5G5HA

Escherichia coli periplasmic aldehyde oxidase r440h mutant
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
173
structure length
173
Chain Sequence
AATPAPEIMPLTLKVNGKTEQLEVDTRTTLLDTLRENLHLIGTKKGCDHGQCGACTVLVNGRRLNACLTLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTSGQICSSVAVLKEIQDGIPSHVTVDLVSAPETTADEIRERMSGNICRCGAYANILAAIEDAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Escherichia Coli Periplasmic Aldehyde Oxidoreductase is an Exceptional Member of the Xanthine Oxidase Family of Molybdoenzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords PUTATIVE XANTHINE DEHYDROGENASE YAGT IRON-SULFUR-BINDING SUB
total genus 48
structure length 173
sequence length 173
ec nomenclature ec 1.2.99.6: Carboxylate reductase.
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 5g5hA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5g5hA01
2L83A 3P1MA 1JWBD 1NVID 1FFVA 1FXAA 1A70A 1L6UA 2QIEB 1NYRA 1N61A 3HVZA 1GAQB 1KRHA 1F0ZA 3AB5A 2WLBA 4IDIA 1GPXA 3P4RB 2WS3B 3AEDB 3VRAB 1N5WA 2E3TA 4JWUC 1RWSA 1J7BA 2FBWB 2N0SB 1N60A 3L4PA 1FXIA 3AE5B 3AEFB 1J7AA 1I7HA 1XLOA 2BT6A 3AEAB 4HRSA 3W9CB 2CJOA 1JRPA 4A9AA 1JWAD 1J7CA 1NEKB 2WP9B 2M56B 3AE8B 3AE9B 4WWMA 1FM0D 1R7SA 3AMZA 3AE1B 3HUIA 1L0VB 1SB3C 3P63A 3RPFC 3NS1A 2DWQA 1PDXA 1WRIA 1L6VA 1TKYA 2B76B 1YJJA 2Y5CA 2WU2B 4KX6B 1DOXA 1YQ4B 1ZP0B 1ROEA 2PVGC 5MPOA 2KAJA 1DOIA 1SIJA 4ZOHC 3NRZA 1QT9A 2W3SA 1NI3A 4YTPB 1UWMA 4YXDB 1VDVA 1WXQA 2JX5A 1E9MA 2WU5B 3FAHA 1TKGA 3AE4B 1JQ4A 2PIAA 3EUB2 1XO3A 1SF0A 2DBYA 5H8YE 3AE6B 1DOYA 3ZYYX 1OQRA 4C7ZA 3B2FA 5H92C 3AEBB 2QJLA 1ZOYB 2MJDA 5C3JB 4C7YA 2LEKA 3P4PB 1XLNA 2K5PA 1QOAA 3AM9A 2BS3B 5G5GA 3AE2B 2K9XA 3AEGB 1TKEA 2PKOA 4LTUA 4US8A 1QOBA 1E10A 4YTMB 3FC4A 5AUIA 4US9A 2WDQB 1XLPA 1CJEA 4JX1C 1NYQA 4C80A 4P6VF 3VR9B 1QOGA 1E6EB 1KFYB 1PFDA 1RM6C 1IUEA 3B2GA 2BS2B 3WCQA 1YQ3B 3VRBB 4HROA 2G1EA 4ZHPA 4YSXB 3HRDD 3DWMA 3NVWA 1OFFA 1XLQA 3AE7B 3LXFA 4YSYB 2PVOD 5EE1A 1E0ZA 3ETRA 3AEEB 1AWDA 4YT0B 2M19A 1V8CA 2KMMA 1RYJA 1WGKA 2MJEA 1FFUA 1L5PA 1N62A 3CWIA 1N5XA 2H88B 1WYGA 3AV8A 2L52A 1TYGB 2WQYB 4FXCA 2H89B 3ABVB 1FRDA 1QF6A 1V97A 5C2TB 4N59A 1QLBB 3SFEB 3AN1A 3B9JA 1FMAD 2MH7A 2WDVB 5EE0A 1ZUD2 2K22A 1JW9D 2CU3A 1T3QA 3CIRB 3SFDB 3W5UB 1AYFA 1ZXIA 1KF6B 5GXGB 1VJKA 3DWGC 2BS4B 3P4QB 4WQMA 1N63A 2W55A 3NVYA 5G5HA 4N6EB 2ACZB 3AH7A 3NVZA 1CZPA 5EE9A 3SR6A 1FIQA 1RFKA 1JROA 2Q5WD 2MJ3A 3VR8B 4USAA 1TJEA 2AX5A 2JQRB 2CJNA 1QOFA 1OQQA 2W54A 2HTME 2WDRB 4N58A 3AE3B 3BIID 5AUKA 2W3RA 1FO4A 3NVVA 4ZHOA 4ITKA 1VLBA 3KWLA 1EWYC 1YJIA 2EKIA 1PUTA 2OHFA 1WWTA 1DGJA 3AECB 1B9RA 1NENB 3P4SB 3W5VB 1JALA 4YTNB 5EE3A 4YSZB 4JWSC 1E7PB 3PO0A 1FRRA 3LB8C
chains in the Genus database with same CATH superfamily
5L1MA 1ZDXA 2LJIA 1EWCA 2K39A 1RXWA 2KWCA 1BPBA 3PW2A 2W7PA 1J2NA 2K6QA 5BO4B 4PYUA 7ICEA 3NJTA 2ZIWA 2BZFA 3Q8PB 2KQ7A 3BYYB 3GV7B 4ZDVA 2ZXIA 1ZQLA 2JPHA 7ICPA 2EZYA 4C8KA 3QAQA 1CMXB 9ICIA 4UW9A 5ALQA 3AEFB 1I7HA 2QDFA 1K52A 2PTLA 1A5RA 2WP9B 2GBKA 2KJ9A 3AE8B 3WIMA 2BGWA 1M6YA 4R64A 3HUIA 3QX7A 2UU7A 3S2AA 3ZUNA 2I1QA 1ZRNA 2MP2A 3UMBA 4F93B 1SZHA 3AU4A 3GDXA 4K7WA 2HMXA 4F92B 4EZLA 1PK1A 3KHRA 2K8HA 2KK0A 3QU2A 4Z6FA 2KIVA 2D3DA 4QZAA 3DCGA 3WA0A 3RT3B 3TAQA 3OJUA 3QZ8A 4UAWA 2K60A 3FAHA 4I2CA 2YMQA 3AL0B 4AYBC 3EHVA 4BOZB 3OHAA 3EUB2 4M9GA 2XNAC 2LRWA 4HLEA 5HNKA 2FNJB 1S1QB 4MF2A 4NJ7A 5LXHA 2FCMA 4HAIA 2BWFA 3JSVB 1KLNA 2JV3A 4CF4A 4F50A 1U47A 2RMMA 2NS5A 4MGYE 1H4RA 2YQEA 3FC4A 1H38A 1T0YA 2GOWA 3C5FA 3AU5A 4KN7A 1RXVA 1PFDA 2KX3A 2G5HB 3VDZA 1E8XA 3UXOA 4PYZA 5ALNA 2KWDA 4E0DA 1Z3EB 1K1SA 5CHGA 2FCSA 5B66U 2Z8LA 2GO7A 1YZ7A 2F77X 5L1IA 2KV2A 2ZJDA 3RNAC 1Z5SB 2MJEA 2AHOB 4K3CA 5AKZA 5AZFA 5AKGA 3DPDA 5HMLA 2GLEA 1MI0A 3KZIU 1C7YA 2WQYB 2H89B 3JSVA 2JHDA 3RNGC 3AU6A 4XX5A 3QCAA 4RGTA 2ESEA 2K8BB 3B9JA 4M9HA 5JTIA 8ICTA 3E56A 2DAFA 1HJPA 2HE7A 2V3PA 2ZW0A 3QUCA 3ZIMA 1ET9A 1K8RB 3PHWB 1XCQL 4RPYA 2ACZB 2GBRA 4CE6A 3ENEA 3L10B 3VAWA 4ANVA 2C2RA 3GIKA 3APDA 1WCNA 2XVTA 4YR2A 1R4MB 2O6VB 4OZAA 4KLQA 1RFKA 1JROA 4GXBA 1VJ5A 1WJ6A 1UT8A 1IYFA 4EZ9A 2W54A 3UIPB 3WANA 2DGZA 3GZFA 4RU9A 2KD1A 1YJIA 3BVZA 2KOBA 3A0BU 3N1YC 2M1MA 3A9KA 4C4RA 2HHQA 3MC9A 3Q3NC 3NHEB 4YSZB 4JWSC 5EE3A 3UQBA 4I2AA 3RH6A 3R9KA 2H3QA 3I76A 4UB4A 5D49A 5KFOA 5DG8A 4KIKB 4RNMA 3RR8A 1V1PB 1FD6A 5ALJA 1ISNA 4RM9A 3UF8A 1S5LU 3RJKA 1JWSD 4JWUC 4AS1A 4ANWA 1M4VA 2YEPB 2JVCA 1T0RC 1MC8A 2D8CA 9ICLA 3TADC 4BBNC 1SXEA 4UDUC 4D2KA 4M00A 2K6DB 2AGQA 2EMSA 3QYPA 4CO7A 1UT5A 3T5JA 3D32A 3AE1B 1WX9A 2J0JA 1Z1VA 4C8NA 1MFWA 1KN5A 2A4ZA 8ICEA 4RPXA 2G45B 4MSQB 2FLPA 2OYYA 1V5TA 1U48A 3QZ7A 1UGJA 2KAJA 1VZ7A 1SIJA 2YEPF 3RN9C 4ECQA 2QB0A 1NK0A 3M3JA 2BCRA 1D8YA 4LJXA 2J0MA 8ICGA 2HBJA 1E9MA 5BMHA 3KWVA 1Q8KA 2LUEA 2W9NA 2DBYA 3HWTA 3B0YA 4ECSA 1ZJMA 1SE4A 1ZRMA 1ZOYB 4KLFA 1FCCC 2HOQA 2KTQA 7ICUA 3DDHA 4DSLA 3PV8A 5KFFA 2LMRA 2NO4A 2W8KA 1HE8A 4YTMB 2WDQB 3TI0A 5T14A 2GMIC 1GOZA 4IL6U 4I2IA 1V1PA 2LVOA 3HHMA 5IAAC 9ICVA 1WJ4A 2BS2B 5DQHA 2K8BA 3WCQA 3RFZB 3K4GA 4MELA 3U2SC 2YB4A 2K8CB 4I2FA 4G3XB 3KQ4A 4ICUA 3AQEA 1BPEA 2J0KA 3Q8BA 5KFNA 3BQTA 4PZNA 3AEEB 5D4BA 2K4PA 2VKQA 2ZTDA 3SYZA 1VR9A 4I2BA 4XWWA 3FYHA 1L0XB 4QZIA 1N62A 2RDJA 4I28A 3HKZC 4II2B 2QLTA 3LDZE 2HHTA 7ICJA 3BZCA 3ZRFA 3DDCB 7ICMA 3OWEB 4HWIB 4I6LB 4HPLB 1ZD2P 2J52A 3MDAA 4XDDA 1XU4A 1NDDA 3GB1A 3KW5B 3PO4A 3TAPA 4ACFA 4WQMA 2ZEQA 2RDGA 2WXIA 2KP7A 3ORYA 5D3DA 3H9DA 3NVZA 5J2JA 2KICA 3OJ3A 4PS3A 3EYZA 3HIZA 2SEBD 5EWFA 2LM4A 2UVWA 4M8MA 2JQRB 2I1JA 2WXKA 4C4VA 3MR2A 1Y8RC 2XC9A 4KTQA 4JL9A 2NRWA 5JHAA 1ZQGA 1BPYA 4DSKA 1AARA 4ITKA 3B0XA 2LXCA 2EKIA 2IOHA 1WWTA 3MR3A 3UQ0A 3N32A 2ONQA 3W5VB 1KOTA 1B4FA 3QU4A 1SE9A 4Y2VA 1E7PB 2ZZPB 3QUTA 4QZHA 1JWBD 5CP2A 2V9HA 2KVRA 2LD9A 2WTFA 2XY7A 1ZQKA 3ZD9A 5EWGA 4B6WA 4F2RA 2PI4A 1HZ5A 5IINA 2KDMA 5A0LA 4DFPA 3BWUD 1KM7A 3N97B 4F4WA 2E3TA 1D5ZC 3I63C 4GDLB 1NKEA 1N60A 2YMMA 5HHHA 2DHZA 3VUXA 2BR0A 4M0WA 4XC2A 1IV8A 1WX8A 2ALZA 4B9KA 4CYEA 1NK4A 2M56B 2RDHA 2IO1B 3AE9B 3MGHA 1X9SA 3BVGA 1UCVA 4II3B 2DKXA 4YN4A 4Q45A 2Y5CA 2IGHA 2KFJA 1DOXA 3V60A 4WJNA 2KX0A 4AJYB 1HQRD 1ROEA 1GUAB 5KG4A 3TEYA 1SJHD 4O1NA 1SKWA 1NI3A 1ZQYA 1WXQA 1V86A 3O65B 1U45A 1BXTA 4C4TA 1ZETA 4MHVA 1LV5A 2LYBA 4ZRIA 3RJFA 3SHQA 4F2SA 4O5KA 5E6JA 2ZJ5A 3F2CA 4A90A 2F1IA 2N9KA 1UWXA 1ZQHA 1L4ZB 4YXMA 2R61A 5AUIA 2WXPA 4NLZA 4GOCA 5KNIA 4UBBA 2ZTEA 2FMPA 2LBOA 2H3FA 2R2OA 3S6JA 4KZCA 2XK5B 4EX7A 5HHDG 2F8LA 3TL5A 3ZKJC 4EBCA 1ESFA 1ZQWA 1OFFA 2JXXA 4IM0A 1EU3A 2MLBA 2MWSB 3IHPC 2KN7A 4RQ6A 9ICUA 5IKCM 1SEBD 3F2BA 2KDFB 3PSTA 3EPIA 2JH7A 2NCNA 3CWIA 1N5XA 4N9F4 5DKWA 1RYSA 1TT5B 1FRDA 3PZPA 3IAS1 4NL9A 3C0RB 5AKEA 4G3IA 3BQ0A 3RMKC 3SEBA 3D2QA 4NJ6A 2KOXA 5BYSA 1IXRA 3B1LX 1KF6B 4RZRA 1VJKA 3PMLA 3P2BA 1E90A 2W55A 9ICTA 2E8NA 4O9MA 3IFWB 4F3OA 2BQQA 1CQVA 3DHIC 5GTHU 4P0QA 5JU5A 1DK2A 2R2QA 1MPEA 4IKGA 4HCNB 2OOBB 5C0YA 2EMTA 5AUKA 4NAWB 5F9LA 2RR9A 4JIOU 1ZQUA 1KTKA 5BYRA 3NRWA 1NK5A 1SL1A 4MEMA 1WJUA 2AU0A 4YD2A 2IO3B 2O6VD 1X6IA 4GXKA 1E8WA 1RAXA 2Y1JA 3IHQB 2BGFA 3BINA 2KG5A 3OG5A 4PL2A 4NQKE 4I2GA 4J03A 1F9JA 3PO0A 3DHGC 5BYQA 4IUMB 2BYTA 2UYZB 3WK5A 2MBEA 2HTHA 5J0XA 3Q14C 2MUTA 4YCXA 3L08A 2ES6A 3P4RB 4WWNA 4PZOA 4WWPA 9ICHA 4B0EA 4KITB 2N1VA 4DSEA 2JEGA 3GQCA 1EM7A 3TQ1A 3AEAB 4Z6CA 5GMVA 5C5JA 4JLCA 4HK2A 4GC6A 1F2RI 2D11A 3BZKA 2BPFA 4TUUA 3PW5A 4QIWF 4BDPA 4REZA 2I1KA 5AK4A 1T7PA 4O3NA 1GB1A 3EW9A 2CU1A 2L7RA 3ICXA 5KFKA 2J7QB 3M7DA 5EWEA 2RDBC 4NLGA 4DQSA 1N48A 2D6FC 3A9KB 1K53A 2I6XA 2J42A 1IBXA 1R4MI 5DBBA 4F4KA 2WXGA 3ECIA 3IDWA 1Z4NA 4QZEA 3F2DA 1X2IA 4DL2A 2O2VA 3PRMB 5AKLA 4W9KA 4F5PA 3M8RA 3PW0A 3CSTA 2QARA 4KDIC 2LGXA 1J8CA 8ICVA 1DRGA 4P2HA 1E10A 4KLLA 2PW9A 2JZZA 4MFFA 9ICGA 1VZ6A 3RR7A 3L16A 1EF5A 3WK4A 3W2DA 4DQQA 1RG6A 3BZDB 1OTRB 2KANA 4JMUA 3BDPA 3R7QA 1PQSA 4DF8A 2N4FA 4AQ7A 1Q10A 5KFYA 4W9CA 3RI7C 4NJCA 3KHGA 2WXJA 2CKHB 5ALGA 4FULA 1WGKA 1RZTA 2AQ1B 2H3ZA 2ZPNA 3K9OB 4O3OA 2J6UA 2WX1A 2C2DA 3RULA 1WIAA 5CR0A 1V97A 5EE0A 2IO0B 9ICNA 3SFDB 1AQ6A 3TKAA 3DVGY 4GLXA 3P4QB 4U6PA 2AYOB 8ICAA 3LJ3A 2ZNVB 2KEYA 2EZXA 2QMTA 4GSWA 2ZIXB 2KSOB 3IM1A 4ELTA 2KO3A 3KUZA 3V6JA 1TIFA 2E8PA 1BT0A 3DBRI 2YB1A 3PS6A 4C8OA 1PUZA 2KKVA 3PZ8A 2FCQA 1VLBA 1EWYC 1Y56A 4J9RA 1SV0A 4K1RB 3RNCC 2ATLA 4F5OA 3F53A 4QW9A 1JALA 2ZG6A 2HVIA 2FPKA 1CEZA 1JIHA 4J3OD 2F1HA 4AP9A 1GJZA 4QW8A 4DK5A 5BOLA 2HHWA 3RTVA 3M8SA 4KLEA 3CP8A 2KHQA 2BB6A 4OHJA 4GU2A 1SXTA 2WLBA 4GLSC 3VH4B 4I2JA 2WF6A 3IG5A 4DQPA 7ICIA 4EE2A 3N20C 5AZGA 3PMNA 3J81j 1WWVA 2GLSA 4CQNA 2L05A 5KFIA 4RQ3A 3H1UA 3ZDBA 3BK2A 5EOZA 1PGBA 5KG6A 2KZRA 4QIWC 2BYVE 4EUTA 4YD1A 2KMCA 4KVGB 1KFSA 2B76B 1GO3F 2DLBA 2CHZA 3RUIB 4IS7A 3J9CA 4I27A 4YXJA 5G2NA 5KT7A 4M47A 1V5OA 3E9SA 3MDCA 5HP4A 3AUOA 4J9LA 1BMLC 3QEBZ 2KDBA 4KV2A 4NLNA 3MGVA 4F4YA 1WR6E 3TIXA 1NK6A 3ZRCA 2IDYA 4DQIA 4RFBA 2ZUCA 1DOYA 3D6JA 4O3QA 1SL0A 2DENB 3PRPB 2JH1A 3QA8A 4DQRA 4ECZA 1NK8A 1UBQA 2KFNA 4EYHB 2I2YA 4M9NA 1QOAA 5D6JB 3RFAA 1SSNA 5FP0A 4DL5A 4C4SA 2VZKB 2MP2B 1COKA 1XEEA 2ZNVC 1S0MA 2W11A 3H8SA 