPFA 5AM5A 4TQ0A 1RZTA 4RUAA 3GILA 1P98A 3EW9A 2KWDA 1J2NA 1VZ8A 3CWIA 1DOXA 2G09A 3TQ1A 5LNK1 3MDAA 3ABVB 3GE8C 3RCZA 1EWCA 3BK2A 1BPEA 1CQVA 3ETLA 4Y2RA 1X9MA 4RQ8A 2F2AB 1U49A 1MSWD 4RQ3A 1OUQA 1Q5WB 1UCVA 3JPTA 4FJVB 3MFIA 3SYZA 2PVGC 1N5XA 4QZ8A 2NBWB 3IN5A 3A9KA 4XE0A 4WWPA 4F92B 4YQWA 4IG7B 3DCGA 1WJUA 2K8CA 2D11A 1ISNA 3HX0A 5ALSA 4DWIA 4WWNA 5JH5C 1T3QA 3T5LA 4W9LA 1ZETA 1HZ6A 4FHJA 2E1EA 1J7AA 4KN4A 3GZNI 2V9HA 4HRSA 2KNJA 4BDPA 1XU4A 9ICXA 1UNSA 1IGCA 2PXIA 2BWES 2MLBA 2WXFA 4OVZA 4KZCA 5HG2A 3PSIA 2HOFA 2KJRA 3WANA 4FA6A 2FNJB 1CK1A 2QILA 3HVDA 4HAIA 1ZQOA 1RYUA 8ICSA 1DGJA 1NK6A 4RT3A 3H7SA 4KLHA 3CP8A 3KQ4A 3LWLA 1IP9A 4ZHPA 4M8MA 3TJPA 4ED3A 1JROA 1WXAA 2I1JA 1QQRA 2HBJA 4F93B 2KQSA 2CKHB 3JYUA 2EELA 5J18A 1B1ZA 2C28A 1CEZA 1R4NI 4XUSA 5IKCM 5KFFA 4RM8A 1MQ3A 5LLIA 4NL9A 2KLGA 1YJ1A 2CU3A 4W9JA 4WQMA 2XY7A 2VJ5A 3MJWA 5EOZA 2B76B 2M9NA 2ZG6A 3AN1A 4W9HA 3PO5A 1VZ6A 3F53A 1K5OA 2MQJA 1O03A 4QWAA 1FNWA 5J0SA 1WJNA 4DSLA 3DBSA 3GV7B 4GN1A 2JPHA 5EE0A 2MBOA 4B0EA 3Q3FA 4YP3A 4YMMA 1DOIA 1NJXA 2ZTCA 4E3CA 1KQQA 3GIKA 1L3SA 5CJ7A 4WJNA 5C3JB 2XCPA 4IWOA 4M04A 1TKEA 2KLCA 4EZLA 4EEWA 1U9LA 2PTLA 2KX3A 3LVVA 2CR5A 4KIKA 3CNHA 1ZQGA 1KFDA 4YVZA 3AE1B 2MAXA 1D8YA 2ZIWA 3PZPA 1ZQNA 2C9WB 3WAPA 1Y8RC 1KN5A 3E58A 3EUB2 5J2IA 2BKFA 2J52A 1XLPA 4WJ3B 5KG4A 2E1FA 2V3NA 4JB3A 4ECZA 2DZMA 5KAFU 5E6NA 2RSUA 2ZXIA 3VR8B 3QARA 1WWVA 3NVVA 3P4QB 1SV0C 2K0PA 1YN4A 1SXEA 2INNE 3HK0A 5KFWA 5D4BA 1H38A 2VKQA 4NJ8A 4RGOS 4AUQC 4ZHOA 5KFVA 2G5IB 8ICHA 4P2HA 4MSQB 4HEA1 3VAWA 2FCSA 3K1ZA 7ICVA 1TT5B 5HP4A 3EHVA 5IO9A 4Y2VA 5CP2A 2GWSA 3N3KB 3L10B 2PI4A 1EU3A 4I6NB 3WALA 4R8UA 1VD2A 3TFRA 2NTSA 4LJOB 2GBJA 3QEAZ 3X23A 2G3QB 2KWVB 4C8LA 2W54A 3RR8A 3NG0A 1FFVA 2BS3B 4NQKE 2WU2B 2WB1F 3GZNB 3TL5A 1U45A 3AH7A 2PFPA 3VUWA 4Q44A 4PYZA 3GOEA 3WCQA 4DHZE 1JWUD 5F9LA 3C2MA 2KKCA 4M0WA 2MCNB 5CHGA 4HXDA 3PZ8A 4KLFA 2M0AA 5IN7A 2G08A 3JW0X 3JPNA 3RULA 1L3VA 2JV3A 3QU7A 2LKYA 4X5VA 3GZFA 3IG3A 4M0WB 3SEBA 5J2FA 2QB0A 3JPSA 4ECSA 7ICJA 1V6EA 3N30A 2R8GA 4GDKA 3Q8PB 1NKCA 4F1SA 3Q3MC 4DQRA 2DKZA 1WX8A 2WHEA 1R4NB 3MBYA 5DPRA 3J9CA 4ARCA 2E5SA 2OJRA 3A9JA 4JV1A 1NKBA 5J2EA 5IIKA 4W9CA 1IM4A 2LPEA 4B9VA 3NZ3A 1XO0A 1V5OA 1N2XA 2PI5A 2ONQA 2QIEB 1DOYA 2JT4B 4MFAA 3EFUA 4KLIA 4M8NA 3QXGA 3N1YC 3KYDD 3D6JA 5EE3A 4UB3A 2EDUA 4KLJA 2NRVA 3ICXA 2HTME 1V1PB 5KFTA 1SZPA 1MG8A 1QOBA 1MQ2A 1SJED 1L7YA 1TY0A 1HTOA 4DXGA 4TQ1A 4DHJB 4O5CA 2A5UA 2GRIA 2LRUA 3WIMA 1FEZA 3APFA 4L2YA 5LXHA 3PX0A 4PT5A 2AXTU 3X0WA 4ZRIA 1SIFA 4C56C 5L83A 2M0XA 4EYIB 4YXDB 4Z6EA 1KLVA 2J6UA 3A1QA 1ZD4A 1E6EB 2M1MA 5AKHA 2KVCA 4TV3A 9ICUA 3U26A 2OHFA 4TUPA 3LK9A 4NPNA 3ZD9A 1ET9A 4YMOA 3IAM1 3OWEB 3VRAB 2CJOA 1ZQWA 5ALHA 4EEYA 1LO5D 3A4RA 3GIIA 4IRKA 1JXLA 2HHQA 3RJGA 5FR3A 2AQ0A 1NK7A 2WDQB 1EF5A 1RG6A 2ZW1A 4MDKE 2LI6A 1X1MA 1L6VA 3MTNB 5C5JA 9ICPA 1GUAB 2EAOA 2ZEQA 1E0ZA 3K1RB 3ZD8A 2W3SA 1WXMA 2WXHA 1S0NA 4BKTA 4UAWA 4RGTA 2L7RA 4R65A 5L1IA 4UB4A 3WK4A 2RDHA 3L5KA 3DV9A 1C7YA 2Y9TA 4P0QB 2IBIB 1JI7A 3DWGC 1ZQUA 2L3ZA 3QQ8B 4PHEA 4LDTD 2LVOA 4CDGA 3M9MB 1JXEA 3QIJA 3C23A 2K8BA 1X42A 4NXZA 4DL3A 2AGOA 1VJ5A 2D3BA 2REXA 2VH1A 2GBMA 1E9MA 5JRTA 1WCNA 2EKIA 2K6QA 2HI0A 2N9PC 4Q43A 4J9SA 1YN3A 2AQ1B 3AUOA 2M4NA 1SB3C 5L1JA 2BQQA 2MBHA 2F1IA 4BWMA 5CRXA 1UT8A 4B6JA 4ED8A 2KJ6A 2ZPYA 3UF8A 4LJXA 1ZQHA 1R7SA 1QOGA 1Z5SB 4G3IA 4GIVA 1UGJA 2JYTA 1SEBD 4R3DA 3HM6X 2KXJA 5D94A 2IO0B 1KW4A 1TFRA 4NLGA 2AEHA 3JPQA 2OEHA 1YZ6A 4ECWA 8ICVA 2MSED 3QJZA 3PW0A 3U8ZA 3HUIA 2C2EA 1N61A 1K50A 4KLLA 4HPLB 1WGRA 1ZQYA 3W5VB 1T8EA 3NHEB 4CF5A 1ZQSA 5C1ZA 2D8CA 4FZLA 5J29A 5MPOA 5DDYA 5DB6A 4WQOB 2W9MA 4BXOA 1WXSA 3M1YA 1FFUA 1XSPA 3MHZA 5AI0A 1LFDA 4FLHA 1SL2A 3H0LB 3BDPA 1SV4A 4IS7A 3HT3A 4ZRKA 4UBCA 4BXOB 2B6GA 3QU4A 2ZNVB 1P7FA 3SMVA 4IQWA 1M4VA 3GE3C 3RB6A 2KDBA 1T94A 1F2RC 4HWIB 3ZJVA 1P9DU 1OGWA 5KFGA 2P35A 4YCXA 2DYBA 2PE9A 1SZHA 4UAVA 4GC6A 2LYBA 1C9FA 2GB1A 2KT7A 1ZP0B 2KZMA 3KYCD 2W9BB 2BDPA 2KK8A 4N9F4 2XC9A 2LWPA 3H9DA 4LZDA 1TAQA 3MGIA 3RH5A 3E9SA 4II3B 2PKEA 2R2OA 1HA5A 1QOFA 1SBBB 4B9MA 1TK5A 2AYOB 3QWZB 1NK5A 3UQ2A 9ICKA 1ZQQA 4I2EA 3O13A 4RMAA 4NNJB 3DBHB 1Z3EB 5AKEA 4EELA 2IGDA 2K60A 2R2QA 2NMQA 5ALLA 2PMZF 2IMWP 3BS5B 1NI2A 3H7PB 1UPHA 2RGFA 4ZH4A 5G55A 5JXVA 4CF3A 2J0MA 5BO4B 5KTQA 3T5HA 1J2MA 1ACCA 1RAXA 1H4RA 2N1VA 3R2IA 4US8A 5J0XA 3RJHA 1ZQCA 2GMIC 1KOTA 2V9WA 2K25A 1KKXA 5HMMA 5KFJA 4EEKA 3DVGY 1RYRA 4IR9A 2LYAA 3PLVA 2V0GA 4TMAB 2BCVA 1T0QC 4BZAA 1I4HA 1J7BA 1UGMA 3ZRFA 2CS4A 4BFRA 3MABA 2NO5A 1SE4A 3IBEA 2E8NA 3KBBA 4O3NA 2YMPA 3NS1A 1SGGA 1GPXA 2DYOA 4MM3B 1E8XA 1FCLA 1KLGD 5IA7A 3W1SA 2ZW0A 1EM7A 4J9NA 3DHHC 2LD9A 2KHWB 3EWAA 2UVWA 2V4QA 1HE8A 2WB1C 3WKCA 4PZOA 4QZAA 4FO6A 2W9AA 3KHLA 4EFOA 4IR1A 4KLQA 2QDFA 5AKYA 2Y3AA 4KKJA 4FBJB 4YTPB 4F7ZA 3TADC 3OJUA 1F9JA 3SV3A 2ZIUB 1E5WA 2WXJA 3SI8A 3SDLC 3ZDEA 3KUDB 4LNKA 2AU0A 3EGRA 2ASDA 5BMIA 3EECA 3D2NA 2LEKA 2FDRA 1Z4NA 1L2NA 3SAFA 9ICMA 3Q2AC 2BYFA 2JGAA 5AUKA 3B08A 4IM2A 1SKSA 1ZQAA 5B66U 1RLFA 3AEDB 1XNSA 1NKEA 4OJOA 3VH3B 4KX5A 7ICHA 2YTUA 1ZQZA 2WS3B 3L54A 7ICEA 7ICOA 1YJIA 3VVWB 2HCFA 1L7OA 1V80A 1S77D 9ICLA 4HPMB 5DKWA 2HD5B 1TKGA 3P4RB 4GMVA 2G06A 9ICGA 3FAHA 2LYHA 2BS4B 5KG1A 4JL9A 4YR0A 5ALZA 2KJHB 4RU9A 2LGXA 4F8RA 4RNAA 3ZYYX 4IKGA 3Q69A 2KD1A 4J03A 3DBLI 4I6LB 5AKGA 1F77A 5DPWA 4DF8A 4DEZA 1L8OA 1ZQJA 3RD2A 1Q46A 8ICCA 2DYMA 4FHKA 4F2SA 4P7IA 2EZXA 4ED7A 3C29A 1YN5A 3N1ZC 2LJIA 5D7GA 3AE9B 7ICPA 1JWAD 1FM0D 5AKZA 1QILA 1X9SA 1D9DA 2FPMA 2W3RA 1B0XA 2NTTA 5KG2A 2MRLA 5J0WA 1TYGB 5AK4A 1ZE3D 1LGRA 4RQ5A 1URJA 2R18A 8ICWA 5ALKA 3WKBA 3HP6A 4B9UA 2B3AA 1RQNA 2HJ8A 3HVZA 3H8HA 1JUDA 2RDIA 2L00B 1Q3UA 1WRDB 2RDGA 1GC6A 4FFDA 3JPPA 1DK2A 2L83A 4WJQA 2KQ4X 4QZDA 1G6JA 2HBLA 4W9EA 1JMLA 2AQ2B 4RQ0A 2GLEA 3KUZA 2IZVB 1S97A 1MHXA 1QLNA 4UARA 4JLCA 3SV4A 4DSFA 2HVHA 1BXTA 2FCQA 4NQLB 2KHQA 4NJ6A 1D4BA 2W03A 3BQ7A 2J0KA 2KV2A 2JZBB 3P42A 4GDLB 1ZQIA 2PLPA 2K5PA 2MW5A 4ZRJA 1VLBA 1FXIA 1GB1A 3CIRB 4WAAA 7ICIA 1J97A 3A0HU 5J2KA 5KAIU 2JH1A 3FC4A 3R7RA 2JQRB 4K4IA 2LUMA 4IL6U 1Q3VA 2CHZA 3IVFA 2W7PA 5KFOA 1I35A 2NRXA 1YD8U 4A20A 1WXQA 2KDFB 3S6JA 2WWZA 2YN4A 9ICTA 2ON8A 2MBBB 5IIJA 2NYVA 4F5QA 3AV8A 4BOSC 5JHAA 1AYFA 4BVUC 1EF1A 2IOHA 1XF5L 5K4LA 4J9RA 2INCC 3ML8A 3RR7A 1L6UA 2B21A 1SL1A 2JR5A 4JWNA 1PK1A 4KX3A 4ICVA 2E3TA 1C3TA 3ISBA 2KFZA 2WXRA 1TKDA 3M9OB 5CB1A 3Q6BA 2M19A 1QKZA 2BYEA 3PRPB 5HKHA 4A9AA 5EWFA 2FI1A 2QARA 3ZVVA 2K89A 3PW2A 3H1UA 1SE2A 1ZQTA 4O3OA 5CTRC 2DBYA 2IY0B 3C5FA 2XO7A 2JXXA 3D32A 1BPYA 4HDOA 4TSSA 4K7UA 1U4BA 1Q1OA 1OQYA 3RZFA 1T5XD 3V61A 2JSVX 3DBLB 3MR3A 4A3OA 3R8BA 1CRXA 5AK5A 3RNAC 2KQ7A 4UQGA 3PW7A 1UWMA 1F52A 3ZDTA 2MJDA 2KACA 5DBCA 4P4MA 9ICWA 3K9OB 8ICUA 5KNIA 4RF0A 2NRZA 3IV6A 3RF9A 3GV8B 2GLSA 3CF6E 4W9IA 5ALFA 3MR6A 3PW4A 3KUCB 2KWUB 5HMLA 1ENFA 1KRHA 1E7PB 3W5UB 2KVZA 1SIJA 3T3FA 3BINA 2C7NB 5ALMA 1MG4A 4A8XC 2W43A 1PGXA 2VZKD 3OTQA 1GG3A 3CYMA 4M47A 4ED1A 1P7DA 4MT5A 2BCUA 2ASLA 3I63C 3B0XA 5J2CA 8ICJA 2K4EA 4AYBF 2BKRB 5JUMA 1L5UA 2IA6A 1ROEA 2VA8A 1XLNA 2RDBC 4I2CA 2Z7JA 4DSKA 8ICQA 3NS8A 3H7IA 2GBRA 2PMZC 3AMZA 2YVCA 3RYTA 3L0WB 1P7EA 4B9LA 4C0ZA 1RXVA 2N4FA 1RYSA 2FLPA 1C78A 4DOCA 2YMLA 1ZPSA 3VCBA 4KLMA 1D3ZA 5CA7A 4LDTB 4RQ1A 2KC1A 4GOCA 3QU9A 4TQRA 3B2FA 1SGHA 3PR5B 3MFHA 4QWBA 4JGHB 2BCRA 3NUHB 4MGYE 2RDJA 2RRDA 4IRDA 4P1BC 3ZI4A 4ANVA 1N56A 3A9KB 2BPGA 5J2DA 4GGQA 2XGQA 4P0PA 4BAXA 