5G5HA

Escherichia coli periplasmic aldehyde oxidase r440h mutant
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
173
structure length
173
Chain Sequence
b'AATPAPEIMPLTLKVNGKTEQLEVDTRTTLLDTLRENLHLIGTKKGCDHGQCGACTVLVNGRRLNACLTLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTSGQICSSVAVLKEIQDGIPSHVTVDLVSAPETTADEIRERMSGNICRCGAYANILAAIEDAAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE XANTHINE DEHYDROGENASE YAGT IRON-SULFUR-BINDING SUB
publication title The Escherichia Coli Periplasmic Aldehyde Oxidoreductase is an Exceptional Member of the Xanthine Oxidase Family of Molybdoenzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 48
structure length 173
sequence length 173
ec nomenclature ec 1.2.99.6: Carboxylate reductase.
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 5g5hA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5g5hA01
2W3RA 2K22A 2WDQB 1QT9A 1QF6A 2BS3B 1XLNA 2MJ3A 3P4QB 1JRPA 2WDVB 1NYQA 1TYGB 3AE4B 2M19A 2BS2B 3VRAB 1QOAA 4WQMA 4P6VF 3AEEB 2WU5B 2B76B 1DOYA 5G5HA 1WRIA 1V97A 1PFDA 1RFKA 3LB8C 3LXFA 5H92C 5C2TB 3WCQA 2E3TA 3VR9B 3VRBB 3AE6B 1N61A 3NS1A 3HUIA 4N59A 1TKGA 3NVWA 2AX5A 3AEBB 3NVYA 1CJEA 1E6EB 1OFFA 2QIEB 3P63A 2CU3A 1J7CA 3FAHA 4N58A 4ZHOA 2WS3B 4US9A 1KFYB 1TKEA 4YTNB 1AWDA 1IUEA 1E7PB 1WXQA 3SFDB 1CZPA 1FRDA 1KRHA 3W5UB 3AEAB 2BT6A 1YJIA 1SB3C 1N5XA 1R7SA 1VJKA 2W54A 3AN1A 3NVZA 4IDIA 3SFEB 1WGKA 3SR6A 3AECB 1FIQA 1WYGA 2LEKA 1N60A 5EE3A 4C7ZA 1TKYA 1OQRA 4C7YA 2CJOA 2BS4B 2FBWB 2WP9B 3AEFB 1RM6C 3ABVB 3P4PB 3AE8B 1VDVA 3B2FA 1L5PA 3P4SB 2K9XA 4YTPB 1UWMA 1N62A 1XO3A 2H88B 2MJEA 3P4RB 2MJDA 3B2GA 1B9RA 2N0SB 1JQ4A 3AM9A 2ACZB 2WQYB 4HRSA 3FC4A 3ETRA 4HROA 5C3JB 1VLBA 2QJLA 1NI3A 4JWSC 2W3SA 1FRRA 1JALA 2DBYA 5AUKA 1YQ3B 1NVID 1L6VA 1TJEA 1QOGA 5EE0A 4YTMB 1JROA 3NVVA 3AE3B 2KMMA 3AE2B 1DOXA 1N63A 3AMZA 2W55A 3AE1B 1RWSA 3ZYYX 1JW9D 1KF6B 5MPOA 1FFVA 1NYRA 1L6UA 1SF0A 2MH7A 4WWMA 3VR8B 3KWLA 1QLBB 2WLBA 3DWMA 3HRDD 1FMAD 3EUB2 1XLQA 2KAJA 1ZXIA 4LTUA 3P1MA 3PO0A 4YT0B 2M56B 1DGJA 2H89B 1PUTA 3AE5B 1FM0D 1EWYC 2EKIA 2PVGC 3W9CB 1ZOYB 3HVZA 4A9AA 1NEKB 1T3QA 3AEDB 3AEGB 4YSXB 1FXAA 2OHFA 1XLPA 4ZHPA 1E10A 1GAQB 2CJNA 1N5WA 2PKOA 1SIJA 2DWQA 3AE9B 4C80A 1QOFA 2L83A 2WDRB 1E0ZA 4USAA 5G5GA 1FXIA 1ZP0B 3RPFC 3AB5A 1ZUD2 2HTME 3W5VB 1YQ4B 4KX6B 4ZOHC 5AUIA 3BIID 4ITKA 1A70A 1WWTA 1L0VB 1J7BA 1F0ZA 4US8A 2WU2B 4N6EB 4YXDB 4YSYB 1YJJA 1I7HA 1FFUA 1V8CA 3AV8A 3CIRB 5H8YE 3AH7A 1NENB 1J7AA 2JQRB 1QOBA 2K5PA 5GXGB 2PIAA 5EE9A 4JX1C 4JWUC 3L4PA 1FO4A 1DOIA 1E9MA 1RYJA 2PVOD 3B9JA 3CWIA 4FXCA 1JWAD 2JX5A 1JWBD 1PDXA 1AYFA 1GPXA 2Q5WD 1ROEA 2L52A 3DWGC 4YSZB 2G1EA 1OQQA 3NRZA 5EE1A 3AE7B 2Y5CA 1XLOA
chains in the Genus database with same CATH superfamily
5J0RA 2WDQB 3SDLC 4JE3B 3RZWC 7ICPA 5J0UA 2LASA 3N7RC 5AI8A 5HI1A 2D8CA 2EZYA 3SAFA 2ZTDA 5J2KA 2JPHA 2N1WA 2EDUA 4JPSA 1Q8KA 2KK8A 3RNGC 2JV3A 4NXZA 2JZPA 1QQ7A 3AE6B 5FP0A 4OJ6A 5J2JA 4F91B 4WWNA 2E8MA 2NO4A 2AQ2B 4QZCA 3X23A 7ICSA 4ACOA 1PGXA 2K6QA 4Y2RA 1K53A 1MG4A 4HPMB 2FUG1 4MM3B 4AYBF 3GIIA 1AARA 3QC8B 2XEWA 2WX1A 5J2DA 1GB4A 1FIQA 5KFVA 4M0AA 2C2RA 4KLEA 2MBBB 4C7ZA 1TKYA 1L0XB 5DPSA 2FBWB 5IIMA 5KFLA 3THVA 2M9NA 1OUQA 3MDCA 2J0KA 2KWVB 1L3TA 2R18A 3HM3A 4DCCA 3NGDA 5AKXA 4DS5A 1R4NI 4KMUA 2JU6X 2A1JA 2KV2A 3Q8QB 4B9MA 2KQ4X 3RUIB 4BAXA 3ETRA 2V9HA 4J9KA 1VD2A 1TS2A 3QA8A 1RFAA 2KQSA 4C4TA 2KJ8A 2QHOA 1C1YB 2OJRA 2ICIA 7ICEA 3PHXB 2K8CB 8ICFA 4HEA1 2MBQA 3ALRA 4ED3A 4A20A 3ICXA 3HX0A 1D5ZC 4YR0A 1LVHA 3OJUA 2ASDA 3WKAA 2PFOA 4FFDA 4F2SA 1SV4A 2OEDA 3TIXA 2KWUB 2O6VA 3I9V1 2QKQA 4DOBA 4H2AA 4O1NA 1N5WA 2IOFA 3BVZA 2LM4A 3BK2A 4C4VB 1EF5A 2BQRA 4PHEA 2ZIUA 2XNAC 2VZKD 3MFGA 1ZPSA 4RM9A 2KFKA 1YQ4B 4WJNA 2DGZA 3BIID 1TFRA 5AK5A 3TFSA 2BB5A 4JB3A 2ESEA 3K75D 5ALHA 5GTIU 1U49A 2LD9A 4N6EB 4J9MA 2PMZC 1RYUA 3AH7A 3BYTB 4M8MA 4YD2A 3BQ1A 1SIFA 2IHMA 2IJ0A 2LGYA 5EE9A 2N7DA 2ZTCA 3L10B 3PLVA 2UVWA 2KWCA 3B1LX 3RFZB 1X9XA 2EH9A 5AKIA 3UXOA 1JWAD 4UB2A 3NG0A 4FULA 4MEMA 4REZA 1IIPA 1DRGA 1JWMD 2E8PA 1OQQA 1XLOA 1WGHA 3Q3MC 1S0MA 4TQSA 1F2RC 2D3CA 4JL9A 1JRPA 4I2CA 3VHTC 2M19A 3CNHA 1AN8A 5A0LA 3VRAB 4OVVA 4ACFA 1CEZA 2FE8A 1LGRA 3L3FX 4IQVA 5G5HA 1NK0A 2O2VB 3RF9A 4ED7A 2AQ0A 4G3IA 1SWVA 3R66C 4KIKB 3QX1A 2B3AA 2BZFA 1SL2A 4B9UA 1L8OA 1WG8A 1SKRA 4TQ1A 1K1QA 3OSPA 2W03A 1C20A 3ZDMC 4QZHA 1L3VA 1CJEA 2GI9A 1J7CA 4QWEA 2CXYA 1J97A 3HP6A 4QW9A 3IDWA 4EYHB 1NZBA 4TSSA 3ISCA 3RNCC 1FRDA 2WF6A 4CO7A 1SB3C 3NUQA 2N9KA 3IHPC 4FBUA 3R2IA 2LI6A 3MGIA 4W9JA 3IN5A 3B0AA 3PW5A 3NTUA 5ALVA 1BVSA 3Q8CA 1QQRA 2YMMA 4UB3A 3V6HA 5FR6A 2BYTA 1YZ7A 1UQVA 3WKEA 4HK2A 3D2QA 3HHMA 3LDZE 4GFJA 3QIJA 1TVAA 1U47A 5C3JB 4PGXA 7ICFA 4RGOS 4Y2TA 5FKAC 3RFAA 5KG3A 1Y56A 9ICSA 4PPXA 2KVZA 4J9OA 3M7DA 2Y3AA 1F0MA 2ZCCA 4WH4A 4W9CA 4ANXA 3UQAA 4KLOA 3UXPA 5F3XB 4QJFB 2ZUDA 1NYRA 1E7VA 2KN7A 4O3PA 2FIFA 1G6JA 3PZPA 4EENA 1V85A 4Z6EA 3PX0A 4FZMA 4NWIA 4M6WB 2R8JA 4IM2A 3ED5A 1X6IA 4WIPA 2PKEA 3OHAA 1QKZA 2NRWA 3PSFA 5DPTA 8ICJA 1D8LA 5KFIA 9ICXA 4IC7B 3KOOA 2KACA 1SIJA 2RGFA 3EGRA 1ZD2P 1WX8A 2I2YA 3A9JA 4CE6A 3D32A 4ECQA 1FEHA 2Y1IA 1ZUD2 2KJ6A 2J0JA 2Y0SC 2LUMA 2KD0A 4W9IA 4CQNA 5KFRA 3K1RB 4I2JA 1RPLA 1JMLA 1L0VB 4J9NA 5AM5A 2FMPA 2LFIA 2Z7JA 1FFUA 1ISNA 3LVVA 5KFUA 2JEIA 2JVCA 5IIIA 5GXGB 3RCZA 1XQQA 2PPHA 4JWUC 4KLTA 3GZNB 4NPNA 2KMDA 4F8RA 3GOEA 1JX4A 4UAWA 3CF6E 1WRDB 4ZRPA 2JX5A 4OZBA 2MCNB 2PFNA 3V3XA 4UB1A 2PI4A 1IBXA 4XUSA 5L1KA 3TL5A 1L7MA 2BS3B 4GDKB 4BWMA 2JMGA 1SZHA 2RHFA 3KZIU 2W8KA 2UVVA 3BVMA 3RD2A 2PMZF 1S97A 1WYWB 2NPTA 1SWWA 4B9VA 2FLLA 3PV1A 3MC9A 2KMAA 4P0QB 1ZQTA 3DBRI 3ZI4A 3IM1A 3Q6BA 4EBCA 1FPYA 4CNQA 1I4PA 4ECZA 3TQ1A 4NJ7A 4R8UB 3PREA 4XX5A 2WFAA 2K8AA 1OTRB 4UB4A 5KT6A 1WMHA 3KQ4A 1D9FA 2WXFA 1AROP 1TKEA 4YTNB 4K7SA 1J2MA 2LHDA 3ZDAA 2W82A 1KRHA 3HKZC 4PL2A 1A5RA 1ZQOA 4IDIA 8ICQA 1N56A 2BWFA 2FJ6A 3SEIA 3IAM1 2LEKA 2A3VA 3ZDTA 1ZQLA 5I4DA 1COOA 3B0XA 3RH6A 5HMLA 5KG0A 1L5PA 4BKGA 2MA1A 2L3ZA 5D4BA 4KN4A 2MW5A 2BWES 2NBVB 5DQIA 1YOVB 2XK5B 2BDUA 3TBLD 3RAQA 2P66A 1WR6E 2LPEA 2LJ5A 2M0AA 2NBUA 3NY5A 4M9GA 4IUMB 1D4BA 1NI3A 4YXMA 3DBLI 1C7YA 3Q3FA 3DOWA 2C28A 1T94A 1QOGA 1TK5A 4Y2PA 4F4XA 1V9PA 2EZZA 4RNNA 2VH2A 5KG1A 1XC9A 1EU4A 1KF6B 3MJWA 9ICMA 2C7HA 2BKFA 4RH6A 4ZYNA 1ZXHA 1FNVA 4DOCA 4F4YA 1EF1A 1HJPA 1SKSA 4DSEA 2UYZB 3MGHA 4LLGM 3OJSA 4XE0A 2PVGC 3OSNA 2QEJC 4NL9C 2E1EA 2ZTEA 5J2BA 3KZXA 2PI5A 4HXDA 3GE3C 4MDKE 2G3QB 3UMBA 8ICNA 2KJ5A 3A1QB 1BMLC 1ED1A 2CS4A 3SV4A 2J53A 4F8CB 4USAA 3RPFC 2ZIWB 1D9DA 3QUCA 3BJYA 1P7EA 1WGRA 5J2AA 2KO3A 3WU2U 4EUTA 2H5XA 3V72A 1MG8A 4ANWA 1HXYD 5AIAA 3PX6A 1HUZA 2PW9A 4MEYA 1YN5A 4J3OD 4DS4A 2LYBA 2DL0A 3DHIC 3N3KB 2VA2A 2L8JA 3D6JA 4DWFA 3WAOA 4ECTA 2L52A 4I6NB 4C8OA 1B22A 2Y0SF 4HKQA 2NTSA 1RZTA 1BXTA 5T8IA 4F2RA 5BMGA 2MJ3A 5IOIA 5IA7A 5BYSA 4B95A 2NRVA 3ORYA 4GOCA 2D2QA 1HE8A 1SV0C 5CR0A 4Y2JA 2XCAA 4JIOU 1D3ZA 2B76B 3SI8A 2P35A 3ZDBA 1SZPA 5DPRA 3T5HA 3LXFA 5C2TB 4DSLA 4AUQC 4Z6FA 3IP4B 3QUBA 4MGZE 1NK9A 5EWFA 3Q8SB 3TAQA 3AEBB 2BQUA 2WF9A 1S9FA 3I76A 3OHBA 3ML8A 5GMVA 1V49A 3GE8C 3Q3OC 1P0RA 1S8OA 9ICUA 3VR8B 1T4GA 1Z4OA 4J03A 1BPDA 3W5UB 1X2IA 2KJ9A 1KLVA 1UNSA 3AN1A 3HK0A 3U30A 3NASA 4KV2A 1WYGA 3N28A 2J42A 3QWZB 5AM3A 1MC8A 1IP9A 1ZQKA 3VAWA 3W1SC 2W11A 1ZQGA 2J0MA 2QCZA 4FE3A 3B2FA 4M02A 4GIVA 3RH4A 4YD1A 1SSNA 4TURA 3UQ2A 1Q1OA 8ICGA 2ZUCA 3VCBA 3C5FA 1S77D 2L32A 3P42A 1I4GA 3GS2A 3AM9A 2WGSA 2IYDB 3FC4A 2LJIA 3HKZF 3R3MA 4P4PA 4YTMB 3RBDA 3AE3B 3Q3NC 4NJ8A 2IO3B 3ZKJC 4DDGD 4F5RA 2IY0B 2I1KA 3MHSD 1ZYQA 4P0PB 3SHQA 1TKDA 2HVIA 3HRDD 4I2AA 1Q10A 3TEZA 2RDGA 1PZNA 3ZJUA 3PHWB 5L9XA 4QW8A 2KVCA 4DSIA 1C76A 3RB0A 3ZNHB 1WCLA 2EKIA 2DQNB 5ALWA 3KFUF 3TJPA 5KAIU 1TGZB 2L00B 2LM1A 2WF7A 3MFIA 3K9OB 4ZHPA 2HOQA 3PW2A 1X1MA 3RNAC 4KGTA 1EM7A 5DG8A 4DL6A 2R2QA 1VZ6A 2VIXA 4DQSA 1QSSA 2MAXA 4QZIA 2DPIA 1XNSA 3APCA 4FADA 4DL7A 1OQYA 1QZEA 5ALUA 5J2CA 1J7BA 3UF8A 4YXDB 3PPAA 2KKVA 3KTQA 3JPTA 1WM3A 2V0GA 5CP2A 2JQRB 2LGSA 5KG7A 5J0SA 2YQEA 3MP9A 4OJPA 4RU9A 5JRTA 3Q8PB 2BCUA 2PVOD 4RGMA 2UWQA 4RNMA 1M94A 1T5XD 1ZRNA 1KQQA 2PLPA 4FJYA 3VQIA 2FLNA 3X0WA 3Q8RB 4ICVA 9ICHA 3U26A 5LXIB 5EE1A 1F1HA 2Y5CA 3IG8A 2HI0A 5KT7A 2WDVB 5KHQA 2BYEA 1NYQA 1RQNA 1S0VA 5J8YA 3HJEA 4PJ0U 1H8CA 4A3PA 3MR3A 2GMIC 2O6VD 2K0PA 3O65B 5KFOA 1WXMA 1XEEA 1E90A 3PMLA 4C8MA 4ZRJA 2JZZA 3RJIA 5E6OA 3NS1A 2D5GA 3NVWA 4CF5A 1SL1A 1C4CA 7ICTA 4GN1A 4M00A 3TEWA 2FI1A 1IXRA 1WR1A 4NM2A 4Q43A 1E7PB 2OEHA 3GDXA 3G6YA 4IRKA 1VJKA 2CU1A 1SGHA 1SL0A 4NL9A 2GO7A 3SR6A 2ZIVB 3Q69A 5AM2A 5KFGA 5J17A 4HAIA 1WM2A 1V81A 1ZQJA 1YZ6A 5LLIA 4YTPB 2HBLA 2BQ3A 4W9KA 2ODGA 9ICGA 4KLLA 4FHKA 4RUCA 4P2HA 2INPE 2W8LA 3RB4A 2OJWA 2EQYA 3V7JA 2BR0A 4AS1A 1QH9A 2DBYA 1YQ3B 1SEBD 4CDGA 4DFDA 4GXIA 3DDCB 4ANVA 2SAKA 1E5WA 1XU4A 2DX5B 1UA0A 2KFZA 5HMMA 5HHIA 5GTHU 4YVZA 3MFHA 1RWSA 5KG2A 3AU5A 1HA5A 2OM6A 2INNE 2N9LA 5ALGA 5KL1B 2WLBA 3CSTA 4K1RB 4UBBA 1RQLA 4M9HA 1YIWA 9ICAA 4F93B 2KAJA 2VANA 5CHWA 4M01A 1SXEA 5E6NA 4RUAA 2BW2A 4YT0B 1UUPA 3ZUNA 2WAQC 1VJ5A 4IM3A 3U2SC 4AJWA 1ZKHA 