3OJSA 2BCVA 4HROA 2KZZA 3EFCA 4M04A 2K0PA 3U7ZA 5EE1A 1OUQA 3EA6A 4KSLC 1WE7A 2NV3A 2Y0SC 1R4NI 4MSMB 5KFMA 5BOMA 1HZ6A 2H88B 2Y5PA 1WMHA 8ICBA 4WURA 1GB4A 4LZGA 1WFYA 3VQIA 2ZIUA 3HKZF 4PHEA 2K4EA 9ICOA 2HJ8A 2UVRA 1GC6A 4CGZA 3Q69A 4XGAB 2AH5A 2LWPA 4WQOB 5DDYA 3SV4A 4QZFA 5KFTA 3APCA 4RQ5A 5AI8A 4A8EA 3BS5B 4N6EB 5TSSA 3AH7A 1LB2B 3M6ZA 1CZPA 2G4SA 3ZJTA 2UWQA 5TISU 3PX0A 2NPTA 1QQ6A 3H7IA 1JUDA 4NLBA 3VCBA 4TQRA 5ALKA 5KTQA 2LMCA 2F3NA 3KYCD 3Q3OC 3BYTB 3HM3A 1WG8A 3LWMA 2QB0B 1XCTL 2HTME 3GIJA 2NMQA 3A9JB 4K4GA 1F77A 1HEKA 2KN5A 2W9MA 3IV6A 1TAMA 5ALVA 1CI4A 1TS3A 4LLGM 4DXFA 3Q3JA 4TUPA 2V1YA 2KC1A 2DZMA 3ZNZB 4WJ3B 3UQAA 5CEHA 1L4DB 4A3PA 2BPSA 3EPGA 1TS4A 1WSPA 5AK3A 2INNE 1JN3A 1I4RA 4J9NA 1IM4A 1BVSA 3SD7A 3EFUA 1I4GA 2HCFA 3WALA 2XO7A 1N5WA 2EAPA 3ISCA 4P0PB 1RWSA 2KTFA 4HXDA 2FBWB 1C4AA 2OWOA 4NLCA 1J7AA 2WDTB 2A3VA 3VC8A 1TS2A 2G3QB 2E8OA 3GV5B 4UAZA 4GGQA 4M6WB 2BYEA 3L5KA 1P0RA 3FKYA 3UMGA 3IRUA 1L6VA 2VH2A 2QB1A 2MU2A 2LGSA 5DB8A 5FKAC 3BVMA 5KG0A 3JPNA 5MPOA 4W9HA 3U8ZA 1YQBA 1QSSA 4F91B 3U4EG 4K4IA 3LK9A 2YVCA 5J0YA 3TCAA 2LPEA 2KHWB 4RNNA 4TV3A 1JQ4A 3T3NA 4L2YA 4YMNA 4TUSA 1YZ6A 5ALXA 3SEIA 1YX5B 3KYDD 2DX5B 2Y3AA 5AZHA 5JXVA 2HHVA 5DLFA 3RAQA 3NS8A 4R8UA 3RJJA 2JZPA 3CMMB 3PZDA 2LEKA 2ZVNA 3A9JA 3Q3MC 5HKHA 4NAWA 2PMZF 2L00B 1UPHA 5G5GA 4DQOC 3C1YA 2PKOA 4R66A 1HA5A 1SV0C 4ED3A 5J0RA 3ZXVA 3K75D 2KD0A 5KT5A 2WNMA 1SWVA 4KLTA 1ZQQA 1P1AA 3PVXA 2K4HA 4LNIA 2ZIXA 4FHKA 3MP9A 5KFBA 2P6UA 2KNJA 4GDKA 4R8UB 3EC8A 1DXSA 3DBRB 1TKDA 8ICUA 1AWDA 2CN1A 2WXRA 3ZNID 1XSPA 4DL4A 4HPMB 1BNOA 1ZD5A 2FPLA 4F4XA 5KFCA 4ELUA 1JCKB 3ABVB 3OLMD 1WGDA 2KQ4X 2A1JA 4U7CA 4NZLB 4ED0A 1T3QA 5CB1A 3Q8AA 3D2NA 1TK8A 4B95A 1D6EC 4DEZA 3NG0A 3NZ3A 3QU7A 3TADA 4PS8A 4AJWA 4GMVA 4QWCA 2L0TA 2D3BA 3PREA 1TV9A 3NZUA 1D8BA 4WIPA 5L1JA 4DS4A 1SWWA 2KMDA 7ICGA 2ASLA 3LYSA 2V4LA 4N58A 1WXAA 2KLCA 2J6TA 2NYVA 5KFGA 4OJ6A 4BKSA 1Q3VA 2G06A 2NBVB 2FI1A 2AGPA 2Z0DB 4A8XC 1V2YA 3ZI4A 4G0NB 2F1JA 2WF8A 2OCEA 1TE2A 2CS4A 3V61A 1ZQVA 5BMIA 8ICKA 4WWOA 2Y9UA 1L6UA 1QCKA 4CNQA 3PLVA 4GIVA 2FUG1 1I4XA 5KG2A 4RGOS 1SE2A 4B0MA 4QZGA 3C29A 3BQ2A 4M01A 1RDFA 2G0AA 4EX6A 3KFUF 2OJRA 4NJ8A 2MA9B 1DOQA 5ALTA 2FLLA 4A9AA 3ZNGC 2RRDA 2W03A 3T8MA 3TARA 3E0FA 1XNSA 4O0IA 2QCZA 3T9LA 4O3PA 2PI5A 1ZQXA 3A4RA 3BS5A 3GS2A 4GDKB 2WU2B 3C23A 2UVUA 5ALYA 1SXDA 2PLPA 2N9EB 4O5CA 2NTTA 1R4NB 2K8CA 4FLHA 3TACB 1J97A 3RRHA 4YTPB 1ZQNA 5KHQA 1NNLA 2OXOA 4YR0A 1L7YA 2EELA 1P7DA 3ISDA 2JRHA 3BS7A 2PIAA 4KLOA 1AN8A 4JWNA 2D3AA 1TVAA 5H8YE 3AE6B 3ZYYX 5IN7A 2XY6A 4KLIA 2FPMA 2JUOA 3AEBB 4KKIA 2IO2B 5CHVC 3H0RB 4P4PA 2K5PA 3ALBA 1J2MA 1NZBA 1C76A 4DHJB 3RB6A 3ML9A 4TSSA 4BBNF 5F9NA 4M9JA 4C00A 2KJ8A 1NYQA 1S76D 4MFCA 8ICSA 4HPPA 3PSFA 1QSYA 1IUEA 4DSJA 3GOEA 2D10A 3N9YC 4K7SA 5DPWA 4QZ9A 5J2BA 4TQSA 3BQ1A 1LO5D 1YQ3B 2V4QA 1YT3A 4NWIA 2M0NA 2WWZA 5IIKA 4BGDA 2EANA 4LJOB 1X6JA 1GNUA 1XXGA 3VXWA 2CRXA 2Y0SF 3WK7A 2E5SA 3HJEA 2Y5BB 4IWPA 5AM4A 1C4CA 1Z2MA 4FXCA 3LVVA 1L3UA 2HBLA 1I35A 3VUYA 4CHKA 2XIDA 2IJ0A 4NNJB 4YWGG 4FS1A 4P4MA 4IRDA 3CIRB 2WFAA 2CHWA 4RQNA 1ZQ1C 2ASQA 4ECVA 3F5AA 2LXAA 4IR9A 3QJZA 3N7SC 3PR4A 2HHSA 2L76A 3DBHB 3JW0X 4RQMA 2HI0A 1TZOA 2L0FA 1L7NA 2RQ5A 2HHXA 5JH5C 4FBTA 4B6JA 5TZVA 3MTNB 1V9JA 5D2MB 4EEYA 1HXYD 3DVGX 5ALSA 2XGPA 4Y2YA 2MRPA 3WKDA 3IG3A 2I38A 1BPXA 3ZTCA 1KBUA 2MEKA 2NPTB 2XICA 2WXHA 3AU2A 4M0AA 1QTMA 4AWJA 5J2RA 3WU2U 2FMQA 2QIEB 1LKYA 1XT9B 3GZNI 2L5YA 4OZCA 1N56A 2WHEA 2JF5A 3VRAB 3ED5A 1IP9A 4UB1A 2BCSA 1ZQFA 1PK1B 2MBQA 3JVZX 4QNLA 1MVKA 3N7RC 8ICPA 1Z00A 2BT6A 1UELA 2KNBA 2C7NB 1L0YB 3WK8A 2JWUA 3KBBA 3P63A 1L0VB 1URJA 3GFKB 2DWQA 1XO0A 4IG7B 3QUBA 4RQ0A 1IIPA 2PE6B 4ICVA 2FDRA 4LJPB 5IILA 1L7OA 4ECWA 3NTUA 2IBKA 1YMHE 3H8WA 3KZXA 3FM9A 1Z4OA 4ZOHC 3NRZA 4BX9C 1ZQEA 2HVHA 2JZ3B 2KWUB 2EQYA 4OJOA 2INCC 1DGSA 4PL1A 1WWUA 2N1WA 3NGDA 4RUAA 3RJGA 3B08A 7ICTA 3KUCB 4NL9C 3QWZB 2V0GA 2W7OA 1TAQA 4HJKA 4B9SA 3X0WA 1UQVA 3IG8A 5DB7A 1S0OA 4WJQA 1NK9A 4LDTB 5D7GA 5C3JB 1Q46A 1XLNA 1V9PA 2Z59B 1TZ1A 2BS3B 2K9XA 5KFVA 4W9EA 4EBEA 5AK5A 4GXIA 2RD0A 2VZKD 4G9BA 2BB5A 4KX3A 4C80A 2MA1A 1E6EB 5HR7A 1L3TA 5J2AA 1Z1BA 2G07A 2INDC 1ZQZA 2JEJA 2G1EA 5IA7A 3AE7B 3HILA 3VUWA 1C3TA 1E0ZA 4DOCA 2R8KA 5AIAA 2KZ3A 2JZBB 2EAMA 2HDEA 4UB2A 2R8GA 1RYJA 3R8BA 3H6NA 4ARIA 3KUDB 1L5PA 1J19A 4ZYNA 3ALRA 1QQRA 2GBJA 4DHZB 8ICJA 1KLVA 4HJGE 2A1AA 3GILA 3ZDAA 2Z7JA 1MQ2A 2L32A 3I57A 1FMAD 3SV3A 1AW7A 4NY0A 5LLIA 5KFQA 3OGUA 4UBCA 2N7EA 2XI9A 8ICHA 3PO5A 2LVPA 2ASJA 3QC8B 3WAMA 2F8KA 5DQIA 2CPRA 3NVYA 3PHXB 4BFRA 3BJYA 2H3VA 5AHXA 4OJPA 3ZVVA 1E5WA 3RNEC 3EECA 4I2HA 1NKBA 2NRXA 3WK6A 4ZRQA 4ZHOA 1COOA 1ZQAA 4J9MA 1L5UA 9ICXA 4CF5A 4ASWC 1NJXA 4ECUA 4LCDE 7ICVA 5D94A 1T3NA 5HG2A 5FR6A 3IVFA 2ASDA 2YLMA 2ZIVB 4O3MA 4CDGA 2AL6A 1SZPA 1NYRA 4DHZE 5FK9C 1F1HA 2K1FA 4A55A 3AB5A 1HIWA 4F7ZA 3LYYA 2VA2A 3UINB 1FCLA 4RH6A 3L4PA 2BDUA 1SBBB 2IY0B 4S17A 3ZXRA 2B0CA 2IHMA 1TAUA 1IGCA 3PSIA 1F2RC 3MHSD 4A20A 5L95C 5LNK1 2ICIA 3PT2B 1Y88A 1FPYA 2F44A 5JZEB 2AQ2B 5KFZA 3ZNHB 1BUIC 3QEAZ 5ALOA 4UAVA 5ALIA 4DL3A 3ISBA 1DOIA 8ICMA 1SGGA 3HW8A 4UQGA 3RB4A 1S10A 1ET6A 3K9PB 4KIKA 2BPCA 1WMHB 2EAOA 4KDLB 4WJOA 2BPGA 4Y2QA 5AK6A 3JPPA 4F1SA 3AE4B 1WUDA 2WXFA 3DBSA 5AM1A 3R3MA 3N30A 4FJYA 2EDUA 2MSNA 4HDQA 5AI0A 3DHHC 4GXJA 5J17A 4RQ8A 4C4VB 3R66C 4DOBA 4RCOA 4US8A 2ZUDA 1K51A 2BCUA 3ZGZA 5KG3A 1WCLA 2MAXA 2KYWA 1S3SG 3HT3A 3VR9B 2IA6A 2ODGA 4RT2A 1YN3A 3WKAA 1BGXT 5AKKA 2PPHA 3ZTDA 3VHTC 2E8MA 5J0UA 4MF8A 3L17A 3LXFA 4IW0A 3W1SC 3ETLA 3ETRA 3T5KA 2L3ZA 1YIWA 3AXCA 2A19A 2JYTA 3DOWA 2LGDA 2OEDA 5C23A 7ICLA 5AKYA 2O6VA 3IAM1 3T3OA 3KD3A 4DL7A 3GIIA 1VD2A 4MEXA 2UVVA 1ENFA 3HX0A 1VZ8A 4HDOA 4FJVB 4M6WA 4DXGA 4R3DA 3HP6A 1N63A 1WX7A 5FR3A 1MQ3A 3CNHA 3MR5A 3Q2AC 3I3TB 3M9NB 4FZMA 4EKUA 2HBKA 2I9GA 2XEWA 3M1YA 1U4AA 4XUSA 2WGSA 2KIWA 4YVZA 2A5UA 1EU4A 2AX5A 3QHTA 2KKPA 2WXMA 3QXGA 4RNOA 4Q43A 2BKRB 2DFLA 5F3XB 3PSEB 4WJPA 3I1YA 2REXA 2WAQC 4ED7A 4TMAB 3FILA 3P4SB 3AULA 1L8OA 1ZQJA 1SIFA 3PGEA 4B9LA 1Z00B 4ED8A 1ZE3D 4F5QA 2V9WA 3RBDA 4XYCA 3A1QB 3ZDDA 3TANA 4IQTA 2NRVA 5J2EA 1GAQB 3KLSX 1QQ5A 2KE7A 1KRHA 5AIBA 4RMAA 1L7MA 4ARCA 1J0GA 1GPXA 3RZFA 3AEDB 1PK3A 7ICKA 1TS5A 3U26A 5KFRA 4Z6EA 5D46A 3JPRA 1SJED 3V7LA 7ICQA 4S0RA 1C1YB 4ED1A 1FEHA 1QQ7A 3KOOA 3GE8C 3ZLZA 5ALFA 4FA6A 4QZ8A 2Y9TA 4Q8EA 1ZDVA 1SB3C 3RPFC 3NS1A 1PDXA 1WRIA 5IIMA 3H40A 1KFDA 3SAHA 5JUMA 2RP5A 2L1AA 3KVFB 4B9TA 3C2KA 2PVGC 4EOYA 1STEA 2WX0A 4EFOA 4OO1J 4ECXA 4NQLB 4Y2PA 2AWTA 3SDLC 5KL8B 4UARA 2JT4B 1S9FA 1TKGA 4YQWA 2GBMA 4DO9A 4PPXA 2PJHA 3HM6X 4GDLA 1UA0A 3W1YA 1ZD3A 2IGGA 1QH9A 4QWBA 1D3ZA 4E3CA 2FIFA 5HHIA 1LVHA 3AEGB 3T3FA 2BDPA 4EYIB 5AM0A 1JX4A 1F5SA 4QZBA 3PLUA 4DBGA 2KVCA 1C77A 4AYBF 1XLPA 1Q0WB 2KN4A 3VTVA 3MGIA 2IZVB 1C79A 4KGTA 3B2GA 3RZWC 5CJ7A 5AI4A 2RDIA 2Q0ZX 1TBEA 3HRDD 2QARB 7ICSA 4DXAB 2IMWP 1WYWB 2PVOD 3L3FX 1S0VA 4I2EA 4H2AA 1PVPA 4KLJA 2R8HA 2CHXA 2DKZA 2NRTA 4BAXA 3Q8FA 4EZJA 4URKA 5KFHA 4DSFA 1OW5A 5CWRA 3C1ZA 2LGYA 2LVQA 4E74A 3M62B 4IM3A 3MFGA 5C2TB 2QILA 4FN2A 3N1ZC 4UB3A 2AQ3B 2LUMA 4IOIE 3DVNU 3WKCA 3G6YA 2IOFA 2W43A 1A6SA 4HYKA 2MBHA 5GXGB 3QIJA 1OQYA 1QKZA 3V6CB 7ICRA 1V85A 3H7SA 5IOIA 9ICCA 2KJRA 4A6QA 2Q5WD 4K4HA 1SGHA 5AI6A 3URYA 2YMLA 1QOFA 2XBBC 3ML8A 4KN4A 3OHBA 3QX1A 5BMGA 2W3RA 1KEJA 4DL6A 1JXLA 4BXOA 3H0MB 2K25A 5AKHA 8ICYA 1BNPA 1PUTA 2OHFA 4W9JA 3AECB 2QKQA 2ZIUB 1B9RA 1WJNA 2DL0A 2DZIA 2FE8A 2MBBB 2E1FA 2WHIA 1ZQOA 3BK1A 4DDGD 1ZQSA 4KLUA 9ICSA 4OVZA 3C5GA 2C5LC 4FHJA 3MHZA 9ICRA 5LXIB 2XCPA 4ZYSA 1A70A 3RBEA 1XC9A 9ICFA 2BYFA 2D3CA 4X57B 3MC1A 4PJ0U 2HOFA 1WXSA 1JRUA 2XN9C 4Y2SA 1BPZA 3LDAA 4YL8A 3KHLA 3E58A 1P3QU 2BCQA 1YN4A 1L2NA 1QILA 3SZ2A 4EEWA 5AM5A 2WXQA 3FILB 3TFRA 4LNFA 2IHNA 4W9LA 2LGIA 1XLOA 5KFPA 1IBXB 2ZTCA 1PZNA 4I6PA 4FBJB 2CJOA 2DUYA 5J2HA 1PVRA 3WKEA 3DVNV 3AMZA 3Q3FA 3N3KB 3ZW3A 1MA7A 1CUKA 2JR5A 2ZIWB 3UI3A 2C60A 5AM3A 1TGZB 3B0AA 3NUQA 1ZP0B 1U9LA 3A33B 1QT9A 2AXTU 8ICLA 2F2AB 4L23A 3H0LB 3ZDCA 3ZD8A 4RPZA 5AKIA 3ZDEA 2WU5B 2ZXHA 2KXJA 1UH6A 3PZ7A 2PKEA 3MR6A 9ICPA 5H92C 1KRPA 2KLGA 1ZW7A 1MHXA 4TKNA 3SENA 1FEZA 1TFRA 2XGQA 3AM9A 5CX3A 1RQLA 5L1LA 5JHBA 2J6SA 2VA8A 4OJLA 4RF0A 2DZKA 1V80A 2E1EA 2GH1A 1RFAA 1TK5A 3BQ7A 2X38A 2BQUA 3WAPA 2PMVA 4IWOA 5ALZA 1QOGA 4O5EA 4G50A 3M9MB 5J2DA 3G6XA 1F0MA 1CRXA 3VRBB 4KLDA 5IIOA 1PVQA 5CHFA 4RT3A 4F5RA 8ICXA 4DWIA 1E8ZA 2Q4TA 4MFAA 3APFA 3NY5A 3H4BA 1WZ3A 4FS2A 3N4MB 3VTWA 4KLHA 1SKSA 3WAOA 3L54A 4ECYA 2HW3A 4RM8A 4TQ0A 4NY8A 1FNUA 1QLBB 4WAAA 1RYRA 1JI7A 4FADA 3RB0A 5KFDA 2FIDA 4F71A 1WI0A 1S0NA 1ZXHA 4LK0M 4MJSA 3W5UB 1AYFA 2FUHB 4JB3A 4AP4C 3U7DA 1WZ0A 1JMSA 3K1RB 5AKJA 5EE9A 2ZJ8A 3SAGA 1XO1A 1B1ZA 3V3XA 1NI2A 3Q8KA 1WGRA 4JGHB 4KLSA 3V7KA 2BQ3A 2MJ3A 1WE6A 1RQNA 1X42A 4USAA 2W8LA 1E7UA 1TJEA 2CJNA 3DV9A 5B5EU 2WDRB 4HKZE 3AE3B 1TK0A 4LZDA 4RQ1A 2LI6A 3OSNA 9ICAA 2LHTA 4MGKE 3N1XC 4JV2A 1Q5WB 2WAQF 2JZBA 3T5HA 3LB8C 1YOVB 4XQ8A 3A4SC 3NOBA 4OZBA 1P98A 3G6VA 1FXAA 2BTEA 3F5EA 3UIOB 2ZPYA 4DFJA 3MFIA 1N6ZA 4DFKA 5DG7A 2YTUA 1F0ZA 5J2IA 3TBLD 