3T79A 4DXAB 1PVPA 4NLBA 4PGQA 2UVRA 4I2AA 2K8CB 1WR1A 5DGAA 2WX0A 3G6XA 1ZQXA 2D5GA 2KG5A 2W11A 5D3IB 3AE8B 5AIAA 5J0RA 3PTFC 2KZZA 1SKWA 2NBUA 3ZXRA 2J0JA 2LM4A 1Z2MA 4KV2A 1CUKA 3IRUA 4UAZA 3E56A 3DDCB 4O3MA 4Y2QA 4GXBA 2IY1B 4X57B 2NR2A 3Q8QB 1DRGA 4G50A 4I2FA 4J6IA 3V6HA 5C0YA 1K8RB 3WKEA 5DQIA 3Q3NC 2N1RA 3CSFA 2KJ8A 3KZIU 4Y2SA 5KFSA 1L3UA 4RF1A 3Q8EA 5CEHA 3Q3OC 1I4RA 2JF5A 3RRGA 4CF4A 3AECB 1BVSA 4O0IA 1C77A 3BVZA 1S1QB 5GTIU 5J8YA 2D6FC 4F50A 3RNFC 2D2QA 3AEVA 4ZRQA 4KMOB 9ICAA 1WXVA 1T4GA 1WZ3A 2ZPNA 3WKAA 5L95C 3BS7A 2KK0A 2KZRA 2JEFA 8ICKA 3TEXA 2HHXA 2FLLA 3TKAA 5E6PA 1S10A 4EBDA 1IBXA 3RBDA 2DX5B 2YEPF 4DCCA 2K8HA 3JPRA 4Q8FA 3AM9A 2D07B 4LK0M 3KOOA 1U4AA 3PS6A 3PX4A 3ZNZB 3AEAB 3AE7B 3T3NA 3RAXA 3EPGA 9ICEA 1IBXB 5CHVC 4F2RA 4K4HA 2MEKA 5HNKA 1RRBA 2W8LA 2G07A 4IRCA 3SD7A 5ALVA 2MX2A 4UB5A 5T14A 3UM9A 3QNMA 2WAQF 2YEPB 4KIKB 4BUGA 1EU4A 3QX1A 2VJ4A 1V8CA 4PS3A 3ZRCA 2K39A 2ZIWB 5IIOA 1TS2A 1WE6A 3PSFA 2ZUCA 3RT3B 3V05A 2FE8A 2V4RA 3U2SC 1KTQA 1M6YA 4RQ4A 5DG8A 3WK9A 1VRAB 2AWTA 1NYQA 4K1RB 2RPQA 2EKEC 1L7PA 2LHDA 4P4PA 1WZ0A 2DAFA 4EOYA 4DFKA 4G3XB 3IHQB 4I2DA 2INDC 3WK6A 1NJWA 2VH2A 5AM3A 3BQTA 4F3OA 1OFFA 1Y56A 1NDDA 2K8AA 4F4YA 3O0FA 2G0AA 3Q8KA 1TAMA 4M0AA 4WWMA 2EZZA 4GIBA 1TZOA 3MDCA 2F1HA 3N7RC 4MH0E 4U7CA 1KLNA 3DEEA 4ECQA 4R8UB 1NBFC 4FJZA 3ALRA 3MR5A 9ICNA 3RPFC 2P6UA 3DVNU 2WXQA 2OWOA 3N1XC 3SU8X 1IYFA 1L4DB 2I38A 2LXAA 1EWYC 1WJ6A 1LKYA 3IXSA 2Y5BB 3PSEB 3A33B 4Y2TA 3V3XA 2JUOA 1DK3A 5AHXA 3A0BU 3SFDB 2FUG1 4QZGA 2RR9A 3BVMA 8ICYA 3ENEA 4MHVA 4I2GA 4YXMA 3L08A 1RDFA 3SEIA 4FS1A 4XWTA 2NCNA 2JWZA 3LDAA 1N6ZA 2KHVA 2ZTEA 3HRDD 2UYZB 2QB0B 3DVGX 3HW8A 2H88B 1CZPA 4NJ7A 4O5KA 1RFKA 4M02A 2DZKA 4KLDA 1ZQ1C 1WGHA 2WXKA 4GDKB 2KDEB 1L7MA 1D8LA 1D9FA 2LGDA 1K51A 2QHOA 1LB2B 3NVWA 4YR3A 1BNOA 3PMNA 1VCBA 2I1KA 4UAYA 3GP7A 2L0FA 3A9JB 1WF9A 2I2YA 5KFQA 4AQ7A 3S2AA 1X66A 1PGBA 4XC2A 4JMUA 4KLGA 3L3FX 5L1KA 4WH4A 3PO0A 4FULA 5DQGA 2JEGA 2KVSA 2JXJA 4IDIA 1T6BX 5KFRA 2DHZA 2LVQA 1AW7A 2M8SA 1V97A 2PEAA 1YIWA 2LBOA 3NJTA 4DWFA 3HIZA 4CYEA 3OJ3A 1ZOLA 3RRHA 4OJPA 2HHVA 1P1AA 2M56B 2CHWA 5G5HA 5JU5A 1FIQA 2BDUA 2N7DA 2KMCA 2L8JA 4HPPA 4IC7B 1HXYD 2YY6A 3B9JA 2RD0A 3AEBB 5AK3A 4EBCA 1KLUD 2OOBB 1L8LA 1KSPA 1C1YB 5AM4A 2GBNA 3H0MB 3EA6A 4AP9A 3QAQA 2E8MA 3A1QB 4WWOA 1KRPA 3OLMD 3Q8SB 3KVFB 4ITKA 4UAUA 4I2HA 1WGYA 3RI7C 3FILA 1WGKA 4PHDA 1WE7A 3PY8A 2BPCA 4Z6FA 2ZJ8A 1AARA 4AYBC 4ZOHC 4QZEA 3APCA 3PHWB 3PVXA 2KMAA 3U7DA 5ALJA 2EAMA 5E6OA 3ISDA 3H4DA 1GB4A 4DOAA 5IIIA 3LYYA 1IPGA 5D6JB 1S3SG 4NV0A 4C80A 2L05A 2F3NA 3BQ1A 4F5PA 1XEEA 2BZFA 4M00A 5D49A 1B4FA 5IAAC 7ICQA 5ALOA 2KFJA 2R8IA 2OXOA 1YZ7A 3KH0A 3DBRI 4MEXA 5DBAA 1D6EC 3KWLA 3KKAA 4MGZE 1Q0WB 2LFIA 1GC7A 3TBLD 3NTUA 3GV5B 4GC7A 5E79U 1KTKA 2PFQA 2C60A 2WXIA 5AKKA 5BMGA 2K8BB 2XGPA 3QUCA 4BWJA 3PT2B 3V6KA 1Z19A 4ECXA 2MHJA 3ZLZA 1VZ7A 3C21A 3RNBC 3RZWC 3NASA 3GS2A 3TAQA 5GMVA 1ZD3A 1N63A 1QLBB 5DB8A 4CGZA 3ECIA 2P66A 3N4MB 4H2AA 2SEBD 3KW5B 3RFZB 4LTUA 2HTHA 5D3DA 3LYSA 2DGZA 4KGTA 2XNAC 1QCKA 1MA7A 2V4IB 4MF8A 2H3FA 5KG0A 5AM2A 1UWXA 4OZBA 5BYRA 2KJ9A 2KOBA 3IP4B 4AS1A 5KFUA 2H3QA 5FKAC 3K75D 1TTNA 3WKDA 4TUQA 4OVVA 4YTMB 2CU1A 3W1YA 4RZRA 3V7LA 4NL9C 3A4SC 1ZKHA 2D3CA 4TUUA 3V60A 4EZ9A 3UQ0A 5J8YC 4TQSA 1A5RA 4PH5A 5KT7A 3QUTA 2FLNA 4NAWA 1GJZA 4L23A 2O2VA 5KFEA 3AE5B 5KFZA 4DF4A 1O08A 1I4GA 1AN8A 2MSNA 4NAWB 1ZXIA 3PSPA 3L13A 2O2VB 4O1NA 3QUBA 1ESFA 2AL3A 5HR7A 5IOIA 5L1LA 1SL0A 3NGDA 2WF8A 5GTHU 4NWIA 3WK8A 2CJNA 2XBBC 2Y5PA 3ZDAA 4HJKA 2Q5WD 4FADA 4GXJA 4URKA 4DHZB 3AEFB 3PX6A 2K4IA 2KE7A 2V3SA 5DG9A 4J9MA 2VZKB 3ALBA 2WDRB 3RMKC 4NAMA 1ZQKA 4F8CB 2D10A 4MEYA 9ICOA 1SJHD 2IPKD 2HW3A 1WR6E 4RGMA 3BQ2A 4N58A 3ZQ4A 4OO1J 4KN7A 2WAQC 4GXKA 4JPSA 1C76A 4HKQA 3IG5A 8ICTA 2BGWA 2QLTA 1IG6A 3HILA 4M01A 2BYTA 5ALIA 5H2FU 2M17A 1RQLA 1WMHA 2A4ZA 1U47A 3R66C 2DPIA 2IO3B 4PGYA 4YD2A 4DXFA 3HM3A 4FZNA 4F72A 2Z59B 2ZCCA 2IHMA 3LJ3A 4QW9A 3Q8BA 4E71A 4CQNA 3BQ0A 4QWDA 1XQQA 4ASWC 4YSZB 4DK5A 1L0VB 4JIOU 3NRWA 4Q2JA 5CR0A 2LJ5A 2IOFK 4PS8A 1TV9A 3BJYA 3ZDDA 3WAOA 5DLGA 2ZVOA 3R2TA 3KTQA 4ICUA 3OJSA 3K9PB 4A6QA 4DL2A 3KHHA 1C20A 5J0TA 2KWCA 1GAQB 4QIWF 2MA9B 3UPQA 1V2YA 2W9CA 4MJSA 3UQAA 2C22A 8ICOA 5HHIA
chains in the Genus database with same CATH topology
2WXGA 1SE2A 2DLBA 2WDVB 5BMHA 1TKEA 1SSNA 2WXPA 3NRZA 2DBYA 4XDDA 2PTLA 3MFGA 4C7ZA 4TSSA 4ZRPA 1K53A 3AE1B 2N9LA 1T5XD 2LGIA 2JSVX 4OZAA 5H92C 3TUOA 3EUB2 2J52A 3R8BA 3URYA 4A90A 1XLPA 2N9KA 2W55A 1L0YB 1UWMA 2V3NA 4P6VF 2MJDA 2KACA 3VR8B 2SAKA 4RF0A 3NVVA 3P4QB 2K0PA 3KLSX 1NI3A 1YN4A 2QMTA 4KGSA 2INNE 1XLOA 1ENFA 1KRHA 1E7PB 3MJ5A 3W5UB 4RGOS 4ZHOA 1SIJA 2IGGA 1I4XA 2BB6A 1XCTL 2WQYB 1YQ3B 2X38A 4HEA1 4A8XC 1PGXA 2GI9A 2VZKD 3VRBB 4MACA 4MT5A 5AUIA 1CJEA 2HDEA 1FCCC 3BZDB 1EU3A 1ROEA 1K52A 1C79A 1XLNA 2NTSA 2J53A 2AQ3B 4ZYSA 2JZPA 2W54A 1FFVA 2BS3B 2WU2B 3AMZA 1P7EA 3VR9B 3AH7A 3U52E 5HFYA 1OQQA 3WCQA 1SXTA 1JWUD 2J42A 2RMMA 1C78A 1WSPA 1TS3A 4M0WA 4JX1C 1ZPSA 3PZ8A 2M0AA 3U7ZA 1SF0A 3B2GA 3LXFA 2IGHA 1JCKB 1NYRA 1MHHE 3B2FA 3SEBA 1FEHA 1KH0A 3NVYA 2IDYA 2W82A 3NUHB 3P63A 2WXLA 2G9HD 3AEEB 3T3OA 4RFBA 1SE3A 1ZDVA 1KFYB 1VR9A 2JX5A 2PMVA 4KKIA 3J9CA 4ARCA 2D5GA 1KF6B 3GB1A 5D3IB 4GLSC 3AE8B 2WXOA 3MP9A 3NZ3A 4JWUC 2ONQA 2LMCA 2QIEB 1DOYA 1ZUD2 3ZJUA 2WXNA 1TJEA 1MPEA 1UUPA 3E56A 4A55A 5BYSA 3PZ7A 2KDMA 3W9CB 1FNUA 5EE3A 1BUIC 1WRIA 2HTME 1V1PB 1QOBA 4ARIA 1SJED 4KX6B 1QT9A 4RF1A 1TY0A 3BIID 3MC0B 3Q8EA 4RGNA 1PGAA 4DXGA 4TQ1A 1I4RA 3AECB 2GRIA 1C77A 1BMLC 1ET6A 3BVZA 4L2YA 3TEZA 1JWMD 4PT5A 1TS4A 1HZ5A 4C56C 4HKZE 4ZRQA 4YXDB 2JXTA 1NEKB 1PYWD 1E6EB 3AE6B 2OHFA 4JWSC 1D5MC 1JQ4A 3TEXA 1A70A 1ET9A 3IAM1 3OWEB 1FXAA 3VRAB 2CJOA 1YQ4B 1LO5D 4UDUC 1V1OA 4NZLB 1IBXA 2YEPF 1FRDA 5FR3A 3AM9A 1DYQA 4LK0M 4REZA 2WDQB 1XLQA 2BW2A 2ZW1A 3AEAB 3N9YC 3AE7B 3T3NA 1IBXB 1L6VA 2MEKA 4N6EB 3DWMA 1JWBD 1E0ZA 1N62A 2YEPB 2W3SA 2WXHA 2QJLA 1EU4A 3LB8C 4RGTA 1V8CA 2BTEA 4XDCA 1J7CA 1L0XB 1TS2A 2RDHA 1JW9D 3ETRA 3DWGC 4WURA 3Q8CA 3V05A 2FE8A 3U2SC 2IJ0A 1I4PA 2Y5CA 1AWDA 1VRAB 2KN4A 1NYQA 1QF6A 2LHDA 1E9MA 4DQOC 2EKIA 1YN3A 2AQ1B 1SB3C 3P4PB 4B0MA 4YSXB 1Y56A 1OFFA 4YT0B 5TSSA 1R7SA 1QOGA 4WWMA 1E10A 1TZOA 1UGJA 2JYTA 1SEBD 4R3DA 1XCQL 2L32A 1NENB 1VJKA 1F2RI 1TY2A 3P1MA 1RYJA 4J3OD 3RPFC 4HROA 2WXQA 3BWUD 3AE4B 1L4DB 2I38A 1EWYC 4EE2A 3HUIA 4WAFA 1OQRA 3IXSA 1N61A 5HI1A 3V3XA 4YSYB 2DWQA 1K50A 4OZCA 1Q10A 3SFDB 2FUG1 3W5VB 3BVGA 3Q8AA 3BVMA 5MPOA 2PVOD 2INPE 2QEJC 4XWTA 1FFUA 3MHZA 3ZGZA 2PIAA 1MVKA 3HRDD 1IGDA 2H88B 1P7FA 1CZPA 5I4DA 1RFKA 1M4VA 2K3UA 2WXKA 4GDKB 1RM6C 1F2RC 1F0ZA 3ZJVA 1K51A 3NVWA 2PW9A 3GP7A 3BYTB 2GB1A 1C9FA 1ZP0B 1PUTA 3BK1A 1WWTA 1YJJA 1FRRA 2BT6A 2I2YA 1I4QA 4AQ7A 1PGBA 3E9SA 2K9XA 4WH4A 2LHEA 1HA5A 1QOFA 1SBBB 3PO0A 2ICIA 4L1BA 4US9A 2BB5A 4IDIA 1QOAA 1T6BX 2J4XA 2JYEA 3IAS1 3O13A 1AW7A 1TKYA 2R61A 1HQRD 1V97A 2FBWB 2BBCA 2IGDA 2NMQA 2M56B 1N5WA 4USAA 5G5HA 1FIQA 5JXVA 2WU5B 3SR6A 1I7HA 1HXYD 1ACCA 1YMHE 5GXGB 2JWUA 3B9JA 3AEBB 4US8A 3R2IA 1KLUD 5E6JA 4MH8A 1B9RA 2N0SB 2WLBA 4XWWA 5BYQA 3EA6A 2V0GA 4TMAB 1FD6A 3IT4B 1I4HA 1J7BA 4ITKA 4OW0A 1SE4A 2QSDA 4YWGG 3FILA 1WYGA 1WGKA 2K22A 3W2DA 2JU6X 3NVZA 2G1EA 3NS1A 4FXCA 5H8YE 1GPXA 1C4AA 4ZOHC 2DYOA 4MM3B 1FCLA 1KLGD 1D5ZC 1JRPA 2XN9C 4WIPA 3W1SA 2ZW0A 1VDVA 1EM7A 4KGRA 1GB4A 1XXGA 2WNMA 3LYYA 2MJ3A 4D2KA 4C80A 1YNTE 1FMAD 1IUEA 1XEEA 5C2TB 2OEDA 2V3PA 