2ZZPB 4ECVA 9ICBA 4XA5A 1I4RA 4GDLB 1E10A 5J2IA 1XLPA 2DHZA 3H40A 4FBTA 4XDDA 2XICA 2DWQA 3AE9B 4DLEA 4PZNA 1DOQA 3PW4A 1HEKA 1C4PA 1DXSA 5KFAA 1H4RA 4FZNA 3E0FA 1I4QA 8ICVA 4UATA 1ET6A 4Y2YA 5J2EA 1F9JA 1JXLA 3JPNA 8ICHA 2LVQA 4K4IA 4P4OA 2KNBA 4BOZB 2N1RA 4DQOC 2GBNA 2ZNVC 1S1QB 2KLCA 4Q2JA 4R3DA 1K5OA 1OXJA 3T5KA 2AGQA 2PIAA 4M47A 3WK9A 4BVUC 3H9DA 3B9JA 3LWLA 1GPXA 3UXNA 2Q5WD 1ROEA 1WJ4A 5L83A 3UQBA 1O08A 5E6JA 2G1EA 4NY0A 4KLSA 5TSSA 4WWOA 2MLBA 4MACA 3KHGA 5L1LA 3P4QB 2IPKD 2XC9A 2FNJB 3EFCA 5ALFA 2BCSA 5ALXA 2CHWA 3DHHC 1V1PA 3TAPA 4DQIA 3VH3B 3WAPA 4UB5A 1WY8A 2AH5A 2W9CA 4XYCA 1MFWA 4GLSC 2XVTA 2IO0B 2D10A 4N59A 5CTRC 2JYTA 5HP4A 4P7IA 4F50A 3PRPB 4QZEA 4EOYA 4HJGE 2MA9B 2V4IB 1ZQNA 2JF5A 2V4LA 5ALOA 2PFQA 1N5XA 1P7FA 4PH5A 3GB1A 4CF4A 2KJHB 1CUKA 2ZJDA 3SFEB 3QU2A 2WX0A 3KHLA 3GILA 4QWAA 2ASLA 7ICLA 3H7SA 4BBNC 1WWUA 4F5PA 2KJRA 4QAYA 3ZXRA 3A33B 2K9XA 2JRIB 2AXTU 4OZCA 2Y9UA 2QB0A 2RPVA 3PLUA 4FA6A 1UZXB 2WHEA 3EPIA 4HROA 4YWGG 5BO4B 4DFMA 4B0EA 1NDDA 2O6VB 2QARB 2DYOA 3SD7A 2I9GA 4Q8EA 1TJEA 1K1SA 1N63A 1XWLA 3A4RA 1WGDA 4JQWC 4F92B 2K4HA 1L6UA 4I2FA 3DBHB 3OJ4B 4BJQA 2KHWB 5ALKA 3H7PA 2ZUBA 4JWMA 1XLQA 3NS8A 5AKKA 2J6TA 2NMQA 1ZXIA 4HPLB 3IT4B 4B9TA 1TZOA 2JRZA 7ICUA 2JEGA 1L7NA 7ICOA 4W9EA 2WWZA 4TUQA 2PTLA 3GV7B 3Q8AA 4GIBA 3EECA 3JSVB 3R7RA 3ZXVA 5F9LA 4ZH4A 4Q44A 1ZQDA 2IO2B 1CI4A 5J0OA 2ZVNA 3H0RB 4HPPA 2BF8B 4A90A 1ZP0B 3BS5A 1ZGUB 3AB5A 2M0NA 4DF8A 4DSJA 4MGYE 5D2MB 1ZQXA 1WFYA 5EOZA 4QZGA 2WAQF 2E8OA 2F76X 2ALZA 3RRGA 4M9NA 4LNIA 2L05A 4M0WB 4M2YA 1OGWA 2BKEA 4DHZE 3AV8A 3PW0A 4DOAA 4A8XC 4LJOB 3WK4A 2K6DB 2C5LC 1QOBA 2K5PA 2UU7A 5AK4A 4JX1C 4IL6U 4BOSC 1GB1A 1RG6A 4RT3A 1FO4A 8ICSA 1SXTA 5AM4A 3UQ0A 5CRXA 1PK1B 1I4HA 2VJ5A 2MP2A 4PZOA 2CHXA 3N7SC 2K1FA 1K51A 2JEFA 4BXOA 2DZKA 3H4DA 1RRBA 2KDBA 3NUHB 3M1YA 3NZSA 2FDRA 3SV3A 7ICNA 3LJ3A 1Z2MA 2HE7A 5B5EU 3RULA 3LB8C 2REXA 3L5KA 5AM1A 1KDHA 3DVNU 4J9SA 8ICTA 2A4ZA 4RNAA 4Y2QA 2AX5A 3BDPA 4KKJA 4XQ8A 3MHZA 4IKGA 1A0PA 2YEPF 2DZMA 2I5HA 3G6VA 1D8BA 4DHJD 4ELVA 3KD3A 2JXJA 5DQGA 1BPZA 2BTEA 1KLGD 3FYHA 4HCNB 2FMQA 1DK3A 1U45A 1WGKA 3QU5A 1LV5A 4B9LA 4KLMA 1UT5A 2VZKB 4AQ7A 3E58A 4Z6CA 1L7PA 4AP4C 4WJOA 1ZDXA 2F77X 3M9OB 1KOTA 2LXCA 2V3PA 4D2KA 2GBRA 4II3B 3PRZA 2V3NA 2KFNA 1SE4A 3B2GA 2LRUA 3IG3A 4RQ5A 2CKHB 5D3IB 4GDLA 4F3OA 4RNOA 1VLBA 2ZVOA 1BNOA 3R7QA 4RMAA 3Q8LA 2LVOA 2KC1A 4OJLA 1T0SC 4EZ9A 4N9F4 4B0MA 2NV3A 5JHBA 2EAMA 2GLEA 3ZYYX 4BBNF 3RRHA 2EAPA 4NJ6A 1CMXB 1ZRMA 3TI0A 3KWLA 2A5UA 4KMOB 1QLBB 3B0YA 3EUB2 3C29A 3UINB 5AI6A 5DG7A 8ICKA 3P1MA 2KOXA 4HYKA 1ZQCA 1RLFA 1L0YB 2XIDA 2NR2A 2ZCBA 1ECWA 2KSOA 3AE5B 3AEGB 1F52A 1DGSA 5JTIA 2ASJA 3AU2A 1ZQSA 3RYTA 4AWJA 3BZDB 2XO7A 2LVPA 5HFYA 2BCQA 3FDSA 2G07A 3RB6A 5K4LA 2AJQA 4XC2A 3H8SA 1EWCA 1YX5B 5CHVC 3RR7A 2KC2A 3BY4B 4UQGA 4I2GA 4B6WA 3A0HU 1A70A 1KLUD 3DBSA 2G4DB 3WK8A 1YJJA 4RPYA 2GOWA 9ICLA 4PYUA 1L6NA 9ICVA 2QLTA 4IR9A 2KDIA 3SYZA 5KG5A 2W9BA 3RBEA 2DENB 5TISU 4YP3A 2DKXA 3LYSA 1KM7A 3CP8A 5J0QA 4KZCA 4PGYA 2PFPA 4DSKA 8ICAA 1JWBD 5DGAA 3V6EB 2W7OA 1TK8A 9ICNA 2BPSA 1WUDA 2JZBB 2M1MA 3QJZA 5KFSA 4RQMA 4IM0A 2CRXA 1WXVA 2BB6A 1Z1VA 2DF4B 4TQ0A 4ECXA 2BGFA 3PR4A 3AEEB 1MJDA 4JLCA 2HSZA 2GBJA 4O0IA 2JH1A 5AI4A 3KYCD 4LZGA 2G09A 5IO9A 1RFKA 1ZQYA 3C8YA 4ARCA 2ZJ8A 3JPOA 3Q3JA 3SENA 4RQNA 2ATLA 5ALTA 4M9LA 1UWXA 1T3NA 1WI0A 1E6EB 2IMWP 1UF0A 4DSFA 2WS3B 1KFYB 4DL4A 1NZPA 4LDTD 4TUUA 4LK0M 3VVWB 2HW3A 2QARA 1MSWD 5HHDG 3BQ0A 4F4WA 1UELA 4TV3A 4O3NA 4KLGA 3F2BA 1R7SA 4IQUA 4B9KA 4MM3A 4O5KA 4DO9A 3G6XA 8ICRA 2HBJA 3PO4A 3C19A 5B66U 3BZCA 3VFKA 3ZJTA 3U7DA 4ZDVA 4KX5A 3J9CA 4BUGA 1HTQA 2VH1A 3H0LB 2ISPA 2ACZB 2WXJA 1ZQHA 2FCNA 3NZUA 1JQ4A 3GV8B 4CCHA 4KX3A 4ED0A 2ZIXB 3M8SA 2D6FC 2F44A 5AKYA 1XO1A 2HTHA 2G5IB 2Y9TA 4O9MA 2HJ8A 1S5LU 3PRMB 4I27A 2HHQA 2W55A 1BPYA 3F5AA 2W7PA 4MFAA 1C4AA 4OVUA 3N1ZC 1XO0A 4KLFA 1T0RC 3SEBA 1FMAD 1Z3EB 5AKJA 2W04A 3AQEA 2K8CA 1JXEA 4QIWC 2ZG6A 1F44A 2WXOA 3U4EG 4E3CA 2BPGA 4YSXB 4NZLB 2KXJA 4DXAB 2OHFA 2F1JA 4YR2A 9ICTA 5J8YC 2K3UA 1ZQVA 3EHVA 4G11A 1KKXA 2Z0DB 1JI7A 4UW9A 2PKOA 2IOHA 4BKTA 2LXAA 2E5SA 4K3CA 1QTMA 3JYUA 1Y8RC 4K4HA 5J2GA 2YY6A 2VA3A 5G5GA 2ZJ5A 3PT2B 4C4VA 2MBOA 4A6QA 5KFCA 3GIKA 4KLDA 3SMVA 2K4IA 3V7LA 3DBHI 3RMKC 1M6YA 1F0ZA 7ICKA 1KBUA 2KTFA 1VZ7A 4HVBA 4I28A 1GNUA 5ALZA 2BBCA 1PGAA 2KX3A 1NJWA 1J2NA 1SKWA 4W9GA 3I57A 2FCQA 4I2HA 4O3RA 1KLNA 2V4QA 2PEAA 1L4ZB 2KKCA 3H7IA 2KQ7A 4KSLC 3OAWA 4UAVA 3D2SA 4RPZA 4JK1A 2EANA 3NRZA 2FPMA 2BYFA 2DAJA 2NS5A 2HDEA 4I2EA 2W3RA 4OJ5A 4FS2A 3Q14C 2K8HA 1JN3A 3Q2AC 4J9PA 3PMNA 5BPCA 1NJXA 1COKA 1T0YA 4RCOA 1LKYB 3EWAA 2WU5B 1C3TA 2R8HA 3RJKA 3I3TB 4P16A 5IKCM 2E8NA 2KTRB 7ICGA 1XSPA 5H92C 2HOIA 3PZDA 3PSIA 2HVHA 1ZDVA 2O2VA 2HBKA 5J0WA 3AULA 3HUIA 5KFDA 1TS5A 5JZEB 3PY8A 1PVQA 4KIKA 3VTWA 1NI2A 4LCDE 5HHHA 2WXQA 5ALPA 1WX7A 2AL3A 1AWDA 2ONQA 4EE2A 2CN1A 2K8BB 2FLPA 1IUEA 1WXQA 3UPQA 1H38A 2F8LA 4K4GA 1YJIA 2BT6A 2LRWA 4UASA 2HHUA 1SJHD 2W54A 4GXBA 3SD5A 3AECB 4RGTA 3KYDD 1YJ1A 1ZQ1C 5ALJA 4C7YA 3ZW3A 5L1JA 1HUOA 1QILA 3QE9Y 3EW9A 1WGYA 2KKPA 4RQ3A 1L8LA 3LK9A 2WTFA 2HHWA 4DL5A 2LYAA 3V6JA 3P2BA 3BQ7A 3GFKB 2RDJA 4KKIA 3SZ2A 1R4MB 2QJLA 1PK3A 3FILB 5KT2A 9ICQA 4I6PA 1VR9A 2KMMA 4BX9C 2W43A 4O5CA 1DYQA 2M17A 2DPJA 4WJ3B 4G0NB 2LYHA 3B08A 4I29A 4DXGA 2MH7A 2G5HB 2JEJA 1YN4A 3I63C 4EX6A 3ZD8A 1ZQBA 3RZFA 1FD6A 2FIDA 3HPOA 1ZJNA 4QZBA 1NKBA 5T14A 4IC9A 3ONSA 4TUSA 3UMCA 1V2YA 3DCGA 5CX3A 4Q45A 5CEHA 4M6WA 2I1JA 3ONNA 3PGEA 4NAWB 3V61A 4EZJA 4A9AA 4DWIA 1FXAA 3T79A 1KJTA 4EFOA 5J18A 2KK0A 3RNBC 1X9WA 2VJ4A 5KFPA 3RJGA 2WXRA 2EMSA 3GP7A 1RYSA 2JZBA 4FN2A 1J0GA 2MUTB 2QSDA 2YMQA 2HTME 4ZYSA 1PGBA 3HVDA 4IG7B 5D6JB 4FHJA 8ICLA 4QIWF 2HBMA 4KVGB 2KZ3A 3L13A 5JU5A 2WXPA 1BPEA 5KFZA 3HT3A 3NZ3A 1J7AA 5KFNA 1R4NB 2DZIA 3DEEA 3M63B 1WZ3A 2IOFK 1DOIA 4MHVA 2UVRA 2D3GA 1BGXT 4J9LA 1CRXA 3H6NA 4GXJA 4HWIB 2LMRA 4XDCA 4FS1A 2MHJA 1QCKA 1QT9A 3Q8KA 5J0PA 5J29A 1L2NA 4GDKA 4XZ4A 2EKEC 1LXDA 4GC7A 3EA6A 5J2HA 4WQMA 3UIPB 3JPSA 1N48A 3ZQ4A 1NK8A 1SE9A 2HHXA 2MSNA 2E3TA 1IM4A 4EZKA 4RF1A 4P0QA 2JYEA 4U6PA 8ICPA 1L7YA 3APDA 3IAS1 5ALEA 1JWSD 4KGSA 4R8UA 2N7JA 3KHHA 3FAHA 5BOLA 4I2BA 2IGDA 3U7ZA 1J8CA 1ET9A 4KGRA 1ACCA 1AW7A 4DBGA 3QU7A 2G06A 4RM8A 1X9MA 3ENEA 2V3SA 3KUCB 4EZLA 5D7GA 1N60A 4AOFA 2CJOA 1RM6C 3QEAZ 2Q0ZX 3Q8EA 4OW0A 3K4GA 2KX0A 1STEA 1PUZA 2A1JB 1TTNA 2MJEA 3Q8FA 2H3VA 3L16A 4DL2A 1UHUA 2N0SB 1NNLA 2HHTA 3GZNI 3PSTA 2J6SA 2BQQA 2XK5A 3QYPA 1P3QU 4JUZA 1GC6A 3L08A 5JHAA 5AUKA 1L6VA 5EE0A 4IQTA 4OZAA 1D8YA 3N97B 2E6XA 4IS7A 2B21A 5IAAC 3H0MB 3T8MA 3BK1A 1ENFA 1YD8U 1WGGA 3ISDA 1N2XA 1E8ZA 1SF0A 2WB1C 1ZD5A 3IFWB 4XWWA 2G0AA 3C1YA 5TZVA 2MRLA 4WQOB 5KAFU 2L76A 1QLNA 2JWUA 1S76D 4ELTA 1URJA 1PUTA 2KHQA 8ICIA 1V1OA 1EWYC 2XI9A 1FNUA 1YMHE 3BZKA 3OTQA 2DKZA 2IY1B 3W9CB 5BMIA 4XGAB 2KWDA 4NNJB 1GAQB 1NK7A 3MDAA 3AUOA 4PS3A 1KRPA 2WHIA 3F2DA 1X6JA 2KYWA 2ZIUB 1A76A 1B1ZA 4HCPB 1ZQRA 2KMCA 5J2RA 5CA7A 2KFKB 4BDPA 5CHGA 1L4DB 5KHOA 5KFWA 2J52A 4EELA 1UGMA 3E9SA 4W9FA 2Y1JA 3A1QA 4ASWC 2NRXA 2WXLA 1FNWA 3F53A 1WX9A 2ZIWA 3APFA 2KTQA 5C1ZA 3M9MB 1ZQZA 1I7HA 4S0RA 4DQRA 2KIWA 2KTRA 3IRUA 4MH8A 2CPRA 5KG6A 2VKQA 3F5EA 2R2OA 1ESFA 1LQBA 1MPEA 4ED1A 3ZIMA 2KDMA 1XXGA 3DVGX 2RRDA 2PE9A 1K52A 3NRWA 2PE6B 4JGHB 3TSSA 4FO6A 4A3OA 1PQSA 4GMVA 3T3FA 1TT5B 4URKA 3WKBA 2MBEA 4I2IA 4M04A 2IGHA 2GBMA 3GV5B 2INCC 1IV8A 1TYGB 4KZ0A 1P1AA 4LVSA 3KH0A 3WANA 4ELUA 1PVPA 1UA1A 4HJKA 3C2MA 3M6KA 3WCQA 5ALNA 5CHFA 3PZ8A 1P9DU 4NLNA 1XSNA 4UB8U 4E71A 4IQWA 2ZNVB 2L5YA 7ICMA 4IWOA 3NVYA 5AI5A 4ED8A 3QXGA 3WKCA 5F9NA 3O0FA 1JMSA 4EBEA 2DNFA 3T3NA 5DLFA 3UIOB 4RQ6A 3O13A 3NHEB 3RI7C 1N6ZA 5TR5A 2HCFA 4UAYA 9ICJA 2F1IA 2I1QA 1WSPA 5EE3A 5LXHA 3RT3B 2IBIB 2YEPB 1JUDA 4F71A 2HHSA 2BS4B 2A19A 8ICOA 3AQFA 3AE8B 1VDVA 3CMMB 5ALLA 2KICA 2TSSA 4F5OA 5AKZA 1N62A 2H88B 1QQ5A 2EMTA 3H4BA 2BPCA 4QWCA 3UGBB 1VZ8A 1O03A 4BKSA 1XCTL 3H8WA 3W1YA 2W3SA 2IA6A 3BS7A 3C1ZA 4EBDA 4L1BA 2LMCA 4JMUA 1VCBA 3N1YC 5KTQA 5DGBA 1Q46A 1AQ6A 3KKAC 4PHPA 3EZ5A 2LGDA 2KZRA 3L17A 2AU0A 4YMMA 1KEJA 4RQ4A 2WF5A 5AI0A 3HW8A 2XY7A 3DWMA 2DUYA 3DDHA 1NJYA 4P0PA 4DFKA 2XCPA 3VC8A 4F5QA 3DBRB 3KLSX 4MJSB 1EO6A 2M56B 3GU3A 2D3BA 2G08A 4W9LA 1FCLA 1TS4A 5AZHA 2LGIA 4MFFA 5FR3A 3NJTA 5AHXA 4EEWA 2LZ6A 2ZEQA 4KLQA 1QQ6A 4QZ8A 3OGUA 2RLTA 3LVWA 3RTVA 3ZGZA 1MVKA 3ZDDA 1HQRD 4MGIE 1OEYA 1SGGA 2E1FA 2BPFA 4B9NA 4C4SA 1HIWA 1A6SA 2AWTA 4DFPA 9ICCA 2WB1F 4KLJA 2NVUI 5ALSA 3W5VB 2XGPA 2RR9A 2DYMA 2C9WB 3OJ3A 4MELA 3JPPA 4RGNA 3VUWA 1WWTA 4DL3A 3ZRCA 1TK0A 4Y2XA 1Z1BA 3DVNV 3NOBA 1TAQA 2OCEA 4LNOA 1QSLA 2YVCA 3N1XC 4X57B 2FUHB 3PVLA 5DCNA 9ICOA 3DBLB 3CYMA 1C79A 4FXCA 1IBXB 1ZE3D 8ICXA 4YSZB 4ECWA 1NK5A 3QCAA 3AE7B 3M9NB 3WA0A 1NKCA 3CW2C 2DYBA 1MQ3A 4G50A 4MF2A 3ZDCA 1UH6A 2NPTB 4OHJA 1TS3A 2KOBA 4JV0A 3GZFA 3MC8A 2QC8A 1WRIA 2DZJA 4PGQA 1TY0A 1WXSA 1V97A 5AK6A 4Y2SA 4ZRQA 4KLIA 2KN4A 1F5SA 2M8SA 5AKEA 3AXCA 2ES6A 3VRBB 1IYFA 3GIJA 1WMHB 3KVFB 5ALIA 2F1HA 1I4XA 1KFTA 2QIEB 2VA8A 1D5MC 4ECSA 1P7DA 5KFTA 4IOIE 4K7WA 4BZAA 3U52E 1RAXA 2I6XA 