4EZKA 5I4DA 1ED1A 4P0QB 2DYOA 2N0SB 1KQQA 1X40A 2NO5A 4C8MA 2MHJA 1JRPA 1J7CA 4KKJA 3RF9A 1L8LA 2E6XA 1YJ1A 3PRZA 2EZZA 4JWMA 1LM8B 1LKYB 4IR1A 3SD5A 5EDSA 5J2FA 1H8CA 5IP4D 5DBCA 5KFAA 5KAIU 3P42A 4BXOB 1K50A 1P9DU 1KSPA 4J9SA 2ZCCA 5J18A 4JK1A 1JWMD 3I9V1 5H2FU 3DBLI 4YXDB 4I2DA 2HD5B 1VDVA 2JX5A 2HOIA 3NASA 5IIJA 4UB6U 2KJ5A 1ZOLA 1SL2A 2ON8A 3RYTA 1NJWA 5J0WA 2FE9A 2JEIA 3GZNB 2G5IB 3TMPB 2C2EA 1WY8A 3MC8A 3OAWA 4F72A 2MJDA 1SKRA 1GC7A 4YMOA 4WH4A 2PEAA 4OJ5A 4KLMA 2KJHB 1YX6B 2LZ6A 4J9KA 2WB1C 3CW2C 9ICQA 4R63A 1F52A 3L0WB 2M8SA 3SU8X 2LYAA 1Q1OA 1XQQA 1IG6A 4YMMA 5KG5A 2OEHA 3DWMA 7ICOA 3H4DA 1I42A 1D4BA 3U52E 4XZ4A 2FJ6A 2M19A 2H3IA 3RJIA 2KMMA 5KT4A 4MEYA 2L52A 2N9XA 1GG3A 3MABA 1X66A 1KW4A 5E6NA 2KMAA 2OM6A 1V49A 4EZ6A 3AN1A 3JPTA 2MH7A 4EELA 3SAFA 1UD7A 2K22A 3QU5A 1TTNA 4BWMA 1FNWA 2ZW1A 5KFEA 9ICMA 1C20A 5E79U 1EUVB 1XSNA 4JUZA 3HVDA 3ONNA 5ALPA 3UXPA 4DHJD 3SR6A 3V05A 1ZD4A 2KTRA 3VR8B 5KG1A 4GC7A 1OQQA 4BKTA 3UPQA 1FO4A 3IT4B 2M9NA 4JQWC 2P66A 2DAJA 5CHWA 4X5VA 1L3VA 1T0QC 4UB5A 5DB6A 5HR6A 4FE3A 3PX4A 2PFPA 5J0QA 1G6JA 1D9DA 3P1MA 5KFLA 2XCAA 1A0PA 2NBUA 4OD0A 1ZQMA 1N61A 2LRUA 3C28A 3VTUA 1WM2A 1WM3A 8ICFA 3DQVA 1FXIA 2OJWA 2RHFA 3H7PA 3RNFC 3PR5B 1SE3A 3CSFA 3DEEA 4HRSA 2C22A 4BOSC 2JGAA 1FM0D 1K1QA 1XF5L 1OEYJ 4M02A 1A76A 3QARA 3JYUA 1ACCA 3VH3B 1TKYA 2WB1F 4G11A 2RPQA 5E6PA 4LNOA 5HMMA 1X9WA 1ZQDA 2BF8B 1I4QA 3RJHA 1KL9A 8ICNA 1ZQPA 1WR1A 4ED6A 4F4ZA 1D5MC 2KJ6A 4A3OA 2W3SA 1UWMA 5CTRC 4W9DA 4NM1A 4QZDA 1MG4A 4LVSA 8ICOA 2BWES 2W9AA 4Y2RA 1WXVA 1U4BA 4F5NA 1IPGA 4GFJA 3ZJVA 4ZRJA 4BKSD 3AI5A 2LJ5A 3PNCA 3P4PB 5DQGA 3BY4B 4ZRPA 3C19A 1UBIA 1MSWD 2HDOA 4PH5A 4B9UA 1XSLA 3E2EA 2MQJA 1JMLA 3TEWA 5ALMA 2LKYA 5KFXA 3KH0A 4JX1C 3NZSA 3H8HA 1RM6C 4UAYA 4HKQA 5AEKB 4RGMA 2A1JB 5J2GA 1UZXB 1HUZA 4L1BA 4YSXB 4ZHPA 3AQFA 3GU3A 5AI9A 2M4NA 8ICCA 2M0XA 4YT0B 4DSIA 1ZQRA 4IRKA 4RGNA 4IQVA 2RSUA 1FFUA 4PHDA 1E7VA 3IT6B 3H8JA 1TYGB 2NRZA 2WXNA 4BJQA 3SFEB 2ISPA 4QWDA 3ZDMC 3L13A 1T5XD 1KTQA 4KMUA 4NV0A 4O3RA 2IGDA 3UGBB 2AQ0A 3Q8QB 4F8CB 1ZXIA 4JV0A 3Q8RB 2PFNA 2BS4B 5KFSA 3RH5A 5G5HA 8ICZA 2KVZA 2BQRA 2AQ4A 2AEHA 2G9HD 3C21A 3N28A 3AEVA 1S8OA 4FO6A 2LASA 2PXIA 4ECTA 3JPOA 2VA3A 2IOFK 5KFUA 2VANA 1D9FA 4QJFB 4FBUA 4NLKA 5BPCA 1WGGA 2XK5A 2JRZA 1PGXA 2W04A 1QSLA 1XD3B 7ICHA 1TY2A 5KAFU 3OJ4B 3IBEA 1LXDA 4DF4A 3IN5A 1L3SA 1XO3A 3JPQA 3SI8A 3R2TA 1ZQIA 2KHVA 1NVID 3RJEA 1X9XA 4J6IA 2BW2A 1ZYQA 3HVZA 3RNBC 4UAUA 3THVA 1RPLA 2K4IA 2WS3B 2R8JA 2GRIA 2NBWB 2BVCA 5CA7A 5T8IA 4PGYA 2QHOA 3C2MA 1V1OA 3AE5B 1QZEA 4EENA 4DFMA 1T0SC 1OXJA 2D3GA 3W9CB 1JWAD 3U30A 4O3SA 1VRAB 5KFJA 2WXOA 3KKAA 4Y2JA 2CR5A 1R7SA 4QZCA 5ALHA 4CRXA 1YJJA 5DPTA 2G08A 1AROP 2WYQA 4TQ1A 4YG2A 1OGWA 5JRTA 1YQ4B 2KSOA 2FAZA 1C4PA 2MCNB 3PX6A 3GIMA 2NTSA 1N2XA 4BWJA 4XE0A 4J9OA 2H5XA 1WH3A 4RQ7A 2PE9A 3MJWA 5DLGA 1ZJNA 2XY5A 3MBYA 5J0TA 4MGIE 8ICWA 1KLUD 3RB3A 1SF0A 1MHHE 1O08A 4XA5A 4C7ZA 5G55A 3B2FA 3R7RA 2QJLA 3QNMA 2AJQA 2YN4A 2C7HA 5J0SA 8ICRA 2INPE 3C8YA 4ICAA 1TKEA 4LTUA 1QOBA 1Q3UA 2EH9A 1XS9D 2P35A 4Y2TA 5ALWA 2M17A 2KVSA 4US9A 4K81A 2LFIA 2KTRB 1QLNA 2ISOA 1DK3A 1KFYB 1UA1A 2RLTA 5CRXA 2GI9A 1V6EA 1L6NA 3NVWA 4PHAA 3EZ5A 3SQIA 2AGOA 1ZQBA 4YSYB 4JE3B 3V6EB 5AKXA 1F44A 2GOLA 1RRBA 2HBMA 4C56C 1Z19A 2JSVX 2V3SA 1B22A 1YD8U 3QU9A 2V4IB 2OH2A 2KDEB 3UQ2A 2EKEC 2N7JA 1NJZA 4LNNA 3V6HA 1T8EA 2O2VB 3ZQ4A 1NOMA 1LFDA 2CU3A 4RUCA 4MT5A 1D8LA 1E8YA 3DWGC 5KHOA 3PV1A 7ICNA 3I5JC 5DPSA 1DYQA 3O0FA 5KG7A 2KC2A 5AI5A 5J0PA 3PPAA 1KFTA 4AUQC 5ALEA 1P7EA 1FIQA 1WF9A 1ZQTA 4DLGA 1U49A 1YN5A 3QUQA 2PFOA 2KKCA 3TEZA 4GN1A 4FFDA 2HSZA 1D5XC 4QWAA 4P16A 5DBAA 2W9CB 4RQ2A 4KGRA 3R2IA 3OPXA 4FZLA 5L1KA 2YY6A 2DPJA 4JV1A 1NENB 1CK1A 2BKEA 5ALUA 4YTNB 2MW5A 4AOFA 4OCZA 1NZPA 5J8YC 4YP3A 3O13A 3QQ8B 1NJYA 3OSPA 5DCNA 1C9FA 5J0OA 2AL3A 3QK0A 3MJ5A 2F76X 8ICIA 4P1BC 5J2CA 9ICJA 4PGQA 2KDIA 4K7UA 4ANUA 9ICEA 3CRXA 1A77A 4IDIA 4PHPA 3RRGA 4BUGA 2IYDB 2QSDA 2W9BA 9ICBA 1J7BA 1LQBA 5ALLA 1FXTB 4B9VA 1UNSA 2KQSA 2MRLA 3CF6E 1X9MA 3UMCA 5J29A 4ECRA 3PY8A 4PS7A 3FDSA 4WWMA 2C9WB 3JPSA 4MACA 4PGXA 2KZMA 3T79A 4NPNA 4DOAA 5DGAA 4MDKE 4DFDA 1WRDB 1OEYA 2DF4B 4XDCA 3TSSA 2KFKB 1M94A 4F8RA 4M2YA 1HTOA 2L8JA 3WK9A 2KFZA 1KKXA 4UB8U 2CXYA 4DCCA 3T5LA 5KL1B 4BKGA 2QEJC 2PFQA 2G4DB 4RNAA 3M6KA 3C2LA 2GWSA 3A1QA 1O03A 4C0ZA 1KDHA 1B0XA 1EO6A 4ANXA 2DYBA 1WGYA 2JMGA 1OQRA 3TJPA 3D2SA 4E71A 4KSKC 4C7YA 4DWFA 2YMPA 4LDTD 3PVLA 2RPVA 2V4RA 3K1ZA 4W9FA 4YFKA 4JPSA 4GB9A 1UUPA 3RD2A 3RH4A 2VJ4A 4P6VF 4HEA1 5K4LA 3UM9A 3M9OB 5KT3A 1YNTE 5IIIA 2N1RA 1XLQA 2W82A 4Y2XA 4BZAA 2IY1B 2J4XA 4ED2A 1V8CA 1WXMA 4IC9A 1WGHA 2N9LA 4DLEA 2RGFA 2LM1A 5DG9A 4P0PA 3MC0B 5D3IB 1WYGA 2JXTA 2R18A 3AV8A 5DPRA 4NM2A 3LVWA 4R65A 4MH0E 4PT5A 5HI1A 3VFKA 1QF6A 9ICWA 4IRCA 2JWZA 2KFKA 3UXNA 2WDVB 1T4GA 3KKAC 4FJZA 1JW9D 3V7JA 3W1SA 3KHHA 4B9MA 3PW4A 3SMVA 2R8IA 1KJTA 4KX5A 4Q44A 2LI5A 2C7MB 5KFWA 3GE3C 4MH8A 5L9XA 2G09A 2VRRB 3ZJUA 4IQWA 2ZUBA 1V81A 3H8MA 3V62A 2DZJA 2GB1A 3ONSA 3WKBA 1JWUD 1MJDA 4OW0A 4ACOA 1KLGD 2DPIA 2KK8A 1T6BX 3H7PB 4NAMA 2FLNA 4CF3A 4M9LA 4QAYA 4I29A 1C78A 3V72A 4KGSA 4ZRKA 2GBNA 4GIBA 5TR5A 2MBOA 3KWLA 2B3AA 3A0HU 3TUOA 5DDMA 2O6KA 4BVUC 1I4PA 2D07B 4Q8FA 2LYHA 4OVUA 2JRIB 2L83A 5HFYA 4FZNA 4KZ0A 1FFVA 3PSPA 1ZQCA 1RLFA 4B9NA 3TEXA 2NVUI 2X8XX 4RF1A 1UF0A 3ZDTA 1HEZE 1K5OA 4LNKA 2K8AA 4MJSB 4UASA 4Y2UA 3GV8B 9ICKA 3X23A 2JYEA 7ICFA 1MN8A 3VVWB 2WF7A 2VJ5A 4EBDA 4MGZE 2WXLA 1NEKB 4W9IA 2SAKA 2VIXA 4IM2A 4MM3B 1V38A 4ZH4A 5KT6A 1HTQA 4C8LA 4HVBA 1L7PA 5ALRA 3EWAA 4IQUA 4KX6B 2KACA 3I28A 3ZO5B 2V3NA 3GP7A 1NBFC 3V6KA 1I4HA 2Z0EB 3DBHI 3KTQA 3Q6BA 4J9PA 4ELVA 5KT2A 2K89A 2M0AA 1S97A 2ZVOA 2QC8A 1S77D 3HK0A 3HPOA 2N9PC 4IC7B 2W9BB 3N7PD 2DYMA 1SV4A 3LWLA 1UGMA 1JXEA 4EEKA 5AICA 5J2KA 2LHEA 1MG8A 4M0WB 2BHNA 3QE9Y 2B21A 4NXZA 1XWLA 1IGDA 3RAXA 4MM3A 5AM2A 3AE2B 4J9QA 2P6RA 1EF1A 3Q8EA 4WAFA 2D2QA 3Q8CA 1PGAA 1CJEA 4W9GA 2MUTB 4YR3A 5J8YA 1ZGUB 2MX2A 4TUQA 3TFSA 2WF9A 2KWVB 3EGRA 3Q8LA 2W9CA 4PK1A 4P1CC 1LGRA 3M63B 5C1ZA 2K3UA 2MSED 1BPDA 3PW7A 1ECWA 2FMSA 2BBCA 1HUOA 4KLGA 5DB9A 1NKCA 1P7FA 3IP4B 3Q8SB 4HCPB 2IPKD 2WF5A 2JEFA 1ZPSA 2J53A 2BKFA 4TURA 2FCNA 3IXSA 1VCBA 3DBLB 4RQ4A 4UATA 4DDID 4P7IA 2JXJA 4XWTA 5IO9A 3OTQA 2PMZC 2HJ1A 2YX8A 1KH0A 3CYMA 2JY6A 2VH1A 4N59A 4K3BA 1FNVA 2C28A 4Q2JA 1ZUD2 4QWEA 1T94A 5DGBA 2JU6X 2D5GA 8ICQA 4OVVA 1TY0A 5E6OA 1NK7A 2ZJAA 2N7DA 3MFHA 2IBIB 2TSSA 2I5HA 4I6NB 5L83A 2DNFA 2KT7A 3Q8MA 2Y1IA 2ZIVA 1EXNA 4DS5A 4XRHA 3M95A 3BIID 5ALDA 3NVVA 2DQNB 2HHUA 1PYWD 1X1MA 2LHDA 5GTIU 4P4OA 4IWQA 1UHUA 3PTFC 2ZCBA 3RCZA 1ZKHA 1DGJA 1RYUA 2B6GA 4M8NA 4KMOB 3NUHB 2NR2A 4Z6DA 1B43A 1FRRA 4CCHA
chains in the Genus database with same CATH topology
1ZDXA 2LJIA 3P1MA 1EWCA 1NYRA 1N61A 5FK9C 4A55A 4OHJA 2BB6A 3AB5A 1SXTA 2WLBA 4GLSC 3LYYA 3BYYB 4EE2A 1FCLA 4RH6A 3L4PA 1FXIA 1SBBB 3AEFB 1SE3A 1I7HA 1K52A 2PTLA 4HRSA 4CQNA 1IGCA 2WP9B 1F2RC 3BK2A 3AE8B 5LNK1 1PGBA 2ICIA 1FM0D 1XF5L 3HUIA 1ACCA 2B76B 1TKYA 2DLBA 3J9CA 2AQ2B 1BUIC 1I4QA 1DOIA 3E9SA 1D5MC 1ET6A 2W3SA 1UWMA 1BMLC 3AE4B 3FAHA 2WXFA 3EUB2 2IDYA 2XNAC 4RFBA 1DOYA 3ZJVA 3P4PB 4ZRPA 2I2YA 2RMMA 1QOAA 1SSNA 4RCOA 4US8A 1K51A 1JMLA 2VZKB 3TEWA 3FC4A 3ZGZA 1XEEA 4JX1C 3VR9B 3H8HA 1PFDA 1RM6C 4HKQA 4RGMA 1YN3A 4HROA 4L1BA 4YSXB 4ZHPA 2KWDA 3LXFA 2K0PA 3U7ZA 5EE1A 3EA6A 2Z8LA 3ETRA 4YT0B 2JYTA 2MJEA 2OEDA 4RGNA 1FFUA 1HZ6A 2H88B 3IT6B 2Y5PA 4WURA 3IAM1 1MI0A 1TYGB 2WQYB 3VQIA 2H89B 2WXNA 3T3OA 1GB4A 4RGTA 3SFEB 3B9JA 3E56A 1ENFA 1T5XD 3Q69A 1VZ8A 2IGDA 2V3PA 2ZW0A 4DXGA 4R3DA 1ET9A 1ZXIA 2BS4B 1N63A 1XCQL 5G5HA 4N6EB 2ACZB 5TSSA 3AH7A 5FR3A 1CZPA 2G9HD 3ZJTA 4OZAA 1RFKA 1JROA 2LMCA 1EU4A 2AX5A 3BYTB 1XCTL 2HTME 2W54A 2NMQA 2WXMA 1F77A 1PGXA 1TY2A 1TS3A 1YJIA 3BVZA 4LLGM 4DXFA 4TMAB 3FILA 3P4SB 4YSZB 4JWSC 5EE3A 1XO3A 1ZE3D 3R2TA 1L4DB 1NVID 1TS4A 1WSPA 2INNE 2BW2A 1I4RA 3HVZA 1GAQB 3KLSX 1KRHA 1V1PB 1FD6A 4ARCA 1I4GA 1GPXA 2WS3B 3AEDB 1N5WA 1JWSD 1TS5A 1RWSA 4JWUC 4AS1A 2GRIA 1M4VA 2YEPB 2FBWB 1SJED 5T8IA 1V1OA 1C4AA 3AE5B 1J7AA 4UDUC 1FEHA 3W9CB 4D2KA 1TS2A 1JWAD 1VRAB 2WXOA 1R7SA 3AE1B 1ZDVA 1SB3C 3RPFC 3NS1A 1PDXA 1WRIA 1L6VA 1YJJA 4TQ1A 1YQ4B 5FKAC 2L1AA 3BVMA 1UGJA 2PVGC 5MPOA 2KAJA 1C4PA 1VZ7A 2NTSA 1SIJA 1STEA 2YEPF 3U4EG 4XE0A 1E9MA 5BMHA 1TKGA 4L2YA 3T3NA 3KWVA 1KLUD 1JQ4A 1SF0A 2DBYA 2Y3AA 1MHHE 5JXVA 4C7ZA 2IGGA 3B2FA 1SE4A 2QJLA 1ZOYB 2JZPA 1FCCC 2LEKA 2INPE 5G5GA 3AEGB 3C8YA 4DQOC 1TKEA 2PKOA 4LTUA 1QOBA 1HA5A 4YTMB 4US9A 2WDQB 1C77A 2LFIA 2WNMA 1XLPA 2KN4A 1GOZA 1V1PA 4KGTA 1C79A 1KFYB 3B2GA 2BS2B 3WCQA 3RFZB 3U2SC 2GI9A 3MP9A 3HRDD 3NVWA 3KQ4A 4YSYB 4JE3B 2PVOD 3Q8BA 4H2AA 3AEEB 1AWDA 4C56C 2JSVX 1VR9A 4XWWA 2WXRA 1L0XB 2V4IB 1N62A 3Q8FA 2N7JA 1JCKB 3ABVB 3MFGA 3OWEB 5C2TB 2QILA 2KQ4X 4NZLB 3ZQ4A 2AQ3B 2J52A 2LUMA 4IOIE 2CU3A 1T3QA 3GB1A 3Q8AA 4MT5A 4XDDA 5GXGB 1D6EC 3DWGC 4WQMA 3NZ3A 1QKZA 2RDGA 2WXIA 5D3DA 3NVZA 1DYQA 2SEBD 4WIPA 4A6QA 1P7EA 1FIQA 2Q5WD 1YN5A 3URYA 3TEZA 2JQRB 1QOFA 2WXKA 4N58A 1D5XC 5BMGA 2W3RA 4P16A 4ITKA 4KGRA 3R2IA 2EKIA 