2Y3AA 4KKJA 1N60A 4YTPB 5EE1A 1JALA 3L4PA 2WXJA 2KAJA 1D6EC 3KWLA 1GOZA 1L4ZB 3EGRA 2LFIA 5BMIA 2LEKA 4IOIE 2MH7A 1MI0A 1KTKA 1HEZE 3UI3A 2WXIA 4LLGM 3ZJTA 5BMGA 5AUKA 4C7YA 2Z8LA 1L5PA 4P16A 4N59A 4NJCA 3AEDB 1VZ7A 2MJEA 3GS2A 2WP9B 1ZDXA 1N63A 2WS3B 1YJIA 1QLBB 1STEA 4H2AA 5EE9A 2SEBD 3RFZB 4LTUA 5D3DA 1JWSD 3AE3B 3P4SB 3TSSA 1TKGA 3P4RB 4KGTA 2XNAC 3FAHA 2BS4B 1C4CA 2V4IB 1PDXA 5BYRA 1UWXA 3BYYB 2L52A 4OZBA 4RNAA 3ZYYX 4IKGA 4AS1A 3Q69A 5FKAC 4OHJA 3TEWA 2L1AA 1F77A 5G5GA 3AB5A 4YTMB 5HHDG 1ZXHA 2DYMA 4TQ0A 1FNVA 2KWDA 1DOXA 2TSSA 1YN5A 1VZ8A 3CWIA 5D7GA 2LJIA 4HJGE 4L23A 3AE9B 2ACZB 1JWAD 3AE5B 5LNK1 1FM0D 3TEYA 1I4GA 3ABVB 3AEGB 1QILA 1AN8A 1XO3A 1EWCA 3BK2A 4NAWB 1ZXIA 2W3RA 1CQVA 2NTTA 1C4PA 3IT6B 3KWVA 4O1NA 2H89B 1TYGB 1ESFA 1NVID 1ZE3D 2CJNA 2Y5PA 2PVGC 1N5XA 2Q5WD 3HVZA 3VQIA 3H8HA 4XE0A 2PKOA 2E6XA 2WXMA 2RDGA 3AE2B 3AEFB 3Q8FA 2L83A 2VZKB 2KQ4X 2WDRB 4NAMA 1JMLA 2AQ2B 1T3QA 1TS5A 1MHXA 1HZ6A 1BXTA 1SJHD 1J7AA 2IPKD 2RPVA 4HRSA 4RGMA 4N58A 1UNSA 3ZQ4A 1IGCA 3I9V1 1D4BA 2WXFA 4OVZA 3P42A 5HG2A 4GDLB 1FO4A 1RWSA 4JPSA 1CK1A 1C76A 2K5PA 2PLPA 2QILA 1VLBA 1FXIA 3HVDA 4HKQA 1GB1A 1DGJA 3CIRB 2BYTA 1V1PA 1PFDA 3KQ4A 4ZHPA 3FC4A 4DXFA 3I57A 4RH6A 2JQRB 2LUMA 2BS2B 1JROA 3Q8BA 1QQRA 2AX5A 2EELA 1WXQA 4CQNA 1B1ZA 4YSZB 1ZOYB 1L0VB 2ON8A 4RCOA 4YTNB 3U4EG 4Q2JA 3AV8A 1D5XC 1AYFA 2CU3A 4WQMA 1XF5L 3R2TA 5T8IA 2B76B 3AN1A 1L6UA 4A6QA 1VZ6A 5FK9C 3FILB 3SFEB 2E3TA 1FNWA 2WXRA 2N7JA 1GAQB 3C8YA 5EE0A 2M19A 1QKZA 2KMMA 4B0EA 4JE3B 4A9AA 1DOIA 5C3JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QT9 A;  3HRD D;  5EE9 A;  2WDV B;  3BII D;  1TKE A;  4LTU A;  2H88 B;  3AE3 B;  1CZP A;  3NRZ A;  1TKG A;  2DBY A;  1RFK A;  3P4S B;  3P4R B;  3FAH A;  2BS4 B;  3AEC B;  1RM6 C;  4C7Z A;  1PDX A;  1F0Z A;  2L52 A;  3ZYY X;  3AE1 B;  3NVW A;  3AB5 A;  5G5G A;  4YXD B;  4YTM B;  5H92 C;  1ZP0 B;  3EUB 2;  1NEK B;  1E6E B;  1PUT A;  3AE6 B;  1WWT A;  1XLP A;  1FRR A;  1YJJ A;  2BT6 A;  2W55 A;  1UWM A;  2OHF A;  4JWS C;  4P6V F;  2MJD A;  1DOX A;  3CWI A;  2K9X A;  3VR8 B;  1A70 A;  1JQ4 A;  1FXA A;  3AE9 B;  3NVV A;  1QOF A;  2CJO A;  2ACZ B;  1JWA D;  1YQ4 B;  3AE5 B;  3P4Q B;  1FM0 D;  3PO0 A;  1NI3 A;  3ABV B;  3AEG B;  1XO3 A;  2WS3 B;  4US9 A;  1KRH A;  1XLO A;  1ZXI A;  1E7P B;  2W3R A;  3AM9 A;  1FRD A;  1QOA A;  4IDI A;  3W5U B;  1TKY A;  4ZHO A;  2WDQ B;  1V97 A;  1SIJ A;  1XLQ A;  1TYG B;  2FBW B;  2H89 B;  3AEA B;  1NVI D;  3AE7 B;  2M56 B;  1L6V A;  1N5W A;  4USA A;  1YQ3 B;  2WQY B;  5G5H A;  2CJN A;  4N6E B;  1FIQ A;  2PVG C;  1N5X A;  2Q5W D;  3HVZ A;  3VRB B;  2WU5 B;  3SR6 A;  3DWM A;  1JWB D;  1E0Z A;  1I7H A;  1N62 A;  2PKO A;  1CJE A;  5AUI A;  5GXG B;  3AE2 B;  3B9J A;  3AEB B;  4US8 A;  2W3S A;  3AEF B;  1B9R A;  2QJL A;  3LB8 C;  2L83 A;  2N0S B;  1V8C A;  1ROE A;  2WDR B;  2WLB A;  1XLN A;  1T3Q A;  1J7C A;  1JW9 D;  4KX6 B;  2W54 A;  3ETR A;  3DWG C;  1J7B A;  1FFV A;  2BS3 B;  1J7A A;  3AMZ A;  2WU2 B;  4ITK A;  4HRS A;  4N58 A;  3AH7 A;  3VR9 B;  1OQQ A;  2Y5C A;  1AWD A;  1WYG A;  1WGK A;  2K22 A;  3WCQ A;  1NYQ A;  1QF6 A;  3NVZ A;  2G1E A;  3NS1 A;  4FXC A;  1FO4 A;  1RWS A;  4JX1 C;  5H8Y E;  2K5P A;  1GPX A;  1VLB A;  4ZOH C;  1E9M A;  1FXI A;  1SF0 A;  1DGJ A;  2EKI A;  3CIR B;  3B2G A;  3LXF A;  1PFD A;  1JRP A;  1VDV A;  1NYR A;  1SB3 C;  4ZHP A;  3B2F A;  3FC4 A;  3P4P B;  2JQR B;  3NVY A;  4YSX B;  2BS2 B;  1OFF A;  2MJ3 A;  1JRO A;  3P63 A;  4YT0 B;  2AX5 A;  1R7S A;  4C80 A;  1QOG A;  3AEE B;  4WWM A;  1E10 A;  1FMA D;  1IUE A;  1KFY B;  5C2T B;  1WXQ A;  4YSZ B;  2JX5 A;  1N60 A;  1NEN B;  1ZOY B;  1VJK A;  4YTP B;  1L0V B;  5EE1 A;  1JAL A;  3P1M A;  1RYJ A;  4YTN B;  3L4P A;  3AV8 A;  3RPF C;  4HRO A;  2KAJ A;  1KF6 B;  3KWL A;  1AYF A;  2CU3 A;  3AE4 B;  3AE8 B;  4WQM A;  1EWY C;  3HUI A;  1OQR A;  2LEK A;  2B76 B;  1N61 A;  2MH7 A;  3AN1 A;  1L6U A;  4JWU C;  4YSY B;  3SFE B;  2DWQ A;  2QIE B;  1DOY A;  1ZUD 2;  2E3T A;  5AUK A;  1TJE A;  3SFD B;  4C7Y A;  3W5V B;  1L5P A;  1GAQ B;  4N59 A;  3W9C B;  5EE0 A;  3AED B;  5EE3 A;  3VRA B;  2M19 A;  2PVO D;  2KMM A;  5MPO A;  2MJE A;  1FFU A;  1WRI A;  2HTM E;  2WP9 B;  4A9A A;  1DOI A;  1QOB A;  2PIA A;  1N63 A;  5C3J B;  1YJI A;  1QLB B; 
#chains in the Genus database with same CATH topology
 2RLT A;  2JVC A;  2WXG A;  5L1M A;  4MGK E;  4Y2Y A;  2KX0 A;  1SSN A;  2MU2 A;  9ICS A;  2WXP A;  3NRZ A;  4Z6D A;  4I29 A;  2BQ3 A;  3RJI A;  2HBK A;  3IDW A;  1V38 A;  4PS7 A;  1YX5 B;  2O6V A;  4UW9 A;  2J6T A;  3IFW B;  3TI0 A;  2DF4 B;  4HLE A;  2N9L A;  4B9S A;  7ICL A;  2LGI A;  5J0O A;  3TAN A;  3ZXV A;  3TUO A;  3URY A;  1T0S C;  1NK8 A;  2KYW A;  1UBI A;  4P6V F;  2PJH A;  1E7V A;  5FP0 A;  2KTF A;  2D3G A;  3DOW A;  3RNE C;  2F8K A;  2SAK A;  4FJY A;  2LGS A;  4DFP A;  3PV1 A;  2K4P A;  3KLS X;  2XCA A;  2FMP A;  3B1L X;  3E0F A;  4KGS A;  3MJ5 A;  4AP4 C;  1WGD A;  3D2Q A;  2IO1 B;  1TAU A;  1TIF A;  4CE6 A;  4TUR A;  3P2B A;  5ALD A;  1XCT L;  2WQY B;  4QJF B;  5J2A A;  5KFH A;  1BPB A;  4DS5 A;  2LM1 A;  3AU6 A;  3VRB B;  3DHI C;  2HVI A;  1GNU A;  3ORY A;  2ES6 A;  2GBK A;  2I1Q A;  3KD3 A;  2BCQ A;  2AL6 A;  2BF8 B;  3V6J A;  4J9Q A;  2HDE A;  1FCC C;  3ZNI D;  4DL4 A;  1C79 A;  9ICV A;  1KBU A;  3MGV A;  7ICN A;  7ICU A;  2BHN A;  5IIN A;  2W04 A;  2JZP A;  3ED5 A;  4RQ2 A;  4DL5 A;  3V7K A;  1UD7 A;  1Z1B A;  4F4K A;  3U52 E;  1UH6 A;  3VR9 B;  5HFY A;  1OQQ A;  8ICN A;  3QCA A;  3U30 A;  2J42 A;  2RMM A;  3PML A;  3ZW3 A;  4JX1 C;  3U7Z A;  2V1Y A;  3M62 B;  1IIP A;  3QU5 A;  5BOL A;  4J9P A;  2R8K A;  1CI4 A;  3B2G A;  1OEY A;  3LXF A;  4IQU A;  4KIT B;  4IQT A;  7ICS A;  1NYR A;  1MHH E;  1QQ6 A;  4GSW A;  5AI9 A;  1FEH A;  3NVY A;  1V9P A;  1KH0 A;  3T5J A;  2FIF A;  1L7N A;  3RJJ A;  3P63 A;  3RJF A;  2G9H D;  3AEE B;  3T3O A;  1WJ4 A;  4RFB A;  4ANU A;  2FMS A;  4DOB A;  2GOL A;  3MC9 A;  5D46 A;  1E7U A;  4C8O A;  4ECR A;  4C8M A;  8ICL A;  4KKI A;  4PHP A;  2RP5 A;  5DPS A;  1I42 A;  1ZGU B;  4KVG B;  1KF6 B;  2HBM A;  3N28 A;  2WXO A;  5KFA A;  4B9T A;  3F5E A;  1V85 A;  2J7Q B;  3QYP A;  4JWU C;  1BGX T;  2LMC A;  1K1Q A;  1ZUD 2;  2WXN A;  3EFC A;  2ZIX A;  5KFM A;  1UUP A;  4M6W A;  4FBU A;  4A55 A;  3PZ7 A;  3QEB Z;  8ICI A;  5J0P A;  1E90 A;  5AI5 A;  2I9G A;  1BUI C;  1WRI A;  2R8J A;  2ZIX B;  1NOM A;  4DFM A;  1ZD5 A;  9ICH A;  1R4M I;  2WGS A;  4KX6 B;  2KN7 A;  5KG3 A;  3M63 B;  1DOQ A;  1PUZ A;  4YD1 A;  3PR4 A;  3UXN A;  1NK9 A;  1ET6 A;  2LI5 A;  4K3C A;  4JK1 A;  4LZG A;  2KTQ A;  3C1Y A;  1TS4 A;  1HZ5 A;  4C4S A;  4HKZ E;  3R9K A;  1HEK A;  3DPD A;  4B95 A;  1WI0 A;  3JPO A;  9ICQ A;  4JV2 A;  3FDS A;  4DQQ A;  1D5M C;  3VFK A;  3ZTD A;  1JQ4 A;  4PL1 A;  1PK1 B;  4EUT A;  2KC2 A;  1V1O A;  4NZL B;  2MBE A;  5J0Q A;  3Q3J A;  1NK0 A;  3NZU A;  4J9L A;  2QAR B;  3OGU A;  3NY5 A;  7ICT A;  4LNF A;  4EZK A;  3Q8M A;  2ZNV C;  2A1A A;  2LAS A;  4N6E B;  2WFA A;  8ICP A;  5DPT A;  3R7Q A;  4HVB A;  1JN3 A;  2KKV A;  3M8S A;  1X9W A;  2LVP A;  1BT0 A;  4W9K A;  4CO7 A;  3ZIM A;  2EAN A;  2R8H A;  2QJL A;  3LB8 C;  4OJ5 A;  2BTE A;  1KL9 A;  4XDC A;  2QCZ A;  2FUH B;  3APD A;  1ED1 A;  5J2J A;  3UIP B;  3ETR A;  4WUR A;  1E8W A;  2BQR A;  3OAW A;  3LVW A;  1S76 D;  2IJ0 A;  2JHD A;  1ZQP A;  4A8E A;  2HSZ A;  