1RYRA 2I38A 2FPLA 3AEAB 3RJEA 3N9YC 4WAAA 1Z5SB 2RD0A 3N30A 5DB8A 1BPXA 1X9SA 4MSQB 1WXAA 1JIHA 1L7OA 3PNCA 5FK9C 4OCZA 3ISBA 2KDFB 4B9SA 5L1MA 3MR6A 2X8XX 5JUMA 7ICJA 3QUTA 1MN8A 3TADA 3VH4B 1SJED 2JH7A 2ZIVA 4IRCA 2WP9B 4NLGA 3WK7A 3P4PB 3P4SB 4PS8A 2WXGA 2WXNA 2QB1A 3D2NA 3UI3A 1V80A 5DBAA 3ALBA 5IN7A 1RXWA 3AU4A 3J81j 3M95A 2KEYA 5DPWA 3BQTA 2L7RA 1SXDA 1TAUA 5KFXA 5KFHA 1UBIA 3UMGA 3RJJA 1HZ6A 5G2NA 3NVVA 3PO5A 1TBEA 3AE2B 3AI5A 3R2TA 4P1BC 4WURA 3ZJVA 2HD5B 9ICPA 1JW9D 4GLXA 4EEYA 4CRXA 5BMHA 5EDSA 3RNFC 4QZFA 3ZNID 2C60A 2N7EA 2Q4TA 4CGZA 1GOZA 2KIVA 1BUIC 1X66A 4YMOA 1S10A 3WAMA 1V38A 1HZ5A 3KBBA 1K50A 3QHTA 3QAQA 4YMNA 1A77A 1EXNA 3L54A 2OH2A 5E79U 3HVZA 4NQLB 5JXVA 3IVFA 3JPQA 1YN3A 4LJPB 1WZ0A 3URYA 5IIOA 1U9LA 2NO5A 3VDZA 5C23A 3WALA 2GWSA 5DB6A 4KTQA 2N9EB 2JGAA 2L83A 4ZRIA 1SE2A 3N4MB 2BKRB 3QU9A 4P1CC 4WWPA 4DHJB 2ZJAA 4O3MA 4YXJA 4IWPA 1C78A 1NOMA 2JXTA 1UD7A 5ALDA 4II2B 4NAMA 2PJHA 1DK2A 3KWVA 3V05A 4R66A 1E8YA 1V5OA 4DXFA 5JH5C 1ZQWA 2C22A 4C8LA 3FM9A 1D5XC 1S0NA 1YNTE 2MBHA 3DHGC 3Q8BA 1B4FA 3PX4A 4JV2A 1GG3A 3A9KB 3PW7A 1XD3B 1AYFA 4ANUA 7ICHA 1UPHA 1CQVA 3DWGC 4HDQA 4KX6B 5AKLA 3RH5A 2YTUA 1FXTB 2K22A 1QF6A 1TAMA 2O6KA 4IWQA 4PS7A 1NBFC 3TARA 3AE4B 4QZ9A 2F2AB 3DV9A 3GQCA 4P6VF 2OXOA 3TKAA 2C2DA 1PFDA 1TY2A 3SAHA 3T9LA 3I1YA 3C21A 3KKAA 2CR5A 4FJVB 2X38A 5KFKA 4F7ZA 2JXXA 1N61A 2RDIA 1TKGA 5AZFA 4O5EA 2Z8LA 1MQ2A 2BVCA 3P63A 4BFRA 2UVUA 4US9A 9ICFA 5KFMA 4TQRA 1CZPA 1KSPA 4PT5A 3QUQA 3QZ8A 1BPBA 3NVZA 2XN9C 4KN7A 5AI9A 1IG6A 4JWNA 5HR6A 2N9PC 5J0TA 1T7PA 4NLCA 4DQPA 4YR3A 3RJFA 2RQ5A 3OG5A 4Z6DA 3A4SC 2LGXA 3W2DA 3I28A 4MJSA 3ETLA 2H3IA 1UWMA 4U7CA 3P4RB 3V6KA 1OEYJ 2L1AA 2HJ1A 4NJCA 1ZJMA 1Z00B 4M8NA 1JROA 3M8RA 1XS9D 1ZQEA 1WF9A 2AGPA 3AE1B 2KFJA 4GB9A 1NJZA 2F8KA 4RFBA 1UGJA 2D07B 2LWPA 3TANA 3KUZA 2NTTA 1B43A 1TE2A 1HEZE 3QZ7A 1V9JA 3IT6B 4WJQA 4KLHA 2DFLA 2ZXHA 2FCMA 2YMLA 4LTUA 4MGKE 2IZVB 2WXMA 2FCSA 4YFKA 1V5TA 2AYOB 3V6CB 2WNMA 4GU2A 3JSVA 2YX8A 3ZTDA 4UARA 4ED6A 1I42A 3MC1A 4UBCA 2BHNA 1NK6A 1WWVA 5CWRA 3QQ8B 1Q0WB 4OO1J 4NLKA 4RQ1A 3N32A 4LDTB 4EEKA 1CK1A 2WDTB 1EUVB 2BYVE 3PV8A 1WCNA 4FZLA 3WKDA 1E7UA 3WIMA 3ZLZA 2KG5A 2GOLA 4M0WA 1X40A 2YN4A 1IGDA 1JRUA 2R61A 3LWMA 1RYJA 4LZDA 1E8XA 3QARA 3CWIA 1GJZA 1ZD4A 3VUXA 1PK1A 1UT8A 3C28A 1L3UA 3EFUA 4EYIB 3I5JC 4RPXA 5AZGA 4A55A 5ALMA 5DKWA 2JZ3B 1T0QC 3M3JA 3AL0B 4HLEA 2A1AA 3ZO5B 4X5VA 4C00A 2BS2B 2Y5BB 1ZQUA 2K39A 2R8IA 1DOYA 2GH1A 8ICCA 2XBBC 4KLUA 5J0XA 5AICA 1NKEA 3PTFC 3C2LA 3T3OA 1Q5WB 3MGVA 4QNLA 2IDYA 1UCVA 5HKHA 3MBYA 1KL9A 4MEXA 1LFDA 4XRHA 4Q8FA 5BYQA 3MJ5A 5AK3A 2NYVA 2AQ3B 3E56A 1KTKA 1WIAA 1KH0A 2NRTA 1KFDA 5KFEA 1SBBB 3SFDB 3ZNGC 2V1YA 1HTOA 4OVZA 4C8NA 1Y88A 8ICEA 1IPGA 2F3NA 1ZQQA 2KT7A 4DK5A 3TEYA 1KW4A 4DFJA 1L5UA 5C0YA 2G45B 2JSVX 3VUYA 2N9XA 3H8HA 1I35A 4R65A 1T6BX 1WE6A 4K7UA 4QWBA 1ZQAA 3MABA 3MR5A 5C5JA 3Q8MA 1MHXA 4NQKE 4KDLB 5DLGA 2IO1B 5KG4A 2MJDA 1T8EA 4QZDA 5D49A 1B9RA 3WK5A 4Y2UA 4ECUA 2WQYB 2AEHA 4JWSC 2K4PA 2LBOA 4J6IA 3HM6X 5J0YA 2AL6A 4PL1A 2C7NB 2WYQA 3PSPA 2W9MA 5KNIA 3JW0X 5L95C 3CRXA 2RPQA 3V62A 1D6EC 1WJUA 2NCNA 3QK0A 3IHQB 5D94A 4EX7A 1NK4A 5KFBA 3V7KA 4O3SA 1WE7A 3MC0B 2WF8A 5IILA 5CJ7A 3H1UA 4E74A 4FBJB 2MWSB 3C5GA 3PO0A 2H89B 1KN5A 5ALRA 2KANA 1V86A 3MTNB 2IHNA 3ZVVA 3L0WB 3TACB 4TUPA 4CF3A 3UM9A 4RZRA 1ZQPA 1XCQL 2INDC 2LHEA 4YN4A 3C23A 3EPGA 1V6EA 2J7QB 3A9KA 2JY6A 2R8GA 2OWOA 2N4FA 4MF8A 3ML9A 2GRIA 5IP4D 5LNK1 1Q3UA 2K60A 3EC8A 2DAFA 5AEKB 2LUEA 1E0ZA 1ZOLA 2K25A 4YL8A 2PXIA 5AUIA 4PHDA 3U8ZA 2K4EA 2KE7A 2AQ4A 3ZD9A 1ZQFA 4BKSD 2P6UA 4A8EA 1WJ6A 2MQJA 4YSYB 3E2EA 2R8KA 3PSEB 2WXIA 5H8YE 1F2RI 2Z59B 3ZTCA 2G9HD 3KHRA 4GGQA 4YQWA 3RJHA 4EKUA 3SQIA 1E9MA 2KZMA 5EWEA 2ON8A 3A0BU 4WJPA 2JT4B 8ICZA 1EU3A 2KD1A 4E0DA 1PYWD 4XWTA 3F2CA 2ASQA 3DVGY 4DHZB 4DEZA 1JWUD 1F77A 1C77A 1GC7A 2WXHA 4W9DA 2AGOA 2EELA 2WXKA 2RDHA 3V60A 5J2FA 3N7PD 1S3SG 3BYYB 4W9HA 1V1PB 1KTQA 2RMMA 2FMSA 3C0RB 4OJOA 2BCVA 4YG2A 4ECRA 3ZDEA 1RXVA 2MRPA 2OYYA 2W9CB 1JCKB 3MR2A 2KDEB 2N1VA 3R8BA 4JV1A 4PK1A 4RT2A 2D11A 3KW5B 1FEZA 5IIJA 5KFYA 4GSWA 5KFQA 4I6LB 3IG5A 2JR5A 5KT3A 2DLBA 4MFCA 2JUOA 2CU3A 2YMPA 4N58A 2KN5A 3PVXA 8ICMA 2NRZA 2ZW1A 3KUDB 3H8JA 4RQ2A 3OLMD 4ICAA 2KVSA 1Z00A 2YB4A 4QZAA 2QMTA 1LB2B 7ICQA 2NBWB 4ARIA 3WK6A 1FCCC 3SU8X 1SE3A 2G4SA 4KSKC 4AP9A 1OQRA 1L3SA 2FAZA 2HDOA 3ABVB 3AEFB 2QB0B 3TFRA 1BNPA 2JHDA 4NLBA 2PMVA 1XSLA 1GUAB 4R63A 5KFFA 4GXKA 3DPDA 2HOFA 4ICUA 2V4RA 3T5JA 2MSED 2BGWA 3HILA 1JALA 2H3ZA 4C0ZA 5KT5A 3JPRA 2JWZA 2C2EA 4KITB 2OOBB 2RDBC 2RP5A 4LNFA 2AHOB 2ZIXA 1DOXA 4EZ6A 3LDAA 5D3DA 3H7PB 2B0CA 5MPOA 2GB1A 5EWGA 4WWMA 2MU2A 4KDIC 2KP7A 1C9FA 3TCAA 1U4AA 2ZXIA 2Y5PA 3M62B 2BCRA 3ZNZB 2IBKA 1WJNA 5DG9A 3DQVA 3TMPB 4LNNA 4NLZA 5IIKA 2KHVA 2M4NA 1ZOYB 4CHKA 2D3DA 1NEKB 1T3QA 3AEDB 3ZRFA 5D46A 1YX6B 2CHZA 2L0FA 4TKNA 4FLHA 3EYZA 2HHVA 9ICRA 2FE9A 3PR5B 2Z0EB 2H3QA 3S2AA 3VTUA 4C80A 4YCXA 2XY6A 3QEBZ 5HR7A 7ICVA 3BS5B 4MT5A 3RAXA 4BWJA 2LKYA 2WDRB 3BINA 5BYRA 2J6UA 1FXIA 3S6JA 9ICWA 2FPKA 3C2KA 1RDFA 4F4ZA 5L1IA 4ZOHC 4B6JA 4C4RA 4IRDA 4TMAB 1U48A 4ITKA 1KFSA 4DDID 1VRAB 1YT3A 4M9JA 4US8A 1ZD3A 5DBCA 3CIRB 5CB1A 2M0XA 2LI5A 4FJZA 2MP2B 2IGGA 3HIZA 2EZXA 3L4PA 3T5LA 4RQ7A 4DF4A 1OW5A 3RN9C 2W9NA 4G9BA 5ALYA 1MHHE 2XGQA 2B6GA 4LJXA 4BXOB 3TADC 4MSMB 3VTVA 1Z4NA 4Y2VA 4RQ0A 1S0OA 7ICRA 4C8KA 3HWTA 1MA7A 1XLNA 7ICIA 2HMXA 2L0TA 1TV9A 4F72A 4LNKA 2KLGA 4F5NA 4F1SA 1MI0A 1QOAA 4AYBC 1E8WA 5HG2A 1YQBA 3K1ZA 8ICBA 4J9QA 4O3OA 9ICEA 2MX2A 1LKYA 2V9WA 4L23A 3SAGA 5AKHA 2H3FA 5HNKA 3VR9B 1Q3VA 4HDOA 2C7MB 4I2DA 5AKGA 5KL8B 4BGDA 3K9PB 3TUOA 5DB7A 3IXSA 1OFFA 1XF5L 1XT9B 1LO5D 4ZHOA 3M6ZA 1TZ1A 4GC6A 3VXWA 4ECYA 1LM8B 1QSYA 3TEXA 2K8BA 5BOMA 2YLMA 3IBEA 2KVRA 4UDUC 1J19A 5DQHA 5KT4A 4R64A 3N20C 4OD0A 3FKYA 1ZETA 1GO3F 3PZ7A 5DDYA 2D3AA 2ISOA 1M4VA 5DBBA 1XO3A 3GIMA 5IINA 3ECIA 4CYEA 2ZPYA 2XY5A 1SV0A 3BWUD 4HRSA 4WAFA 5KFJA 1P98A 1FRRA 2SEBD 1NVID 3CSFA 2GBKA 3IV6A 5G55A 5AM0A 4O3QA 1B0XA 3FILA 2MEKA 3AMZA 4K81A 4PYZA 8ICYA 2J4XA 8ICWA 3RNEC 4J9RA 2KNJA 4DLGA 2KZZA 2BDPA 2P6RA 3RB3A 4QWDA 1FFVA 1ZQMA 4F4KA 2RSUA 4L2YA 4AJYB 8ICUA 1IGCA 1UBQA 2AQ1B 2KSOB 3OWEB 1DGJA 3R9KA 4C56C 3JVZX 1FM0D 3BQ2A 4UB6U 3LYYA 1ZW7A 1ZQIA 2W9AA 4K3BA 4IW0A 3QU4A 2K89A 1Z19A 4ZRKA 4NAWA 3QX7A 2JRHA 3W1SA 4P4MA 3QNMA 2ZPNA 2CJNA 4NV0A 2ZW0A 2LHTA 1BT0A 3PS6A 2QDFA 4DQQA 1QOFA 4NY8A 3BVGA 3RR8A 2GLSA 2VRRB 1K8RB 1TIFA 2MUTA 2YB1A 4S17A 4UAUA 2WU2B 2QILA 4G3XB 2EAOA 3H8MA 2W9BB 9ICIA 1V8CA 4UAZA 5DDMA 1NENB 9ICKA 4RF0A 4IR1A 1PVRA 1U4BA 3AU6A 1WH3A 3AEVA 4HKZE 5DB9A 5E6PA 4ED2A 4RQ8A 5AIBA 5ALQA 4NM1A 1PDXA 3OPXA 4PHAA 1X42A 3A9JB 1R4MI 4MH0E 5H2FU
chains in the Genus database with same CATH topology
2W3RA 2K22A 2WDQB 1QF6A 4JE3B 2WDVB 1NYQA 3AE4B 5HI1A 4RCOA 4P6VF 2WU5B 4JPSA 4P16A 2K0PA 1PFDA 1TY2A 1XEEA 5H92C 1ZDVA 2JZPA 2X38A 3AE6B 1N61A 3NS1A 2D5GA 3HUIA 1TKGA 3NVWA 1C4CA 1TS5A 2Z8LA 3P63A 3TEWA 2WXQA 2AQ2B 4US9A 1PGXA 4EE2A 1AWDA 2ONQA 1IUEA 1E7PB 1K53A 1WXQA 1CZPA 4MM3B 2FUG1 4PT5A 2BT6A 1YJIA 1VJKA 1SJHD 2W54A 2XN9C 3NVZA 3SR6A 1GB4A 3AECB 4RGTA 3Q69A 1FIQA 4C7ZA 1TKYA 4C7YA 1L0XB 2FBWB 1QILA 3W2DA 4YTPB 1UWMA 3P4RB 2INPE 2L1AA 2JU6X 2KQ4X 4KKIA 3ETRA 4AS1A 2QJLA 4NJCA 3FILB 1TS2A 2DBYA 1VR9A 1YQ3B 1SEBD 1JROA 2KMMA 2SAKA 1DYQA 3AE1B 1RWSA 4RFBA 1HA5A 4DXGA 1UGJA 2ICIA 2INNE 2N9LA 2MH7A 2NTTA 1YN4A 2WLBA 1HEZE 4HEA1 3IT6B 1FD6A 2KAJA 4LTUA 2BW2A 1D5ZC 4YT0B 1UUPA 2WXMA 3U2SC 4NAWB 1I4RA 2OEDA 4A9AA 4GDLB 1E10A 1FXAA 3I9V1 1XLPA 4H2AA 2WNMA 4O1NA 4XDDA 1N5WA 3BVZA 2DWQA 2WXRA 3AE9B 3BK2A 3GP7A 2XNAC 1C4PA 2VZKD 1ZPSA 3MFGA 1I4QA 2QSDA 2HTME 1YQ4B 4ZYSA 1PGBA 1ET6A 1CK1A 3HVDA 3BIID 2BB5A 2WXPA 4DQOC 4N6EB 4R3DA 4Q2JA 3NZ3A 3AH7A 3BYTB 4M0WA 1J7AA 1IGDA 2IJ0A 2PIAA 2R61A 5EE9A 1DOIA 1RYJA 3RFZB 3B9JA 3CWIA 1JWAD 1GPXA 2Q5WD 1ROEA 4REZA 4XDCA 1JWMD 5E6JA 2G1EA 1OQQA 5TSSA 1XLOA 4A55A 4MACA 1QT9A 1F2RC 3P4QB 2IPKD 1JRPA 2M19A 1AN8A 2BS2B 3VRAB 3EA6A 4WQMA 2FE8A 1DOYA 5G5HA 1V1PA 3ZQ4A 3T3OA 2E3TA 4GLSC 4RF1A 2IDYA 2JYEA 4N59A 4TQ1A 3IAS1 2JYTA 1JWSD 2GI9A 1CJEA 3MJ5A 4KGSA 5BYQA 2N7JA 1J7CA 3FAHA 1KTKA 2AQ3B 2IGDA 3E56A 3U7ZA 4HJGE 1ET9A 1KH0A 2V4IB 4KGRA 1SBBB 4TSSA 1ACCA 1AW7A 1FRDA 3SFDB 1SB3C 1N5XA 1P7FA 2N9KA 4OVZA 3GB1A 3R2IA 3SFEB 3TEYA 5D7GA 1N60A 2JSVX 2CJOA 3H8HA 1RM6C 1T6BX 3Q8EA 4OW0A 2K9XA 3Q8CA 1MHXA 1QQRA 1STEA 3Q8FA 4OZCA 2MJEA 2BYTA 2RPVA 2MJDA 1B9RA 2N0SB 2WQYB 4YWGG 4HROA 4B0EA 5C3JB 4JWSC 4RGOS 2DYOA 5FKAC 5AUKA 1TJEA 1L6VA 5EE0A 1Y56A 2E6XA 1N63A 2Y3AA 4WH4A 3BK1A 1ENFA 1D6EC 1NYRA 1L6UA 1SF0A 3VR8B 4XWWA 3MC0B 1XLQA 2NMQA 1ZXIA 3IT4B 1TZOA 3PO0A 2JWUA 2H89B 1V1OA 1PUTA 4WIPA 1EWYC 1FNUA 1QKZA 1YMHE 5BMIA 2PTLA 3W9CB 3Q8AA 2KWDA 1GAQB 1XCQL 2LHEA 2KACA 1SIJA 1B1ZA 3EGRA 2I2YA 2GRIA 5LNK1 4A90A 1L4DB 1E0ZA 2J52A 1FEHA 1ZP0B 3AB5A 1ZUD2 3E9SA 2LUMA 4CQNA 2WXLA 5AUIA 1FNWA 1JMLA 1L0VB 2LFIA 4YSYB 1I7HA 1FFUA 3AV8A 5H8YE 2WXIA 4A8XC 1F2RI 1QOBA 2K5PA 2G9HD 5GXGB 4MH8A 4JX1C 4JWUC 1GB1A 1FO4A 1E9MA 1SXTA 2ON8A 1ESFA 1MPEA 1I4HA 2KDMA 1XXGA 