1PUTA 2OHFA 1WWTA 3AECB 1B9RA 1NENB 1CK1A 2ONQA 2FE8A 3W5VB 4YTNB 3BK1A 4A8XC 1E7PB 4OVZA 3O13A 1JWBD 3MHZA 5BMIA 1C9FA 4ZYSA 1A70A 3MJ5A 1L6UA 1HZ5A 2FUG1 1I4XA 2XN9C 4RGOS 2KDMA 4IDIA 1SE2A 3BWUD 4B0MA 2E3TA 2QSDA 1YN4A 1D5ZC 1QILA 4GDLB 2WXQA 1J7BA 3FILB 1N60A 1UNSA 2LGIA 1XLOA 1IBXB 4M0WA 4A9AA 2CJOA 2M56B 2RDHA 3AE9B 3BVGA 4WWMA 4MACA 3AMZA 3GS2A 4GDKB 2Y5CA 2WU2B 3UI3A 2IGHA 4XDCA 3TSSA 1DOXA 1ZP0B 1HQRD 1ROEA 2NTTA 3TEYA 1QT9A 1SJHD 4O1NA 1NI3A 4YTPB 1WXQA 4L23A 2QEJC 4RNAA 2EELA 1BXTA 2WU5B 2PIAA 3PZ7A 1AN8A 5H8YE 3AE6B 3ZYYX 1OQRA 4KKIA 5H92C 3AEBB 5E6JA 4C7YA 1MHXA 4A90A 2K5PA 3AM9A 2RPVA 2N9KA 1C76A 1UWXA 1L4ZB 4TSSA 4RF0A 4JPSA 2R61A 5AUIA 1UUPA 2WXPA 2X38A 2PMVA 1NYQA 4P6VF 4HEA1 1QOGA 1IUEA 3N9YC 1LO5D 1YQ3B 5HHDG 3VRBB 1YNTE 1ESFA 1OFFA 1XLQA 2W82A 1EU3A 1XXGA 1SEBD 2J4XA 1V8CA 2N9LA 5D3IB 3CWIA 1N5XA 3MC0B 1WYGA 2JXTA 3AV8A 1C4CA 4FXCA 4PT5A 1FRDA 3IAS1 5HI1A 1QF6A 4TQ0A 1FNUA 1QLBB 2IJ0A 2WDVB 3SEBA 4YWGG 1JW9D 1ZXHA 4LK0M 3CIRB 3W1SA 5BYSA 3W5UB 1AYFA 1KF6B 1VJKA 2W55A 4MH8A 3ZJUA 5EE9A 1B1ZA 1CQVA 3V3XA 1TZOA 2GB1A 1JWUD 2MJ3A 1MPEA 1KLGD 4OW0A 4IKGA 4USAA 1T6BX 1TJEA 4NAMA 2CJNA 2WDRB 4HKZE 5AUKA 1C78A 3AE3B 4NAWB 1HXYD 4KGSA 5BYRA 1KTKA 3KWLA 3TUOA 2I38A 1I4PA 3PO0A 2MEKA 2L83A 2WXHA 3LB8C 5HFYA 5BYQA 2BYTA 1FFVA 4OZBA 1FXAA 2BTEA 2QIEB 3TEXA 4RF1A 1HEZE 1F0ZA 4OZCA 3P4RB 3VRAB 5I4DA 2DYOA 2JYEA 1MVKA 2N0SB 4B0EA 1EM7A 2BT6A 3AEAB 1JRPA 2WXLA 1J7CA 1NEKB 4KKJA 2SAKA 4MM3B 1L0YB 1F2RI 2E6XA 2JWUA 3P63A 1L0VB 2DWQA 4REZA 4KX6B 2KACA 1GB1A 2V3NA 3P42A 1YMHE 3GP7A 1K50A 1I4HA 4ZOHC 3NRZA 1JWMD 3I9V1 2PLPA 1K53A 2J42A 2M0AA 1IBXA 4YXDB 1VDVA 2JX5A 2WXGA 2V0GA 2DYMA 2ON8A 2LHEA 5D7GA 2MJDA 5C3JB 1IGDA 4WH4A 1XLNA 2BS3B 3AE2B 2K9XA 3Q8EA 4WAFA 1E10A 2PW9A 2VZKD 3Q8CA 2BB5A 1PGAA 1CJEA 1VZ6A 4C80A 3W2DA 1E6EB 3BZDB 3EGRA 2G1EA 3DWMA 2K3UA 3AE7B 1D4BA 3U52E 4AQ7A 1Q10A 2BBCA 1E0ZA 1P7FA 4NJCA 2M19A 2IPKD 2HDEA 1ZPSA 2KMMA 2J53A 1RYJA 1WGKA 2WXJA 3R8BA 3IXSA 4ARIA 1L5PA 2AQ1B 1QQRA 2L52A 4HJGE 4XWTA 1V97A 4N59A 2L32A 1KH0A 3AN1A 1FMAD 2MH7A 3I57A 5EE0A 1AW7A 1FNVA 4Q2JA 1ZUD2 2K22A 1FNWA 3SFDB 2ZW1A 2JU6X 3P4QB 2D5GA 3NVYA 1TY0A 2TSSA 2QMTA 3HVDA 3SR6A 3V05A 3VR8B 1OQQA 3BIID 1FO4A 3IT4B 3NVVA 4ZRQA 1PYWD 2LHDA 3PZ8A 4ZHOA 1VLBA 1EWYC 1Y56A 1DGJA 3NUHB 1JALA 5HG2A 4J3OD 1FRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L83 A;  3P1M A;  1JWB D;  1NVI D;  1FFV A;  1FXA A;  1A70 A;  1L6U A;  2QIE B;  1NYR A;  1N61 A;  3HVZ A;  1GAQ B;  1KRH A;  1F0Z A;  3AB5 A;  2WLB A;  4IDI A;  1GPX A;  3P4R B;  2WS3 B;  3AED B;  3VRA B;  1N5W A;  2E3T A;  4JWU C;  1RWS A;  1J7B A;  2FBW B;  2N0S B;  1N60 A;  3L4P A;  1FXI A;  3AE5 B;  3AEF B;  1J7A A;  1I7H A;  1XLO A;  2BT6 A;  3AEA B;  4HRS A;  3W9C B;  2CJO A;  1JRP A;  4A9A A;  1JWA D;  1J7C A;  1NEK B;  2WP9 B;  2M56 B;  3AE8 B;  3AE9 B;  4WWM A;  1FM0 D;  1R7S A;  3AMZ A;  3AE1 B;  3HUI A;  1L0V B;  1SB3 C;  3P63 A;  3RPF C;  3NS1 A;  2DWQ A;  1PDX A;  1WRI A;  1L6V A;  1TKY A;  2B76 B;  1YJJ A;  2Y5C A;  2WU2 B;  4KX6 B;  1DOX A;  1YQ4 B;  1ZP0 B;  1ROE A;  2PVG C;  5MPO A;  2KAJ A;  1DOI A;  1SIJ A;  4ZOH C;  3NRZ A;  1QT9 A;  2W3S A;  1NI3 A;  4YTP B;  1UWM A;  4YXD B;  1VDV A;  1WXQ A;  2JX5 A;  1E9M A;  2WU5 B;  3FAH A;  1TKG A;  3AE4 B;  1JQ4 A;  2PIA A;  3EUB 2;  1XO3 A;  1SF0 A;  2DBY A;  5H8Y E;  3AE6 B;  1DOY A;  3ZYY X;  1OQR A;  4C7Z A;  3B2F A;  5H92 C;  3AEB B;  2QJL A;  1ZOY B;  2MJD A;  5C3J B;  4C7Y A;  2LEK A;  3P4P B;  1XLN A;  2K5P A;  1QOA A;  3AM9 A;  2BS3 B;  5G5G A;  3AE2 B;  2K9X A;  3AEG B;  1TKE A;  2PKO A;  4LTU A;  4US8 A;  1QOB A;  1E10 A;  4YTM B;  3FC4 A;  5AUI A;  4US9 A;  2WDQ B;  1XLP A;  1CJE A;  4JX1 C;  1NYQ A;  4C80 A;  4P6V F;  3VR9 B;  1QOG A;  1E6E B;  1KFY B;  1PFD A;  1RM6 C;  1IUE A;  3B2G A;  2BS2 B;  3WCQ A;  1YQ3 B;  3VRB B;  4HRO A;  2G1E A;  4ZHP A;  4YSX B;  3HRD D;  3DWM A;  3NVW A;  1OFF A;  1XLQ A;  3AE7 B;  3LXF A;  4YSY B;  2PVO D;  5EE1 A;  1E0Z A;  3ETR A;  3AEE B;  1AWD A;  4YT0 B;  2M19 A;  1V8C A;  2KMM A;  1RYJ A;  1WGK A;  2MJE A;  1FFU A;  1L5P A;  1N62 A;  3CWI A;  1N5X A;  2H88 B;  1WYG A;  3AV8 A;  2L52 A;  1TYG B;  2WQY B;  4FXC A;  2H89 B;  3ABV B;  1FRD A;  1QF6 A;  1V97 A;  5C2T B;  4N59 A;  1QLB B;  3SFE B;  3AN1 A;  3B9J A;  1FMA D;  2MH7 A;  2WDV B;  5EE0 A;  1ZUD 2;  2K22 A;  1JW9 D;  2CU3 A;  1T3Q A;  3CIR B;  3SFD B;  3W5U B;  1AYF A;  1ZXI A;  1KF6 B;  5GXG B;  1VJK A;  3DWG C;  2BS4 B;  3P4Q B;  4WQM A;  1N63 A;  2W55 A;  3NVY A;  5G5H A;  4N6E B;  2ACZ B;  3AH7 A;  3NVZ A;  1CZP A;  5EE9 A;  3SR6 A;  1FIQ A;  1RFK A;  1JRO A;  2Q5W D;  2MJ3 A;  3VR8 B;  4USA A;  1TJE A;  2AX5 A;  2JQR B;  2CJN A;  1QOF A;  1OQQ A;  2W54 A;  2HTM E;  2WDR B;  4N58 A;  3AE3 B;  3BII D;  5AUK A;  2W3R A;  1FO4 A;  3NVV A;  4ZHO A;  4ITK A;  1VLB A;  3KWL A;  1EWY C;  1YJI A;  2EKI A;  1PUT A;  2OHF A;  1WWT A;  1DGJ A;  3AEC B;  1B9R A;  1NEN B;  3P4S B;  3W5V B;  1JAL A;  4YTN B;  5EE3 A;  4YSZ B;  4JWS C;  1E7P B;  3PO0 A;  1FRR A;  3LB8 C; 
#chains in the Genus database with same CATH topology
 5L1M A;  1ZDX A;  2LJI A;  1EWC A;  2K39 A;  1RXW A;  2KWC A;  1BPB A;  3PW2 A;  2W7P A;  1J2N A;  2K6Q A;  5BO4 B;  4PYU A;  7ICE A;  3NJT A;  2ZIW A;  2BZF A;  3Q8P B;  2KQ7 A;  3BYY B;  3GV7 B;  4ZDV A;  2ZXI A;  1ZQL A;  2JPH A;  7ICP A;  2EZY A;  4C8K A;  3QAQ A;  1CMX B;  9ICI A;  4UW9 A;  5ALQ A;  3AEF B;  1I7H A;  2QDF A;  1K52 A;  2PTL A;  1A5R A;  2WP9 B;  2GBK A;  2KJ9 A;  3AE8 B;  3WIM A;  2BGW A;  1M6Y A;  4R64 A;  3HUI A;  3QX7 A;  2UU7 A;  3S2A A;  3ZUN A;  2I1Q A;  1ZRN A;  2MP2 A;  3UMB A;  4F93 B;  1SZH A;  3AU4 A;  3GDX A;  4K7W A;  2HMX A;  4F92 B;  4EZL A;  1PK1 A;  3KHR A;  2K8H A;  2KK0 A;  3QU2 A;  4Z6F A;  2KIV A;  2D3D A;  4QZA A;  3DCG A;  3WA0 A;  3RT3 B;  3TAQ A;  3OJU A;  3QZ8 A;  4UAW A;  2K60 A;  3FAH A;  4I2C A;  2YMQ A;  3AL0 B;  4AYB C;  3EHV A;  4BOZ B;  3OHA A;  3EUB 2;  4M9G A;  2XNA C;  2LRW A;  4HLE A;  5HNK A;  2FNJ B;  1S1Q B;  4MF2 A;  4NJ7 A;  5LXH A;  2FCM A;  4HAI A;  2BWF A;  3JSV B;  1KLN A;  2JV3 A;  4CF4 A;  4F50 A;  1U47 A;  2RMM A;  2NS5 A;  4MGY E;  1H4R A;  2YQE A;  3FC4 A;  1H38 A;  1T0Y A;  2GOW A;  3C5F A;  3AU5 A;  4KN7 A;  1RXV A;  1PFD A;  2KX3 A;  2G5H B;  3VDZ A;  1E8X A;  3UXO A;  4PYZ A;  5ALN A;  2KWD A;  4E0D A;  1Z3E B;  1K1S A;  5CHG A;  2FCS A;  5B66 U;  2Z8L A;  2GO7 A;  1YZ7 A;  2F77 X;  5L1I A;  2KV2 A;  2ZJD A;  3RNA C;  1Z5S B;  2MJE A;  2AHO B;  4K3C A;  5AKZ A;  5AZF A;  5AKG A;  3DPD A;  5HML A;  2GLE A;  1MI0 A;  3KZI U;  1C7Y A;  2WQY B;  2H89 B;  3JSV A;  2JHD A;  3RNG C;  3AU6 A;  4XX5 A;  3QCA A;  4RGT A;  2ESE A;  2K8B B;  3B9J A;  4M9H A;  5JTI A;  8ICT A;  3E56 A;  2DAF A;  1HJP A;  2HE7 A;  2V3P A;  2ZW0 A;  3QUC A;  3ZIM A;  1ET9 A;  1K8R B;  3PHW B;  1XCQ L;  4RPY A;  2ACZ B;  2GBR A;  4CE6 A;  3ENE A;  3L10 B;  3VAW A;  4ANV A;  2C2R A;  3GIK A;  3APD A;  1WCN A;  2XVT A;  4YR2 A;  1R4M B;  2O6V B;  4OZA A;  4KLQ A;  1RFK A;  1JRO A;  4GXB A;  1VJ5 A;  1WJ6 A;  1UT8 A;  1IYF A;  4EZ9 A;  2W54 A;  3UIP B;  3WAN A;  2DGZ A;  3GZF A;  4RU9 A;  2KD1 A;  1YJI A;  3BVZ A;  2KOB A;  3A0B U;  3N1Y C;  2M1M A;  3A9K A;  4C4R A;  2HHQ A;  3MC9 A;  3Q3N C;  3NHE B;  4YSZ B;  4JWS C;  5EE3 A;  3UQB A;  4I2A A;  3RH6 A;  3R9K A;  2H3Q A;  3I76 A;  4UB4 A;  5D49 A;  5KFO A;  5DG8 A;  4KIK B;  4RNM A;  3RR8 A;  1V1P B;  1FD6 A;  5ALJ A;  1ISN A;  4RM9 A;  3UF8 A;  1S5L U;  3RJK A;  1JWS D;  4JWU C;  4AS1 A;  4ANW A;  1M4V A;  2YEP B;  2JVC A;  1T0R C;  1MC8 A;  2D8C A;  9ICL A;  3TAD C;  4BBN C;  1SXE A;  4UDU C;  4D2K A;  4M00 A;  2K6D B;  2AGQ A;  2EMS A;  3QYP A;  4CO7 A;  1UT5 A;  3T5J A;  3D32 A;  3AE1 B;  1WX9 A;  2J0J A;  1Z1V A;  4C8N A;  1MFW A;  1KN5 A;  2A4Z A;  8ICE A;  4RPX A;  2G45 B;  4MSQ B;  2FLP A;  2OYY A;  1V5T A;  1U48 A;  3QZ7 A;  1UGJ A;  2KAJ A;  1VZ7 A;  1SIJ A;  2YEP F;  3RN9 C;  4ECQ A;  2QB0 A;  1NK0 A;  3M3J A;  2BCR A;  1D8Y A;  4LJX A;  2J0M A;  8ICG A;  2HBJ A;  1E9M A;  5BMH A;  3KWV A;  1Q8K A;  2LUE A;  2W9N A;  2DBY A;  3HWT A;  3B0Y A;  4ECS A;  1ZJM A;  1SE4 A;  1ZRM A;  1ZOY B;  4KLF A;  1FCC C;  2HOQ A;  2KTQ A;  7ICU A;  3DDH A;  4DSL A;  3PV8 A;  5KFF A;  2LMR A;  2NO4 A;  2W8K A;  1HE8 A;  4YTM B;  2WDQ B;  3TI0 A;  5T14 A;  2GMI C;  1GOZ A;  4IL6 U;  4I2I A;  1V1P A;  2LVO A;  3HHM A;  5IAA C;  9ICV A;  1WJ4 A;  2BS2 B;  5DQH A;  2K8B A;  3WCQ A;  3RFZ B;  3K4G A;  4MEL A;  3U2S C;  2YB4 A;  2K8C B;  4I2F A;  4G3X B;  3KQ4 A;  4ICU A;  3AQE A;  1BPE A;  2J0K A;  3Q8B A;  5KFN A;  3BQT A;  4PZN A;  3AEE B;  5D4B A;  2K4P A;  2VKQ A;  2ZTD A;  3SYZ A;  1VR9 A;  4I2B A;  4XWW A;  3FYH A;  1L0X B;  4QZI A;  1N62 A;  2RDJ A;  4I28 A;  3HKZ C;  4II2 B;  2QLT A;  3LDZ E;  2HHT A;  7ICJ A;  3BZC A;  3ZRF A;  3DDC B;  7ICM A;  3OWE B;  4HWI B;  4I6L B;  4HPL B;  1ZD2 P;  2J52 A;  3MDA A;  4XDD A;  1XU4 A;  1NDD A;  3GB1 A;  3KW5 