3WK5 A;  1AWD A;  5AIB A;  1I4P A;  2KVR A;  2Y5C A;  4YMN A;  2DQN B;  4HDQ A;  4DQI A;  3VUX A;  2AHO B;  4ACF A;  2N7E A;  3VTV A;  3VTW A;  2CRX A;  2VA2 A;  5DG7 A;  3PPA A;  2KN5 A;  3OSN A;  3AI5 A;  2E8O A;  2IHN A;  2LXC A;  3PVL A;  2VRR B;  2FPK A;  5KG5 A;  3UMC A;  4B0M A;  1UA1 A;  4YT0 B;  5TSS A;  3KHG A;  4AWJ A;  2A19 A;  2XI9 A;  3C1Z A;  1ZQB A;  2A1J A;  1YT3 A;  2HOQ A;  2I6X A;  1TZ1 A;  1NEN B;  2Z0E B;  2KFN A;  1A6S A;  1F2R I;  5DCN A;  3P1M A;  5HHH A;  3TIX A;  3AQE A;  3JVZ X;  1S9F A;  1K1S A;  1ZQE A;  1OXJ A;  2DUY A;  5KL8 B;  4EE2 A;  3BZK A;  4J9O A;  1OQR A;  4XYC A;  2DAJ A;  5HI1 A;  4RPZ A;  5F9N A;  2DWQ A;  3B0Y A;  4OZC A;  2CN1 A;  1Q10 A;  4RQ6 A;  4PHA A;  1NZP A;  3VUY A;  2L0T A;  3BVG A;  2HMX A;  1Z4O A;  2OYY A;  2ZIV A;  2INP E;  3VH4 B;  4LNO A;  2QEJ C;  3ZNH B;  4NY8 A;  2WF7 A;  3M6Z A;  5KT2 A;  3PGE A;  1ZQV A;  1NJZ A;  2PIA A;  3ZGZ A;  3H8S A;  1LXD A;  1R4M B;  1UT5 A;  4MEM A;  7ICG A;  1MVK A;  2ZIV B;  1IGD A;  3W1S C;  4OVU A;  3VHT C;  2HHS A;  1XO1 A;  1J19 A;  3G6V A;  2WYQ A;  4P0P B;  1E8Y A;  1MFW A;  2K3U A;  4QAY A;  5J17 A;  1ARO P;  2XIC A;  2X8X X;  4QIW C;  4CRX A;  1DXS A;  1QSS A;  4EKU A;  1WH3 A;  4I28 A;  3RNG C;  3BK1 A;  1WWT A;  1YJJ A;  2FE9 A;  3EYZ A;  2ZVN A;  1I4Q A;  2MBQ A;  2AGQ A;  4K81 A;  1SXD A;  1WX9 A;  4RM9 A;  3ZO5 B;  2ICI A;  4L1B A;  1TK0 A;  4EYH B;  4HCP B;  2KP7 A;  4C8K A;  4US9 A;  4PPX A;  2VAN A;  1P3Q U;  1QOA A;  4O3S A;  2HHU A;  2BB5 A;  3IAS 1;  1TKY A;  2R61 A;  2KNB A;  1HQR D;  4YR2 A;  4MFC A;  2ZZP B;  3V6E B;  1KM7 A;  1N5W A;  4USA A;  2O6V D;  4HK2 A;  3VTU A;  3NUQ A;  2JZZ A;  3AU4 A;  3SR6 A;  2JEJ A;  8ICX A;  5ALX A;  1IV8 A;  4RT2 A;  4QZB A;  2JEI A;  3RJE A;  2MUT A;  8ICF A;  2CPR A;  1YMH E;  5GXG B;  3QA8 A;  1XT9 B;  4YXJ A;  3H0R B;  2P6R A;  5ALT A;  1ZRN A;  1JRU A;  2N0S B;  3VXW A;  1V49 A;  1X2I A;  4R64 A;  1X40 A;  2WLB A;  5J0U A;  4B6W A;  2K4H A;  2MUT B;  2Y1J A;  2KZ3 A;  3IT4 B;  1A76 A;  4JQW C;  4I2J A;  1Y88 A;  1QSY A;  4M9H A;  4EZ6 A;  2H3Z A;  2QSD A;  2YB4 A;  4YWG G;  1J8C A;  1GO3 F;  1EXN A;  3KFU F;  2MRP A;  4CHK A;  4OD0 A;  4MEL A;  3ZDB A;  2JU6 X;  3NVZ A;  3SAH A;  4XA5 A;  2G1E A;  4IUM B;  3WK7 A;  2WDT B;  5TR5 A;  5H8Y E;  4R63 A;  2KIW A;  1PVR A;  2YB1 A;  1ZQM A;  3GDX A;  1VDV A;  1F5S A;  1A0P A;  4KGR A;  1YX6 B;  5AM0 A;  1XXG A;  2WNM A;  4DDI D;  2Q0Z X;  2QKQ A;  2NO4 A;  2MJ3 A;  1F1H A;  2NBV B;  1L6N A;  2EAP A;  1YNT E;  2K6D B;  3TAP A;  3I5J C;  3QX7 A;  2H3I A;  4ED6 A;  1IUE A;  2BGF A;  2OED A;  2V3P A;  3M6K A;  1N60 A;  3MR2 A;  1FXT B;  1S8O A;  2F8L A;  5ALP A;  4I2B A;  3N7S C;  2W8K A;  4F4X A;  2KAJ A;  4BX9 C;  2NRT A;  1L4Z B;  3MHS D;  2MH7 A;  2G45 B;  3UI3 A;  3WU2 U;  1Z00 A;  1TVA A;  1BPX A;  3Q8R B;  4XX5 A;  4C7Y A;  5L9X A;  1L5P A;  4P16 A;  1XSN A;  4N59 A;  4NJC A;  3AQF A;  3QUQ A;  5KFP A;  5IIL A;  2MJE A;  4UAT A;  1Z00 B;  4EEN A;  4GLX A;  1ZDX A;  5DB9 A;  4I27 A;  3ZTC A;  5JZE B;  1STE A;  2KEY A;  3DHG C;  1JX4 A;  5EE9 A;  3RNC C;  4K4G A;  3AE3 B;  3TSS A;  3V62 A;  2HDO A;  2D3A A;  5J2H A;  2ISP A;  1C4C A;  2NV3 A;  1PDX A;  2ESE A;  2CHX A;  1HJP A;  3HPO A;  9ICC A;  1SWW A;  3OPX A;  4QZI A;  3OHA A;  4OCZ A;  2L1A A;  3AB5 A;  4DFD A;  4GU2 A;  4NLK A;  1ZXH A;  4LNI A;  4ECT A;  1TK8 A;  1LKY B;  3QZ8 A;  4E0D A;  1FNV A;  2TSS A;  3M3J A;  2AJQ A;  4HJG E;  4UB6 U;  1UA0 A;  3RB4 A;  4F5O A;  3PRE A;  2ACZ B;  3CMM B;  3L17 A;  5DQH A;  3Q8L A;  2KMD A;  2FJ6 A;  3TEY A;  2LUE A;  3AEG B;  1XO3 A;  3HKZ F;  3CST A;  4BJQ A;  1C4P A;  2F1J A;  3IT6 B;  3KWV A;  9ICB A;  4F4W A;  2H89 B;  2JMG A;  4F5N A;  1NVI D;  1WUD A;  4DQS A;  3V6C B;  4GXI A;  5ALG A;  2AQ4 A;  7ICK A;  1E8Z A;  3VQI A;  4RNN A;  3SQI A;  3RJK A;  2LZ6 A;  2ZUB A;  4MSM B;  4NLC A;  2PKO A;  2E6X A;  2WXM A;  3AE2 B;  1XSL A;  3TAD A;  1WIA A;  1S0V A;  2F76 X;  3Q8F A;  4BKG A;  2YMQ A;  2OM6 A;  2JRI B;  1M94 A;  4Q45 A;  4UB8 U;  2J6S A;  5D2M B;  4RQN A;  2EMS A;  3DDH A;  5CHW A;  1S0M A;  3UXO A;  2WTF A;  2XY6 A;  1TS5 A;  4NLN A;  4ANW A;  3KZX A;  4JUZ A;  3PST A;  2RPV A;  3J81 j;  1UQV A;  2ZJ5 A;  3RH6 A;  3M9N B;  1LVH A;  3I9V 1;  1WY8 A;  5F3X B;  4EX7 A;  5TZV A;  1FO4 A;  1RWS A;  4DO9 A;  4ED2 A;  2LRW A;  4QZF A;  1WM2 A;  4DQP A;  3UMB A;  3HWT A;  1YOV B;  1V1P A;  4Y2X A;  1PFD A;  3SAG A;  2CXY A;  5KFL A;  4F91 B;  4XRH A;  1KJT A;  5EWG A;  4M9L A;  2C7H A;  3I57 A;  4RH6 A;  3TCA A;  4AJY B;  1HUO A;  4ELV A;  1TGZ B;  2BS2 B;  1HIW A;  3N32 A;  1ZW7 A;  2ZXH A;  2AX5 A;  5KFY A;  3LDZ E;  4JV0 A;  4K3B A;  5KFN A;  1SWV A;  8ICZ A;  2PPH A;  3FKY A;  2JZ3 B;  1ZOY B;  4O5E A;  4RCO A;  4YTN B;  3U4E G;  3QZ7 A;  1BPD A;  2ZTD A;  4DSE A;  1D5X C;  1FPY A;  1ZJM A;  4A3P A;  4ZYN A;  3I1Y A;  5T8I A;  1KFS A;  4Y2P A;  3SHQ A;  2C2R A;  4K7S A;  5FK9 C;  3SFE B;  5EWE A;  3FIL B;  1B22 A;  4QZC A;  1N48 A;  2M0N A;  3CRX A;  7ICM A;  2N7J A;  3C8Y A;  1S0O A;  4KDI C;  2XID A;  9ICR A;  2FMQ A;  2KMM A;  2BCS A;  4JE3 B;  3PHX B;  3UIN B;  2ASJ A;  5AZG A;  3GIJ A;  4XQ8 A;  3RH4 A;  1EUV B;  2C2D A;  1T7P A;  3KHR A;  1BNP A;  3RN9 C;  3OG5 A;  2FCN A;  3F2B A;  2DLB A;  2WDV B;  2V4L A;  5BMH A;  3AU2 A;  4Q8E A;  3LWM A;  2ZJD A;  1ZRM A;  3DBH I;  4XDD A;  8ICE A;  2GOW A;  5AKL A;  2YX8 A;  4QW8 A;  5BOM A;  3C5G A;  4YFK A;  3H40 A;  2ALZ A;  3MFG A;  4C7Z A;  2N9X A;  2UU7 A;  3M95 A;  4DBG A;  1V86 A;  2FCM A;  5AEK B;  4ZRP A;  1K53 A;  2VA3 A;  3PV8 A;  1TE2 A;  3ONN A;  3PNC A;  3K4G A;  4OZA A;  1AQ6 A;  5H92 C;  1COO A;  5AIC A;  4A90 A;  4P0Q A;  1OTR B;  3VC8 A;  1QH9 A;  4FZM A;  5JTI A;  2N9K A;  2W55 A;  1ZQF A;  1L0Y B;  4RNM A;  4KSK C;  1F0M A;  4QWE A;  4G0N B;  1NK4 A;  1RPL A;  3V7J A;  4U6P A;  4GB9 A;  3F2D A;  4PGX A;  3MC8 A;  1NI3 A;  2KAN A;  2QMT A;  4Y2J A;  1XD3 B;  1XLO A;  2WF9 A;  5ALU A;  4KLS A;  3F5A A;  2IGG A;  1I4X A;  2RHF A;  2EQY A;  2BB6 A;  3AU5 A;  3IG8 A;  1YQ3 B;  2X38 A;  2KDI A;  2GI9 A;  5AI8 A;  8ICA A;  3FM9 A;  2PFN A;  4G11 A;  1RFA A;  4MAC A;  4Z6C A;  2UVV A;  4II2 B;  5AUI A;  1CJE A;  5AZH A;  8ICM A;  3BY4 B;  4O3Q A;  1JMS A;  3AUL A;  2BKE A;  2IYD B;  3BZD B;  4ZDV A;  1K52 A;  2KIV A;  4QNL A;  9ICI A;  1T0Y A;  2BPS A;  2J53 A;  2AQ3 B;  4EZJ A;  4ZYS A;  4BKS A;  1KDH A;  3M7D A;  1MJD A;  4B9K A;  4C00 A;  2ISO A;  2Y9U A;  1A77 A;  5ALQ A;  7ICR A;  1SXT A;  2OCE A;  3TAR A;  1WSP A;  1TS3 A;  5ALY A;  5ALR A;  3HJE A;  4O3P A;  3PRM B;  5CX3 A;  1SF0 A;  1V5T A;  2LMR A;  5A0L A;  2G4D B;  2WX1 A;  2IGH A;  2F44 A;  1JCK B;  3QE9 Y;  3PW5 A;  5DB7 A;  2Y0S F;  3UMG A;  4ACO A;  4RNO A;  4FBT A;  2W82 A;  1T0R C;  2IDY A;  4DLG A;  5J0Y A;  4C4T A;  1QQ7 A;  2WXL A;  4I2I A;  4R66 A;  2OJW A;  9ICF A;  3RAQ A;  1SE3 A;  1ZDV A;  1KFY B;  4DFJ A;  2MP2 A;  1WM3 A;  1VR9 A;  4BOZ B;  4BBN F;  2WF6 A;  2JX5 A;  2QB1 A;  3IHP C;  1J0G A;  2W7O A;  5CWR A;  1UZX B;  2PMV A;  4KMU A;  5KFI A;  1WGG A;  3N20 C;  3OSP A;  4LVS A;  1PQS A;  2MP2 B;  3GB1 A;  4M9N A;  4GLS C;  4C8N A;  3UIO B;  4YN4 A;  5KT6 A;  2W9B A;  3MP9 A;  2BQU A;  4IW0 A;  2LHT A;  3H8M A;  4IM0 A;  4NM1 A;  2BVC A;  1UEL A;  3DVN V;  3R3M A;  3ZJU A;  