1EU3A 2JX5A 4OZBA 4ZRPA 1K52A 3TSSA 1PYWD 1K51A 4XWTA 3V3XA 1JWUD 1F77A 1IBXA 1C77A 2BS3B 4GDKB 2WXHA 2EELA 2IGHA 2WXKA 2RDHA 1TYGB 3BVMA 3NUHB 3BYYB 1V1PB 2RMMA 1JCKB 3R8BA 3LB8C 3WCQA 1I4PA 3PZ8A 4RNAA 2AX5A 4KKJA 3NVYA 3MHZA 4IKGA 2DLBA 2YEPF 2CU3A 4N58A 3KQ4A 2WXFA 1TKEA 2ZW1A 4YTNB 3T3NA 2LHDA 2BTEA 2W82A 1KRHA 3O13A 1KLGD 2QMTA 4IDIA 4ARIA 1WGKA 1FCCC 3IAM1 2LEKA 2VZKB 1SE3A 1WSPA 5EE3A 4AQ7A 1OQRA 2YEPB 2BS4B 5I4DA 3AEFB 3ABVB 1ZDXA 3AE8B 1VDVA 1L5PA 2PMVA 2TSSA 2V3PA 4D2KA 1N62A 2H88B 2V3NA 1SE4A 3B2GA 1VZ8A 5D3IB 1XCTL 2M0AA 1D4BA 1VLBA 1NI3A 2W3SA 1JALA 1QOGA 4L1BA 2LMCA 1DOXA 4B0MA 5D3DA 3ZYYX 1EU4A 5MPOA 1KF6B 2GB1A 4WWMA 4RH6A 1C9FA 3KWLA 1ZXHA 1FNVA 1QLBB 3DWMA 3EUB2 3KLSX 2Y5PA 3P1MA 1L0YB 2M56B 1FCLA 1TS4A 4LLGM 3AE5B 2LGIA 4XE0A 2PVGC 1ZOYB 2QEJC 5FR3A 1NEKB 1T3QA 3AEDB 3AEGB 3ZGZA 3BZDB 1MVKA 1HQRD 5HFYA 4C80A 4MT5A 1BMLC 2WDRB 2J53A 5BYRA 4USAA 1EWCA 1FXIA 3RPFC 3W5VB 4RGNA 2DYMA 4ZOHC 1P7EA 4TMAB 4ITKA 1A70A 1KLUD 1VRAB 1WWTA 4US8A 1HXYD 1YJJA 3CIRB 2PW9A 1YN5A 4J3OD 2IGGA 3L4PA 1C79A 4FXCA 1IBXB 1MHHE 1JWBD 1ZE3D 2L52A 4YSZB 3AE7B 4HKQA 2NTSA 1BXTA 5T8IA 5BMGA 2MJ3A 1XLNA 5BYSA 2BB6A 4OHJA 1TS3A 4TQ0A 1MI0A 1QOAA 5HG2A 3AEEB 2B76B 1WRIA 1TY0A 1V97A 4ZRQA 1RFKA 2KN4A 3LXFA 4L23A 5C2TB 3C8YA 3VR9B 4ARCA 3VRBB 1I4XA 3TUOA 3AEBB 1UWXA 3IXSA 1E6EB 1OFFA 2QIEB 1XF5L 1D5MC 1LO5D 4ZHOA 2WS3B 1KFYB 4IOIE 3U52E 4LK0M 5HHDG 2I38A 3W5UB 3AEAB 3N9YC 1R7SA 3TEXA 1UNSA 3AN1A 4UDUC 5FK9C 1WYGA 2J42A 1SJED 2WP9B 3ZJTA 3P4PB 3B2FA 3P4SB 3PZ7A 2WXGA 2WXNA 1M4VA 1SSNA 1XO3A 3J9CA 3UI3A 2L32A 3P42A 1I4GA 3GS2A 2WXJA 3BWUD 3AM9A 2ACZB 4HRSA 1JQ4A 3FC4A 4WAFA 2LJIA 1FRRA 1HZ6A 2SEBD 1NVID 4YTMB 3AE3B 3NVVA 4WURA 3ZJVA 3AE2B 3FILA 3R2TA 2MEKA 3AMZA 2W55A 2J4XA 1JW9D 4L2YA 1FFVA 1C4AA 5BMHA 1IGCA 3SEBA 3HRDD 1FMAD 1Q10A 2RDGA 3TEZA 2AQ1B 3ZJUA 1GOZA 1BUIC 1C76A 3OWEB 1DGJA 4C56C 1FM0D 1HZ5A 1K50A 2EKIA 2WXOA 3U4EG 3LYYA 4YSXB 3HVZA 4NZLB 4ZHPA 5JXVA 1YN3A 2OHFA 2K3UA 3W1SA 4KGTA 3URYA 2CJNA 2PKOA 2ZW0A 1EM7A 1QOFA 1VZ6A 1SE2A 2L83A 3BVGA 5G5GA 4A6QA 1C78A 1J7BA 2JXTA 1F0ZA 2WU2B 2QILA 4YXDB 1VZ7A 4NAMA 2V0GA 1V8CA 3KWVA 1NENB 3V05A 2JQRB 3MP9A 2BBCA 4RF0A 4DXFA 1PGAA 4HKZE 3I57A 2PVOD 1D5XC 4RGMA 1YNTE 1T5XD 3Q8BA 1L4ZB 2PLPA 1PDXA 3VQIA 1AYFA 1CQVA 3DWGC 4KX6B 3NRZA 5EE1A 2Y5CA 2HDEA 4OZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W3R A;  2K22 A;  2WDQ B;  1QT9 A;  1QF6 A;  2BS3 B;  1XLN A;  2MJ3 A;  3P4Q B;  1JRP A;  2WDV B;  1NYQ A;  1TYG B;  3AE4 B;  2M19 A;  2BS2 B;  3VRA B;  1QOA A;  4WQM A;  4P6V F;  3AEE B;  2WU5 B;  2B76 B;  1DOY A;  5G5H A;  1WRI A;  1V97 A;  1PFD A;  1RFK A;  3LB8 C;  3LXF A;  5H92 C;  5C2T B;  3WCQ A;  2E3T A;  3VR9 B;  3VRB B;  3AE6 B;  1N61 A;  3NS1 A;  3HUI A;  4N59 A;  1TKG A;  3NVW A;  2AX5 A;  3AEB B;  3NVY A;  1CJE A;  1E6E B;  1OFF A;  2QIE B;  3P63 A;  2CU3 A;  1J7C A;  3FAH A;  4N58 A;  4ZHO A;  2WS3 B;  4US9 A;  1KFY B;  1TKE A;  4YTN B;  1AWD A;  1IUE A;  1E7P B;  1WXQ A;  3SFD B;  1CZP A;  1FRD A;  1KRH A;  3W5U B;  3AEA B;  2BT6 A;  1YJI A;  1SB3 C;  1N5X A;  1R7S A;  1VJK A;  2W54 A;  3AN1 A;  3NVZ A;  4IDI A;  3SFE B;  1WGK A;  3SR6 A;  3AEC B;  1FIQ A;  1WYG A;  2LEK A;  1N60 A;  5EE3 A;  4C7Z A;  1TKY A;  1OQR A;  4C7Y A;  2CJO A;  2BS4 B;  2FBW B;  2WP9 B;  3AEF B;  1RM6 C;  3ABV B;  3P4P B;  3AE8 B;  1VDV A;  3B2F A;  1L5P A;  3P4S B;  2K9X A;  4YTP B;  1UWM A;  1N62 A;  1XO3 A;  2H88 B;  2MJE A;  3P4R B;  2MJD A;  3B2G A;  1B9R A;  2N0S B;  1JQ4 A;  3AM9 A;  2ACZ B;  2WQY B;  4HRS A;  3FC4 A;  3ETR A;  4HRO A;  5C3J B;  1VLB A;  2QJL A;  1NI3 A;  4JWS C;  2W3S A;  1FRR A;  1JAL A;  2DBY A;  5AUK A;  1YQ3 B;  1NVI D;  1L6V A;  1TJE A;  1QOG A;  5EE0 A;  4YTM B;  1JRO A;  3NVV A;  3AE3 B;  2KMM A;  3AE2 B;  1DOX A;  1N63 A;  3AMZ A;  2W55 A;  3AE1 B;  1RWS A;  3ZYY X;  1JW9 D;  1KF6 B;  5MPO A;  1FFV A;  1NYR A;  1L6U A;  1SF0 A;  2MH7 A;  4WWM A;  3VR8 B;  3KWL A;  1QLB B;  2WLB A;  3DWM A;  3HRD D;  1FMA D;  3EUB 2;  1XLQ A;  2KAJ A;  1ZXI A;  4LTU A;  3P1M A;  3PO0 A;  4YT0 B;  2M56 B;  1DGJ A;  2H89 B;  1PUT A;  3AE5 B;  1FM0 D;  1EWY C;  2EKI A;  2PVG C;  3W9C B;  1ZOY B;  3HVZ A;  4A9A A;  1NEK B;  1T3Q A;  3AED B;  3AEG B;  4YSX B;  1FXA A;  2OHF A;  1XLP A;  4ZHP A;  1E10 A;  1GAQ B;  2CJN A;  1N5W A;  2PKO A;  1SIJ A;  2DWQ A;  3AE9 B;  4C80 A;  1QOF A;  2L83 A;  2WDR B;  1E0Z A;  4USA A;  5G5G A;  1FXI A;  1ZP0 B;  3RPF C;  3AB5 A;  1ZUD 2;  2HTM E;  3W5V B;  1YQ4 B;  4KX6 B;  4ZOH C;  5AUI A;  3BII D;  4ITK A;  1A70 A;  1WWT A;  1L0V B;  1J7B A;  1F0Z A;  4US8 A;  2WU2 B;  4N6E B;  4YXD B;  4YSY B;  1YJJ A;  1I7H A;  1FFU A;  1V8C A;  3AV8 A;  3CIR B;  5H8Y E;  3AH7 A;  1NEN B;  1J7A A;  2JQR B;  1QOB A;  2K5P A;  5GXG B;  2PIA A;  5EE9 A;  4JX1 C;  4JWU C;  3L4P A;  1FO4 A;  1DOI A;  1E9M A;  1RYJ A;  2PVO D;  3B9J A;  3CWI A;  4FXC A;  1JWA D;  2JX5 A;  1JWB D;  1PDX A;  1AYF A;  1GPX A;  2Q5W D;  1ROE A;  2L52 A;  3DWG C;  4YSZ B;  2G1E A;  1OQQ A;  3NRZ A;  5EE1 A;  3AE7 B;  2Y5C A;  1XLO A; 
#chains in the Genus database with same CATH topology
 5J0R A;  2WDQ B;  3SDL C;  4JE3 B;  3RZW C;  7ICP A;  5J0U A;  2LAS A;  3N7R C;  5AI8 A;  5HI1 A;  2D8C A;  2EZY A;  3SAF A;  2ZTD A;  5J2K A;  2JPH A;  2N1W A;  2EDU A;  4JPS A;  1Q8K A;  2KK8 A;  3RNG C;  2JV3 A;  4NXZ A;  2JZP A;  1QQ7 A;  3AE6 B;  5FP0 A;  4OJ6 A;  5J2J A;  4F91 B;  4WWN A;  2E8M A;  2NO4 A;  2AQ2 B;  4QZC A;  3X23 A;  7ICS A;  4ACO A;  1PGX A;  2K6Q A;  4Y2R A;  1K53 A;  1MG4 A;  4HPM B;  2FUG 1;  4MM3 B;  4AYB F;  3GII A;  1AAR A;  3QC8 B;  2XEW A;  2WX1 A;  5J2D A;  1GB4 A;  1FIQ A;  5KFV A;  4M0A A;  2C2R A;  4KLE A;  2MBB B;  4C7Z A;  1TKY A;  1L0X B;  5DPS A;  2FBW B;  5IIM A;  5KFL A;  3THV A;  2M9N A;  1OUQ A;  3MDC A;  2J0K A;  2KWV B;  1L3T A;  2R18 A;  3HM3 A;  4DCC A;  3NGD A;  5AKX A;  4DS5 A;  1R4N I;  4KMU A;  2JU6 X;  2A1J A;  2KV2 A;  3Q8Q B;  4B9M A;  2KQ4 X;  3RUI B;  4BAX A;  3ETR A;  2V9H A;  4J9K A;  1VD2 A;  1TS2 A;  3QA8 A;  1RFA A;  2KQS A;  4C4T A;  2KJ8 A;  2QHO A;  1C1Y B;  2OJR A;  2ICI A;  7ICE A;  3PHX B;  2K8C B;  8ICF A;  4HEA 1;  2MBQ A;  3ALR A;  4ED3 A;  4A20 A;  3ICX A;  3HX0 A;  1D5Z C;  4YR0 A;  1LVH A;  3OJU A;  2ASD A;  3WKA A;  2PFO A;  4FFD A;  4F2S A;  1SV4 A;  2OED A;  3TIX A;  2KWU B;  2O6V A;  3I9V 1;  2QKQ A;  4DOB A;  4H2A A;  4O1N A;  1N5W A;  2IOF A;  3BVZ A;  2LM4 A;  3BK2 A;  4C4V B;  1EF5 A;  2BQR A;  4PHE A;  2ZIU A;  2XNA C;  2VZK D;  3MFG A;  1ZPS A;  4RM9 A;  2KFK A;  1YQ4 B;  4WJN A;  2DGZ A;  3BII D;  1TFR A;  5AK5 A;  3TFS A;  2BB5 A;  4JB3 A;  2ESE A;  3K75 D;  5ALH A;  5GTI U;  1U49 A;  2LD9 A;  4N6E B;  4J9M A;  2PMZ C;  1RYU A;  3AH7 A;  3BYT B;  4M8M A;  4YD2 A;  3BQ1 A;  1SIF A;  2IHM A;  2IJ0 A;  2LGY A;  5EE9 A;  2N7D A;  2ZTC A;  3L10 B;  3PLV A;  2UVW A;  2KWC A;  3B1L X;  3RFZ B;  1X9X A;  2EH9 A;  5AKI A;  3UXO A;  1JWA D;  4UB2 A;  3NG0 A;  4FUL A;  4MEM A;  4REZ A;  1IIP A;  1DRG A;  1JWM D;  2E8P A;  1OQQ A;  1XLO A;  1WGH A;  3Q3M C;  1S0M A;  4TQS A;  1F2R C;  2D3C A;  4JL9 A;  1JRP A;  4I2C A;  3VHT C;  2M19 A;  3CNH A;  1AN8 A;  5A0L A;  3VRA B;  4OVV A;  4ACF A;  1CEZ A;  2FE8 A;  1LGR A;  3L3F X;  4IQV A;  5G5H A;  1NK0 A;  2O2V B;  3RF9 A;  4ED7 A;  2AQ0 A;  4G3I A;  1SWV A;  3R66 C;  4KIK B;  3QX1 A;  2B3A A;  2BZF A;  1SL2 A;  4B9U A;  1L8O A;  1WG8 A;  1SKR A;  4TQ1 A;  1K1Q A;  3OSP A;  2W03 A;  1C20 A;  3ZDM C;  4QZH A;  1L3V A;  1CJE A;  2GI9 A;  1J7C A;  4QWE A;  2CXY A;  1J97 A;  3HP6 A;  4QW9 A;  3IDW A;  4EYH B;  1NZB A;  4TSS A;  3ISC A;  3RNC C;  1FRD A;  2WF6 A;  4CO7 A;  1SB3 C;  3NUQ A;  2N9K A;  3IHP C;  4FBU A;  3R2I A;  2LI6 A;  3MGI A;  4W9J A;  3IN5 A;  3B0A A;  3PW5 A;  3NTU A;  5ALV A;  1BVS A;  3Q8C A;  1QQR A;  2YMM A;  4UB3 A;  3V6H A;  5FR6 A;  2BYT A;  1YZ7 A;  1UQV A;  3WKE A;  4HK2 A;  3D2Q A;  3HHM A;  3LDZ E;  4GFJ A;  3QIJ A;  1TVA A;  1U47 A;  5C3J B;  4PGX A;  7ICF A;  4RGO S;  4Y2T A;  5FKA C;  3RFA A;  5KG3 A;  1Y56 A;  9ICS A;  4PPX A;  2KVZ A;  4J9O A;  3M7D A;  2Y3A A;  1F0M A;  2ZCC A;  4WH4 A;  4W9C A;  4ANX A;  3UQA A;  4KLO A;  3UXP A;  5F3X B;  4QJF B;  2ZUD A;  1NYR A;  1E7V A;  2KN7 A;  4O3P A;  2FIF A;  1G6J A;  3PZP A;  4EEN A;  1V85 A;  4Z6E A;  3PX0 A;  4FZM A;  4NWI A;  4M6W B;  2R8J A;  4IM2 A;  3ED5 A;  1X6I A;  4WIP A;  2PKE A;  3OHA A;  1QKZ A;  2NRW A;  3PSF A;  5DPT A;  8ICJ A;  1D8L A;  5KFI A;  9ICX A;  4IC7 B;  3KOO A;  2KAC A;  1SIJ A;  2RGF A;  3EGR A;  1ZD2 P;  1WX8 A;  2I2Y A;  3A9J A;  4CE6 A;  3D32 A;  4ECQ A;  1FEH A;  2Y1I A;  1ZUD 2;  2KJ6 A;  2J0J A;  2Y0S C;  2LUM A;  2KD0 A;  4W9I A;  4CQN A;  5KFR A;  3K1R B;  4I2J A;  1RPL A;  1JML A;  1L0V B;  4J9N A;  5AM5 A;  2FMP A;  2LFI A;  2Z7J A;  1FFU A;  1ISN A;  3LVV A;  5KFU A;  2JEI A;  2JVC A;  5III A;  5GXG B;  3RCZ A;  1XQQ A;  2PPH A;  4JWU C;  4KLT A;  3GZN B;  4NPN A;  2KMD A;  4F8R A;  3GOE A;  1JX4 A;  4UAW