B;  3PO4 A;  3TAP A;  4ACF A;  4WQM A;  2ZEQ A;  2RDG A;  2WXI A;  2KP7 A;  3ORY A;  5D3D A;  3H9D A;  3NVZ A;  5J2J A;  2KIC A;  3OJ3 A;  4PS3 A;  3EYZ A;  3HIZ A;  2SEB D;  5EWF A;  2LM4 A;  2UVW A;  4M8M A;  2JQR B;  2I1J A;  2WXK A;  4C4V A;  3MR2 A;  1Y8R C;  2XC9 A;  4KTQ A;  4JL9 A;  2NRW A;  5JHA A;  1ZQG A;  1BPY A;  4DSK A;  1AAR A;  4ITK A;  3B0X A;  2LXC A;  2EKI A;  2IOH A;  1WWT A;  3MR3 A;  3UQ0 A;  3N32 A;  2ONQ A;  3W5V B;  1KOT A;  1B4F A;  3QU4 A;  1SE9 A;  4Y2V A;  1E7P B;  2ZZP B;  3QUT A;  4QZH A;  1JWB D;  5CP2 A;  2V9H A;  2KVR A;  2LD9 A;  2WTF A;  2XY7 A;  1ZQK A;  3ZD9 A;  5EWG A;  4B6W A;  4F2R A;  2PI4 A;  1HZ5 A;  5IIN A;  2KDM A;  5A0L A;  4DFP A;  3BWU D;  1KM7 A;  3N97 B;  4F4W A;  2E3T A;  1D5Z C;  3I63 C;  4GDL B;  1NKE A;  1N60 A;  2YMM A;  5HHH A;  2DHZ A;  3VUX A;  2BR0 A;  4M0W A;  4XC2 A;  1IV8 A;  1WX8 A;  2ALZ A;  4B9K A;  4CYE A;  1NK4 A;  2M56 B;  2RDH A;  2IO1 B;  3AE9 B;  3MGH A;  1X9S A;  3BVG A;  1UCV A;  4II3 B;  2DKX A;  4YN4 A;  4Q45 A;  2Y5C A;  2IGH A;  2KFJ A;  1DOX A;  3V60 A;  4WJN A;  2KX0 A;  4AJY B;  1HQR D;  1ROE A;  1GUA B;  5KG4 A;  3TEY A;  1SJH D;  4O1N A;  1SKW A;  1NI3 A;  1ZQY A;  1WXQ A;  1V86 A;  3O65 B;  1U45 A;  1BXT A;  4C4T A;  1ZET A;  4MHV A;  1LV5 A;  2LYB A;  4ZRI A;  3RJF A;  3SHQ A;  4F2S A;  4O5K A;  5E6J A;  2ZJ5 A;  3F2C A;  4A90 A;  2F1I A;  2N9K A;  1UWX A;  1ZQH A;  1L4Z B;  4YXM A;  2R61 A;  5AUI A;  2WXP A;  4NLZ A;  4GOC A;  5KNI A;  4UBB A;  2ZTE A;  2FMP A;  2LBO A;  2H3F A;  2R2O A;  3S6J A;  4KZC A;  2XK5 B;  4EX7 A;  5HHD G;  2F8L A;  3TL5 A;  3ZKJ C;  4EBC A;  1ESF A;  1ZQW A;  1OFF A;  2JXX A;  4IM0 A;  1EU3 A;  2MLB A;  2MWS B;  3IHP C;  2KN7 A;  4RQ6 A;  9ICU A;  5IKC M;  1SEB D;  3F2B A;  2KDF B;  3PST A;  3EPI A;  2JH7 A;  2NCN A;  3CWI A;  1N5X A;  4N9F 4;  5DKW A;  1RYS A;  1TT5 B;  1FRD A;  3PZP A;  3IAS 1;  4NL9 A;  3C0R B;  5AKE A;  4G3I A;  3BQ0 A;  3RMK C;  3SEB A;  3D2Q A;  4NJ6 A;  2KOX A;  5BYS A;  1IXR A;  3B1L X;  1KF6 B;  4RZR A;  1VJK A;  3PML A;  3P2B A;  1E90 A;  2W55 A;  9ICT A;  2E8N A;  4O9M A;  3IFW B;  4F3O A;  2BQQ A;  1CQV A;  3DHI C;  5GTH U;  4P0Q A;  5JU5 A;  1DK2 A;  2R2Q A;  1MPE A;  4IKG A;  4HCN B;  2OOB B;  5C0Y A;  2EMT A;  5AUK A;  4NAW B;  5F9L A;  2RR9 A;  4JIO U;  1ZQU A;  1KTK A;  5BYR A;  3NRW A;  1NK5 A;  1SL1 A;  4MEM A;  1WJU A;  2AU0 A;  4YD2 A;  2IO3 B;  2O6V D;  1X6I A;  4GXK A;  1E8W A;  1RAX A;  2Y1J A;  3IHQ B;  2BGF A;  3BIN A;  2KG5 A;  3OG5 A;  4PL2 A;  4NQK E;  4I2G A;  4J03 A;  1F9J A;  3PO0 A;  3DHG C;  5BYQ A;  4IUM B;  2BYT A;  2UYZ B;  3WK5 A;  2MBE A;  2HTH A;  5J0X A;  3Q14 C;  2MUT A;  4YCX A;  3L08 A;  2ES6 A;  3P4R B;  4WWN A;  4PZO A;  4WWP A;  9ICH A;  4B0E A;  4KIT B;  2N1V A;  4DSE A;  2JEG A;  3GQC A;  1EM7 A;  3TQ1 A;  3AEA B;  4Z6C A;  5GMV A;  5C5J A;  4JLC A;  4HK2 A;  4GC6 A;  1F2R I;  2D11 A;  3BZK A;  2BPF A;  4TUU A;  3PW5 A;  4QIW F;  4BDP A;  4REZ A;  2I1K A;  5AK4 A;  1T7P A;  4O3N A;  1GB1 A;  3EW9 A;  2CU1 A;  2L7R A;  3ICX A;  5KFK A;  2J7Q B;  3M7D A;  5EWE A;  2RDB C;  4NLG A;  4DQS A;  1N48 A;  2D6F C;  3A9K B;  1K53 A;  2I6X A;  2J42 A;  1IBX A;  1R4M I;  5DBB A;  4F4K A;  2WXG A;  3ECI A;  3IDW A;  1Z4N A;  4QZE A;  3F2D A;  1X2I A;  4DL2 A;  2O2V A;  3PRM B;  5AKL A;  4W9K A;  4F5P A;  3M8R A;  3PW0 A;  3CST A;  2QAR A;  4KDI C;  2LGX A;  1J8C A;  8ICV A;  1DRG A;  4P2H A;  1E10 A;  4KLL A;  2PW9 A;  2JZZ A;  4MFF A;  9ICG A;  1VZ6 A;  3RR7 A;  3L16 A;  1EF5 A;  3WK4 A;  3W2D A;  4DQQ A;  1RG6 A;  3BZD B;  1OTR B;  2KAN A;  4JMU A;  3BDP A;  3R7Q A;  1PQS A;  4DF8 A;  2N4F A;  4AQ7 A;  1Q10 A;  5KFY A;  4W9C A;  3RI7 C;  4NJC A;  3KHG A;  2WXJ A;  2CKH B;  5ALG A;  4FUL A;  1WGK A;  1RZT A;  2AQ1 B;  2H3Z A;  2ZPN A;  3K9O B;  4O3O A;  2J6U A;  2WX1 A;  2C2D A;  3RUL A;  1WIA A;  5CR0 A;  1V97 A;  5EE0 A;  2IO0 B;  9ICN A;  3SFD B;  1AQ6 A;  3TKA A;  3DVG Y;  4GLX A;  3P4Q B;  4U6P A;  2AYO B;  8ICA A;  3LJ3 A;  2ZNV B;  2KEY A;  2EZX A;  2QMT A;  4GSW A;  2ZIX B;  2KSO B;  3IM1 A;  4ELT A;  2KO3 A;  3KUZ A;  3V6J A;  1TIF A;  2E8P A;  1BT0 A;  3DBR I;  2YB1 A;  3PS6 A;  4C8O A;  1PUZ A;  2KKV A;  3PZ8 A;  2FCQ A;  1VLB A;  1EWY C;  1Y56 A;  4J9R A;  1SV0 A;  4K1R B;  3RNC C;  2ATL A;  4F5O A;  3F53 A;  4QW9 A;  1JAL A;  2ZG6 A;  2HVI A;  2FPK A;  1CEZ A;  1JIH A;  4J3O D;  2F1H A;  4AP9 A;  1GJZ A;  4QW8 A;  4DK5 A;  5BOL A;  2HHW A;  3RTV A;  3M8S A;  4KLE A;  3CP8 A;  2KHQ A;  2BB6 A;  4OHJ A;  4GU2 A;  1SXT A;  2WLB A;  4GLS C;  3VH4 B;  4I2J A;  2WF6 A;  3IG5 A;  4DQP A;  7ICI A;  4EE2 A;  3N20 C;  5AZG A;  3PMN A;  3J81 j;  1WWV A;  2GLS A;  4CQN A;  2L05 A;  5KFI A;  4RQ3 A;  3H1U A;  3ZDB A;  3BK2 A;  5EOZ A;  1PGB A;  5KG6 A;  2KZR A;  4QIW C;  2BYV E;  4EUT A;  4YD1 A;  2KMC A;  4KVG B;  1KFS A;  2B76 B;  1GO3 F;  2DLB A;  2CHZ A;  3RUI B;  4IS7 A;  3J9C A;  4I27 A;  4YXJ A;  5G2N A;  5KT7 A;  4M47 A;  1V5O A;  3E9S A;  3MDC A;  5HP4 A;  3AUO A;  4J9L A;  1BML C;  3QEB Z;  2KDB A;  4KV2 A;  4NLN A;  3MGV A;  4F4Y A;  1WR6 E;  3TIX A;  1NK6 A;  3ZRC A;  2IDY A;  4DQI A;  4RFB A;  2ZUC A;  1DOY A;  3D6J A;  4O3Q A;  1SL0 A;  2DEN B;  3PRP B;  2JH1 A;  3QA8 A;  4DQR A;  4ECZ A;  1NK8 A;  1UBQ A;  2KFN A;  4EYH B;  2I2Y A;  4M9N A;  1QOA A;  5D6J B;  3RFA A;  1SSN A;  5FP0 A;  4DL5 A;  4C4S A;  2VZK B;  2MP2 B;  1COK A;  1XEE A;  2ZNV C;  1S0M A;  2W11 A;  3H8S A;  3OJS A;  2BCV A;  4HRO A;  2KZZ A;  3EFC A;  4M04 A;  2K0P A;  3U7Z A;  5EE1 A;  1OUQ A;  3EA6 A;  4KSL C;  1WE7 A;  2NV3 A;  2Y0S C;  1R4N I;  4MSM B;  5KFM A;  5BOM A;  1HZ6 A;  2H88 B;  2Y5P A;  1WMH A;  8ICB A;  4WUR A;  1GB4 A;  4LZG A;  1WFY A;  3VQI A;  2ZIU A;  3HKZ F;  4PHE A;  2K4E A;  9ICO A;  2HJ8 A;  2UVR A;  1GC6 A;  4CGZ A;  3Q69 A;  4XGA B;  2AH5 A;  2LWP A;  4WQO B;  5DDY A;  3SV4 A;  4QZF A;  5KFT A;  3APC A;  4RQ5 A;  5AI8 A;  4A8E A;  3BS5 B;  4N6E B;  5TSS A;  3AH7 A;  1LB2 B;  3M6Z A;  1CZP A;  2G4S A;  3ZJT A;  2UWQ A;  5TIS U;  3PX0 A;  2NPT A;  1QQ6 A;  3H7I A;  1JUD A;  4NLB A;  3VCB A;  4TQR A;  5ALK A;  5KTQ A;  2LMC A;  2F3N A;  3KYC D;  3Q3O C;  3BYT B;  3HM3 A;  1WG8 A;  3LWM A;  2QB0 B;  1XCT L;  2HTM E;  3GIJ A;  2NMQ A;  3A9J B;  4K4G A;  1F77 A;  1HEK A;  2KN5 A;  2W9M A;  3IV6 A;  1TAM A;  5ALV A;  1CI4 A;  1TS3 A;  4LLG M;  4DXF A;  3Q3J A;  4TUP A;  2V1Y A;  2KC1 A;  2DZM A;  3ZNZ B;  4WJ3 B;  3UQA A;  5CEH A;  1L4D B;  4A3P A;  2BPS A;  3EPG A;  1TS4 A;  1WSP A;  5AK3 A;  2INN E;  1JN3 A;  1I4R A;  4J9N A;  1IM4 A;  1BVS A;  3SD7 A;  3EFU A;  1I4G A;  2HCF A;  3WAL A;  2XO7 A;  1N5W A;  2EAP A;  3ISC A;  4P0P B;  1RWS A;  2KTF A;  4HXD A;  2FBW B;  1C4A A;  2OWO A;  4NLC A;  1J7A A;  2WDT B;  2A3V A;  3VC8 A;  1TS2 A;  2G3Q B;  2E8O A;  3GV5 B;  4UAZ A;  4GGQ A;  4M6W B;  2BYE A;  3L5K A;  1P0R A;  3FKY A;  3UMG A;  3IRU A;  1L6V A;  2VH2 A;  2QB1 A;  2MU2 A;  2LGS A;  5DB8 A;  5FKA C;  3BVM A;  5KG0 A;  3JPN A;  5MPO A;  4W9H A;  3U8Z A;  1YQB A;  1QSS A;  4F91 B;  3U4E G;  4K4I A;  3LK9 A;  2YVC A;  5J0Y A;  3TCA A;  2LPE A;  2KHW B;  4RNN A;  4TV3 A;  1JQ4 A;  3T3N A;  4L2Y A;  4YMN A;  4TUS A;  1YZ6 A;  5ALX A;  3SEI A;  1YX5 B;  3KYD D;  2DX5 B;  2Y3A A;  5AZH A;  5JXV A;  2HHV A;  5DLF A;  3RAQ A;  3NS8 A;  4R8U A;  3RJJ A;  2JZP A;  3CMM B;  3PZD A;  2LEK A;  2ZVN A;  3A9J A;  3Q3M C;  5HKH A;  4NAW A;  2PMZ F;  2L00 B;  1UPH A;  5G5G A;  4DQO C;  3C1Y A;  2PKO A;  4R66 A;  1HA5 A;  1SV0 C;  4ED3 A;  5J0R A;  3ZXV A;  3K75 D;  2KD0 A;  5KT5 A;  2WNM A;  1SWV A;  4KLT A;  1ZQQ A;  1P1A A;  3PVX A;  2K4H A;  4LNI A;  2ZIX A;  4FHK A;  3MP9 A;  5KFB A;  2P6U A;  2KNJ A;  4GDK A;  4R8U B;  3EC8 A;  1DXS A;  3DBR B;  1TKD A;  8ICU A;  1AWD A;  2CN1 A;  2WXR A;  3ZNI D;  1XSP A;  4DL4 A;  4HPM B;  1BNO A;  1ZD5 A;  2FPL A;  4F4X A;  5KFC A;  4ELU A;  1JCK B;  3ABV B;  3OLM D;  1WGD A;  2KQ4 X;  2A1J A;  4U7C A;  4NZL B;  4ED0 A;  1T3Q A;  5CB1 A;  3Q8A A;  3D2N A;  1TK8 A;  4B95 A;  1D6E C;  4DEZ A;  3NG0 A;  3NZ3 A;  3QU7 A;  3TAD A;  4PS8 A;  4AJW A;  4GMV A;  4QWC A;  2L0T A;  2D3B A;  3PRE A;  1TV9 A;  3NZU A;  1D8B A;  4WIP A;  5L1J A;  4DS4 A;  1SWW A;  2KMD A;  7ICG A;  2ASL A;  3LYS A;  2V4L A;  4N58 A;  1WXA A;  2KLC A;  2J6T A;  2NYV A;  5KFG A;  4OJ6 A;  4BKS A;  1Q3V A;  2G06 A;  2NBV B;  2FI1 A;  2AGP A;  2Z0D B;  4A8X C;  1V2Y A;  3ZI4 A;  4G0N B;  2F1J A;  2WF8 A;  2OCE A;  1TE2 A;  2CS4 A;  3V61 A;  1ZQV A;  5BMI A;  8ICK A;  4WWO A;  2Y9U A;  1L6U A;  1QCK A;  4CNQ A;  3PLV A;  4GIV A;  2FUG 1;  1I4X A;  5KG2 A;  4RGO S;  1SE2 A;  4B0M A;  4QZG A;  3C29 A;  3BQ2 A;  4M01 A;  1RDF A;  2G0A A;  4EX6 A;  3KFU F;  2OJR A;  4NJ8 A;  2MA9 B;  1DOQ A;  5ALT A;  2FLL A;  4A9A A;  3ZNG C;  2RRD A;  2W03 A;  3T8M A;  3TAR A;  3E0F A;  1XNS A;  4O0I A;  2QCZ A;  3T9L A;  4O3P A;  2PI5 A;  1ZQX A;  3A4R A;  3BS5 A;  3GS2 A;  4GDK B;  2WU2 B;  3C23 A;  