5G6AA

Structure of bacillus subtilis nitric oxide synthase in complex with 7-((3-fluorophenethylamino)ethyl)quinolin-2-amine
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
362
structure length
362
Chain Sequence
EEKEILWNEAKAFIAACYQELGKAAEVKDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPPEEKGEKQVEIWNHQLIRYAGYESDGERIGDPASCSLTAACEELGWRGERTDFDLLPLIFRMKGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDKPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting Bacterial Nitric Oxide Synthase with Aminoquinoline-Based Inhibitors.
pubmed doi rcsb
molecule keywords NITRIC OXIDE SYNTHASE OXYGENASE
molecule tags Oxidoreductase
source organism Bacillus subtilis
total genus 125
structure length 362
sequence length 362
ec nomenclature ec 1.14.14.47: Nitric-oxide synthase (flavodoxin).
pdb deposition date 2016-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02898 NO_synthase Nitric oxide synthase, oxygenase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.340.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase; Chain A, domain 1 Nitric Oxide Synthase; Chain A, domain 1 5g6aA01
3.90.440.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase;Heme Domain; Chain A, domain 2 Nitric Oxide Synthase;Heme Domain;Chain A domain 2 5g6aA02
3.90.1230.10 Alpha Beta Alpha-Beta Complex Bovine Endothelial Nitric Oxide Synthase Heme Domain; Chain: A,domain 3 Nitric Oxide Synthase; Chain A, domain 3 5g6aA03
4IMTA 4UGJA 3PNHA 5AGLA 4UGOA 3EAHA 3NLEA 4KCOA 5G6CA 1OM5A 5AGPA 1M9MA 3SVQA 4UH5A 3RQLA 4D38A 2AN0A 3JX2A 4D3VA 3EBFA 5FVVA 1P6LA 4UH6A 5G66A 3SVPA 4CTUA 1ED6A 1M00A 1DM8A 5ADBA 4UPPA 4KCPA 4LUXA 1ZZQA 4D7JA 2G6OA 4UPRA 4D3KA 1QW4A 3JWUA 5G6QA 3JX1A 2ORTA 1M7VA 4CU1B 4UGXA 3N2RA 4CTWA 4CTPA 3E7SB 3N5YA 5G6BA 3TYLA 3NLRA 5ADMA 4CX2A 1K2UA 4V3YA 4D3JA 4D7HA 4UG8A 5G6KA 4CU1A 4D3UA 4CAQA 3NLJA 1P6NA 4UGRA 4UG6A 5FVYA 5ADDA 4UH4A 4KCRA 1ZZRA 4UHAA 3RQNA 3FC5A 4UGSA 4KCJA 1M9RA 4UGFA 4CX6A 5G6GA 3E7SA 1VAGA 4V3UA 4K5FA 1M9JA 2G6MA 4UGKA 4K5GA 5G68A 3HSNA 4UH7A 1NSIA 1QW5A 4D31A 1JWKA 4JSKA 4UGVA 4D33A 3NLDA 4IMWA 5G6PA 4D2ZA 1RS8A 4UPSA 5FW0A 4LUWA 4K5DA 5ADFA 3B3OA 3NW2A 1DM7A 4UGCA 3PNEA 3UFSA 4CWWA 3N64A 3NLKA 4D3BA 3NLIA 5G6AA 4D37A 3NQSA 1DMIA 1VAFA 3JWYA 5FVOA 1DMJA 4FVZA 1K2SA 5ADKA 3JWZA 3JT4A 