A;  3CF6 E;  1WRD B;  4ZRP A;  2JX5 A;  4OZB A;  2MCN B;  2PFN A;  3V3X A;  4UB1 A;  2PI4 A;  1IBX A;  4XUS A;  5L1K A;  3TL5 A;  1L7M A;  2BS3 B;  4GDK B;  4BWM A;  2JMG A;  1SZH A;  2RHF A;  3KZI U;  2W8K A;  2UVV A;  3BVM A;  3RD2 A;  2PMZ F;  1S97 A;  1WYW B;  2NPT A;  1SWW A;  4B9V A;  2FLL A;  3PV1 A;  3MC9 A;  2KMA A;  4P0Q B;  1ZQT A;  3DBR I;  3ZI4 A;  3IM1 A;  3Q6B A;  4EBC A;  1FPY A;  4CNQ A;  1I4P A;  4ECZ A;  3TQ1 A;  4NJ7 A;  4R8U B;  3PRE A;  4XX5 A;  2WFA A;  2K8A A;  1OTR B;  4UB4 A;  5KT6 A;  1WMH A;  3KQ4 A;  1D9F A;  2WXF A;  1ARO P;  1TKE A;  4YTN B;  4K7S A;  1J2M A;  2LHD A;  3ZDA A;  2W82 A;  1KRH A;  3HKZ C;  4PL2 A;  1A5R A;  1ZQO A;  4IDI A;  8ICQ A;  1N56 A;  2BWF A;  2FJ6 A;  3SEI A;  3IAM 1;  2LEK A;  2A3V A;  3ZDT A;  1ZQL A;  5I4D A;  1COO A;  3B0X A;  3RH6 A;  5HML A;  5KG0 A;  1L5P A;  4BKG A;  2MA1 A;  2L3Z A;  5D4B A;  4KN4 A;  2MW5 A;  2BWE S;  2NBV B;  5DQI A;  1YOV B;  2XK5 B;  2BDU A;  3TBL D;  3RAQ A;  2P66 A;  1WR6 E;  2LPE A;  2LJ5 A;  2M0A A;  2NBU A;  3NY5 A;  4M9G A;  4IUM B;  1D4B A;  1NI3 A;  4YXM A;  3DBL I;  1C7Y A;  3Q3F A;  3DOW A;  2C28 A;  1T94 A;  1QOG A;  1TK5 A;  4Y2P A;  4F4X A;  1V9P A;  2EZZ A;  4RNN A;  2VH2 A;  5KG1 A;  1XC9 A;  1EU4 A;  1KF6 B;  3MJW A;  9ICM A;  2C7H A;  2BKF A;  4RH6 A;  4ZYN A;  1ZXH A;  1FNV A;  4DOC A;  4F4Y A;  1EF1 A;  1HJP A;  1SKS A;  4DSE A;  2UYZ B;  3MGH A;  4LLG M;  3OJS A;  4XE0 A;  2PVG C;  3OSN A;  2QEJ C;  4NL9 C;  2E1E A;  2ZTE A;  5J2B A;  3KZX A;  2PI5 A;  4HXD A;  3GE3 C;  4MDK E;  2G3Q B;  3UMB A;  8ICN A;  2KJ5 A;  3A1Q B;  1BML C;  1ED1 A;  2CS4 A;  3SV4 A;  2J53 A;  4F8C B;  4USA A;  3RPF C;  2ZIW B;  1D9D A;  3QUC A;  3BJY A;  1P7E A;  1WGR A;  5J2A A;  2KO3 A;  3WU2 U;  4EUT A;  2H5X A;  3V72 A;  1MG8 A;  4ANW A;  1HXY D;  5AIA A;  3PX6 A;  1HUZ A;  2PW9 A;  4MEY A;  1YN5 A;  4J3O D;  4DS4 A;  2LYB A;  2DL0 A;  3DHI C;  3N3K B;  2VA2 A;  2L8J A;  3D6J A;  4DWF A;  3WAO A;  4ECT A;  2L52 A;  4I6N B;  4C8O A;  1B22 A;  2Y0S F;  4HKQ A;  2NTS A;  1RZT A;  1BXT A;  5T8I A;  4F2R A;  5BMG A;  2MJ3 A;  5IOI A;  5IA7 A;  5BYS A;  4B95 A;  2NRV A;  3ORY A;  4GOC A;  2D2Q A;  1HE8 A;  1SV0 C;  5CR0 A;  4Y2J A;  2XCA A;  4JIO U;  1D3Z A;  2B76 B;  3SI8 A;  2P35 A;  3ZDB A;  1SZP A;  5DPR A;  3T5H A;  3LXF A;  5C2T B;  4DSL A;  4AUQ C;  4Z6F A;  3IP4 B;  3QUB A;  4MGZ E;  1NK9 A;  5EWF A;  3Q8S B;  3TAQ A;  3AEB B;  2BQU A;  2WF9 A;  1S9F A;  3I76 A;  3OHB A;  3ML8 A;  5GMV A;  1V49 A;  3GE8 C;  3Q3O C;  1P0R A;  1S8O A;  9ICU A;  3VR8 B;  1T4G A;  1Z4O A;  4J03 A;  1BPD A;  3W5U B;  1X2I A;  2KJ9 A;  1KLV A;  1UNS A;  3AN1 A;  3HK0 A;  3U30 A;  3NAS A;  4KV2 A;  1WYG A;  3N28 A;  2J42 A;  3QWZ B;  5AM3 A;  1MC8 A;  1IP9 A;  1ZQK A;  3VAW A;  3W1S C;  2W11 A;  1ZQG A;  2J0M A;  2QCZ A;  4FE3 A;  3B2F A;  4M02 A;  4GIV A;  3RH4 A;  4YD1 A;  1SSN A;  4TUR A;  3UQ2 A;  1Q1O A;  8ICG A;  2ZUC A;  3VCB A;  3C5F A;  1S77 D;  2L32 A;  3P42 A;  1I4G A;  3GS2 A;  3AM9 A;  2WGS A;  2IYD B;  3FC4 A;  2LJI A;  3HKZ F;  3R3M A;  4P4P A;  4YTM B;  3RBD A;  3AE3 B;  3Q3N C;  4NJ8 A;  2IO3 B;  3ZKJ C;  4DDG D;  4F5R A;  2IY0 B;  2I1K A;  3MHS D;  1ZYQ A;  4P0P B;  3SHQ A;  1TKD A;  2HVI A;  3HRD D;  4I2A A;  1Q10 A;  3TEZ A;  2RDG A;  1PZN A;  3ZJU A;  3PHW B;  5L9X A;  4QW8 A;  2KVC A;  4DSI A;  1C76 A;  3RB0 A;  3ZNH B;  1WCL A;  2EKI A;  2DQN B;  5ALW A;  3KFU F;  3TJP A;  5KAI U;  1TGZ B;  2L00 B;  2LM1 A;  2WF7 A;  3MFI A;  3K9O B;  4ZHP A;  2HOQ A;  3PW2 A;  1X1M A;  3RNA C;  4KGT A;  1EM7 A;  5DG8 A;  4DL6 A;  2R2Q A;  1VZ6 A;  2VIX A;  4DQS A;  1QSS A;  2MAX A;  4QZI A;  2DPI A;  1XNS A;  3APC A;  4FAD A;  4DL7 A;  1OQY A;  1QZE A;  5ALU A;  5J2C A;  1J7B A;  3UF8 A;  4YXD B;  3PPA A;  2KKV A;  3KTQ A;  3JPT A;  1WM3 A;  2V0G A;  5CP2 A;  2JQR B;  2LGS A;  5KG7 A;  5J0S A;  2YQE A;  3MP9 A;  4OJP A;  4RU9 A;  5JRT A;  3Q8P B;  2BCU A;  2PVO D;  4RGM A;  2UWQ A;  4RNM A;  1M94 A;  1T5X D;  1ZRN A;  1KQQ A;  2PLP A;  4FJY A;  3VQI A;  2FLN A;  3X0W A;  3Q8R B;  4ICV A;  9ICH A;  3U26 A;  5LXI B;  5EE1 A;  1F1H A;  2Y5C A;  3IG8 A;  2HI0 A;  5KT7 A;  2WDV B;  5KHQ A;  2BYE A;  1NYQ A;  1RQN A;  1S0V A;  5J8Y A;  3HJE A;  4PJ0 U;  1H8C A;  4A3P A;  3MR3 A;  2GMI C;  2O6V D;  2K0P A;  3O65 B;  5KFO A;  1WXM A;  1XEE A;  1E90 A;  3PML A;  4C8M A;  4ZRJ A;  2JZZ A;  3RJI A;  5E6O A;  3NS1 A;  2D5G A;  3NVW A;  4CF5 A;  1SL1 A;  1C4C A;  7ICT A;  4GN1 A;  4M00 A;  3TEW A;  2FI1 A;  1IXR A;  1WR1 A;  4NM2 A;  4Q43 A;  1E7P B;  2OEH A;  3GDX A;  3G6Y A;  4IRK A;  1VJK A;  2CU1 A;  1SGH A;  1SL0 A;  4NL9 A;  2GO7 A;  3SR6 A;  2ZIV B;  3Q69 A;  5AM2 A;  5KFG A;  5J17 A;  4HAI A;  1WM2 A;  1V81 A;  1ZQJ A;  1YZ6 A;  5LLI A;  4YTP B;  2HBL A;  2BQ3 A;  4W9K A;  2ODG A;  9ICG A;  4KLL A;  4FHK A;  4RUC A;  4P2H A;  2INP E;  2W8L A;  3RB4 A;  2OJW A;  2EQY A;  3V7J A;  2BR0 A;  4AS1 A;  1QH9 A;  2DBY A;  1YQ3 B;  1SEB D;  4CDG A;  4DFD A;  4GXI A;  3DDC B;  4ANV A;  2SAK A;  1E5W A;  1XU4 A;  2DX5 B;  1UA0 A;  2KFZ A;  5HMM A;  5HHI A;  5GTH U;  4YVZ A;  3MFH A;  1RWS A;  5KG2 A;  3AU5 A;  1HA5 A;  2OM6 A;  2INN E;  2N9L A;  5ALG A;  5KL1 B;  2WLB A;  3CST A;  4K1R B;  4UBB A;  1RQL A;  4M9H A;  1YIW A;  9ICA A;  4F93 B;  2KAJ A;  2VAN A;  5CHW A;  4M01 A;  1SXE A;  5E6N A;  4RUA A;  2BW2 A;  4YT0 B;  1UUP A;  3ZUN A;  2WAQ C;  1VJ5 A;  4IM3 A;  3U2S C;  4AJW A;  1ZKH A;  2ZZP B;  4ECV A;  9ICB A;  4XA5 A;  1I4R A;  4GDL B;  1E10 A;  5J2I A;  1XLP A;  2DHZ A;  3H40 A;  4FBT A;  4XDD A;  2XIC A;  2DWQ A;  3AE9 B;  4DLE A;  4PZN A;  1DOQ A;  3PW4 A;  1HEK A;  1C4P A;  1DXS A;  5KFA A;  1H4R A;  4FZN A;  3E0F A;  1I4Q A;  8ICV A;  4UAT A;  1ET6 A;  4Y2Y A;  5J2E A;  1F9J A;  1JXL A;  3JPN A;  8ICH A;  2LVQ A;  4K4I A;  4P4O A;  2KNB A;  4BOZ B;  2N1R A;  4DQO C;  2GBN A;  2ZNV C;  1S1Q B;  2KLC A;  4Q2J A;  4R3D A;  1K5O A;  1OXJ A;  3T5K A;  2AGQ A;  2PIA A;  4M47 A;  3WK9 A;  4BVU C;  3H9D A;  3B9J A;  3LWL A;  1GPX A;  3UXN A;  2Q5W D;  1ROE A;  1WJ4 A;  5L83 A;  3UQB A;  1O08 A;  5E6J A;  2G1E A;  4NY0 A;  4KLS A;  5TSS A;  4WWO A;  2MLB A;  4MAC A;  3KHG A;  5L1L A;  3P4Q B;  2IPK D;  2XC9 A;  2FNJ B;  3EFC A;  5ALF A;  2BCS A;  5ALX A;  2CHW A;  3DHH C;  1V1P A;  3TAP A;  4DQI A;  3VH3 B;  3WAP A;  4UB5 A;  1WY8 A;  2AH5 A;  2W9C A;  4XYC A;  1MFW A;  4GLS C;  2XVT A;  2IO0 B;  2D10 A;  4N59 A;  5CTR C;  2JYT A;  5HP4 A;  4P7I A;  4F50 A;  3PRP B;  4QZE A;  4EOY A;  4HJG E;  2MA9 B;  2V4I B;  1ZQN A;  2JF5 A;  2V4L A;  5ALO A;  2PFQ A;  1N5X A;  1P7F A;  4PH5 A;  3GB1 A;  4CF4 A;  2KJH B;  1CUK A;  2ZJD A;  3SFE B;  3QU2 A;  2WX0 A;  3KHL A;  3GIL A;  4QWA A;  2ASL A;  7ICL A;  3H7S A;  4BBN C;  1WWU A;  4F5P A;  2KJR A;  4QAY A;  3ZXR A;  3A33 B;  2K9X A;  2JRI B;  2AXT U;  4OZC A;  2Y9U A;  2QB0 A;  2RPV A;  3PLU A;  4FA6 A;  1UZX B;  2WHE A;  3EPI A;  4HRO A;  4YWG G;  5BO4 B;  4DFM A;  4B0E A;  1NDD A;  2O6V B;  2QAR B;  2DYO A;  3SD7 A;  2I9G A;  4Q8E A;  1TJE A;  1K1S A;  1N63 A;  1XWL A;  3A4R A;  1WGD A;  4JQW C;  4F92 B;  2K4H A;  1L6U A;  4I2F A;  3DBH B;  3OJ4 B;  4BJQ A;  2KHW B;  5ALK A;  3H7P A;  2ZUB A;  4JWM A;  1XLQ A;  3NS8 A;  5AKK A;  2J6T A;  2NMQ A;  1ZXI A;  4HPL B;  3IT4 B;  4B9T A;  1TZO A;  2JRZ A;  7ICU A;  2JEG A;  1L7N A;  7ICO A;  4W9E A;  2WWZ A;  4TUQ A;  2PTL A;  3GV7 B;  3Q8A A;  4GIB A;  3EEC A;  3JSV B;  3R7R A;  3ZXV A;  5F9L A;  4ZH4 A;  4Q44 A;  1ZQD A;  2IO2 B;  1CI4 A;  5J0O A;  2ZVN A;  3H0R B;  4HPP A;  2BF8 B;  4A90 A;  1ZP0 B;  3BS5 A;  1ZGU B;  3AB5 A;  2M0N A;  4DF8 A;  4DSJ A;  4MGY E;  5D2M B;  1ZQX A;  1WFY A;  5EOZ A;  4QZG A;  2WAQ F;  2E8O A;  2F76 X;  2ALZ A;  3RRG A;  4M9N A;  4LNI A;  2L05 A;  4M0W B;  4M2Y A;  1OGW A;  2BKE A;  4DHZ E;  3AV8 A;  3PW0 A;  4DOA A;  4A8X C;  4LJO B;  3WK4 A;  2K6D B;  2C5L C;  1QOB A;  2K5P A;  2UU7 A;  5AK4 A;  4JX1 C;  4IL6 U;  4BOS C;  1GB1 A;  1RG6 A;  4RT3 A;  1FO4 A;  8ICS A;  1SXT A;  5AM4 A;  3UQ0 A;  5CRX A;  1PK1 B;  1I4H A;  2VJ5 A;  2MP2 A;  4PZO A;  2CHX A;  3N7S C;  2K1F A;  1K51 A;  2JEF A;  4BXO A;  2DZK A;  3H4D A;  1RRB A;  2KDB A;  3NUH B;  3M1Y A;  3NZS A;  2FDR A;  3SV3 A;  7ICN A;  3LJ3 A;  1Z2M A;  2HE7 A;  5B5E U;  3RUL A;  3LB8 C;  2REX A;  3L5K A;  5AM1 A;  1KDH A;  3DVN U;  4J9S A;  8ICT A;  2A4Z A;  4RNA A;  4Y2Q A;  2AX5 A;  3BDP A;  4KKJ A;  4XQ8 A;  3MHZ A;  4IKG A;  1A0P A;  2YEP F;  2DZM A;  2I5H A;  3G6V A;  1D8B A;  4DHJ D;  4ELV A;  3KD3 A;  2JXJ A;  5DQG A;  1BPZ A;  2BTE A;  1KLG D;  3FYH A;  4HCN B;  2FMQ A;  1DK3 A;  1U45 A;  1WGK A;  3QU5 A;  1LV5 A;  4B9L A;  4KLM A;  1UT5 A;  2VZK B;  4AQ7 A;  3E58 A;  4Z6C A;  1L7P A;  4AP4 C;  4WJO A;  1ZDX A;  2F77 X;  3M9O B;  1KOT A;  2LXC A;  2V3P A;  4D2K A;  2GBR A;  4II3 B;  3PRZ A;  2V3N A;  2KFN A;  1SE4 A;  3B2G A;  2LRU A;  3IG3 A;  4RQ5 A;  2CKH B;  5D3I B;  4GDL A;  4F3O A;  4RNO A;  1VLB A;  