2UVU A;  5ALY A;  1SXD A;  2PLP A;  2N9E B;  4O5C A;  2NTT A;  1R4N B;  2K8C A;  4FLH A;  3TAC B;  1J97 A;  3RRH A;  4YTP B;  1ZQN A;  5KHQ A;  1NNL A;  2OXO A;  4YR0 A;  1L7Y A;  2EEL A;  1P7D A;  3ISD A;  2JRH A;  3BS7 A;  2PIA A;  4KLO A;  1AN8 A;  4JWN A;  2D3A A;  1TVA A;  5H8Y E;  3AE6 B;  3ZYY X;  5IN7 A;  2XY6 A;  4KLI A;  2FPM A;  2JUO A;  3AEB B;  4KKI A;  2IO2 B;  5CHV C;  3H0R B;  4P4P A;  2K5P A;  3ALB A;  1J2M A;  1NZB A;  1C76 A;  4DHJ B;  3RB6 A;  3ML9 A;  4TSS A;  4BBN F;  5F9N A;  4M9J A;  4C00 A;  2KJ8 A;  1NYQ A;  1S76 D;  4MFC A;  8ICS A;  4HPP A;  3PSF A;  1QSY A;  1IUE A;  4DSJ A;  3GOE A;  2D10 A;  3N9Y C;  4K7S A;  5DPW A;  4QZ9 A;  5J2B A;  4TQS A;  3BQ1 A;  1LO5 D;  1YQ3 B;  2V4Q A;  1YT3 A;  4NWI A;  2M0N A;  2WWZ A;  5IIK A;  4BGD A;  2EAN A;  4LJO B;  1X6J A;  1GNU A;  1XXG A;  3VXW A;  2CRX A;  2Y0S F;  3WK7 A;  2E5S A;  3HJE A;  2Y5B B;  4IWP A;  5AM4 A;  1C4C A;  1Z2M A;  4FXC A;  3LVV A;  1L3U A;  2HBL A;  1I35 A;  3VUY A;  4CHK A;  2XID A;  2IJ0 A;  4NNJ B;  4YWG G;  4FS1 A;  4P4M A;  4IRD A;  3CIR B;  2WFA A;  2CHW A;  4RQN A;  1ZQ1 C;  2ASQ A;  4ECV A;  3F5A A;  2LXA A;  4IR9 A;  3QJZ A;  3N7S C;  3PR4 A;  2HHS A;  2L76 A;  3DBH B;  3JW0 X;  4RQM A;  2HI0 A;  1TZO A;  2L0F A;  1L7N A;  2RQ5 A;  2HHX A;  5JH5 C;  4FBT A;  4B6J A;  5TZV A;  3MTN B;  1V9J A;  5D2M B;  4EEY A;  1HXY D;  3DVG X;  5ALS A;  2XGP A;  4Y2Y A;  2MRP A;  3WKD A;  3IG3 A;  2I38 A;  1BPX A;  3ZTC A;  1KBU A;  2MEK A;  2NPT B;  2XIC A;  2WXH A;  3AU2 A;  4M0A A;  1QTM A;  4AWJ A;  5J2R A;  3WU2 U;  2FMQ A;  2QIE B;  1LKY A;  1XT9 B;  3GZN I;  2L5Y A;  4OZC A;  1N56 A;  2WHE A;  2JF5 A;  3VRA B;  3ED5 A;  1IP9 A;  4UB1 A;  2BCS A;  1ZQF A;  1PK1 B;  2MBQ A;  3JVZ X;  4QNL A;  1MVK A;  3N7R C;  8ICP A;  1Z00 A;  2BT6 A;  1UEL A;  2KNB A;  2C7N B;  1L0Y B;  3WK8 A;  2JWU A;  3KBB A;  3P63 A;  1L0V B;  1URJ A;  3GFK B;  2DWQ A;  1XO0 A;  4IG7 B;  3QUB A;  4RQ0 A;  1IIP A;  2PE6 B;  4ICV A;  2FDR A;  4LJP B;  5IIL A;  1L7O A;  4ECW A;  3NTU A;  2IBK A;  1YMH E;  3H8W A;  3KZX A;  3FM9 A;  1Z4O A;  4ZOH C;  3NRZ A;  4BX9 C;  1ZQE A;  2HVH A;  2JZ3 B;  2KWU B;  2EQY A;  4OJO A;  2INC C;  1DGS A;  4PL1 A;  1WWU A;  2N1W A;  3NGD A;  4RUA A;  3RJG A;  3B08 A;  7ICT A;  3KUC B;  4NL9 C;  3QWZ B;  2V0G A;  2W7O A;  1TAQ A;  4HJK A;  4B9S A;  3X0W A;  1UQV A;  3IG8 A;  5DB7 A;  1S0O A;  4WJQ A;  1NK9 A;  4LDT B;  5D7G A;  5C3J B;  1Q46 A;  1XLN A;  1V9P A;  2Z59 B;  1TZ1 A;  2BS3 B;  2K9X A;  5KFV A;  4W9E A;  4EBE A;  5AK5 A;  4GXI A;  2RD0 A;  2VZK D;  4G9B A;  2BB5 A;  4KX3 A;  4C80 A;  2MA1 A;  1E6E B;  5HR7 A;  1L3T A;  5J2A A;  1Z1B A;  2G07 A;  2IND C;  1ZQZ A;  2JEJ A;  2G1E A;  5IA7 A;  3AE7 B;  3HIL A;  3VUW A;  1C3T A;  1E0Z A;  4DOC A;  2R8K A;  5AIA A;  2KZ3 A;  2JZB B;  2EAM A;  2HDE A;  4UB2 A;  2R8G A;  1RYJ A;  3R8B A;  3H6N A;  4ARI A;  3KUD B;  1L5P A;  1J19 A;  4ZYN A;  3ALR A;  1QQR A;  2GBJ A;  4DHZ B;  8ICJ A;  1KLV A;  4HJG E;  2A1A A;  3GIL A;  3ZDA A;  2Z7J A;  1MQ2 A;  2L32 A;  3I57 A;  1FMA D;  3SV3 A;  1AW7 A;  4NY0 A;  5LLI A;  5KFQ A;  3OGU A;  4UBC A;  2N7E A;  2XI9 A;  8ICH A;  3PO5 A;  2LVP A;  2ASJ A;  3QC8 B;  3WAM A;  2F8K A;  5DQI A;  2CPR A;  3NVY A;  3PHX B;  4BFR A;  3BJY A;  2H3V A;  5AHX A;  4OJP A;  3ZVV A;  1E5W A;  3RNE C;  3EEC A;  4I2H A;  1NKB A;  2NRX A;  3WK6 A;  4ZRQ A;  4ZHO A;  1COO A;  1ZQA A;  4J9M A;  1L5U A;  9ICX A;  4CF5 A;  4ASW C;  1NJX A;  4ECU A;  4LCD E;  7ICV A;  5D94 A;  1T3N A;  5HG2 A;  5FR6 A;  3IVF A;  2ASD A;  2YLM A;  2ZIV B;  4O3M A;  4CDG A;  2AL6 A;  1SZP A;  1NYR A;  4DHZ E;  5FK9 C;  1F1H A;  2K1F A;  4A55 A;  3AB5 A;  1HIW A;  4F7Z A;  3LYY A;  2VA2 A;  3UIN B;  1FCL A;  4RH6 A;  3L4P A;  2BDU A;  1SBB B;  2IY0 B;  4S17 A;  3ZXR A;  2B0C A;  2IHM A;  1TAU A;  1IGC A;  3PSI A;  1F2R C;  3MHS D;  4A20 A;  5L95 C;  5LNK 1;  2ICI A;  3PT2 B;  1Y88 A;  1FPY A;  2F44 A;  5JZE B;  2AQ2 B;  5KFZ A;  3ZNH B;  1BUI C;  3QEA Z;  5ALO A;  4UAV A;  5ALI A;  4DL3 A;  3ISB A;  1DOI A;  8ICM A;  1SGG A;  3HW8 A;  4UQG A;  3RB4 A;  1S10 A;  1ET6 A;  3K9P B;  4KIK A;  2BPC A;  1WMH B;  2EAO A;  4KDL B;  4WJO A;  2BPG A;  4Y2Q A;  5AK6 A;  3JPP A;  4F1S A;  3AE4 B;  1WUD A;  2WXF A;  3DBS A;  5AM1 A;  3R3M A;  3N30 A;  4FJY A;  2EDU A;  2MSN A;  4HDQ A;  5AI0 A;  3DHH C;  4GXJ A;  5J17 A;  4RQ8 A;  4C4V B;  3R66 C;  4DOB A;  4RCO A;  4US8 A;  2ZUD A;  1K51 A;  2BCU A;  3ZGZ A;  5KG3 A;  1WCL A;  2MAX A;  2KYW A;  1S3S G;  3HT3 A;  3VR9 B;  2IA6 A;  2ODG A;  4RT2 A;  1YN3 A;  3WKA A;  1BGX T;  5AKK A;  2PPH A;  3ZTD A;  3VHT C;  2E8M A;  5J0U A;  4MF8 A;  3L17 A;  3LXF A;  4IW0 A;  3W1S C;  3ETL A;  3ETR A;  3T5K A;  2L3Z A;  1YIW A;  3AXC A;  2A19 A;  2JYT A;  3DOW A;  2LGD A;  2OED A;  5C23 A;  7ICL A;  5AKY A;  2O6V A;  3IAM 1;  3T3O A;  3KD3 A;  4DL7 A;  3GII A;  1VD2 A;  4MEX A;  2UVV A;  1ENF A;  3HX0 A;  1VZ8 A;  4HDO A;  4FJV B;  4M6W A;  4DXG A;  4R3D A;  3HP6 A;  1N63 A;  1WX7 A;  5FR3 A;  1MQ3 A;  3CNH A;  3MR5 A;  3Q2A C;  3I3T B;  3M9N B;  4FZM A;  4EKU A;  2HBK A;  2I9G A;  2XEW A;  3M1Y A;  1U4A A;  4XUS A;  2WGS A;  2KIW A;  4YVZ A;  2A5U A;  1EU4 A;  2AX5 A;  3QHT A;  2KKP A;  2WXM A;  3QXG A;  4RNO A;  4Q43 A;  2BKR B;  2DFL A;  5F3X B;  3PSE B;  4WJP A;  3I1Y A;  2REX A;  2WAQ C;  4ED7 A;  4TMA B;  3FIL A;  3P4S B;  3AUL A;  1L8O A;  1ZQJ A;  1SIF A;  3PGE A;  4B9L A;  1Z00 B;  4ED8 A;  1ZE3 D;  4F5Q A;  2V9W A;  3RBD A;  4XYC A;  3A1Q B;  3ZDD A;  3TAN A;  4IQT A;  2NRV A;  5J2E A;  1GAQ B;  3KLS X;  1QQ5 A;  2KE7 A;  1KRH A;  5AIB A;  4RMA A;  1L7M A;  4ARC A;  1J0G A;  1GPX A;  3RZF A;  3AED B;  1PK3 A;  7ICK A;  1TS5 A;  3U26 A;  5KFR A;  4Z6E A;  5D46 A;  3JPR A;  1SJE D;  3V7L A;  7ICQ A;  4S0R A;  1C1Y B;  4ED1 A;  1FEH A;  1QQ7 A;  3KOO A;  3GE8 C;  3ZLZ A;  5ALF A;  4FA6 A;  4QZ8 A;  2Y9T A;  4Q8E A;  1ZDV A;  1SB3 C;  3RPF C;  3NS1 A;  1PDX A;  1WRI A;  5IIM A;  3H40 A;  1KFD A;  3SAH A;  5JUM A;  2RP5 A;  2L1A A;  3KVF B;  4B9T A;  3C2K A;  2PVG C;  4EOY A;  1STE A;  2WX0 A;  4EFO A;  4OO1 J;  4ECX A;  4NQL B;  4Y2P A;  2AWT A;  3SDL C;  5KL8 B;  4UAR A;  2JT4 B;  1S9F A;  1TKG A;  4YQW A;  2GBM A;  4DO9 A;  4PPX A;  2PJH A;  3HM6 X;  4GDL A;  1UA0 A;  3W1Y A;  1ZD3 A;  2IGG A;  1QH9 A;  4QWB A;  1D3Z A;  4E3C A;  2FIF A;  5HHI A;  1LVH A;  3AEG B;  3T3F A;  2BDP A;  4EYI B;  5AM0 A;  1JX4 A;  1F5S A;  4QZB A;  3PLU A;  4DBG A;  2KVC A;  1C77 A;  4AYB F;  1XLP A;  1Q0W B;  2KN4 A;  3VTV A;  3MGI A;  2IZV B;  1C79 A;  4KGT A;  3B2G A;  3RZW C;  5CJ7 A;  5AI4 A;  2RDI A;  2Q0Z X;  1TBE A;  3HRD D;  2QAR B;  7ICS A;  4DXA B;  2IMW P;  1WYW B;  2PVO D;  3L3F X;  1S0V A;  4I2E A;  4H2A A;  1PVP A;  4KLJ A;  2R8H A;  2CHX A;  2DKZ A;  2NRT A;  4BAX A;  3Q8F A;  4EZJ A;  4URK A;  5KFH A;  4DSF A;  1OW5 A;  5CWR A;  3C1Z A;  2LGY A;  2LVQ A;  4E74 A;  3M62 B;  4IM3 A;  3MFG A;  5C2T B;  2QIL A;  4FN2 A;  3N1Z C;  4UB3 A;  2AQ3 B;  2LUM A;  4IOI E;  3DVN U;  3WKC A;  3G6Y A;  2IOF A;  2W43 A;  1A6S A;  4HYK A;  2MBH A;  5GXG B;  3QIJ A;  1OQY A;  1QKZ A;  3V6C B;  7ICR A;  1V85 A;  3H7S A;  5IOI A;  9ICC A;  2KJR A;  4A6Q A;  2Q5W D;  4K4H A;  1SGH A;  5AI6 A;  3URY A;  2YML A;  1QOF A;  2XBB C;  3ML8 A;  4KN4 A;  3OHB A;  3QX1 A;  5BMG A;  2W3R A;  1KEJ A;  4DL6 A;  1JXL A;  4BXO A;  3H0M B;  2K25 A;  5AKH A;  8ICY A;  1BNP A;  1PUT A;  2OHF A;  4W9J A;  3AEC B;  2QKQ A;  2ZIU B;  1B9R A;  1WJN A;  2DL0 A;  2DZI A;  2FE8 A;  2MBB B;  2E1F A;  2WHI A;  1ZQO A;  3BK1 A;  4DDG D;  1ZQS A;  4KLU A;  9ICS A;  4OVZ A;  3C5G A;  2C5L C;  4FHJ A;  3MHZ A;  9ICR A;  5LXI B;  2XCP A;  4ZYS A;  1A70 A;  3RBE A;  1XC9 A;  9ICF A;  2BYF A;  2D3C A;  4X57 B;  3MC1 A;  4PJ0 U;  2HOF A;  1WXS A;  1JRU A;  2XN9 C;  4Y2S A;  1BPZ A;  3LDA A;  4YL8 A;  3KHL A;  3E58 A;  1P3Q U;  2BCQ A;  1YN4 A;  1L2N A;  1QIL A;  3SZ2 A;  4EEW A;  5AM5 A;  2WXQ A;  3FIL B;  3TFR A;  4LNF A;  2IHN A;  4W9L A;  2LGI A;  1XLO A;  5KFP A;  1IBX B;  2ZTC A;  1PZN A;  4I6P A;  4FBJ B;  2CJO A;  2DUY A;  5J2H A;  1PVR A;  3WKE A;  3DVN V;  3AMZ A;  3Q3F A;  3N3K B;  3ZW3 A;  1MA7 A;  1CUK A;  2JR5 A;  2ZIW B;  3UI3 A;  2C60 A;  5AM3 A;  1TGZ B;  3B0A A;  3NUQ A;  1ZP0 B;  1U9L A;  3A33 B;  1QT9 A;  2AXT U;  8ICL A;  2F2A B;  4L23 A;  3H0L B;  3ZDC A;  3ZD8 A;  4RPZ A;  5AKI A;  3ZDE A;  2WU5 B;  2ZXH A;  2KXJ A;  1UH6 A;  3PZ7 A;  2PKE A;  3MR6 A;  9ICP A;  5H92 C;  1KRP A;  2KLG A;  1ZW7 A;  1MHX A;  4TKN A;  3SEN A;  1FEZ A;  1TFR A;  2XGQ A;  3AM9 A;  5CX3 A;  1RQL A;  5L1L A;  5JHB A;  2J6S A;  2VA8 A;  4OJL A;  4RF0 A;  2DZK A;  1V80 A;  2E1E A;  2GH1 A;  1RFA A;  1TK5 A;  3BQ7 A;  2X38 A;  2BQU A;  3WAP A;  2PMV A;  4IWO A;  5ALZ A;  1QOG A;  4O5E A;  4G50 A;  3M9M B;  5J2D A;  3G6X A;  1F0M A;  1CRX A;  3VRB B;  4KLD A;  5IIO A;  1PVQ A;  5CHF A;  4RT3 A;  4F5R A;  8ICX A;  4DWI A;  1E8Z A;  2Q4T A;  