3RQJA 4D3IA 1M8IA 1ZVIA 4UGTA 5G0PA 4NSEA 3RQPA 3UFOA 3NLXA 4UGDA 3NSEA 3JX3A 3NLWA 3UFVA 2G6NA 4UG7A 4KCMA 3N5QA 3E6TA 1DD7A 5ADCA 1K2RA 3N6AA 3UFPA 4CX3A 4CDTA 7NSEA 3DQSA 3JWVA 4KCLA 5FVZA 4CTXA 4JSEA 4D35A 4IMUA 4KCNA 5G6NA 3NNZA 4UPTA 1D0CA 5FVXA 5G0NA 1RS7A 4CUMA 1P6HA 4UPMA 4UGGA 1ZZSA 4UH0A 3JT3A 1FOOA 2BHJA 4IMXA 4UH8A 4D32A 3JT9A 1K2TA 4JSMA 5AD7A 5FJ2A 3N60A 1D1WA 5ADJA 1I83A 3EJ8A 4LWBA 4V3ZA 4CARA 5AGNA 5AD6A 1ED4A 1M8DA 4CAMA 1DWVA 1D1YA 3E7MA 5AGMA 3E67A 2ORQA 5G6IA 1M8EA 3NLQA 3N5TA 4D34A 3UFQA 3JX6A 3TYNA 5G6HA 4JS9A 3N6BA 5NSEA 2NODA 3N61A 4D1OA 3JWXA 3JT5A 4KCIA 4V3WA 5FJ3A 1JWJA 3E7IA 3UFUA 5G6EA 4CULA 5FVWA 5G6OA 9NSEA 4C3AA 3E7TA 4CX5A 5FVRA 5FVSA 4CX0A 3UFTA 4FVYA 3NLFA 4UGIA 5G65A 3E65A 4CX7A 2OROA 3N5SA 4KCHA 3HSPA 4CWYA 4D7OA 5AD9A 3JX0A 4CWXA 1DWXA 4UGUA 3NLTA 4CAPA 3NLZA 2FC1A 4EUXA 3JWTA 3N5WA 1LZXA 1RS9A 1QOMA 3E68A 4UGLA 1ED5A 1LZZA 4JSGA 3UFRA 1M9TA 2HX3A 4D1PA 1DM6A 2HX2A 3DWJA 4K5HA 4UGMA 4V3VA 3N63A 2G6HA 4CVGA 3NLMA 5ADLA 2G6LA 1D0OA 2G6IA 3NOSA 2ORSA 3JT7A 1MMVA 3B3MA 4CTQA 3E7GA 1QWCA 3JWWA 4KCKA 5G6FA 4CUNA 1P6IA 4D3AA 4D3OA 4FVXA 4UPQA 5G6JA 3N68A 8NSEA 2HX4A 5G6MA 3N6EA 5G69A 3N5ZA 3PNGA 4D3TA 2NOSA 2FC2A 3RQKA 3N5VA 3EBDA 3E6LA 1M8HA 4CANA 4D30A 3B3NA 1FOIA 4CTTA 3N62A 1N2NA 4C39A 3PNFA 2ORRA 1FOJA 3TYMA 4JSFA 5AD8A 3N6CA 2FLQA 3NNYA 2Y37A 3JTAA 4UCHA 4UPOA 4JSIA 4FW0A 3NLNA 4UGWA 4UG9A 3N5PA 4D3MA 1QW6A 3N5RA 5ADNA 4D39A 3NM0A 4UGNA 5FVTA 4D3NA 4UGAA 3B3PA 1ZVLA 4IMSA 3JX5A 5AD4A 5ADGA 4K5KA 2G6JA 5G6DA 3NLHA 4D36A 3JT6A 1OM4A 3NLOA 3TYOA 4UGHA 5FVQA 1MMWA 3N6GA 1DF1A 3NLGA 3JX4A 3NODA 4UPNA 1NOSA 2AN2A 3UFWA 1NODA 4NOSA 4CX1A 1DWWA 3HSOA 4UH3A 4K5EA 2G6KA 1Q2OA 5AGOA 5FVPA 3RQMA 3NLYA 3E6NA 6NSEA 1ZZUA 2AMOA 1P6KA 4UH1A 4CTVA 4LWAA 3E6OA 4CAOA 5AD5A 3JWSA 4GQEA 5ADEA 4CTZA 3N6DA 1P6JA 1ZZTA 5FVUA 2ORPA 4UGQA 4D1NA 4K5JA 4V3XA 4CWVA 4K5IA 5AGKA 1FOLA 3N66A 3Q99A 4CX4A 4UGYA 3NLPA 4UG5A 4UGEA 4CFTB 4CTYA 4JSHA 3DQTA 4D7IA 4UH9A 4UGPA 5ADIA 3JT8A 2FBZX 3NLUA 5G0OA 3N6FA 3RQOA 3EAIA 4UGBA 4UGZA 2NSEA 4D2YA 1D1VA 3NLVA 3N5XA 1M9QA 3DQRA 3N69A 1FOPA 1MJTA 4CFTA 1D1XA 4CU0A 1DMKA 2NSIA 4JSJA 4CWZA 5ADAA 4KCQA 1M9KA 1NSEA 4UH2A 4UQRA 1NOCA 3Q9AA 5G67A 5G6LA 4FVWA 4CTRA 4KCSA 4UQSA 1R35A 4JSLA 1M7ZA 3N65A 1RS6A 3N67A 1P6MA
chains in the Genus database with same CATH superfamily