2ZVO A;  1BNO A;  3R7Q A;  4RMA A;  3Q8L A;  2LVO A;  2KC1 A;  4OJL A;  1T0S C;  4EZ9 A;  4N9F 4;  4B0M A;  2NV3 A;  5JHB A;  2EAM A;  2GLE A;  3ZYY X;  4BBN F;  3RRH A;  2EAP A;  4NJ6 A;  1CMX B;  1ZRM A;  3TI0 A;  3KWL A;  2A5U A;  4KMO B;  1QLB B;  3B0Y A;  3EUB 2;  3C29 A;  3UIN B;  5AI6 A;  5DG7 A;  8ICK A;  3P1M A;  2KOX A;  4HYK A;  1ZQC A;  1RLF A;  1L0Y B;  2XID A;  2NR2 A;  2ZCB A;  1ECW A;  2KSO A;  3AE5 B;  3AEG B;  1F52 A;  1DGS A;  5JTI A;  2ASJ A;  3AU2 A;  1ZQS A;  3RYT A;  4AWJ A;  3BZD B;  2XO7 A;  2LVP A;  5HFY A;  2BCQ A;  3FDS A;  2G07 A;  3RB6 A;  5K4L A;  2AJQ A;  4XC2 A;  3H8S A;  1EWC A;  1YX5 B;  5CHV C;  3RR7 A;  2KC2 A;  3BY4 B;  4UQG A;  4I2G A;  4B6W A;  3A0H U;  1A70 A;  1KLU D;  3DBS A;  2G4D B;  3WK8 A;  1YJJ A;  4RPY A;  2GOW A;  9ICL A;  4PYU A;  1L6N A;  9ICV A;  2QLT A;  4IR9 A;  2KDI A;  3SYZ A;  5KG5 A;  2W9B A;  3RBE A;  2DEN B;  5TIS U;  4YP3 A;  2DKX A;  3LYS A;  1KM7 A;  3CP8 A;  5J0Q A;  4KZC A;  4PGY A;  2PFP A;  4DSK A;  8ICA A;  1JWB D;  5DGA A;  3V6E B;  2W7O A;  1TK8 A;  9ICN A;  2BPS A;  1WUD A;  2JZB B;  2M1M A;  3QJZ A;  5KFS A;  4RQM A;  4IM0 A;  2CRX A;  1WXV A;  2BB6 A;  1Z1V A;  2DF4 B;  4TQ0 A;  4ECX A;  2BGF A;  3PR4 A;  3AEE B;  1MJD A;  4JLC A;  2HSZ A;  2GBJ A;  4O0I A;  2JH1 A;  5AI4 A;  3KYC D;  4LZG A;  2G09 A;  5IO9 A;  1RFK A;  1ZQY A;  3C8Y A;  4ARC A;  2ZJ8 A;  3JPO A;  3Q3J A;  3SEN A;  4RQN A;  2ATL A;  5ALT A;  4M9L A;  1UWX A;  1T3N A;  1WI0 A;  1E6E B;  2IMW P;  1UF0 A;  4DSF A;  2WS3 B;  1KFY B;  4DL4 A;  1NZP A;  4LDT D;  4TUU A;  4LK0 M;  3VVW B;  2HW3 A;  2QAR A;  1MSW D;  5HHD G;  3BQ0 A;  4F4W A;  1UEL A;  4TV3 A;  4O3N A;  4KLG A;  3F2B A;  1R7S A;  4IQU A;  4B9K A;  4MM3 A;  4O5K A;  4DO9 A;  3G6X A;  8ICR A;  2HBJ A;  3PO4 A;  3C19 A;  5B66 U;  3BZC A;  3VFK A;  3ZJT A;  3U7D A;  4ZDV A;  4KX5 A;  3J9C A;  4BUG A;  1HTQ A;  2VH1 A;  3H0L B;  2ISP A;  2ACZ B;  2WXJ A;  1ZQH A;  2FCN A;  3NZU A;  1JQ4 A;  3GV8 B;  4CCH A;  4KX3 A;  4ED0 A;  2ZIX B;  3M8S A;  2D6F C;  2F44 A;  5AKY A;  1XO1 A;  2HTH A;  2G5I B;  2Y9T A;  4O9M A;  2HJ8 A;  1S5L U;  3PRM B;  4I27 A;  2HHQ A;  2W55 A;  1BPY A;  3F5A A;  2W7P A;  4MFA A;  1C4A A;  4OVU A;  3N1Z C;  1XO0 A;  4KLF A;  1T0R C;  3SEB A;  1FMA D;  1Z3E B;  5AKJ A;  2W04 A;  3AQE A;  2K8C A;  1JXE A;  4QIW C;  2ZG6 A;  1F44 A;  2WXO A;  3U4E G;  4E3C A;  2BPG A;  4YSX B;  4NZL B;  2KXJ A;  4DXA B;  2OHF A;  2F1J A;  4YR2 A;  9ICT A;  5J8Y C;  2K3U A;  1ZQV A;  3EHV A;  4G11 A;  1KKX A;  2Z0D B;  1JI7 A;  4UW9 A;  2PKO A;  2IOH A;  4BKT A;  2LXA A;  2E5S A;  4K3C A;  1QTM A;  3JYU A;  1Y8R C;  4K4H A;  5J2G A;  2YY6 A;  2VA3 A;  5G5G A;  2ZJ5 A;  3PT2 B;  4C4V A;  2MBO A;  4A6Q A;  5KFC A;  3GIK A;  4KLD A;  3SMV A;  2K4I A;  3V7L A;  3DBH I;  3RMK C;  1M6Y A;  1F0Z A;  7ICK A;  1KBU A;  2KTF A;  1VZ7 A;  4HVB A;  4I28 A;  1GNU A;  5ALZ A;  2BBC A;  1PGA A;  2KX3 A;  1NJW A;  1J2N A;  1SKW A;  4W9G A;  3I57 A;  2FCQ A;  4I2H A;  4O3R A;  1KLN A;  2V4Q A;  2PEA A;  1L4Z B;  2KKC A;  3H7I A;  2KQ7 A;  4KSL C;  3OAW A;  4UAV A;  3D2S A;  4RPZ A;  4JK1 A;  2EAN A;  3NRZ A;  2FPM A;  2BYF A;  2DAJ A;  2NS5 A;  2HDE A;  4I2E A;  2W3R A;  4OJ5 A;  4FS2 A;  3Q14 C;  2K8H A;  1JN3 A;  3Q2A C;  4J9P A;  3PMN A;  5BPC A;  1NJX A;  1COK A;  1T0Y A;  4RCO A;  1LKY B;  3EWA A;  2WU5 B;  1C3T A;  2R8H A;  3RJK A;  3I3T B;  4P16 A;  5IKC M;  2E8N A;  2KTR B;  7ICG A;  1XSP A;  5H92 C;  2HOI A;  3PZD A;  3PSI A;  2HVH A;  1ZDV A;  2O2V A;  2HBK A;  5J0W A;  3AUL A;  3HUI A;  5KFD A;  1TS5 A;  5JZE B;  3PY8 A;  1PVQ A;  4KIK A;  3VTW A;  1NI2 A;  4LCD E;  5HHH A;  2WXQ A;  5ALP A;  1WX7 A;  2AL3 A;  1AWD A;  2ONQ A;  4EE2 A;  2CN1 A;  2K8B B;  2FLP A;  1IUE A;  1WXQ A;  3UPQ A;  1H38 A;  2F8L A;  4K4G A;  1YJI A;  2BT6 A;  2LRW A;  4UAS A;  2HHU A;  1SJH D;  2W54 A;  4GXB A;  3SD5 A;  3AEC B;  4RGT A;  3KYD D;  1YJ1 A;  1ZQ1 C;  5ALJ A;  4C7Y A;  3ZW3 A;  5L1J A;  1HUO A;  1QIL A;  3QE9 Y;  3EW9 A;  1WGY A;  2KKP A;  4RQ3 A;  1L8L A;  3LK9 A;  2WTF A;  2HHW A;  4DL5 A;  2LYA A;  3V6J A;  3P2B A;  3BQ7 A;  3GFK B;  2RDJ A;  4KKI A;  3SZ2 A;  1R4M B;  2QJL A;  1PK3 A;  3FIL B;  5KT2 A;  9ICQ A;  4I6P A;  1VR9 A;  2KMM A;  4BX9 C;  2W43 A;  4O5C A;  1DYQ A;  2M17 A;  2DPJ A;  4WJ3 B;  4G0N B;  2LYH A;  3B08 A;  4I29 A;  4DXG A;  2MH7 A;  2G5H B;  2JEJ A;  1YN4 A;  3I63 C;  4EX6 A;  3ZD8 A;  1ZQB A;  3RZF A;  1FD6 A;  2FID A;  3HPO A;  1ZJN A;  4QZB A;  1NKB A;  5T14 A;  4IC9 A;  3ONS A;  4TUS A;  3UMC A;  1V2Y A;  3DCG A;  5CX3 A;  4Q45 A;  5CEH A;  4M6W A;  2I1J A;  3ONN A;  3PGE A;  4NAW B;  3V61 A;  4EZJ A;  4A9A A;  4DWI A;  1FXA A;  3T79 A;  1KJT A;  4EFO A;  5J18 A;  2KK0 A;  3RNB C;  1X9W A;  2VJ4 A;  5KFP A;  3RJG A;  2WXR A;  2EMS A;  3GP7 A;  1RYS A;  2JZB A;  4FN2 A;  1J0G A;  2MUT B;  2QSD A;  2YMQ A;  2HTM E;  4ZYS A;  1PGB A;  3HVD A;  4IG7 B;  5D6J B;  4FHJ A;  8ICL A;  4QIW F;  2HBM A;  4KVG B;  2KZ3 A;  3L13 A;  5JU5 A;  2WXP A;  1BPE A;  5KFZ A;  3HT3 A;  3NZ3 A;  1J7A A;  5KFN A;  1R4N B;  2DZI A;  3DEE A;  3M63 B;  1WZ3 A;  2IOF K;  1DOI A;  4MHV A;  2UVR A;  2D3G A;  1BGX T;  4J9L A;  1CRX A;  3H6N A;  4GXJ A;  4HWI B;  2LMR A;  4XDC A;  4FS1 A;  2MHJ A;  1QCK A;  1QT9 A;  3Q8K A;  5J0P A;  5J29 A;  1L2N A;  4GDK A;  4XZ4 A;  2EKE C;  1LXD A;  4GC7 A;  3EA6 A;  5J2H A;  4WQM A;  3UIP B;  3JPS A;  1N48 A;  3ZQ4 A;  1NK8 A;  1SE9 A;  2HHX A;  2MSN A;  2E3T A;  1IM4 A;  4EZK A;  4RF1 A;  4P0Q A;  2JYE A;  4U6P A;  8ICP A;  1L7Y A;  3APD A;  3IAS 1;  5ALE A;  1JWS D;  4KGS A;  4R8U A;  2N7J A;  3KHH A;  3FAH A;  5BOL A;  4I2B A;  2IGD A;  3U7Z A;  1J8C A;  1ET9 A;  4KGR A;  1ACC A;  1AW7 A;  4DBG A;  3QU7 A;  2G06 A;  4RM8 A;  1X9M A;  3ENE A;  2V3S A;  3KUC B;  4EZL A;  5D7G A;  1N60 A;  4AOF A;  2CJO A;  1RM6 C;  3QEA Z;  2Q0Z X;  3Q8E A;  4OW0 A;  3K4G A;  2KX0 A;  1STE A;  1PUZ A;  2A1J B;  1TTN A;  2MJE A;  3Q8F A;  2H3V A;  3L16 A;  4DL2 A;  1UHU A;  2N0S B;  1NNL A;  2HHT A;  3GZN I;  3PST A;  2J6S A;  2BQQ A;  2XK5 A;  3QYP A;  1P3Q U;  4JUZ A;  1GC6 A;  3L08 A;  5JHA A;  5AUK A;  1L6V A;  5EE0 A;  4IQT A;  4OZA A;  1D8Y A;  3N97 B;  2E6X A;  4IS7 A;  2B21 A;  5IAA C;  3H0M B;  3T8M A;  3BK1 A;  1ENF A;  1YD8 U;  1WGG A;  3ISD A;  1N2X A;  1E8Z A;  1SF0 A;  2WB1 C;  1ZD5 A;  3IFW B;  4XWW A;  2G0A A;  3C1Y A;  5TZV A;  2MRL A;  4WQO B;  5KAF U;  2L76 A;  1QLN A;  2JWU A;  1S76 D;  4ELT A;  1URJ A;  1PUT A;  2KHQ A;  8ICI A;  1V1O A;  1EWY C;  2XI9 A;  1FNU A;  1YMH E;  3BZK A;  3OTQ A;  2DKZ A;  2IY1 B;  3W9C B;  5BMI A;  4XGA B;  2KWD A;  4NNJ B;  1GAQ B;  1NK7 A;  3MDA A;  3AUO A;  4PS3 A;  1KRP A;  2WHI A;  3F2D A;  1X6J A;  2KYW A;  2ZIU B;  1A76 A;  1B1Z A;  4HCP B;  1ZQR A;  2KMC A;  5J2R A;  5CA7 A;  2KFK B;  4BDP A;  5CHG A;  1L4D B;  5KHO A;  5KFW A;  2J52 A;  4EEL A;  1UGM A;  3E9S A;  4W9F A;  2Y1J A;  3A1Q A;  4ASW C;  2NRX A;  2WXL A;  1FNW A;  3F53 A;  1WX9 A;  2ZIW A;  3APF A;  2KTQ A;  5C1Z A;  3M9M B;  1ZQZ A;  1I7H A;  4S0R A;  4DQR A;  2KIW A;  2KTR A;  3IRU A;  4MH8 A;  2CPR A;  5KG6 A;  2VKQ A;  3F5E A;  2R2O A;  1ESF A;  1LQB A;  1MPE A;  4ED1 A;  3ZIM A;  2KDM A;  1XXG A;  3DVG X;  2RRD A;  2PE9 A;  1K52 A;  3NRW A;  2PE6 B;  4JGH B;  3TSS A;  4FO6 A;  4A3O A;  1PQS A;  4GMV A;  3T3F A;  1TT5 B;  4URK A;  3WKB A;  2MBE A;  4I2I A;  4M04 A;  2IGH A;  2GBM A;  3GV5 B;  2INC C;  1IV8 A;  1TYG B;  4KZ0 A;  1P1A A;  4LVS A;  3KH0 A;  3WAN A;  4ELU A;  1PVP A;  1UA1 A;  4HJK A;  3C2M A;  3M6K A;  3WCQ A;  5ALN A;  5CHF A;  3PZ8 A;  1P9D U;  4NLN A;  1XSN A;  4UB8 U;  4E71 A;  4IQW A;  2ZNV B;  2L5Y A;  7ICM A;  4IWO A;  3NVY A;  5AI5 A;  4ED8 A;  3QXG A;  3WKC A;  5F9N A;  3O0F A;  1JMS A;  4EBE A;  2DNF A;  3T3N A;  5DLF A;  3UIO B;  4RQ6 A;  3O13 A;  3NHE B;  3RI7 C;  1N6Z A;  5TR5 A;  2HCF A;  4UAY A;  9ICJ A;  2F1I A;  2I1Q A;  1WSP A;  5EE3 A;  5LXH A;  3RT3 B;  2IBI B;  2YEP B;  1JUD A;  4F71 A;  2HHS A;  2BS4 B;  2A19 A;  8ICO A;  3AQF A;  3AE8 B;  1VDV A;  3CMM B;  5ALL A;  2KIC A;  2TSS A;  4F5O A;  5AKZ A;  1N62 A;  2H88 B;  1QQ5 A;  2EMT A;  3H4B A;  2BPC A;  4QWC A;  3UGB B;  1VZ8 A;  1O03 A;  4BKS A;  1XCT L;  3H8W A;  3W1Y A;  2W3S A;  2IA6 A;  3BS7 A;  3C1Z A;  4EBD A;  4L1B A;  2LMC A;  4JMU A;  1VCB A;  3N1Y C;  5KTQ A;  5DGB A;  1Q46 A;  1AQ6 A;  3KKA C;  4PHP A;  3EZ5 A;  2LGD A;  2KZR A;  3L17 A;  2AU0 A;  4YMM A;  1KEJ A;  4RQ4 A;  2WF5 A;  5AI0 A;  3HW8 A;  2XY7 A;  3DWM A;  2DUY A;  3DDH A;  1NJY A;  4P0P A;  4DFK A;  2XCP A;  3VC8 A;  4F5Q A;  3DBR B;  3KLS X;  4MJS B;  1EO6 A;  2M56 B;  3GU3 A;  2D3B A;  2G08 A;  4W9L A;  1FCL A;  1TS4 A;  5AZH A;  2LGI A;  4MFF A;  5FR3 A;  3NJT A;  5AHX A;  4EEW A;  2LZ6 A;  2ZEQ A;  4KLQ A;  1QQ6 A;  4QZ8 A;  3OGU A;  2RLT A;  3LVW A;  3RTV A;  3ZGZ A;  1MVK A;  3ZDD A;  1HQR D;  4MGI E;  1OEY A;  1SGG A;  2E1F A;  2BPF A;  4B9N A;  4C4S A;  