1TJE A;  2H3V A;  4UBB A;  1SE9 A;  3E2E A;  1MPE A;  4HYK A;  3AXC A;  3VDZ A;  5BPC A;  5BYS A;  3I76 A;  2KDM A;  3W9C B;  4C4V A;  1FNU A;  1Q8K A;  2KIC A;  2EZY A;  4IQV A;  5AKX A;  4PL2 A;  5IIM A;  5ALN A;  2OH2 A;  4KLU A;  1UHU A;  3AL0 B;  3TFS A;  2N1W A;  3ML9 A;  4HCN B;  4ARI A;  1WMH B;  4GFJ A;  1BPZ A;  1QT9 A;  2ZJA A;  1X6J A;  3EC8 A;  4C4V B;  3BS5 A;  3BII D;  3MC0 B;  3H7P A;  4RGN A;  1L3T A;  2BR0 A;  2NPT A;  1PGA A;  5DDM A;  4KLT A;  1IXR A;  1MC8 A;  2E8P A;  1OEY J;  3DBR B;  3ONS A;  1BML C;  3ZDM C;  3RFA A;  3TEZ A;  1JWM D;  3UXP A;  2NPT B;  2AGP A;  4O3R A;  5G2N A;  1X9X A;  9ICJ A;  1V81 A;  2UVU A;  2N9E B;  5KFX A;  2JXT A;  1NEK B;  1PYW D;  4I6P A;  3AE6 B;  2KTR A;  1OW5 A;  2YMM A;  2Y1I A;  4JWS C;  3H8W A;  1NZB A;  7ICF A;  4NY0 A;  3UQB A;  1A70 A;  4TKN A;  1FXA A;  2IOF A;  1YQ4 B;  3OHB A;  2KTR B;  3H8J A;  3ZKJ C;  1ZQR A;  4UDU C;  4ANX A;  4IM3 A;  4MJS B;  2W9C B;  3RB3 A;  1FRD A;  4MM3 A;  1DYQ A;  4REZ A;  1XLQ A;  2BW2 A;  4RQM A;  3N9Y C;  3I28 A;  3NZS A;  4M2Y A;  1ECW A;  4PYU A;  4W9F A;  2WHI A;  1EO6 A;  4G9B A;  2NVU I;  2JH7 A;  1B43 A;  1JWB D;  3DWM A;  1N62 A;  4W9D A;  2DKX A;  2JRZ A;  4DSI A;  1LV5 A;  2O6V B;  1XS9 D;  2BYV E;  3HKZ C;  1DGS A;  2ZIU A;  4W9G A;  5J2B A;  2RQ5 A;  1J7C A;  1L0X B;  2FID A;  4F4Z A;  1JW9 D;  5KFC A;  3T9L A;  3Q8C A;  5AM1 A;  3C2K A;  1S5L U;  2XEW A;  1WWU A;  3JSV A;  4YL8 A;  2DZJ A;  2KN4 A;  1QF6 A;  4RUC A;  2GH1 A;  4OJ6 A;  5JHB A;  2ASQ A;  8ICB A;  4S0R A;  3JSV B;  4DQO C;  5LXI B;  2YQE A;  5AI6 A;  2MA1 A;  2XK5 A;  4RPY A;  1PVQ A;  3GQC A;  3P4P B;  2I5H A;  2KSO A;  4NM2 A;  3WAM A;  4UB1 A;  4F5R A;  2DPJ A;  1QSL A;  3T8M A;  3F2C A;  3PO4 A;  1V9J A;  4YSX B;  1WX7 A;  2KFK A;  2XK5 B;  4B9N A;  1E10 A;  2KSO B;  8ICG A;  4IWP A;  2C5L C;  1XCQ L;  1QZE A;  2L32 A;  3OJ4 B;  1VJK A;  2K1F A;  2KFK B;  4M9J A;  1TY2 A;  5IP4 D;  1RYJ A;  2MWS B;  4J3O D;  2A3V A;  1SKR A;  2IO2 B;  4HRO A;  1T3N A;  3GU3 A;  1TBE A;  1NNL A;  4KTQ A;  3AE4 B;  3BWU D;  3G6Y A;  2PE6 B;  2BWF A;  2L76 A;  4KSL C;  1PK3 A;  4WAF A;  2KD0 A;  3C2L A;  5C23 A;  4UB2 A;  4TUS A;  3H4B A;  2DZI A;  4YSY B;  2ZUD A;  1F44 A;  2NS5 A;  2LGY A;  2ODG A;  1JIH A;  3Q8A A;  4QZ9 A;  3NOB A;  2PVO D;  5EDS A;  5KHO A;  3C19 A;  4P4O A;  3UGB B;  1XWL A;  5ALW A;  4DHJ D;  1UF0 A;  4AJW A;  4KLO A;  2WF5 A;  4DLE A;  4YG2 A;  4DSJ A;  4KLE A;  5J2R A;  4OJL A;  1RXW A;  2G4S A;  5I4D A;  3BZC A;  2IBK A;  2JRH A;  3RB0 A;  3D2S A;  1RM6 C;  1ZQL A;  1F0Z A;  3QU2 A;  3EZ5 A;  2L5Y A;  2QC8 A;  3C0R B;  2DL0 A;  3THV A;  2PW9 A;  4CCH A;  1NJY A;  3BYT B;  1SV0 A;  3O65 B;  1ZYQ A;  3C28 A;  3PZD A;  4E74 A;  1PUT A;  2BT6 A;  1FRR A;  2KOX A;  1QQ5 A;  3KKA C;  5CHF A;  4J9K A;  1KEJ A;  1UBQ A;  1MN8 A;  2K9X A;  4FE3 A;  4DDG D;  5KL1 B;  2LHE A;  4M9G A;  3V72 A;  2KO3 A;  4M6W B;  2JZB A;  4GDL A;  2W9N A;  4AOF A;  3EPI A;  4O9M A;  5KHQ A;  2J4X A;  3TAC B;  4QZH A;  2XY5 A;  4NLZ A;  4DL7 A;  2JYE A;  4EX6 A;  4MFF A;  5B5E U;  2FBW B;  2ZCB A;  4RPX A;  3T5K A;  5KG7 A;  2BBC A;  3TMP B;  4Y2U A;  4LJP B;  5KT4 A;  2D3D A;  2PFO A;  4JWM A;  5AI4 A;  4C4R A;  3ISC A;  2WU5 B;  2KJ5 A;  1U48 A;  2FPL A;  1I7H A;  2C7M B;  2JWU A;  3QK0 A;  4KDL B;  1B9R A;  5E6J A;  4RQ7 A;  4MH8 A;  1X6I A;  4F71 A;  1CMX B;  4ICA A;  2NRW A;  3PRZ A;  4WJO A;  4UAS A;  4XWW A;  5BYQ A;  1XC9 A;  3QHT A;  1WCL A;  4PK1 A;  1FD6 A;  1KFT A;  3SEN A;  4XZ4 A;  5J2G A;  4LCD E;  8ICR A;  4OW0 A;  4K7W A;  4ELT A;  1WYG A;  5AKI A;  1ZJN A;  2K22 A;  3SZ2 A;  1Z1V A;  1LM8 B;  2VIX A;  3W2D A;  4S17 A;  3CW2 C;  4FXC A;  5AK6 A;  5DGB A;  3MGH A;  2XVT A;  1C4A A;  2DNF A;  5TIS U;  1D8B A;  1D5Z C;  1JRP A;  2XN9 C;  1ZQD A;  4WIP A;  1PZN A;  5DLF A;  4CNQ A;  1P0R A;  1H8C A;  4PZN A;  5KT5 A;  1WFY A;  3RBE A;  4D2K A;  4ECY A;  5KT3 A;  2HOI A;  1FMA D;  3FYH A;  4ELU A;  3Q14 C;  4LNN A;  5C2T B;  3SD5 A;  4BKS D;  4BGD A;  4ECU A;  3I3T B;  4ECV A;  5EE1 A;  4WJP A;  1JAL A;  3L4P A;  4MF2 A;  5AZF A;  2HHW A;  4IWQ A;  1GOZ A;  3ZUN A;  3N97 B;  1YQB A;  2KKP A;  4MGI E;  2Y0S C;  4ED0 A;  2ATL A;  4IOI E;  2JY6 A;  2YLM A;  1MI0 A;  1HEZ E;  4LLG M;  4EBE A;  2EMT A;  3ZJT A;  2Z8L A;  2HE7 A;  2B0C A;  3B0A A;  3L16 A;  4KZ0 A;  4P1C C;  1QTM A;  3N7P D;  3ZDC A;  4BBN C;  1HTQ A;  2UWQ A;  2Z0D B;  3GIM A;  2GO7 A;  5KFD A;  3M8R A;  4DL6 A;  2WP9 B;  2DFL A;  5KG6 A;  5AKJ A;  1ZD2 P;  3RTV A;  5HR6 A;  5KFK A;  1WYW B;  3HHM A;  1WG8 A;  3ZNG C;  2O6K A;  3QC8 B;  2FAZ A;  1JWS D;  3P4S B;  2H5X A;  3MC1 A;  4FS2 A;  4FN2 A;  2AH5 A;  2Q4T A;  1HUZ A;  2F77 X;  2A1J B;  1LQB A;  2DEN B;  2G5H B;  3BYY B;  2L52 A;  4DS4 A;  4XGA B;  1COK A;  2HJ1 A;  2EH9 A;  4IC9 A;  3PLU A;  4PJ0 U;  3DQV A;  2HHT A;  4OHJ A;  3IM1 A;  3WA0 A;  3TEW A;  5G5G A;  5FR6 A;  5KFB A;  5DBB A;  5HHD G;  5ALE A;  3RUI B;  3H6N A;  4QWC A;  3GFK B;  2BPF A;  5AM5 A;  4TQ0 A;  1RZT A;  4RUA A;  3GIL A;  1P98 A;  3EW9 A;  2KWD A;  1J2N A;  1VZ8 A;  3CWI A;  1DOX A;  2G09 A;  3TQ1 A;  5LNK 1;  3MDA A;  3ABV B;  3GE8 C;  3RCZ A;  1EWC A;  3BK2 A;  1BPE A;  1CQV A;  3ETL A;  4Y2R A;  1X9M A;  4RQ8 A;  2F2A B;  1U49 A;  1MSW D;  4RQ3 A;  1OUQ A;  1Q5W B;  1UCV A;  3JPT A;  4FJV B;  3MFI A;  3SYZ A;  2PVG C;  1N5X A;  4QZ8 A;  2NBW B;  3IN5 A;  3A9K A;  4XE0 A;  4WWP A;  4F92 B;  4YQW A;  4IG7 B;  3DCG A;  1WJU A;  2K8C A;  2D11 A;  1ISN A;  3HX0 A;  5ALS A;  4DWI A;  4WWN A;  5JH5 C;  1T3Q A;  3T5L A;  4W9L A;  1ZET A;  1HZ6 A;  4FHJ A;  2E1E A;  1J7A A;  4KN4 A;  3GZN I;  2V9H A;  4HRS A;  2KNJ A;  4BDP A;  1XU4 A;  9ICX A;  1UNS A;  1IGC A;  2PXI A;  2BWE S;  2MLB A;  2WXF A;  4OVZ A;  4KZC A;  5HG2 A;  3PSI A;  2HOF A;  2KJR A;  3WAN A;  4FA6 A;  2FNJ B;  1CK1 A;  2QIL A;  3HVD A;  4HAI A;  1ZQO A;  1RYU A;  8ICS A;  1DGJ A;  1NK6 A;  4RT3 A;  3H7S A;  4KLH A;  3CP8 A;  3KQ4 A;  3LWL A;  1IP9 A;  4ZHP A;  4M8M A;  3TJP A;  4ED3 A;  1JRO A;  1WXA A;  2I1J A;  1QQR A;  2HBJ A;  4F93 B;  2KQS A;  2CKH B;  3JYU A;  2EEL A;  5J18 A;  1B1Z A;  2C28 A;  1CEZ A;  1R4N I;  4XUS A;  5IKC M;  5KFF A;  4RM8 A;  1MQ3 A;  5LLI A;  4NL9 A;  2KLG A;  1YJ1 A;  2CU3 A;  4W9J A;  4WQM A;  2XY7 A;  2VJ5 A;  3MJW A;  5EOZ A;  2B76 B;  2M9N A;  2ZG6 A;  3AN1 A;  4W9H A;  3PO5 A;  1VZ6 A;  3F53 A;  1K5O A;  2MQJ A;  1O03 A;  4QWA A;  1FNW A;  5J0S A;  1WJN A;  4DSL A;  3DBS A;  3GV7 B;  4GN1 A;  2JPH A;  5EE0 A;  2MBO A;  4B0E A;  3Q3F A;  4YP3 A;  4YMM A;  1DOI A;  1NJX A;  2ZTC A;  4E3C A;  1KQQ A;  3GIK A;  1L3S A;  5CJ7 A;  4WJN A;  5C3J B;  2XCP A;  4IWO A;  4M04 A;  1TKE A;  2KLC A;  4EZL A;  4EEW A;  1U9L A;  2PTL A;  2KX3 A;  3LVV A;  2CR5 A;  4KIK A;  3CNH A;  1ZQG A;  1KFD A;  4YVZ A;  3AE1 B;  2MAX A;  1D8Y A;  2ZIW A;  3PZP A;  1ZQN A;  2C9W B;  3WAP A;  1Y8R C;  1KN5 A;  3E58 A;  3EUB 2;  5J2I A;  2BKF A;  2J52 A;  1XLP A;  4WJ3 B;  5KG4 A;  2E1F A;  2V3N A;  4JB3 A;  4ECZ A;  2DZM A;  5KAF U;  5E6N A;  2RSU A;  2ZXI A;  3VR8 B;  3QAR A;  1WWV A;  3NVV A;  3P4Q B;  1SV0 C;  2K0P A;  1YN4 A;  1SXE A;  2INN E;  3HK0 A;  5KFW A;  5D4B A;  1H38 A;  2VKQ A;  4NJ8 A;  4RGO S;  4AUQ C;  4ZHO A;  5KFV A;  2G5I B;  8ICH A;  4P2H A;  4MSQ B;  4HEA 1;  3VAW A;  