4MFA A;  3APF A;  3NY5 A;  3H4B A;  1WZ3 A;  4FS2 A;  3N4M B;  3VTW A;  4KLH A;  1SKS A;  3WAO A;  3L54 A;  4ECY A;  2HW3 A;  4RM8 A;  4TQ0 A;  4NY8 A;  1FNU A;  1QLB B;  4WAA A;  1RYR A;  1JI7 A;  4FAD A;  3RB0 A;  5KFD A;  2FID A;  4F71 A;  1WI0 A;  1S0N A;  1ZXH A;  4LK0 M;  4MJS A;  3W5U B;  1AYF A;  2FUH B;  4JB3 A;  4AP4 C;  3U7D A;  1WZ0 A;  1JMS A;  3K1R B;  5AKJ A;  5EE9 A;  2ZJ8 A;  3SAG A;  1XO1 A;  1B1Z A;  3V3X A;  1NI2 A;  3Q8K A;  1WGR A;  4JGH B;  4KLS A;  3V7K A;  2BQ3 A;  2MJ3 A;  1WE6 A;  1RQN A;  1X42 A;  4USA A;  2W8L A;  1E7U A;  1TJE A;  2CJN A;  3DV9 A;  5B5E U;  2WDR B;  4HKZ E;  3AE3 B;  1TK0 A;  4LZD A;  4RQ1 A;  2LI6 A;  3OSN A;  9ICA A;  2LHT A;  4MGK E;  3N1X C;  4JV2 A;  1Q5W B;  2WAQ F;  2JZB A;  3T5H A;  3LB8 C;  1YOV B;  4XQ8 A;  3A4S C;  3NOB A;  4OZB A;  1P98 A;  3G6V A;  1FXA A;  2BTE A;  3F5E A;  3UIO B;  2ZPY A;  4DFJ A;  3MFI A;  1N6Z A;  4DFK A;  5DG7 A;  2YTU A;  1F0Z A;  5J2I A;  3TBL D;  4EZK A;  5I4D A;  1ED1 A;  4P0Q B;  2DYO A;  2N0S B;  1KQQ A;  1X40 A;  2NO5 A;  4C8M A;  2MHJ A;  1JRP A;  1J7C A;  4KKJ A;  3RF9 A;  1L8L A;  2E6X A;  1YJ1 A;  3PRZ A;  2EZZ A;  4JWM A;  1LM8 B;  1LKY B;  4IR1 A;  3SD5 A;  5EDS A;  5J2F A;  1H8C A;  5IP4 D;  5DBC A;  5KFA A;  5KAI U;  3P42 A;  4BXO B;  1K50 A;  1P9D U;  1KSP A;  4J9S A;  2ZCC A;  5J18 A;  4JK1 A;  1JWM D;  3I9V 1;  5H2F U;  3DBL I;  4YXD B;  4I2D A;  2HD5 B;  1VDV A;  2JX5 A;  2HOI A;  3NAS A;  5IIJ A;  4UB6 U;  2KJ5 A;  1ZOL A;  1SL2 A;  2ON8 A;  3RYT A;  1NJW A;  5J0W A;  2FE9 A;  2JEI A;  3GZN B;  2G5I B;  3TMP B;  2C2E A;  1WY8 A;  3MC8 A;  3OAW A;  4F72 A;  2MJD A;  1SKR A;  1GC7 A;  4YMO A;  4WH4 A;  2PEA A;  4OJ5 A;  4KLM A;  2KJH B;  1YX6 B;  2LZ6 A;  4J9K A;  2WB1 C;  3CW2 C;  9ICQ A;  4R63 A;  1F52 A;  3L0W B;  2M8S A;  3SU8 X;  2LYA A;  1Q1O A;  1XQQ A;  1IG6 A;  4YMM A;  5KG5 A;  2OEH A;  3DWM A;  7ICO A;  3H4D A;  1I42 A;  1D4B A;  3U52 E;  4XZ4 A;  2FJ6 A;  2M19 A;  2H3I A;  3RJI A;  2KMM A;  5KT4 A;  4MEY A;  2L52 A;  2N9X A;  1GG3 A;  3MAB A;  1X66 A;  1KW4 A;  5E6N A;  2KMA A;  2OM6 A;  1V49 A;  4EZ6 A;  3AN1 A;  3JPT A;  2MH7 A;  4EEL A;  3SAF A;  1UD7 A;  2K22 A;  3QU5 A;  1TTN A;  4BWM A;  1FNW A;  2ZW1 A;  5KFE A;  9ICM A;  1C20 A;  5E79 U;  1EUV B;  1XSN A;  4JUZ A;  3HVD A;  3ONN A;  5ALP A;  3UXP A;  4DHJ D;  3SR6 A;  3V05 A;  1ZD4 A;  2KTR A;  3VR8 B;  5KG1 A;  4GC7 A;  1OQQ A;  4BKT A;  3UPQ A;  1FO4 A;  3IT4 B;  2M9N A;  4JQW C;  2P66 A;  2DAJ A;  5CHW A;  4X5V A;  1L3V A;  1T0Q C;  4UB5 A;  5DB6 A;  5HR6 A;  4FE3 A;  3PX4 A;  2PFP A;  5J0Q A;  1G6J A;  1D9D A;  3P1M A;  5KFL A;  2XCA A;  1A0P A;  2NBU A;  4OD0 A;  1ZQM A;  1N61 A;  2LRU A;  3C28 A;  3VTU A;  1WM2 A;  1WM3 A;  8ICF A;  3DQV A;  1FXI A;  2OJW A;  2RHF A;  3H7P A;  3RNF C;  3PR5 B;  1SE3 A;  3CSF A;  3DEE A;  4HRS A;  2C22 A;  4BOS C;  2JGA A;  1FM0 D;  1K1Q A;  1XF5 L;  1OEY J;  4M02 A;  1A76 A;  3QAR A;  3JYU A;  1ACC A;  3VH3 B;  1TKY A;  2WB1 F;  4G11 A;  2RPQ A;  5E6P A;  4LNO A;  5HMM A;  1X9W A;  1ZQD A;  2BF8 B;  1I4Q A;  3RJH A;  1KL9 A;  8ICN A;  1ZQP A;  1WR1 A;  4ED6 A;  4F4Z A;  1D5M C;  2KJ6 A;  4A3O A;  2W3S A;  1UWM A;  5CTR C;  4W9D A;  4NM1 A;  4QZD A;  1MG4 A;  4LVS A;  8ICO A;  2BWE S;  2W9A A;  4Y2R A;  1WXV A;  1U4B A;  4F5N A;  1IPG A;  4GFJ A;  3ZJV A;  4ZRJ A;  4BKS D;  3AI5 A;  2LJ5 A;  3PNC A;  3P4P B;  5DQG A;  3BY4 B;  4ZRP A;  3C19 A;  1UBI A;  1MSW D;  2HDO A;  4PH5 A;  4B9U A;  1XSL A;  3E2E A;  2MQJ A;  1JML A;  3TEW A;  5ALM A;  2LKY A;  5KFX A;  3KH0 A;  4JX1 C;  3NZS A;  3H8H A;  1RM6 C;  4UAY A;  4HKQ A;  5AEK B;  4RGM A;  2A1J B;  5J2G A;  1UZX B;  1HUZ A;  4L1B A;  4YSX B;  4ZHP A;  3AQF A;  3GU3 A;  5AI9 A;  2M4N A;  8ICC A;  2M0X A;  4YT0 B;  4DSI A;  1ZQR A;  4IRK A;  4RGN A;  4IQV A;  2RSU A;  1FFU A;  4PHD A;  1E7V A;  3IT6 B;  3H8J A;  1TYG B;  2NRZ A;  2WXN A;  4BJQ A;  3SFE B;  2ISP A;  4QWD A;  3ZDM C;  3L13 A;  1T5X D;  1KTQ A;  4KMU A;  4NV0 A;  4O3R A;  2IGD A;  3UGB B;  2AQ0 A;  3Q8Q B;  4F8C B;  1ZXI A;  4JV0 A;  3Q8R B;  2PFN A;  2BS4 B;  5KFS A;  3RH5 A;  5G5H A;  8ICZ A;  2KVZ A;  2BQR A;  2AQ4 A;  2AEH A;  2G9H D;  3C21 A;  3N28 A;  3AEV A;  1S8O A;  4FO6 A;  2LAS A;  2PXI A;  4ECT A;  3JPO A;  2VA3 A;  2IOF K;  5KFU A;  2VAN A;  1D9F A;  4QJF B;  4FBU A;  4NLK A;  5BPC A;  1WGG A;  2XK5 A;  2JRZ A;  1PGX A;  2W04 A;  1QSL A;  1XD3 B;  7ICH A;  1TY2 A;  5KAF U;  3OJ4 B;  3IBE A;  1LXD A;  4DF4 A;  3IN5 A;  1L3S A;  1XO3 A;  3JPQ A;  3SI8 A;  3R2T A;  1ZQI A;  2KHV A;  1NVI D;  3RJE A;  1X9X A;  4J6I A;  2BW2 A;  1ZYQ A;  3HVZ A;  3RNB C;  4UAU A;  3THV A;  1RPL A;  2K4I A;  2WS3 B;  2R8J A;  2GRI A;  2NBW B;  2BVC A;  5CA7 A;  5T8I A;  4PGY A;  2QHO A;  3C2M A;  1V1O A;  3AE5 B;  1QZE A;  4EEN A;  4DFM A;  1T0S C;  1OXJ A;  2D3G A;  3W9C B;  1JWA D;  3U30 A;  4O3S A;  1VRA B;  5KFJ A;  2WXO A;  3KKA A;  4Y2J A;  2CR5 A;  1R7S A;  4QZC A;  5ALH A;  4CRX A;  1YJJ A;  5DPT A;  2G08 A;  1ARO P;  2WYQ A;  4TQ1 A;  4YG2 A;  1OGW A;  5JRT A;  1YQ4 B;  2KSO A;  2FAZ A;  1C4P A;  2MCN B;  3PX6 A;  3GIM A;  2NTS A;  1N2X A;  4BWJ A;  4XE0 A;  4J9O A;  2H5X A;  1WH3 A;  4RQ7 A;  2PE9 A;  3MJW A;  5DLG A;  1ZJN A;  2XY5 A;  3MBY A;  5J0T A;  4MGI E;  8ICW A;  1KLU D;  3RB3 A;  1SF0 A;  1MHH E;  1O08 A;  4XA5 A;  4C7Z A;  5G55 A;  3B2F A;  3R7R A;  2QJL A;  3QNM A;  2AJQ A;  2YN4 A;  2C7H A;  5J0S A;  8ICR A;  2INP E;  3C8Y A;  4ICA A;  1TKE A;  4LTU A;  1QOB A;  1Q3U A;  2EH9 A;  1XS9 D;  2P35 A;  4Y2T A;  5ALW A;  2M17 A;  2KVS A;  4US9 A;  4K81 A;  2LFI A;  2KTR B;  1QLN A;  2ISO A;  1DK3 A;  1KFY B;  1UA1 A;  2RLT A;  5CRX A;  2GI9 A;  1V6E A;  1L6N A;  3NVW A;  4PHA A;  3EZ5 A;  3SQI A;  2AGO A;  1ZQB A;  4YSY B;  4JE3 B;  3V6E B;  5AKX A;  1F44 A;  2GOL A;  1RRB A;  2HBM A;  4C56 C;  1Z19 A;  2JSV X;  2V3S A;  1B22 A;  1YD8 U;  3QU9 A;  2V4I B;  2OH2 A;  2KDE B;  3UQ2 A;  2EKE C;  2N7J A;  1NJZ A;  4LNN A;  3V6H A;  1T8E A;  2O2V B;  3ZQ4 A;  1NOM A;  1LFD A;  2CU3 A;  4RUC A;  4MT5 A;  1D8L A;  1E8Y A;  3DWG C;  5KHO A;  3PV1 A;  7ICN A;  3I5J C;  5DPS A;  1DYQ A;  3O0F A;  5KG7 A;  2KC2 A;  5AI5 A;  5J0P A;  3PPA A;  1KFT A;  4AUQ C;  5ALE A;  1P7E A;  1FIQ A;  1WF9 A;  1ZQT A;  4DLG A;  1U49 A;  1YN5 A;  3QUQ A;  2PFO A;  2KKC A;  3TEZ A;  4GN1 A;  4FFD A;  2HSZ A;  1D5X C;  4QWA A;  4P16 A;  5DBA A;  2W9C B;  4RQ2 A;  4KGR A;  3R2I A;  3OPX A;  4FZL A;  5L1K A;  2YY6 A;  2DPJ A;  4JV1 A;  1NEN B;  1CK1 A;  2BKE A;  5ALU A;  4YTN B;  2MW5 A;  4AOF A;  4OCZ A;  1NZP A;  5J8Y C;  4YP3 A;  3O13 A;  3QQ8 B;  1NJY A;  3OSP A;  5DCN A;  1C9F A;  5J0O A;  2AL3 A;  3QK0 A;  3MJ5 A;  2F76 X;  8ICI A;  4P1B C;  5J2C A;  9ICJ A;  4PGQ A;  2KDI A;  4K7U A;  4ANU A;  9ICE A;  3CRX A;  1A77 A;  4IDI A;  4PHP A;  3RRG A;  4BUG A;  2IYD B;  2QSD A;  2W9B A;  9ICB A;  1J7B A;  1LQB A;  5ALL A;  1FXT B;  4B9V A;  1UNS A;  2KQS A;  2MRL A;  3CF6 E;  1X9M A;  3UMC A;  5J29 A;  4ECR A;  3PY8 A;  4PS7 A;  3FDS A;  4WWM A;  2C9W B;  3JPS A;  4MAC A;  4PGX A;  2KZM A;  3T79 A;  4NPN A;  4DOA A;  5DGA A;  4MDK E;  4DFD A;  1WRD B;  1OEY A;  2DF4 B;  4XDC A;  3TSS A;  2KFK B;  1M94 A;  4F8R A;  4M2Y A;  1HTO A;  2L8J A;  3WK9 A;  2KFZ A;  1KKX A;  4UB8 U;  2CXY A;  4DCC A;  3T5L A;  5KL1 B;  4BKG A;  2QEJ C;  2PFQ A;  2G4D B;  4RNA A;  3M6K A;  3C2L A;  2GWS A;  3A1Q A;  1O03 A;  4C0Z A;  1KDH A;  1B0X A;  1EO6 A;  4ANX A;  2DYB A;  1WGY A;  2JMG A;  1OQR A;  3TJP A;  3D2S A;  4E71 A;  4KSK C;  4C7Y A;  4DWF A;  2YMP A;  4LDT D;  3PVL A;  2RPV A;  2V4R A;  3K1Z A;  4W9F A;  4YFK A;  4JPS A;  4GB9 A;  1UUP A;  3RD2 A;  3RH4 A;  2VJ4 A;  4P6V F;  4HEA 1;  5K4L A;  3UM9 A;  3M9O B;  5KT3 A;  1YNT E;  5III A;  2N1R A;  1XLQ A;  2W82 A;  4Y2X A;  4BZA A;  2IY1 B;  2J4X A;  4ED2 A;  1V8C A;  1WXM A;  4IC9 A;  1WGH A;  2N9L A;  4DLE A;  2RGF A;  2LM1 A;  5DG9 A;  4P0P A;  3MC0 B;  5D3I B;  1WYG A;  2JXT A;  2R18 A;  3AV8 A;  5DPR A;  4NM2 A;  3LVW A;  4R65 A;  4MH0 E;  4PT5 A;  5HI1 A;  3VFK A;  1QF6 A;  9ICW A;  4IRC A;  2JWZ A;  2KFK A;  3UXN A;  2WDV B;  1T4G A;  3KKA C;  4FJZ A;  1JW9 D;  3V7J A;  3W1S A;  3KHH A;  4B9M A;  3PW4 A;  3SMV A;  2R8I A;  1KJT A;  4KX5 A;  4Q44 A;  2LI5 A;  2C7M B;  5KFW A;  3GE3 C;  4MH8 A;  5L9X A;  2G09 A;  2VRR B;  3ZJU A;  4IQW A;  2ZUB A;  1V81 A;  3H8M A;  3V62 A;  2DZJ A;  2GB1 A;  3ONS A;  3WKB A;  1JWU D;  1MJD A;  4OW0 A;  4ACO A;  1KLG D;  2DPI A;  2KK8 A;  1T6B X;  3H7P B;  4NAM A;  2FLN A;  4CF3 A;  4M9L A;  4QAY A;  4I29 A;  1C78 A;  3V72 A;  4KGS A;  4ZRK A;  2GBN A;  4GIB A;  5TR5 A;  2MBO A;  3KWL A;  2B3A A;  3A0H U;  3TUO A;  5DDM A;  2O6K A;  4BVU C;  1I4P A;  2D07 B;  4Q8F A;  2LYH A;  4OVU A;  2JRI B;  2L83 A;  5HFY A;  4FZN A;  4KZ0 A;  1FFV A;  3PSP A;  1ZQC A;  1RLF A;  4B9N A;  3TEX A;  2NVU I;  2X8X X;  4RF1 A;  1UF0 A;  3ZDT A;  1HEZ E;  1K5O A;  4LNK A;  2K8A A;  4MJS B;  4UAS