1HIW A;  1A6S A;  2AWT A;  4DFP A;  9ICC A;  2WB1 F;  4KLJ A;  2NVU I;  5ALS A;  3W5V B;  2XGP A;  2RR9 A;  2DYM A;  2C9W B;  3OJ3 A;  4MEL A;  3JPP A;  4RGN A;  3VUW A;  1WWT A;  4DL3 A;  3ZRC A;  1TK0 A;  4Y2X A;  1Z1B A;  3DVN V;  3NOB A;  1TAQ A;  2OCE A;  4LNO A;  1QSL A;  2YVC A;  3N1X C;  4X57 B;  2FUH B;  3PVL A;  5DCN A;  9ICO A;  3DBL B;  3CYM A;  1C79 A;  4FXC A;  1IBX B;  1ZE3 D;  8ICX A;  4YSZ B;  4ECW A;  1NK5 A;  3QCA A;  3AE7 B;  3M9N B;  3WA0 A;  1NKC A;  3CW2 C;  2DYB A;  1MQ3 A;  4G50 A;  4MF2 A;  3ZDC A;  1UH6 A;  2NPT B;  4OHJ A;  1TS3 A;  2KOB A;  4JV0 A;  3GZF A;  3MC8 A;  2QC8 A;  1WRI A;  2DZJ A;  4PGQ A;  1TY0 A;  1WXS A;  1V97 A;  5AK6 A;  4Y2S A;  4ZRQ A;  4KLI A;  2KN4 A;  1F5S A;  2M8S A;  5AKE A;  3AXC A;  2ES6 A;  3VRB B;  1IYF A;  3GIJ A;  1WMH B;  3KVF B;  5ALI A;  2F1H A;  1I4X A;  1KFT A;  2QIE B;  2VA8 A;  1D5M C;  4ECS A;  1P7D A;  5KFT A;  4IOI E;  4K7W A;  4BZA A;  3U52 E;  1RAX A;  2I6X A;  1RYR A;  2I38 A;  2FPL A;  3AEA B;  3RJE A;  3N9Y C;  4WAA A;  1Z5S B;  2RD0 A;  3N30 A;  5DB8 A;  1BPX A;  1X9S A;  4MSQ B;  1WXA A;  1JIH A;  1L7O A;  3PNC A;  5FK9 C;  4OCZ A;  3ISB A;  2KDF B;  4B9S A;  5L1M A;  3MR6 A;  2X8X X;  5JUM A;  7ICJ A;  3QUT A;  1MN8 A;  3TAD A;  3VH4 B;  1SJE D;  2JH7 A;  2ZIV A;  4IRC A;  2WP9 B;  4NLG A;  3WK7 A;  3P4P B;  3P4S B;  4PS8 A;  2WXG A;  2WXN A;  2QB1 A;  3D2N A;  3UI3 A;  1V80 A;  5DBA A;  3ALB A;  5IN7 A;  1RXW A;  3AU4 A;  3J81 j;  3M95 A;  2KEY A;  5DPW A;  3BQT A;  2L7R A;  1SXD A;  1TAU A;  5KFX A;  5KFH A;  1UBI A;  3UMG A;  3RJJ A;  1HZ6 A;  5G2N A;  3NVV A;  3PO5 A;  1TBE A;  3AE2 B;  3AI5 A;  3R2T A;  4P1B C;  4WUR A;  3ZJV A;  2HD5 B;  9ICP A;  1JW9 D;  4GLX A;  4EEY A;  4CRX A;  5BMH A;  5EDS A;  3RNF C;  4QZF A;  3ZNI D;  2C60 A;  2N7E A;  2Q4T A;  4CGZ A;  1GOZ A;  2KIV A;  1BUI C;  1X66 A;  4YMO A;  1S10 A;  3WAM A;  1V38 A;  1HZ5 A;  3KBB A;  1K50 A;  3QHT A;  3QAQ A;  4YMN A;  1A77 A;  1EXN A;  3L54 A;  2OH2 A;  5E79 U;  3HVZ A;  4NQL B;  5JXV A;  3IVF A;  3JPQ A;  1YN3 A;  4LJP B;  1WZ0 A;  3URY A;  5IIO A;  1U9L A;  2NO5 A;  3VDZ A;  5C23 A;  3WAL A;  2GWS A;  5DB6 A;  4KTQ A;  2N9E B;  2JGA A;  2L83 A;  4ZRI A;  1SE2 A;  3N4M B;  2BKR B;  3QU9 A;  4P1C C;  4WWP A;  4DHJ B;  2ZJA A;  4O3M A;  4YXJ A;  4IWP A;  1C78 A;  1NOM A;  2JXT A;  1UD7 A;  5ALD A;  4II2 B;  4NAM A;  2PJH A;  1DK2 A;  3KWV A;  3V05 A;  4R66 A;  1E8Y A;  1V5O A;  4DXF A;  5JH5 C;  1ZQW A;  2C22 A;  4C8L A;  3FM9 A;  1D5X C;  1S0N A;  1YNT E;  2MBH A;  3DHG C;  3Q8B A;  1B4F A;  3PX4 A;  4JV2 A;  1GG3 A;  3A9K B;  3PW7 A;  1XD3 B;  1AYF A;  4ANU A;  7ICH A;  1UPH A;  1CQV A;  3DWG C;  4HDQ A;  4KX6 B;  5AKL A;  3RH5 A;  2YTU A;  1FXT B;  2K22 A;  1QF6 A;  1TAM A;  2O6K A;  4IWQ A;  4PS7 A;  1NBF C;  3TAR A;  3AE4 B;  4QZ9 A;  2F2A B;  3DV9 A;  3GQC A;  4P6V F;  2OXO A;  3TKA A;  2C2D A;  1PFD A;  1TY2 A;  3SAH A;  3T9L A;  3I1Y A;  3C21 A;  3KKA A;  2CR5 A;  4FJV B;  2X38 A;  5KFK A;  4F7Z A;  2JXX A;  1N61 A;  2RDI A;  1TKG A;  5AZF A;  4O5E A;  2Z8L A;  1MQ2 A;  2BVC A;  3P63 A;  4BFR A;  2UVU A;  4US9 A;  9ICF A;  5KFM A;  4TQR A;  1CZP A;  1KSP A;  4PT5 A;  3QUQ A;  3QZ8 A;  1BPB A;  3NVZ A;  2XN9 C;  4KN7 A;  5AI9 A;  1IG6 A;  4JWN A;  5HR6 A;  2N9P C;  5J0T A;  1T7P A;  4NLC A;  4DQP A;  4YR3 A;  3RJF A;  2RQ5 A;  3OG5 A;  4Z6D A;  3A4S C;  2LGX A;  3W2D A;  3I28 A;  4MJS A;  3ETL A;  2H3I A;  1UWM A;  4U7C A;  3P4R B;  3V6K A;  1OEY J;  2L1A A;  2HJ1 A;  4NJC A;  1ZJM A;  1Z00 B;  4M8N A;  1JRO A;  3M8R A;  1XS9 D;  1ZQE A;  1WF9 A;  2AGP A;  3AE1 B;  2KFJ A;  4GB9 A;  1NJZ A;  2F8K A;  4RFB A;  1UGJ A;  2D07 B;  2LWP A;  3TAN A;  3KUZ A;  2NTT A;  1B43 A;  1TE2 A;  1HEZ E;  3QZ7 A;  1V9J A;  3IT6 B;  4WJQ A;  4KLH A;  2DFL A;  2ZXH A;  2FCM A;  2YML A;  4LTU A;  4MGK E;  2IZV B;  2WXM A;  2FCS A;  4YFK A;  1V5T A;  2AYO B;  3V6C B;  2WNM A;  4GU2 A;  3JSV A;  2YX8 A;  3ZTD A;  4UAR A;  4ED6 A;  1I42 A;  3MC1 A;  4UBC A;  2BHN A;  1NK6 A;  1WWV A;  5CWR A;  3QQ8 B;  1Q0W B;  4OO1 J;  4NLK A;  4RQ1 A;  3N32 A;  4LDT B;  4EEK A;  1CK1 A;  2WDT B;  1EUV B;  2BYV E;  3PV8 A;  1WCN A;  4FZL A;  3WKD A;  1E7U A;  3WIM A;  3ZLZ A;  2KG5 A;  2GOL A;  4M0W A;  1X40 A;  2YN4 A;  1IGD A;  1JRU A;  2R61 A;  3LWM A;  1RYJ A;  4LZD A;  1E8X A;  3QAR A;  3CWI A;  1GJZ A;  1ZD4 A;  3VUX A;  1PK1 A;  1UT8 A;  3C28 A;  1L3U A;  3EFU A;  4EYI B;  3I5J C;  4RPX A;  5AZG A;  4A55 A;  5ALM A;  5DKW A;  2JZ3 B;  1T0Q C;  3M3J A;  3AL0 B;  4HLE A;  2A1A A;  3ZO5 B;  4X5V A;  4C00 A;  2BS2 B;  2Y5B B;  1ZQU A;  2K39 A;  2R8I A;  1DOY A;  2GH1 A;  8ICC A;  2XBB C;  4KLU A;  5J0X A;  5AIC A;  1NKE A;  3PTF C;  3C2L A;  3T3O A;  1Q5W B;  3MGV A;  4QNL A;  2IDY A;  1UCV A;  5HKH A;  3MBY A;  1KL9 A;  4MEX A;  1LFD A;  4XRH A;  4Q8F A;  5BYQ A;  3MJ5 A;  5AK3 A;  2NYV A;  2AQ3 B;  3E56 A;  1KTK A;  1WIA A;  1KH0 A;  2NRT A;  1KFD A;  5KFE A;  1SBB B;  3SFD B;  3ZNG C;  2V1Y A;  1HTO A;  4OVZ A;  4C8N A;  1Y88 A;  8ICE A;  1IPG A;  2F3N A;  1ZQQ A;  2KT7 A;  4DK5 A;  3TEY A;  1KW4 A;  4DFJ A;  1L5U A;  5C0Y A;  2G45 B;  2JSV X;  3VUY A;  2N9X A;  3H8H A;  1I35 A;  4R65 A;  1T6B X;  1WE6 A;  4K7U A;  4QWB A;  1ZQA A;  3MAB A;  3MR5 A;  5C5J A;  3Q8M A;  1MHX A;  4NQK E;  4KDL B;  5DLG A;  2IO1 B;  5KG4 A;  2MJD A;  1T8E A;  4QZD A;  5D49 A;  1B9R A;  3WK5 A;  4Y2U A;  4ECU A;  2WQY B;  2AEH A;  4JWS C;  2K4P A;  2LBO A;  4J6I A;  3HM6 X;  5J0Y A;  2AL6 A;  4PL1 A;  2C7N B;  2WYQ A;  3PSP A;  2W9M A;  5KNI A;  3JW0 X;  5L95 C;  3CRX A;  2RPQ A;  3V62 A;  1D6E C;  1WJU A;  2NCN A;  3QK0 A;  3IHQ B;  5D94 A;  4EX7 A;  1NK4 A;  5KFB A;  3V7K A;  4O3S A;  1WE7 A;  3MC0 B;  2WF8 A;  5IIL A;  5CJ7 A;  3H1U A;  4E74 A;  4FBJ B;  2MWS B;  3C5G A;  3PO0 A;  2H89 B;  1KN5 A;  5ALR A;  2KAN A;  1V86 A;  3MTN B;  2IHN A;  3ZVV A;  3L0W B;  3TAC B;  4TUP A;  4CF3 A;  3UM9 A;  4RZR A;  1ZQP A;  1XCQ L;  2IND C;  2LHE A;  4YN4 A;  3C23 A;  3EPG A;  1V6E A;  2J7Q B;  3A9K A;  2JY6 A;  2R8G A;  2OWO A;  2N4F A;  4MF8 A;  3ML9 A;  2GRI A;  5IP4 D;  5LNK 1;  1Q3U A;  2K60 A;  3EC8 A;  2DAF A;  5AEK B;  2LUE A;  1E0Z A;  1ZOL A;  2K25 A;  4YL8 A;  2PXI A;  5AUI A;  4PHD A;  3U8Z A;  2K4E A;  2KE7 A;  2AQ4 A;  3ZD9 A;  1ZQF A;  4BKS D;  2P6U A;  4A8E A;  1WJ6 A;  2MQJ A;  4YSY B;  3E2E A;  2R8K A;  3PSE B;  2WXI A;  5H8Y E;  1F2R I;  2Z59 B;  3ZTC A;  2G9H D;  3KHR A;  4GGQ A;  4YQW A;  3RJH A;  4EKU A;  3SQI A;  1E9M A;  2KZM A;  5EWE A;  2ON8 A;  3A0B U;  4WJP A;  2JT4 B;  8ICZ A;  1EU3 A;  2KD1 A;  4E0D A;  1PYW D;  4XWT A;  3F2C A;  2ASQ A;  3DVG Y;  4DHZ B;  4DEZ A;  1JWU D;  1F77 A;  1C77 A;  1GC7 A;  2WXH A;  4W9D A;  2AGO A;  2EEL A;  2WXK A;  2RDH A;  3V60 A;  5J2F A;  3N7P D;  1S3S G;  3BYY B;  4W9H A;  1V1P B;  1KTQ A;  2RMM A;  2FMS A;  3C0R B;  4OJO A;  2BCV A;  4YG2 A;  4ECR A;  3ZDE A;  1RXV A;  2MRP A;  2OYY A;  2W9C B;  1JCK B;  3MR2 A;  2KDE B;  2N1V A;  3R8B A;  4JV1 A;  4PK1 A;  4RT2 A;  2D11 A;  3KW5 B;  1FEZ A;  5IIJ A;  5KFY A;  4GSW A;  5KFQ A;  4I6L B;  3IG5 A;  2JR5 A;  5KT3 A;  2DLB A;  4MFC A;  2JUO A;  2CU3 A;  2YMP A;  4N58 A;  2KN5 A;  3PVX A;  8ICM A;  2NRZ A;  2ZW1 A;  3KUD B;  3H8J A;  4RQ2 A;  3OLM D;  4ICA A;  2KVS A;  1Z00 A;  2YB4 A;  4QZA A;  2QMT A;  1LB2 B;  7ICQ A;  2NBW B;  4ARI A;  3WK6 A;  1FCC C;  3SU8 X;  1SE3 A;  2G4S A;  4KSK C;  4AP9 A;  1OQR A;  1L3S A;  2FAZ A;  2HDO A;  3ABV B;  3AEF B;  2QB0 B;  3TFR A;  1BNP A;  2JHD A;  4NLB A;  2PMV A;  1XSL A;  1GUA B;  4R63 A;  5KFF A;  4GXK A;  3DPD A;  2HOF A;  4ICU A;  2V4R A;  3T5J A;  2MSE D;  2BGW A;  3HIL A;  1JAL A;  2H3Z A;  4C0Z A;  5KT5 A;  3JPR A;  2JWZ A;  2C2E A;  4KIT B;  2OOB B;  2RDB C;  2RP5 A;  4LNF A;  2AHO B;  2ZIX A;  1DOX A;  4EZ6 A;  3LDA A;  5D3D A;  3H7P B;  2B0C A;  5MPO A;  2GB1 A;  5EWG A;  4WWM A;  2MU2 A;  4KDI C;  2KP7 A;  1C9F A;  3TCA A;  1U4A A;  2ZXI A;  2Y5P A;  3M62 B;  2BCR A;  3ZNZ B;  2IBK A;  1WJN A;  5DG9 A;  3DQV A;  3TMP B;  4LNN A;  4NLZ A;  5IIK A;  2KHV A;  2M4N A;  1ZOY B;  4CHK A;  2D3D A;  1NEK B;  1T3Q A;  3AED B;  3ZRF A;  5D46 A;  1YX6 B;  2CHZ A;  2L0F A;  4TKN A;  4FLH A;  3EYZ A;  2HHV A;  9ICR A;  2FE9 A;  3PR5 B;  2Z0E B;  2H3Q A;  3S2A A;  3VTU A;  4C80 A;  4YCX A;  2XY6 A;  3QEB Z;  5HR7 A;  7ICV A;  3BS5 B;  4MT5 A;  3RAX A;  4BWJ A;  2LKY A;  2WDR B;  3BIN A;  5BYR A;  2J6U A;  1FXI A;  3S6J A;  9ICW A;  2FPK A;  3C2K A;  1RDF A;  4F4Z A;  5L1I A;  4ZOH C;  4B6J A;  4C4R A;  4IRD A;  4TMA B;  1U48 A;  4ITK A;  1KFS A;  4DDI D;  1VRA B;  1YT3 A;  4M9J A;  4US8 A;  1ZD3 A;  5DBC A;  3CIR B;  5CB1 A;  2M0X A;  2LI5 A;  4FJZ A;  2MP2 B;  2IGG A;  3HIZ A;  2EZX A;  3L4P A;  3T5L A;  4RQ7 A;  4DF4 A;  1OW5 A;  3RN9 C;  2W9N A;  4G9B A;  5ALY A;  1MHH E;  2XGQ A;  2B6G A;  4LJX A;  4BXO B;  3TAD C;  4MSM B;  3VTV A;  1Z4N A;  4Y2V A;  4RQ0 A;  1S0O A;  7ICR A;  4C8K A;  3HWT A;  1MA7 