2FCS A;  3K1Z A;  7ICV A;  1TT5 B;  5HP4 A;  3EHV A;  5IO9 A;  4Y2V A;  5CP2 A;  2GWS A;  3N3K B;  3L10 B;  2PI4 A;  1EU3 A;  4I6N B;  3WAL A;  4R8U A;  1VD2 A;  3TFR A;  2NTS A;  4LJO B;  2GBJ A;  3QEA Z;  3X23 A;  2G3Q B;  2KWV B;  4C8L A;  2W54 A;  3RR8 A;  3NG0 A;  1FFV A;  2BS3 B;  4NQK E;  2WU2 B;  2WB1 F;  3GZN B;  3TL5 A;  1U45 A;  3AH7 A;  2PFP A;  3VUW A;  4Q44 A;  4PYZ A;  3GOE A;  3WCQ A;  4DHZ E;  1JWU D;  5F9L A;  3C2M A;  2KKC A;  4M0W A;  2MCN B;  5CHG A;  4HXD A;  3PZ8 A;  4KLF A;  2M0A A;  5IN7 A;  2G08 A;  3JW0 X;  3JPN A;  3RUL A;  1L3V A;  2JV3 A;  3QU7 A;  2LKY A;  4X5V A;  3GZF A;  3IG3 A;  4M0W B;  3SEB A;  5J2F A;  2QB0 A;  3JPS A;  4ECS A;  7ICJ A;  1V6E A;  3N30 A;  2R8G A;  4GDK A;  3Q8P B;  1NKC A;  4F1S A;  3Q3M C;  4DQR A;  2DKZ A;  1WX8 A;  2WHE A;  1R4N B;  3MBY A;  5DPR A;  3J9C A;  4ARC A;  2E5S A;  2OJR A;  3A9J A;  4JV1 A;  1NKB A;  5J2E A;  5IIK A;  4W9C A;  1IM4 A;  2LPE A;  4B9V A;  3NZ3 A;  1XO0 A;  1V5O A;  1N2X A;  2PI5 A;  2ONQ A;  2QIE B;  1DOY A;  2JT4 B;  4MFA A;  3EFU A;  4KLI A;  4M8N A;  3QXG A;  3N1Y C;  3KYD D;  3D6J A;  5EE3 A;  4UB3 A;  2EDU A;  4KLJ A;  2NRV A;  3ICX A;  2HTM E;  1V1P B;  5KFT A;  1SZP A;  1MG8 A;  1QOB A;  1MQ2 A;  1SJE D;  1L7Y A;  1TY0 A;  1HTO A;  4DXG A;  4TQ1 A;  4DHJ B;  4O5C A;  2A5U A;  2GRI A;  2LRU A;  3WIM A;  1FEZ A;  3APF A;  4L2Y A;  5LXH A;  3PX0 A;  4PT5 A;  2AXT U;  3X0W A;  4ZRI A;  1SIF A;  4C56 C;  5L83 A;  2M0X A;  4EYI B;  4YXD B;  4Z6E A;  1KLV A;  2J6U A;  3A1Q A;  1ZD4 A;  1E6E B;  2M1M A;  5AKH A;  2KVC A;  4TV3 A;  9ICU A;  3U26 A;  2OHF A;  4TUP A;  3LK9 A;  4NPN A;  3ZD9 A;  1ET9 A;  4YMO A;  3IAM 1;  3OWE B;  3VRA B;  2CJO A;  1ZQW A;  5ALH A;  4EEY A;  1LO5 D;  3A4R A;  3GII A;  4IRK A;  1JXL A;  2HHQ A;  3RJG A;  5FR3 A;  2AQ0 A;  1NK7 A;  2WDQ B;  1EF5 A;  1RG6 A;  2ZW1 A;  4MDK E;  2LI6 A;  1X1M A;  1L6V A;  3MTN B;  5C5J A;  9ICP A;  1GUA B;  2EAO A;  2ZEQ A;  1E0Z A;  3K1R B;  3ZD8 A;  2W3S A;  1WXM A;  2WXH A;  1S0N A;  4BKT A;  4UAW A;  4RGT A;  2L7R A;  4R65 A;  5L1I A;  4UB4 A;  3WK4 A;  2RDH A;  3L5K A;  3DV9 A;  1C7Y A;  2Y9T A;  4P0Q B;  2IBI B;  1JI7 A;  3DWG C;  1ZQU A;  2L3Z A;  3QQ8 B;  4PHE A;  4LDT D;  2LVO A;  4CDG A;  3M9M B;  1JXE A;  3QIJ A;  3C23 A;  2K8B A;  1X42 A;  4NXZ A;  4DL3 A;  2AGO A;  1VJ5 A;  2D3B A;  2REX A;  2VH1 A;  2GBM A;  1E9M A;  5JRT A;  1WCN A;  2EKI A;  2K6Q A;  2HI0 A;  2N9P C;  4Q43 A;  4J9S A;  1YN3 A;  2AQ1 B;  3AUO A;  2M4N A;  1SB3 C;  5L1J A;  2BQQ A;  2MBH A;  2F1I A;  4BWM A;  5CRX A;  1UT8 A;  4B6J A;  4ED8 A;  2KJ6 A;  2ZPY A;  3UF8 A;  4LJX A;  1ZQH A;  1R7S A;  1QOG A;  1Z5S B;  4G3I A;  4GIV A;  1UGJ A;  2JYT A;  1SEB D;  4R3D A;  3HM6 X;  2KXJ A;  5D94 A;  2IO0 B;  1KW4 A;  1TFR A;  4NLG A;  2AEH A;  3JPQ A;  2OEH A;  1YZ6 A;  4ECW A;  8ICV A;  2MSE D;  3QJZ A;  3PW0 A;  3U8Z A;  3HUI A;  2C2E A;  1N61 A;  1K50 A;  4KLL A;  4HPL B;  1WGR A;  1ZQY A;  3W5V B;  1T8E A;  3NHE B;  4CF5 A;  1ZQS A;  5C1Z A;  2D8C A;  4FZL A;  5J29 A;  5MPO A;  5DDY A;  5DB6 A;  4WQO B;  2W9M A;  4BXO A;  1WXS A;  3M1Y A;  1FFU A;  1XSP A;  3MHZ A;  5AI0 A;  1LFD A;  4FLH A;  1SL2 A;  3H0L B;  3BDP A;  1SV4 A;  4IS7 A;  3HT3 A;  4ZRK A;  4UBC A;  4BXO B;  2B6G A;  3QU4 A;  2ZNV B;  1P7F A;  3SMV A;  4IQW A;  1M4V A;  3GE3 C;  3RB6 A;  2KDB A;  1T94 A;  1F2R C;  4HWI B;  3ZJV A;  1P9D U;  1OGW A;  5KFG A;  2P35 A;  4YCX A;  2DYB A;  2PE9 A;  1SZH A;  4UAV A;  4GC6 A;  2LYB A;  1C9F A;  2GB1 A;  2KT7 A;  1ZP0 B;  2KZM A;  3KYC D;  2W9B B;  2BDP A;  2KK8 A;  4N9F 4;  2XC9 A;  2LWP A;  3H9D A;  4LZD A;  1TAQ A;  3MGI A;  3RH5 A;  3E9S A;  4II3 B;  2PKE A;  2R2O A;  1HA5 A;  1QOF A;  1SBB B;  4B9M A;  1TK5 A;  2AYO B;  3QWZ B;  1NK5 A;  3UQ2 A;  9ICK A;  1ZQQ A;  4I2E A;  3O13 A;  4RMA A;  4NNJ B;  3DBH B;  1Z3E B;  5AKE A;  4EEL A;  2IGD A;  2K60 A;  2R2Q A;  2NMQ A;  5ALL A;  2PMZ F;  2IMW P;  3BS5 B;  1NI2 A;  3H7P B;  1UPH A;  2RGF A;  4ZH4 A;  5G55 A;  5JXV A;  4CF3 A;  2J0M A;  5BO4 B;  5KTQ A;  3T5H A;  1J2M A;  1ACC A;  1RAX A;  1H4R A;  2N1V A;  3R2I A;  4US8 A;  5J0X A;  3RJH A;  1ZQC A;  2GMI C;  1KOT A;  2V9W A;  2K25 A;  1KKX A;  5HMM A;  5KFJ A;  4EEK A;  3DVG Y;  1RYR A;  4IR9 A;  2LYA A;  3PLV A;  2V0G A;  4TMA B;  2BCV A;  1T0Q C;  4BZA A;  1I4H A;  1J7B A;  1UGM A;  3ZRF A;  2CS4 A;  4BFR A;  3MAB A;  2NO5 A;  1SE4 A;  3IBE A;  2E8N A;  3KBB A;  4O3N A;  2YMP A;  3NS1 A;  1SGG A;  1GPX A;  2DYO A;  4MM3 B;  1E8X A;  1FCL A;  1KLG D;  5IA7 A;  3W1S A;  2ZW0 A;  1EM7 A;  4J9N A;  3DHH C;  2LD9 A;  2KHW B;  3EWA A;  2UVW A;  2V4Q A;  1HE8 A;  2WB1 C;  3WKC A;  4PZO A;  4QZA A;  4FO6 A;  2W9A A;  3KHL A;  4EFO A;  4IR1 A;  4KLQ A;  2QDF A;  5AKY A;  2Y3A A;  4KKJ A;  4FBJ B;  4YTP B;  4F7Z A;  3TAD C;  3OJU A;  1F9J A;  3SV3 A;  2ZIU B;  1E5W A;  2WXJ A;  3SI8 A;  3SDL C;  3ZDE A;  3KUD B;  4LNK A;  2AU0 A;  3EGR A;  2ASD A;  5BMI A;  3EEC A;  3D2N A;  2LEK A;  2FDR A;  1Z4N A;  1L2N A;  3SAF A;  9ICM A;  3Q2A C;  2BYF A;  2JGA A;  5AUK A;  3B08 A;  4IM2 A;  1SKS A;  1ZQA A;  5B66 U;  1RLF A;  3AED B;  1XNS A;  1NKE A;  4OJO A;  3VH3 B;  4KX5 A;  7ICH A;  2YTU A;  1ZQZ A;  2WS3 B;  3L54 A;  7ICE A;  7ICO A;  1YJI A;  3VVW B;  2HCF A;  1L7O A;  1V80 A;  1S77 D;  9ICL A;  4HPM B;  5DKW A;  2HD5 B;  1TKG A;  3P4R B;  4GMV A;  2G06 A;  9ICG A;  3FAH A;  2LYH A;  2BS4 B;  5KG1 A;  4JL9 A;  4YR0 A;  5ALZ A;  2KJH B;  4RU9 A;  2LGX A;  4F8R A;  4RNA A;  3ZYY X;  4IKG A;  3Q69 A;  2KD1 A;  4J03 A;  3DBL I;  4I6L B;  5AKG A;  1F77 A;  5DPW A;  4DF8 A;  4DEZ A;  1L8O A;  1ZQJ A;  3RD2 A;  1Q46 A;  8ICC A;  2DYM A;  4FHK A;  4F2S A;  4P7I A;  2EZX A;  4ED7 A;  3C29 A;  1YN5 A;  3N1Z C;  2LJI A;  5D7G A;  3AE9 B;  7ICP A;  1JWA D;  1FM0 D;  5AKZ A;  1QIL A;  1X9S A;  1D9D A;  2FPM A;  2W3R A;  1B0X A;  2NTT A;  5KG2 A;  2MRL A;  5J0W A;  1TYG B;  5AK4 A;  1ZE3 D;  1LGR A;  4RQ5 A;  1URJ A;  2R18 A;  8ICW A;  5ALK A;  3WKB A;  3HP6 A;  4B9U A;  2B3A A;  1RQN A;  2HJ8 A;  3HVZ A;  3H8H A;  1JUD A;  2RDI A;  2L00 B;  1Q3U A;  1WRD B;  2RDG A;  1GC6 A;  4FFD A;  3JPP A;  1DK2 A;  2L83 A;  4WJQ A;  2KQ4 X;  4QZD A;  1G6J A;  2HBL A;  4W9E A;  1JML A;  2AQ2 B;  4RQ0 A;  2GLE A;  3KUZ A;  2IZV B;  1S97 A;  1MHX A;  1QLN A;  4UAR A;  4JLC A;  3SV4 A;  4DSF A;  2HVH A;  1BXT A;  2FCQ A;  4NQL B;  2KHQ A;  4NJ6 A;  1D4B A;  2W03 A;  3BQ7 A;  2J0K A;  2KV2 A;  2JZB B;  3P42 A;  4GDL B;  1ZQI A;  2PLP A;  2K5P A;  2MW5 A;  4ZRJ A;  1VLB A;  1FXI A;  1GB1 A;  3CIR B;  4WAA A;  7ICI A;  1J97 A;  3A0H U;  5J2K A;  5KAI U;  2JH1 A;  3FC4 A;  3R7R A;  2JQR B;  4K4I A;  2LUM A;  4IL6 U;  1Q3V A;  2CHZ A;  3IVF A;  2W7P A;  5KFO A;  1I35 A;  2NRX A;  1YD8 U;  4A20 A;  1WXQ A;  2KDF B;  3S6J A;  2WWZ A;  2YN4 A;  9ICT A;  2ON8 A;  2MBB B;  5IIJ A;  2NYV A;  4F5Q A;  3AV8 A;  4BOS C;  5JHA A;  1AYF A;  4BVU C;  1EF1 A;  2IOH A;  1XF5 L;  5K4L A;  4J9R A;  2INC C;  3ML8 A;  3RR7 A;  1L6U A;  2B21 A;  1SL1 A;  2JR5 A;  4JWN A;  1PK1 A;  4KX3 A;  4ICV A;  2E3T A;  1C3T A;  3ISB A;  2KFZ A;  2WXR A;  1TKD A;  3M9O B;  5CB1 A;  3Q6B A;  2M19 A;  1QKZ A;  2BYE A;  3PRP B;  5HKH A;  4A9A A;  5EWF A;  2FI1 A;  2QAR A;  3ZVV A;  2K89 A;  3PW2 A;  3H1U A;  1SE2 A;  1ZQT A;  4O3O A;  5CTR C;  2DBY A;  2IY0 B;  