A;  4Y2U A;  3GV8 B;  9ICK A;  3X23 A;  2JYE A;  7ICF A;  1MN8 A;  3VVW B;  2WF7 A;  2VJ5 A;  4EBD A;  4MGZ E;  2WXL A;  1NEK B;  4W9I A;  2SAK A;  2VIX A;  4IM2 A;  4MM3 B;  1V38 A;  4ZH4 A;  5KT6 A;  1HTQ A;  4C8L A;  4HVB A;  1L7P A;  5ALR A;  3EWA A;  4IQU A;  4KX6 B;  2KAC A;  3I28 A;  3ZO5 B;  2V3N A;  3GP7 A;  1NBF C;  3V6K A;  1I4H A;  2Z0E B;  3DBH I;  3KTQ A;  3Q6B A;  4J9P A;  4ELV A;  5KT2 A;  2K89 A;  2M0A A;  1S97 A;  2ZVO A;  2QC8 A;  1S77 D;  3HK0 A;  3HPO A;  2N9P C;  4IC7 B;  2W9B B;  3N7P D;  2DYM A;  1SV4 A;  3LWL A;  1UGM A;  1JXE A;  4EEK A;  5AIC A;  5J2K A;  2LHE A;  1MG8 A;  4M0W B;  2BHN A;  3QE9 Y;  2B21 A;  4NXZ A;  1XWL A;  1IGD A;  3RAX A;  4MM3 A;  5AM2 A;  3AE2 B;  4J9Q A;  2P6R A;  1EF1 A;  3Q8E A;  4WAF A;  2D2Q A;  3Q8C A;  1PGA A;  1CJE A;  4W9G A;  2MUT B;  4YR3 A;  5J8Y A;  1ZGU B;  2MX2 A;  4TUQ A;  3TFS A;  2WF9 A;  2KWV B;  3EGR A;  3Q8L A;  2W9C A;  4PK1 A;  4P1C C;  1LGR A;  3M63 B;  5C1Z A;  2K3U A;  2MSE D;  1BPD A;  3PW7 A;  1ECW A;  2FMS A;  2BBC A;  1HUO A;  4KLG A;  5DB9 A;  1NKC A;  1P7F A;  3IP4 B;  3Q8S B;  4HCP B;  2IPK D;  2WF5 A;  2JEF A;  1ZPS A;  2J53 A;  2BKF A;  4TUR A;  2FCN A;  3IXS A;  1VCB A;  3DBL B;  4RQ4 A;  4UAT A;  4DDI D;  4P7I A;  2JXJ A;  4XWT A;  5IO9 A;  3OTQ A;  2PMZ C;  2HJ1 A;  2YX8 A;  1KH0 A;  3CYM A;  2JY6 A;  2VH1 A;  4N59 A;  4K3B A;  1FNV A;  2C28 A;  4Q2J A;  1ZUD 2;  4QWE A;  1T94 A;  5DGB A;  2JU6 X;  2D5G A;  8ICQ A;  4OVV A;  1TY0 A;  5E6O A;  1NK7 A;  2ZJA A;  2N7D A;  3MFH A;  2IBI B;  2TSS A;  2I5H A;  4I6N B;  5L83 A;  2DNF A;  2KT7 A;  3Q8M A;  2Y1I A;  2ZIV A;  1EXN A;  4DS5 A;  4XRH A;  3M95 A;  3BII D;  5ALD A;  3NVV A;  2DQN B;  2HHU A;  1PYW D;  1X1M A;  2LHD A;  5GTI U;  4P4O A;  4IWQ A;  1UHU A;  3PTF C;  2ZCB A;  3RCZ A;  1ZKH A;  1DGJ A;  1RYU A;  2B6G A;  4M8N A;  4KMO B;  3NUH B;  2NR2 A;  4Z6D A;  1B43 A;  1FRR A;  4CCH A; 
#chains in the Genus database with same CATH homology
 1ZDX A;  2LJI A;  3P1M A;  1EWC A;  1NYR A;  1N61 A;  5FK9 C;  4A55 A;  4OHJ A;  2BB6 A;  3AB5 A;  1SXT A;  2WLB A;  4GLS C;  3LYY A;  3BYY B;  4EE2 A;  1FCL A;  4RH6 A;  3L4P A;  1FXI A;  1SBB B;  3AEF B;  1SE3 A;  1I7H A;  1K52 A;  2PTL A;  4HRS A;  4CQN A;  1IGC A;  2WP9 B;  1F2R C;  3BK2 A;  3AE8 B;  5LNK 1;  1PGB A;  2ICI A;  1FM0 D;  1XF5 L;  3HUI A;  1ACC A;  2B76 B;  1TKY A;  2DLB A;  3J9C A;  2AQ2 B;  1BUI C;  1I4Q A;  1DOI A;  3E9S A;  1D5M C;  1ET6 A;  2W3S A;  1UWM A;  1BML C;  3AE4 B;  3FAH A;  2WXF A;  3EUB 2;  2IDY A;  2XNA C;  4RFB A;  1DOY A;  3ZJV A;  3P4P B;  4ZRP A;  2I2Y A;  2RMM A;  1QOA A;  1SSN A;  4RCO A;  4US8 A;  1K51 A;  1JML A;  2VZK B;  3TEW A;  3FC4 A;  3ZGZ A;  1XEE A;  4JX1 C;  3VR9 B;  3H8H A;  1PFD A;  1RM6 C;  4HKQ A;  4RGM A;  1YN3 A;  4HRO A;  4L1B A;  4YSX B;  4ZHP A;  2KWD A;  3LXF A;  2K0P A;  3U7Z A;  5EE1 A;  3EA6 A;  2Z8L A;  3ETR A;  4YT0 B;  2JYT A;  2MJE A;  2OED A;  4RGN A;  1FFU A;  1HZ6 A;  2H88 B;  3IT6 B;  2Y5P A;  4WUR A;  3IAM 1;  1MI0 A;  1TYG B;  2WQY B;  3VQI A;  2H89 B;  2WXN A;  3T3O A;  1GB4 A;  4RGT A;  3SFE B;  3B9J A;  3E56 A;  1ENF A;  1T5X D;  3Q69 A;  1VZ8 A;  2IGD A;  2V3P A;  2ZW0 A;  4DXG A;  4R3D A;  1ET9 A;  1ZXI A;  2BS4 B;  1N63 A;  1XCQ L;  5G5H A;  4N6E B;  2ACZ B;  5TSS A;  3AH7 A;  5FR3 A;  1CZP A;  2G9H D;  3ZJT A;  4OZA A;  1RFK A;  1JRO A;  2LMC A;  1EU4 A;  2AX5 A;  3BYT B;  1XCT L;  2HTM E;  2W54 A;  2NMQ A;  2WXM A;  1F77 A;  1PGX A;  1TY2 A;  1TS3 A;  1YJI A;  3BVZ A;  4LLG M;  4DXF A;  4TMA B;  3FIL A;  3P4S B;  4YSZ B;  4JWS C;  5EE3 A;  1XO3 A;  1ZE3 D;  3R2T A;  1L4D B;  1NVI D;  1TS4 A;  1WSP A;  2INN E;  2BW2 A;  1I4R A;  3HVZ A;  1GAQ B;  3KLS X;  1KRH A;  1V1P B;  1FD6 A;  4ARC A;  1I4G A;  1GPX A;  2WS3 B;  3AED B;  1N5W A;  1JWS D;  1TS5 A;  1RWS A;  4JWU C;  4AS1 A;  2GRI A;  1M4V A;  2YEP B;  2FBW B;  1SJE D;  5T8I A;  1V1O A;  1C4A A;  3AE5 B;  1J7A A;  4UDU C;  1FEH A;  3W9C B;  4D2K A;  1TS2 A;  1JWA D;  1VRA B;  2WXO A;  1R7S A;  3AE1 B;  1ZDV A;  1SB3 C;  3RPF C;  3NS1 A;  1PDX A;  1WRI A;  1L6V A;  1YJJ A;  4TQ1 A;  1YQ4 B;  5FKA C;  2L1A A;  3BVM A;  1UGJ A;  2PVG C;  5MPO A;  2KAJ A;  1C4P A;  1VZ7 A;  2NTS A;  1SIJ A;  1STE A;  2YEP F;  3U4E G;  4XE0 A;  1E9M A;  5BMH A;  1TKG A;  4L2Y A;  3T3N A;  3KWV A;  1KLU D;  1JQ4 A;  1SF0 A;  2DBY A;  2Y3A A;  1MHH E;  5JXV A;  4C7Z A;  2IGG A;  3B2F A;  1SE4 A;  2QJL A;  1ZOY B;  2JZP A;  1FCC C;  2LEK A;  2INP E;  5G5G A;  3AEG B;  3C8Y A;  4DQO C;  1TKE A;  2PKO A;  4LTU A;  1QOB A;  1HA5 A;  4YTM B;  4US9 A;  2WDQ B;  1C77 A;  2LFI A;  2WNM A;  1XLP A;  2KN4 A;  1GOZ A;  1V1P A;  4KGT A;  1C79 A;  1KFY B;  3B2G A;  2BS2 B;  3WCQ A;  3RFZ B;  3U2S C;  2GI9 A;  3MP9 A;  3HRD D;  3NVW A;  3KQ4 A;  4YSY B;  4JE3 B;  2PVO D;  3Q8B A;  4H2A A;  3AEE B;  1AWD A;  4C56 C;  2JSV X;  1VR9 A;  4XWW A;  2WXR A;  1L0X B;  2V4I B;  1N62 A;  3Q8F A;  2N7J A;  1JCK B;  3ABV B;  3MFG A;  3OWE B;  5C2T B;  2QIL A;  2KQ4 X;  4NZL B;  3ZQ4 A;  2AQ3 B;  2J52 A;  2LUM A;  4IOI E;  2CU3 A;  1T3Q A;  3GB1 A;  3Q8A A;  4MT5 A;  4XDD A;  5GXG B;  1D6E C;  3DWG C;  4WQM A;  3NZ3 A;  1QKZ A;  2RDG A;  2WXI A;  5D3D A;  3NVZ A;  1DYQ A;  2SEB D;  4WIP A;  4A6Q A;  1P7E A;  1FIQ A;  2Q5W D;  1YN5 A;  3URY A;  3TEZ A;  2JQR B;  1QOF A;  2WXK A;  4N58 A;  1D5X C;  5BMG A;  2W3R A;  4P16 A;  4ITK A;  4KGR A;  3R2I A;  2EKI A;  1PUT A;  2OHF A;  1WWT A;  3AEC B;  1B9R A;  1NEN B;  1CK1 A;  2ONQ A;  2FE8 A;  3W5V B;  4YTN B;  3BK1 A;  4A8X C;  1E7P B;  4OVZ A;  3O13 A;  1JWB D;  3MHZ A;  5BMI A;  1C9F A;  4ZYS A;  1A70 A;  3MJ5 A;  1L6U A;  1HZ5 A;  2FUG 1;  1I4X A;  2XN9 C;  4RGO S;  2KDM A;  4IDI A;  1SE2 A;  3BWU D;  4B0M A;  2E3T A;  2QSD A;  1YN4 A;  1D5Z C;  1QIL A;  4GDL B;  2WXQ A;  1J7B A;  3FIL B;  1N60 A;  1UNS A;  2LGI A;  1XLO A;  1IBX B;  4M0W A;  4A9A A;  2CJO A;  2M56 B;  2RDH A;  3AE9 B;  3BVG A;  4WWM A;  4MAC A;  3AMZ A;  3GS2 A;  4GDK B;  2Y5C A;  2WU2 B;  3UI3 A;  2IGH A;  4XDC A;  3TSS A;  1DOX A;  1ZP0 B;  1HQR D;  1ROE A;  2NTT A;  3TEY A;  1QT9 A;  1SJH D;  4O1N A;  1NI3 A;  4YTP B;  1WXQ A;  4L23 A;  2QEJ C;  4RNA A;  2EEL A;  1BXT A;  2WU5 B;  2PIA A;  3PZ7 A;  1AN8 A;  5H8Y E;  3AE6 B;  3ZYY X;  1OQR A;  4KKI A;  5H92 C;  3AEB B;  5E6J A;  4C7Y A;  1MHX A;  4A90 A;  2K5P A;  3AM9 A;  2RPV A;  2N9K A;  1C76 A;  1UWX A;  1L4Z B;  4TSS A;  4RF0 A;  4JPS A;  2R61 A;  5AUI A;  1UUP A;  2WXP A;  2X38 A;  2PMV A;  1NYQ A;  4P6V F;  4HEA 1;  1QOG A;  1IUE A;  3N9Y C;  1LO5 D;  1YQ3 B;  5HHD G;  3VRB B;  1YNT E;  1ESF A;  1OFF A;  1XLQ A;  2W82 A;  1EU3 A;  1XXG A;  1SEB D;  2J4X A;  1V8C A;  2N9L A;  5D3I B;  3CWI A;  1N5X A;  3MC0 B;  1WYG A;  2JXT A;  3AV8 A;  1C4C A;  4FXC A;  4PT5 A;  1FRD A;  3IAS 1;  5HI1 A;  1QF6 A;  4TQ0 A;  1FNU A;  1QLB B;  2IJ0 A;  2WDV B;  3SEB A;  4YWG G;  1JW9 D;  1ZXH A;  4LK0 M;  3CIR B;  3W1S A;  5BYS A;  3W5U B;  1AYF A;  1KF6 B;  1VJK A;  2W55 A;  4MH8 A;  3ZJU A;  5EE9 A;  1B1Z A;  1CQV A;  3V3X A;  1TZO A;  2GB1 A;  1JWU D;  2MJ3 A;  1MPE A;  1KLG D;  4OW0 A;  4IKG A;  4USA A;  1T6B X;  1TJE A;  4NAM A;  2CJN A;  2WDR B;  4HKZ E;  5AUK A;  1C78 A;  3AE3 B;  4NAW B;  1HXY D;  4KGS A;  5BYR A;  1KTK A;  3KWL A;  3TUO A;  2I38 A;  1I4P A;  3PO0 A;  2MEK A;  2L83 A;  2WXH A;  3LB8 C;  5HFY A;  5BYQ A;  2BYT A;  1FFV A;  4OZB A;  1FXA A;  2BTE A;  2QIE B;  3TEX A;  4RF1 A;  1HEZ E;  1F0Z A;  4OZC A;  3P4R B;  3VRA B;  5I4D A;  2DYO A;  2JYE A;  1MVK A;  2N0S B;  4B0E A;  1EM7 A;  2BT6 A;  3AEA B;  1JRP A;  2WXL A;  1J7C A;  1NEK B;  4KKJ A;  2SAK A;  4MM3 B;  1L0Y B;  1F2R I;  2E6X A;  2JWU A;  3P63 A;  1L0V B;  2DWQ A;  4REZ A;  4KX6 B;  2KAC A;  1GB1 A;  2V3N A;  3P42 A;  1YMH E;  3GP7 A;  1K50 A;  1I4H A;  4ZOH C;  3NRZ A;  1JWM D;  3I9V 1;  2PLP A;  1K53 A;  2J42 A;  2M0A A;  1IBX A;  4YXD B;  1VDV A;  2JX5 A;  2WXG A;  2V0G A;  2DYM A;  2ON8 A;  2LHE A;  5D7G A;  2MJD A;  5C3J B;  1IGD A;  4WH4 A;  1XLN A;  2BS3 B;  3AE2 B;  2K9X A;  3Q8E A;  4WAF A;  1E10 A;  2PW9 A;  2VZK D;  3Q8C A;  2BB5 A;  1PGA A;  1CJE A;  1VZ6 A;  4C80 A;  3W2D A;  1E6E B;  3BZD B;  3EGR A;  2G1E A;  3DWM A;  2K3U A;  3AE7 B;  1D4B A;  3U52 E;  4AQ7 A;  1Q10 A;  2BBC A;  1E0Z A;  1P7F A;  4NJC A;  2M19 A;  2IPK D;  2HDE A;  1ZPS A;  2KMM A;  2J53 A;  1RYJ A;  1WGK A;  2WXJ A;  3R8B A;  3IXS A;  4ARI A;  1L5P A;  2AQ1 B;  1QQR A;  2L52 A;  4HJG E;  4XWT A;  1V97 A;  4N59 A;  2L32 A;  1KH0 A;  3AN1 A;  1FMA D;  2MH7 A;  3I57 A;  5EE0 A;  1AW7 A;  1FNV A;  4Q2J A;  1ZUD 2;  2K22 A;  1FNW A;  3SFD B;  2ZW1 A;  2JU6 X;  3P4Q B;  2D5G A;  3NVY A;  1TY0 A;  2TSS A;  2QMT A;  3HVD A;  3SR6 A;  3V05 A;  3VR8 B;  1OQQ A;  3BII D;  1FO4 A;  3IT4 B;  3NVV A;  4ZRQ A;  1PYW D;  2LHD A;  3PZ8 A;  4ZHO A;  1VLB A;  1EWY C;  1Y56 A;  1DGJ A;  3NUH B;  1JAL A;  5HG2 A;  4J3O D;  1FRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...