A;  1XLN A;  7ICI A;  2HMX A;  2L0T A;  1TV9 A;  4F72 A;  4LNK A;  2KLG A;  4F5N A;  4F1S A;  1MI0 A;  1QOA A;  4AYB C;  1E8W A;  5HG2 A;  1YQB A;  3K1Z A;  8ICB A;  4J9Q A;  4O3O A;  9ICE A;  2MX2 A;  1LKY A;  2V9W A;  4L23 A;  3SAG A;  5AKH A;  2H3F A;  5HNK A;  3VR9 B;  1Q3V A;  4HDO A;  2C7M B;  4I2D A;  5AKG A;  5KL8 B;  4BGD A;  3K9P B;  3TUO A;  5DB7 A;  3IXS A;  1OFF A;  1XF5 L;  1XT9 B;  1LO5 D;  4ZHO A;  3M6Z A;  1TZ1 A;  4GC6 A;  3VXW A;  4ECY A;  1LM8 B;  1QSY A;  3TEX A;  2K8B A;  5BOM A;  2YLM A;  3IBE A;  2KVR A;  4UDU C;  1J19 A;  5DQH A;  5KT4 A;  4R64 A;  3N20 C;  4OD0 A;  3FKY A;  1ZET A;  1GO3 F;  3PZ7 A;  5DDY A;  2D3A A;  2ISO A;  1M4V A;  5DBB A;  1XO3 A;  3GIM A;  5IIN A;  3ECI A;  4CYE A;  2ZPY A;  2XY5 A;  1SV0 A;  3BWU D;  4HRS A;  4WAF A;  5KFJ A;  1P98 A;  1FRR A;  2SEB D;  1NVI D;  3CSF A;  2GBK A;  3IV6 A;  5G55 A;  5AM0 A;  4O3Q A;  1B0X A;  3FIL A;  2MEK A;  3AMZ A;  4K81 A;  4PYZ A;  8ICY A;  2J4X A;  8ICW A;  3RNE C;  4J9R A;  2KNJ A;  4DLG A;  2KZZ A;  2BDP A;  2P6R A;  3RB3 A;  4QWD A;  1FFV A;  1ZQM A;  4F4K A;  2RSU A;  4L2Y A;  4AJY B;  8ICU A;  1IGC A;  1UBQ A;  2AQ1 B;  2KSO B;  3OWE B;  1DGJ A;  3R9K A;  4C56 C;  3JVZ X;  1FM0 D;  3BQ2 A;  4UB6 U;  3LYY A;  1ZW7 A;  1ZQI A;  2W9A A;  4K3B A;  4IW0 A;  3QU4 A;  2K89 A;  1Z19 A;  4ZRK A;  4NAW A;  3QX7 A;  2JRH A;  3W1S A;  4P4M A;  3QNM A;  2ZPN A;  2CJN A;  4NV0 A;  2ZW0 A;  2LHT A;  1BT0 A;  3PS6 A;  2QDF A;  4DQQ A;  1QOF A;  4NY8 A;  3BVG A;  3RR8 A;  2GLS A;  2VRR B;  1K8R B;  1TIF A;  2MUT A;  2YB1 A;  4S17 A;  4UAU A;  2WU2 B;  2QIL A;  4G3X B;  2EAO A;  3H8M A;  2W9B B;  9ICI A;  1V8C A;  4UAZ A;  5DDM A;  1NEN B;  9ICK A;  4RF0 A;  4IR1 A;  1PVR A;  1U4B A;  3AU6 A;  1WH3 A;  3AEV A;  4HKZ E;  5DB9 A;  5E6P A;  4ED2 A;  4RQ8 A;  5AIB A;  5ALQ A;  4NM1 A;  1PDX A;  3OPX A;  4PHA A;  1X42 A;  3A9J B;  1R4M I;  4MH0 E;  5H2F U; 
#chains in the Genus database with same CATH homology
 2W3R A;  2K22 A;  2WDQ B;  1QF6 A;  4JE3 B;  2WDV B;  1NYQ A;  3AE4 B;  5HI1 A;  4RCO A;  4P6V F;  2WU5 B;  4JPS A;  4P16 A;  2K0P A;  1PFD A;  1TY2 A;  1XEE A;  5H92 C;  1ZDV A;  2JZP A;  2X38 A;  3AE6 B;  1N61 A;  3NS1 A;  2D5G A;  3HUI A;  1TKG A;  3NVW A;  1C4C A;  1TS5 A;  2Z8L A;  3P63 A;  3TEW A;  2WXQ A;  2AQ2 B;  4US9 A;  1PGX A;  4EE2 A;  1AWD A;  2ONQ A;  1IUE A;  1E7P B;  1K53 A;  1WXQ A;  1CZP A;  4MM3 B;  2FUG 1;  4PT5 A;  2BT6 A;  1YJI A;  1VJK A;  1SJH D;  2W54 A;  2XN9 C;  3NVZ A;  3SR6 A;  1GB4 A;  3AEC B;  4RGT A;  3Q69 A;  1FIQ A;  4C7Z A;  1TKY A;  4C7Y A;  1L0X B;  2FBW B;  1QIL A;  3W2D A;  4YTP B;  1UWM A;  3P4R B;  2INP E;  2L1A A;  2JU6 X;  2KQ4 X;  4KKI A;  3ETR A;  4AS1 A;  2QJL A;  4NJC A;  3FIL B;  1TS2 A;  2DBY A;  1VR9 A;  1YQ3 B;  1SEB D;  1JRO A;  2KMM A;  2SAK A;  1DYQ A;  3AE1 B;  1RWS A;  4RFB A;  1HA5 A;  4DXG A;  1UGJ A;  2ICI A;  2INN E;  2N9L A;  2MH7 A;  2NTT A;  1YN4 A;  2WLB A;  1HEZ E;  4HEA 1;  3IT6 B;  1FD6 A;  2KAJ A;  4LTU A;  2BW2 A;  1D5Z C;  4YT0 B;  1UUP A;  2WXM A;  3U2S C;  4NAW B;  1I4R A;  2OED A;  4A9A A;  4GDL B;  1E10 A;  1FXA A;  3I9V 1;  1XLP A;  4H2A A;  2WNM A;  4O1N A;  4XDD A;  1N5W A;  3BVZ A;  2DWQ A;  2WXR A;  3AE9 B;  3BK2 A;  3GP7 A;  2XNA C;  1C4P A;  2VZK D;  1ZPS A;  3MFG A;  1I4Q A;  2QSD A;  2HTM E;  1YQ4 B;  4ZYS A;  1PGB A;  1ET6 A;  1CK1 A;  3HVD A;  3BII D;  2BB5 A;  2WXP A;  4DQO C;  4N6E B;  4R3D A;  4Q2J A;  3NZ3 A;  3AH7 A;  3BYT B;  4M0W A;  1J7A A;  1IGD A;  2IJ0 A;  2PIA A;  2R61 A;  5EE9 A;  1DOI A;  1RYJ A;  3RFZ B;  3B9J A;  3CWI A;  1JWA D;  1GPX A;  2Q5W D;  1ROE A;  4REZ A;  4XDC A;  1JWM D;  5E6J A;  2G1E A;  1OQQ A;  5TSS A;  1XLO A;  4A55 A;  4MAC A;  1QT9 A;  1F2R C;  3P4Q B;  2IPK D;  1JRP A;  2M19 A;  1AN8 A;  2BS2 B;  3VRA B;  3EA6 A;  4WQM A;  2FE8 A;  1DOY A;  5G5H A;  1V1P A;  3ZQ4 A;  3T3O A;  2E3T A;  4GLS C;  4RF1 A;  2IDY A;  2JYE A;  4N59 A;  4TQ1 A;  3IAS 1;  2JYT A;  1JWS D;  2GI9 A;  1CJE A;  3MJ5 A;  4KGS A;  5BYQ A;  2N7J A;  1J7C A;  3FAH A;  1KTK A;  2AQ3 B;  2IGD A;  3E56 A;  3U7Z A;  4HJG E;  1ET9 A;  1KH0 A;  2V4I B;  4KGR A;  1SBB B;  4TSS A;  1ACC A;  1AW7 A;  1FRD A;  3SFD B;  1SB3 C;  1N5X A;  1P7F A;  2N9K A;  4OVZ A;  3GB1 A;  3R2I A;  3SFE B;  3TEY A;  5D7G A;  1N60 A;  2JSV X;  2CJO A;  3H8H A;  1RM6 C;  1T6B X;  3Q8E A;  4OW0 A;  2K9X A;  3Q8C A;  1MHX A;  1QQR A;  1STE A;  3Q8F A;  4OZC A;  2MJE A;  2BYT A;  2RPV A;  2MJD A;  1B9R A;  2N0S B;  2WQY B;  4YWG G;  4HRO A;  4B0E A;  5C3J B;  4JWS C;  4RGO S;  2DYO A;  5FKA C;  5AUK A;  1TJE A;  1L6V A;  5EE0 A;  1Y56 A;  2E6X A;  1N63 A;  2Y3A A;  4WH4 A;  3BK1 A;  1ENF A;  1D6E C;  1NYR A;  1L6U A;  1SF0 A;  3VR8 B;  4XWW A;  3MC0 B;  1XLQ A;  2NMQ A;  1ZXI A;  3IT4 B;  1TZO A;  3PO0 A;  2JWU A;  2H89 B;  1V1O A;  1PUT A;  4WIP A;  1EWY C;  1FNU A;  1QKZ A;  1YMH E;  5BMI A;  2PTL A;  3W9C B;  3Q8A A;  2KWD A;  1GAQ B;  1XCQ L;  2LHE A;  2KAC A;  1SIJ A;  1B1Z A;  3EGR A;  2I2Y A;  2GRI A;  5LNK 1;  4A90 A;  1L4D B;  1E0Z A;  2J52 A;  1FEH A;  1ZP0 B;  3AB5 A;  1ZUD 2;  3E9S A;  2LUM A;  4CQN A;  2WXL A;  5AUI A;  1FNW A;  1JML A;  1L0V B;  2LFI A;  4YSY B;  1I7H A;  1FFU A;  3AV8 A;  5H8Y E;  2WXI A;  4A8X C;  1F2R I;  1QOB A;  2K5P A;  2G9H D;  5GXG B;  4MH8 A;  4JX1 C;  4JWU C;  1GB1 A;  1FO4 A;  1E9M A;  1SXT A;  2ON8 A;  1ESF A;  1MPE A;  1I4H A;  2KDM A;  1XXG A;  1EU3 A;  2JX5 A;  4OZB A;  4ZRP A;  1K52 A;  3TSS A;  1PYW D;  1K51 A;  4XWT A;  3V3X A;  1JWU D;  1F77 A;  1IBX A;  1C77 A;  2BS3 B;  4GDK B;  2WXH A;  2EEL A;  2IGH A;  2WXK A;  2RDH A;  1TYG B;  3BVM A;  3NUH B;  3BYY B;  1V1P B;  2RMM A;  1JCK B;  3R8B A;  3LB8 C;  3WCQ A;  1I4P A;  3PZ8 A;  4RNA A;  2AX5 A;  4KKJ A;  3NVY A;  3MHZ A;  4IKG A;  2DLB A;  2YEP F;  2CU3 A;  4N58 A;  3KQ4 A;  2WXF A;  1TKE A;  2ZW1 A;  4YTN B;  3T3N A;  2LHD A;  2BTE A;  2W82 A;  1KRH A;  3O13 A;  1KLG D;  2QMT A;  4IDI A;  4ARI A;  1WGK A;  1FCC C;  3IAM 1;  2LEK A;  2VZK B;  1SE3 A;  1WSP A;  5EE3 A;  4AQ7 A;  1OQR A;  2YEP B;  2BS4 B;  5I4D A;  3AEF B;  3ABV B;  1ZDX A;  3AE8 B;  1VDV A;  1L5P A;  2PMV A;  2TSS A;  2V3P A;  4D2K A;  1N62 A;  2H88 B;  2V3N A;  1SE4 A;  3B2G A;  1VZ8 A;  5D3I B;  1XCT L;  2M0A A;  1D4B A;  1VLB A;  1NI3 A;  2W3S A;  1JAL A;  1QOG A;  4L1B A;  2LMC A;  1DOX A;  4B0M A;  5D3D A;  3ZYY X;  1EU4 A;  5MPO A;  1KF6 B;  2GB1 A;  4WWM A;  4RH6 A;  1C9F A;  3KWL A;  1ZXH A;  1FNV A;  1QLB B;  3DWM A;  3EUB 2;  3KLS X;  2Y5P A;  3P1M A;  1L0Y B;  2M56 B;  1FCL A;  1TS4 A;  4LLG M;  3AE5 B;  2LGI A;  4XE0 A;  2PVG C;  1ZOY B;  2QEJ C;  5FR3 A;  1NEK B;  1T3Q A;  3AED B;  3AEG B;  3ZGZ A;  3BZD B;  1MVK A;  1HQR D;  5HFY A;  4C80 A;  4MT5 A;  1BML C;  2WDR B;  2J53 A;  5BYR A;  4USA A;  1EWC A;  1FXI A;  3RPF C;  3W5V B;  4RGN A;  2DYM A;  4ZOH C;  1P7E A;  4TMA B;  4ITK A;  1A70 A;  1KLU D;  1VRA B;  1WWT A;  4US8 A;  1HXY D;  1YJJ A;  3CIR B;  2PW9 A;  1YN5 A;  4J3O D;  2IGG A;  3L4P A;  1C79 A;  4FXC A;  1IBX B;  1MHH E;  1JWB D;  1ZE3 D;  2L52 A;  4YSZ B;  3AE7 B;  4HKQ A;  2NTS A;  1BXT A;  5T8I A;  5BMG A;  2MJ3 A;  1XLN A;  5BYS A;  2BB6 A;  4OHJ A;  1TS3 A;  4TQ0 A;  1MI0 A;  1QOA A;  5HG2 A;  3AEE B;  2B76 B;  1WRI A;  1TY0 A;  1V97 A;  4ZRQ A;  1RFK A;  2KN4 A;  3LXF A;  4L23 A;  5C2T B;  3C8Y A;  3VR9 B;  4ARC A;  3VRB B;  1I4X A;  3TUO A;  3AEB B;  1UWX A;  3IXS A;  1E6E B;  1OFF A;  2QIE B;  1XF5 L;  1D5M C;  1LO5 D;  4ZHO A;  2WS3 B;  1KFY B;  4IOI E;  3U52 E;  4LK0 M;  5HHD G;  2I38 A;  3W5U B;  3AEA B;  3N9Y C;  1R7S A;  3TEX A;  1UNS A;  3AN1 A;  4UDU C;  5FK9 C;  1WYG A;  2J42 A;  1SJE D;  2WP9 B;  3ZJT A;  3P4P B;  3B2F A;  3P4S B;  3PZ7 A;  2WXG A;  2WXN A;  1M4V A;  1SSN A;  1XO3 A;  3J9C A;  3UI3 A;  2L32 A;  3P42 A;  1I4G A;  3GS2 A;  2WXJ A;  3BWU D;  3AM9 A;  2ACZ B;  4HRS A;  1JQ4 A;  3FC4 A;  4WAF A;  2LJI A;  1FRR A;  1HZ6 A;  2SEB D;  1NVI D;  4YTM B;  3AE3 B;  3NVV A;  4WUR A;  3ZJV A;  3AE2 B;  3FIL A;  3R2T A;  2MEK A;  3AMZ A;  2W55 A;  2J4X A;  1JW9 D;  4L2Y A;  1FFV A;  1C4A A;  5BMH A;  1IGC A;  3SEB A;  3HRD D;  1FMA D;  1Q10 A;  2RDG A;  3TEZ A;  2AQ1 B;  3ZJU A;  1GOZ A;  1BUI C;  1C76 A;  3OWE B;  1DGJ A;  4C56 C;  1FM0 D;  1HZ5 A;  1K50 A;  2EKI A;  2WXO A;  3U4E G;  3LYY A;  4YSX B;  3HVZ A;  4NZL B;  4ZHP A;  5JXV A;  1YN3 A;  2OHF A;  2K3U A;  3W1S A;  4KGT A;  3URY A;  2CJN A;  2PKO A;  2ZW0 A;  1EM7 A;  1QOF A;  1VZ6 A;  1SE2 A;  2L83 A;  3BVG A;  5G5G A;  4A6Q A;  1C78 A;  1J7B A;  2JXT A;  1F0Z A;  2WU2 B;  2QIL A;  4YXD B;  1VZ7 A;  4NAM A;  2V0G A;  1V8C A;  3KWV A;  1NEN B;  3V05 A;  2JQR B;  3MP9 A;  2BBC A;  4RF0 A;  4DXF A;  1PGA A;  4HKZ E;  3I57 A;  2PVO D;  1D5X C;  4RGM A;  1YNT E;  1T5X D;  3Q8B A;  1L4Z B;  2PLP A;  1PDX A;  3VQI A;  1AYF A;  1CQV A;  3DWG C;  4KX6 B;  3NRZ A;  5EE1 A;  2Y5C A;  2HDE A;  4OZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...