3C5F A;  2XO7 A;  2JXX A;  3D32 A;  1BPY A;  4HDO A;  4TSS A;  4K7U A;  1U4B A;  1Q1O A;  1OQY A;  3RZF A;  1T5X D;  3V61 A;  2JSV X;  3DBL B;  3MR3 A;  4A3O A;  3R8B A;  1CRX A;  5AK5 A;  3RNA C;  2KQ7 A;  4UQG A;  3PW7 A;  1UWM A;  1F52 A;  3ZDT A;  2MJD A;  2KAC A;  5DBC A;  4P4M A;  9ICW A;  3K9O B;  8ICU A;  5KNI A;  4RF0 A;  2NRZ A;  3IV6 A;  3RF9 A;  3GV8 B;  2GLS A;  3CF6 E;  4W9I A;  5ALF A;  3MR6 A;  3PW4 A;  3KUC B;  2KWU B;  5HML A;  1ENF A;  1KRH A;  1E7P B;  3W5U B;  2KVZ A;  1SIJ A;  3T3F A;  3BIN A;  2C7N B;  5ALM A;  1MG4 A;  4A8X C;  2W43 A;  1PGX A;  2VZK D;  3OTQ A;  1GG3 A;  3CYM A;  4M47 A;  4ED1 A;  1P7D A;  4MT5 A;  2BCU A;  2ASL A;  3I63 C;  3B0X A;  5J2C A;  8ICJ A;  2K4E A;  4AYB F;  2BKR B;  5JUM A;  1L5U A;  2IA6 A;  1ROE A;  2VA8 A;  1XLN A;  2RDB C;  4I2C A;  2Z7J A;  4DSK A;  8ICQ A;  3NS8 A;  3H7I A;  2GBR A;  2PMZ C;  3AMZ A;  2YVC A;  3RYT A;  3L0W B;  1P7E A;  4B9L A;  4C0Z A;  1RXV A;  2N4F A;  1RYS A;  2FLP A;  1C78 A;  4DOC A;  2YML A;  1ZPS A;  3VCB A;  4KLM A;  1D3Z A;  5CA7 A;  4LDT B;  4RQ1 A;  2KC1 A;  4GOC A;  3QU9 A;  4TQR A;  3B2F A;  1SGH A;  3PR5 B;  3MFH A;  4QWB A;  4JGH B;  2BCR A;  3NUH B;  4MGY E;  2RDJ A;  2RRD A;  4IRD A;  4P1B C;  3ZI4 A;  4ANV A;  1N56 A;  3A9K B;  2BPG A;  5J2D A;  4GGQ A;  2XGQ A;  4P0P A;  4BAX A;  3T79 A;  4DXA B;  1PVP A;  4NLB A;  4PGQ A;  2UVR A;  4I2A A;  2K8C B;  1WR1 A;  5DGA A;  2WX0 A;  3G6X A;  1ZQX A;  2D5G A;  2KG5 A;  2W11 A;  5D3I B;  3AE8 B;  5AIA A;  5J0R A;  3PTF C;  2KZZ A;  1SKW A;  2NBU A;  3ZXR A;  2J0J A;  2LM4 A;  1Z2M A;  4KV2 A;  1CUK A;  3IRU A;  4UAZ A;  3E56 A;  3DDC B;  4O3M A;  4Y2Q A;  4GXB A;  2IY1 B;  4X57 B;  2NR2 A;  3Q8Q B;  1DRG A;  4G50 A;  4I2F A;  4J6I A;  3V6H A;  5C0Y A;  1K8R B;  3WKE A;  5DQI A;  3Q3N C;  2N1R A;  3CSF A;  2KJ8 A;  3KZI U;  4Y2S A;  5KFS A;  1L3U A;  4RF1 A;  3Q8E A;  5CEH A;  3Q3O C;  1I4R A;  2JF5 A;  3RRG A;  4CF4 A;  3AEC B;  1BVS A;  4O0I A;  1C77 A;  3BVZ A;  1S1Q B;  5GTI U;  5J8Y A;  2D6F C;  4F50 A;  3RNF C;  2D2Q A;  3AEV A;  4ZRQ A;  4KMO B;  9ICA A;  1WXV A;  1T4G A;  1WZ3 A;  2ZPN A;  3WKA A;  5L95 C;  3BS7 A;  2KK0 A;  2KZR A;  2JEF A;  8ICK A;  3TEX A;  2HHX A;  2FLL A;  3TKA A;  5E6P A;  1S10 A;  4EBD A;  1IBX A;  3RBD A;  2DX5 B;  2YEP F;  4DCC A;  2K8H A;  3JPR A;  4Q8F A;  3AM9 A;  2D07 B;  4LK0 M;  3KOO A;  1U4A A;  3PS6 A;  3PX4 A;  3ZNZ B;  3AEA B;  3AE7 B;  3T3N A;  3RAX A;  3EPG A;  9ICE A;  1IBX B;  5CHV C;  4F2R A;  4K4H A;  2MEK A;  5HNK A;  1RRB A;  2W8L A;  2G07 A;  4IRC A;  3SD7 A;  5ALV A;  2MX2 A;  4UB5 A;  5T14 A;  3UM9 A;  3QNM A;  2WAQ F;  2YEP B;  4KIK B;  4BUG A;  1EU4 A;  3QX1 A;  2VJ4 A;  1V8C A;  4PS3 A;  3ZRC A;  2K39 A;  2ZIW B;  5IIO A;  1TS2 A;  1WE6 A;  3PSF A;  2ZUC A;  3RT3 B;  3V05 A;  2FE8 A;  2V4R A;  3U2S C;  1KTQ A;  1M6Y A;  4RQ4 A;  5DG8 A;  3WK9 A;  1VRA B;  2AWT A;  1NYQ A;  4K1R B;  2RPQ A;  2EKE C;  1L7P A;  2LHD A;  4P4P A;  1WZ0 A;  2DAF A;  4EOY A;  4DFK A;  4G3X B;  3IHQ B;  4I2D A;  2IND C;  3WK6 A;  1NJW A;  2VH2 A;  5AM3 A;  3BQT A;  4F3O A;  1OFF A;  1Y56 A;  1NDD A;  2K8A A;  4F4Y A;  3O0F A;  2G0A A;  3Q8K A;  1TAM A;  4M0A A;  4WWM A;  2EZZ A;  4GIB A;  1TZO A;  3MDC A;  2F1H A;  3N7R C;  4MH0 E;  4U7C A;  1KLN A;  3DEE A;  4ECQ A;  4R8U B;  1NBF C;  4FJZ A;  3ALR A;  3MR5 A;  9ICN A;  3RPF C;  2P6U A;  3DVN U;  2WXQ A;  2OWO A;  3N1X C;  3SU8 X;  1IYF A;  1L4D B;  2I38 A;  2LXA A;  1EWY C;  1WJ6 A;  1LKY A;  3IXS A;  2Y5B B;  3PSE B;  3A33 B;  4Y2T A;  3V3X A;  2JUO A;  1DK3 A;  5AHX A;  3A0B U;  3SFD B;  2FUG 1;  4QZG A;  2RR9 A;  3BVM A;  8ICY A;  3ENE A;  4MHV A;  4I2G A;  4YXM A;  3L08 A;  1RDF A;  3SEI A;  4FS1 A;  4XWT A;  2NCN A;  2JWZ A;  3LDA A;  1N6Z A;  2KHV A;  2ZTE A;  3HRD D;  2UYZ B;  2QB0 B;  3DVG X;  3HW8 A;  2H88 B;  1CZP A;  4NJ7 A;  4O5K A;  1RFK A;  4M02 A;  2DZK A;  4KLD A;  1ZQ1 C;  1WGH A;  2WXK A;  4GDK B;  2KDE B;  1L7M A;  1D8L A;  1D9F A;  2LGD A;  1K51 A;  2QHO A;  1LB2 B;  3NVW A;  4YR3 A;  1BNO A;  3PMN A;  1VCB A;  2I1K A;  4UAY A;  3GP7 A;  2L0F A;  3A9J B;  1WF9 A;  2I2Y A;  5KFQ A;  4AQ7 A;  3S2A A;  1X66 A;  1PGB A;  4XC2 A;  4JMU A;  4KLG A;  3L3F X;  5L1K A;  4WH4 A;  3PO0 A;  4FUL A;  5DQG A;  2JEG A;  2KVS A;  2JXJ A;  4IDI A;  1T6B X;  5KFR A;  2DHZ A;  2LVQ A;  1AW7 A;  2M8S A;  1V97 A;  2PEA A;  1YIW A;  2LBO A;  3NJT A;  4DWF A;  3HIZ A;  4CYE A;  3OJ3 A;  1ZOL A;  3RRH A;  4OJP A;  2HHV A;  1P1A A;  2M56 B;  2CHW A;  5G5H A;  5JU5 A;  1FIQ A;  2BDU A;  2N7D A;  2KMC A;  2L8J A;  4HPP A;  4IC7 B;  1HXY D;  2YY6 A;  3B9J A;  2RD0 A;  3AEB B;  5AK3 A;  4EBC A;  1KLU D;  2OOB B;  1L8L A;  1KSP A;  1C1Y B;  5AM4 A;  2GBN A;  3H0M B;  3EA6 A;  4AP9 A;  3QAQ A;  2E8M A;  3A1Q B;  4WWO A;  1KRP A;  3OLM D;  3Q8S B;  3KVF B;  4ITK A;  4UAU A;  4I2H A;  1WGY A;  3RI7 C;  3FIL A;  1WGK A;  4PHD A;  1WE7 A;  3PY8 A;  2BPC A;  4Z6F A;  2ZJ8 A;  1AAR A;  4AYB C;  4ZOH C;  4QZE A;  3APC A;  3PHW B;  3PVX A;  2KMA A;  3U7D A;  5ALJ A;  2EAM A;  5E6O A;  3ISD A;  3H4D A;  1GB4 A;  4DOA A;  5III A;  3LYY A;  1IPG A;  5D6J B;  1S3S G;  4NV0 A;  4C80 A;  2L05 A;  2F3N A;  3BQ1 A;  4F5P A;  1XEE A;  2BZF A;  4M00 A;  5D49 A;  1B4F A;  5IAA C;  7ICQ A;  5ALO A;  2KFJ A;  2R8I A;  2OXO A;  1YZ7 A;  3KH0 A;  3DBR I;  4MEX A;  5DBA A;  1D6E C;  3KWL A;  3KKA A;  4MGZ E;  1Q0W B;  2LFI A;  1GC7 A;  3TBL D;  3NTU A;  3GV5 B;  4GC7 A;  5E79 U;  1KTK A;  2PFQ A;  2C60 A;  2WXI A;  5AKK A;  5BMG A;  2K8B B;  2XGP A;  3QUC A;  4BWJ A;  3PT2 B;  3V6K A;  1Z19 A;  4ECX A;  2MHJ A;  3ZLZ A;  1VZ7 A;  3C21 A;  3RNB C;  3RZW C;  3NAS A;  3GS2 A;  3TAQ A;  5GMV A;  1ZD3 A;  1N63 A;  1QLB B;  5DB8 A;  4CGZ A;  3ECI A;  2P66 A;  3N4M B;  4H2A A;  2SEB D;  3KW5 B;  3RFZ B;  4LTU A;  2HTH A;  5D3D A;  3LYS A;  2DGZ A;  4KGT A;  2XNA C;  1QCK A;  1MA7 A;  2V4I B;  4MF8 A;  2H3F A;  5KG0 A;  5AM2 A;  1UWX A;  4OZB A;  5BYR A;  2KJ9 A;  2KOB A;  3IP4 B;  4AS1 A;  5KFU A;  2H3Q A;  5FKA C;  3K75 D;  1TTN A;  3WKD A;  4TUQ A;  4OVV A;  4YTM B;  2CU1 A;  3W1Y A;  4RZR A;  3V7L A;  4NL9 C;  3A4S C;  1ZKH A;  2D3C A;  4TUU A;  3V60 A;  4EZ9 A;  3UQ0 A;  5J8Y C;  4TQS A;  1A5R A;  4PH5 A;  5KT7 A;  3QUT A;  2FLN A;  4NAW A;  1GJZ A;  4L23 A;  2O2V A;  5KFE A;  3AE5 B;  5KFZ A;  4DF4 A;  1O08 A;  1I4G A;  1AN8 A;  2MSN A;  4NAW B;  1ZXI A;  3PSP A;  3L13 A;  2O2V B;  4O1N A;  3QUB A;  1ESF A;  2AL3 A;  5HR7 A;  5IOI A;  5L1L A;  1SL0 A;  3NGD A;  2WF8 A;  5GTH U;  4NWI A;  3WK8 A;  2CJN A;  2XBB C;  2Y5P A;  3ZDA A;  4HJK A;  2Q5W D;  4FAD A;  4GXJ A;  4URK A;  4DHZ B;  3AEF B;  3PX6 A;  2K4I A;  2KE7 A;  2V3S A;  5DG9 A;  4J9M A;  2VZK B;  3ALB A;  2WDR B;  3RMK C;  4NAM A;  1ZQK A;  4F8C B;  2D10 A;  4MEY A;  9ICO A;  1SJH D;  2IPK D;  2HW3 A;  1WR6 E;  4RGM A;  3BQ2 A;  4N58 A;  3ZQ4 A;  4OO1 J;  4KN7 A;  2WAQ C;  4GXK A;  4JPS A;  1C76 A;  4HKQ A;  3IG5 A;  8ICT A;  2BGW A;  2QLT A;  1IG6 A;  3HIL A;  4M01 A;  2BYT A;  5ALI A;  5H2F U;  2M17 A;  1RQL A;  1WMH A;  2A4Z A;  1U47 A;  3R66 C;  2DPI A;  2IO3 B;  4PGY A;  4YD2 A;  4DXF A;  3HM3 A;  4FZN A;  4F72 A;  2Z59 B;  2ZCC A;  2IHM A;  3LJ3 A;  4QW9 A;  3Q8B A;  4E71 A;  4CQN A;  3BQ0 A;  4QWD A;  1XQQ A;  4ASW C;  4YSZ B;  4DK5 A;  1L0V B;  4JIO U;  3NRW A;  4Q2J A;  5CR0 A;  2LJ5 A;  2IOF K;  4PS8 A;  1TV9 A;  3BJY A;  3ZDD A;  3WAO A;  5DLG A;  2ZVO A;  3R2T A;  3KTQ A;  4ICU A;  3OJS A;  3K9P B;  4A6Q A;  4DL2 A;  3KHH A;  1C20 A;  5J0T A;  2KWC A;  1GAQ B;  4QIW F;  2MA9 B;  3UPQ A;  1V2Y A;  2W9C A;  4MJS A;  3UQA A;  2C22 A;  8ICO A;  5HHI A; 
#chains in the Genus database with same CATH homology
 2WXG A;  1SE2 A;  2DLB A;  2WDV B;  5BMH A;  1TKE A;  1SSN A;  2WXP A;  3NRZ A;  2DBY A;  4XDD A;  2PTL A;  3MFG A;  4C7Z A;  4TSS A;  4ZRP A;  1K53 A;  3AE1 B;  2N9L A;  1T5X D;  2LGI A;  2JSV X;  4OZA A;  5H92 C;  3TUO A;  3EUB 2;  2J52 A;  3R8B A;  3URY A;  4A90 A;  1XLP A;  2N9K A;  2W55 A;  1L0Y B;  1UWM A;  2V3N A;  4P6V F;  2MJD A;  2KAC A;  3VR8 B;  2SAK A;  4RF0 A;  3NVV A;  3P4Q B;  2K0P A;  3KLS X;  1NI3 A;  1YN4 A;  2QMT A;  4KGS A;  2INN E;  1XLO A;  1ENF A;  1KRH A;  1E7P B;  3MJ5 A;  3W5U B;  4RGO S;  4ZHO A;  1SIJ A;  2IGG A;  1I4X A;  2BB6 A;  1XCT L;  2WQY B;  1YQ3 B;  2X38 A;  4HEA 1;  4A8X C;  1PGX A;  2GI9 A;  2VZK D;  3VRB B;  4MAC A;  4MT5 A;  5AUI A;  1CJE A;  2HDE A;  1FCC C;  3BZD B;  1EU3 A;  1ROE A;  1K52 A;  1C79 A;  1XLN A;  2NTS A;  2J53 A;  2AQ3 B;  4ZYS A;  2JZP A;  2W54 A;  1FFV A;  2BS3 B;  2WU2 B;  3AMZ A;  1P7E A;  3VR9 B;  3AH7 A;  3U52 E;  5HFY A;  1OQQ A;  3WCQ A;  1SXT A;  1JWU D;  2J42 A;  2RMM A;  1C78 A;  1WSP A;  1TS3 A;  4M0W A;  4JX1 C;  1ZPS A;  3PZ8 A;  2M0A A;  3U7Z A;  1SF0 A;  3B2G A;  3LXF A;  2IGH A;  1JCK B;  1NYR A;  1MHH E;  3B2F A;  3SEB A;  1FEH A;  1KH0 A;  3NVY A;  2IDY A;  2W82 A;  3NUH B;  3P63 A;  2WXL A;  2G9H D;  3AEE B;  3T3O A;  4RFB A;  1SE3 A;  1ZDV A;  1KFY B;  1VR9 A;  2JX5 A;  2PMV A;  4KKI A;  3J9C A;  4ARC A;  2D5G A;  1KF6 B;  3GB1 A;  5D3I B;  4GLS C;  3AE8 B;  2WXO A;  3MP9 A;  3NZ3 A;  4JWU C;  2ONQ A;  2LMC A;  2QIE B;  1DOY A;  1ZUD 2;  3ZJU A;  2WXN A;  1TJE A;  1MPE A;  1UUP A;  3E56 A;  4A55 A;  5BYS A;  3PZ7 A;  2KDM A;  3W9C B;  1FNU A;  5EE3 A;  1BUI C;  1WRI A;  2HTM E;  1V1P B;  1QOB A;  4ARI A;  1SJE D;  4KX6 B;  1QT9 A;  4RF1 A;  1TY0 A;  3BII D;  3MC0 B;  3Q8E A;  4RGN A;  1PGA A;  4DXG A;  4TQ1 A;  1I4R A;  3AEC B;  2GRI A;  1C77 A;  1BML C;  1ET6 A;  3BVZ A;  4L2Y A;  3TEZ A;  1JWM D;  4PT5 A;  1TS4 A;  1HZ5 A;  4C56 C;  4HKZ E;  4ZRQ A;  4YXD B;  2JXT A;  1NEK B;  1PYW D;  1E6E B;  3AE6 B;  2OHF A;  4JWS C;  1D5M C;  1JQ4 A;  3TEX A;  1A70 A;  1ET9 A;  3IAM 1;  3OWE B;  1FXA A;  3VRA B;  2CJO A;  1YQ4 B;  1LO5 D;  4UDU C;  1V1O A;  4NZL B;  1IBX A;  2YEP F;  1FRD A;  5FR3 A;  3AM9 A;  1DYQ A;  4LK0 M;  4REZ A;  2WDQ B;  1XLQ A;  2BW2 A;  2ZW1 A;  3AEA B;  3N9Y C;  3AE7 B;  3T3N A;  1IBX B;  1L6V A;  2MEK A;  4N6E B;  3DWM A;  1JWB D;  1E0Z A;  1N62 A;  2YEP B;  2W3S A;  2WXH A;  2QJL A;  1EU4 A;  3LB8 C;  4RGT A;  1V8C A;  2BTE A;  4XDC A;  1J7C A;  1L0X B;  1TS2 A;  2RDH A;  1JW9 D;  3ETR A;  3DWG C;  4WUR A;  3Q8C A;  3V05 A;  2FE8 A;  3U2S C;  2IJ0 A;  1I4P A;  2Y5C A;  1AWD A;  1VRA B;  2KN4 A;  1NYQ A;  1QF6 A;  2LHD A;  1E9M A;  4DQO C;  2EKI A;  1YN3 A;  2AQ1 B;  1SB3 C;  3P4P B;  4B0M A;  4YSX B;  1Y56 A;  1OFF A;  4YT0 B;  5TSS A;  1R7S A;  1QOG A;  4WWM A;  1E10 A;  1TZO A;  1UGJ A;  2JYT A;  1SEB D;  4R3D A;  1XCQ L;  2L32 A;  1NEN B;  1VJK A;  1F2R I;  1TY2 A;  3P1M A;  1RYJ A;  4J3O D;  3RPF C;  4HRO A;  2WXQ A;  3BWU D;  3AE4 B;  1L4D B;  2I38 A;  1EWY C;  4EE2 A;  3HUI A;  4WAF A;  1OQR A;  3IXS A;  1N61 A;  5HI1 A;  3V3X A;  4YSY B;  2DWQ A;  1K50 A;  4OZC A;  1Q10 A;  3SFD B;  2FUG 1;  3W5V B;  3BVG A;  3Q8A A;  3BVM A;  5MPO A;  2PVO D;  2INP E;  2QEJ C;  4XWT A;  1FFU A;  3MHZ A;  3ZGZ A;  2PIA A;  1MVK A;  3HRD D;  1IGD A;  2H88 B;  1P7F A;  1CZP A;  5I4D A;  1RFK A;  1M4V A;  2K3U A;  2WXK A;  4GDK B;  1RM6 C;  1F2R C;  1F0Z A;  3ZJV A;  1K51 A;  3NVW A;  2PW9 A;  3GP7 A;  3BYT B;  2GB1 A;  1C9F A;  1ZP0 B;  1PUT A;  3BK1 A;  1WWT A;  1YJJ A;  1FRR A;  2BT6 A;  2I2Y A;  1I4Q A;  4AQ7 A;  1PGB A;  3E9S A;  2K9X A;  4WH4 A;  2LHE A;  1HA5 A;  1QOF A;  1SBB B;  3PO0 A;  2ICI A;  4L1B A;  4US9 A;  2BB5 A;  4IDI A;  1QOA A;  1T6B X;  2J4X A;  2JYE A;  3IAS 1;  3O13 A;  1AW7 A;  1TKY A;  2R61 A;  1HQR D;  1V97 A;  2FBW B;  2BBC A;  2IGD A;  2NMQ A;  2M56 B;  1N5W A;  4USA A;  5G5H A;  1FIQ A;  5JXV A;  2WU5 B;  3SR6 A;  1I7H A;  1HXY D;  1ACC A;  1YMH E;  5GXG B;  2JWU A;  3B9J A;  3AEB B;  4US8 A;  3R2I A;  1KLU D;  5E6J A;  4MH8 A;  1B9R A;  2N0S B;  2WLB A;  4XWW A;  5BYQ A;  3EA6 A;  2V0G A;  4TMA B;  1FD6 A;  3IT4 B;  1I4H A;  1J7B A;  4ITK A;  4OW0 A;  1SE4 A;  2QSD A;  4YWG G;  3FIL A;  1WYG A;  1WGK A;  2K22 A;  3W2D A;  2JU6 X;  3NVZ A;  2G1E A;  3NS1 A;  4FXC A;  5H8Y E;  1GPX A;  1C4A A;  4ZOH C;  2DYO A;  4MM3 B;  1FCL A;  1KLG D;  1D5Z C;  1JRP A;  2XN9 C;  4WIP A;  3W1S A;  2ZW0 A;  1VDV A;  1EM7 A;  4KGR A;  1GB4 A;  1XXG A;  2WNM A;  3LYY A;  2MJ3 A;  4D2K A;  4C80 A;  1YNT E;  1FMA D;  1IUE A;  1XEE A;  5C2T B;  2OED A;  2V3P A;  2Y3A A;  4KKJ A;  1N60 A;  4YTP B;  5EE1 A;  1JAL A;  3L4P A;  2WXJ A;  2KAJ A;  1D6E C;  3KWL A;  1GOZ A;  1L4Z B;  3EGR A;  2LFI A;  5BMI A;  2LEK A;  4IOI E;  2MH7 A;  1MI0 A;  1KTK A;  1HEZ E;  3UI3 A;  2WXI A;  4LLG M;  3ZJT A;  5BMG A;  5AUK A;  4C7Y A;  2Z8L A;  1L5P A;  4P16 A;  4N59 A;  4NJC A;  3AED B;  1VZ7 A;  2MJE A;  3GS2 A;  2WP9 B;  1ZDX A;  1N63 A;  2WS3 B;  1YJI A;  1QLB B;  1STE A;  4H2A A;  5EE9 A;  2SEB D;  3RFZ B;  4LTU A;  5D3D A;  1JWS D;  3AE3 B;  3P4S B;  3TSS A;  1TKG A;  3P4R B;  4KGT A;  2XNA C;  3FAH A;  2BS4 B;  1C4C A;  2V4I B;  1PDX A;  5BYR A;  1UWX A;  3BYY B;  2L52 A;  4OZB A;  4RNA A;  3ZYY X;  4IKG A;  4AS1 A;  3Q69 A;  5FKA C;  4OHJ A;  3TEW A;  2L1A A;  1F77 A;  5G5G A;  3AB5 A;  4YTM B;  5HHD G;  1ZXH A;  2DYM A;  4TQ0 A;  1FNV A;  2KWD A;  1DOX A;  2TSS A;  1YN5 A;  1VZ8 A;  3CWI A;  5D7G A;  2LJI A;  4HJG E;  4L23 A;  3AE9 B;  2ACZ B;  1JWA D;  3AE5 B;  5LNK 1;  1FM0 D;  3TEY A;  1I4G A;  3ABV B;  3AEG B;  1QIL A;  1AN8 A;  1XO3 A;  1EWC A;  3BK2 A;  4NAW B;  1ZXI A;  2W3R A;  1CQV A;  2NTT A;  1C4P A;  3IT6 B;  3KWV A;  4O1N A;  2H89 B;  1TYG B;  1ESF A;  1NVI D;  1ZE3 D;  2CJN A;  2Y5P A;  2PVG C;  1N5X A;  2Q5W D;  3HVZ A;  3VQI A;  3H8H A;  4XE0 A;  2PKO A;  2E6X A;  2WXM A;  2RDG A;  3AE2 B;  3AEF B;  3Q8F A;  2L83 A;  2VZK B;  2KQ4 X;  2WDR B;  4NAM A;  1JML A;  2AQ2 B;  1T3Q A;  1TS5 A;  1MHX A;  1HZ6 A;  1BXT A;  1SJH D;  1J7A A;  2IPK D;  2RPV A;  4HRS A;  4RGM A;  4N58 A;  1UNS A;  3ZQ4 A;  1IGC A;  3I9V 1;  1D4B A;  2WXF A;  4OVZ A;  3P42 A;  5HG2 A;  4GDL B;  1FO4 A;  1RWS A;  4JPS A;  1CK1 A;  1C76 A;  2K5P A;  2PLP A;  2QIL A;  1VLB A;  1FXI A;  3HVD A;  4HKQ A;  1GB1 A;  1DGJ A;  3CIR B;  2BYT A;  1V1P A;  1PFD A;  3KQ4 A;  4ZHP A;  3FC4 A;  4DXF A;  3I57 A;  4RH6 A;  2JQR B;  2LUM A;  2BS2 B;  1JRO A;  3Q8B A;  1QQR A;  2AX5 A;  2EEL A;  1WXQ A;  4CQN A;  1B1Z A;  4YSZ B;  1ZOY B;  1L0V B;  2ON8 A;  4RCO A;  4YTN B;  3U4E G;  4Q2J A;  3AV8 A;  1D5X C;  1AYF A;  2CU3 A;  4WQM A;  1XF5 L;  3R2T A;  5T8I A;  2B76 B;  3AN1 A;  1L6U A;  4A6Q A;  1VZ6 A;  5FK9 C;  3FIL B;  3SFE B;  2E3T A;  1FNW A;  2WXR A;  2N7J A;  1GAQ B;  3C8Y A;  5EE0 A;  2M19 A;  1QKZ A;  2KMM A;  4B0E A;  4JE3 B;  4A9A A;  1DOI A;  5C3J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...