4IMTA 4UGJA 3PNHA 5AGLA 4UGOA 3EAHA 3NLEA 4KCOA 5G6CA 1OM5A 5AGPA 1M9MA 3SVQA 4UH5A 3RQLA 4D38A 2AN0A 3JX2A 4D3VA 3EBFA 5FVVA 1P6LA 4UH6A 5G66A 3SVPA 4CTUA 1ED6A 1M00A 1DM8A 5ADBA 4UPPA 4KCPA 4LUXA 1ZZQA 4D7JA 2G6OA 4UPRA 4D3KA 1QW4A 3JWUA 5G6QA 3JX1A 2ORTA 1M7VA 4CU1B 4UGXA 3N2RA 4CTWA 4CTPA 3E7SB 3N5YA 5G6BA 3TYLA 3NLRA 5ADMA 4CX2A 1K2UA 4V3YA 4D3JA 4D7HA 4UG8A 5G6KA 4CU1A 4D3UA 4CAQA 3NLJA 1P6NA 4UGRA 4UG6A 5FVYA 5ADDA 4UH4A 4KCRA 1ZZRA 4UHAA 3RQNA 3FC5A 4UGSA 4KCJA 1M9RA 4UGFA 4CX6A 5G6GA 3E7SA 1VAGA 4V3UA 4K5FA 1M9JA 2G6MA 4UGKA 4K5GA 5G68A 3HSNA 4UH7A 1NSIA 1QW5A 4D31A 1JWKA 4JSKA 4UGVA 4D33A 3NLDA 4IMWA 5G6PA 4D2ZA 1RS8A 4UPSA 5FW0A 4LUWA 4K5DA 5ADFA 3B3OA 3NW2A 1DM7A 4UGCA 3PNEA 3UFSA 4CWWA 3N64A 3NLKA 4D3BA 3NLIA 5G6AA 4D37A 3NQSA 1DMIA 1VAFA 3JWYA 5FVOA 1DMJA 4FVZA 1K2SA 5ADKA 3JWZA 3JT4A 3RQJA 4D3IA 1M8IA 1ZVIA 4UGTA 5G0PA 4NSEA 3RQPA 3UFOA 3NLXA 4UGDA 3NSEA 3JX3A 3NLWA 3UFVA 2G6NA 4UG7A 4KCMA 3N5QA 3E6TA 1DD7A 5ADCA 1K2RA 3N6AA 3UFPA 4CX3A 4CDTA 7NSEA 3DQSA 3JWVA 4KCLA 5FVZA 4CTXA 4JSEA 4D35A 4IMUA 4KCNA 5G6NA 3NNZA 4UPTA 1D0CA 5FVXA 5G0NA 1RS7A 4CUMA 1P6HA 4UPMA 4UGGA 1ZZSA 4UH0A 3JT3A 1FOOA 2BHJA 4IMXA 4UH8A 4D32A 3JT9A 1K2TA 4JSMA 5AD7A 5FJ2A 3N60A 1D1WA 5ADJA 1I83A 3EJ8A 4LWBA 4V3ZA 4CARA 5AGNA 5AD6A 1ED4A 1M8DA 4CAMA 1DWVA 1D1YA 3E7MA 5AGMA 3E67A 2ORQA 5G6IA 1M8EA 3NLQA 3N5TA 4D34A 3UFQA 3JX6A 3TYNA 5G6HA 4JS9A 3N6BA 5NSEA 2NODA 3N61A 4D1OA 3JWXA 3JT5A 4KCIA 4V3WA 5FJ3A 1JWJA 3E7IA 3UFUA 5G6EA 4CULA 5FVWA 5G6OA 9NSEA 4C3AA 3E7TA 4CX5A 5FVRA 5FVSA 4CX0A 3UFTA 4FVYA 3NLFA 4UGIA 5G65A 3E65A 4CX7A 2OROA 3N5SA 4KCHA 3HSPA 4CWYA 4D7OA 5AD9A 3JX0A 4CWXA 1DWXA 4UGUA 3NLTA 4CAPA 3NLZA 2FC1A 4EUXA 3JWTA 3N5WA 1LZXA 1RS9A 1QOMA 3E68A 4UGLA 1ED5A 1LZZA 4JSGA 3UFRA 1M9TA 2HX3A 4D1PA 1DM6A 2HX2A 3DWJA 4K5HA 4UGMA 4V3VA 3N63A 2G6HA 4CVGA 3NLMA 5ADLA 2G6LA 1D0OA 2G6IA 3NOSA 2ORSA 3JT7A 1MMVA 3B3MA 4CTQA 3E7GA 1QWCA 3JWWA 4KCKA 5G6FA 4CUNA 1P6IA 4D3AA 4D3OA 4FVXA 4UPQA 5G6JA 3N68A 8NSEA 2HX4A 5G6MA 3N6EA 5G69A 3N5ZA 3PNGA 4D3TA 2NOSA 2FC2A 3RQKA 3N5VA 3EBDA 3E6LA 1M8HA 4CANA 4D30A 3B3NA 1FOIA 4CTTA 3N62A 1N2NA 4C39A 3PNFA 2ORRA 1FOJA 3TYMA 4JSFA 5AD8A 3N6CA 2FLQA 3NNYA 2Y37A 3JTAA 4UCHA 4UPOA 4JSIA 4FW0A 3NLNA 4UGWA 4UG9A 3N5PA 4D3MA 1QW6A 3N5RA 5ADNA 4D39A 3NM0A 4UGNA 5FVTA 4D3NA 4UGAA 3B3PA 1ZVLA 4IMSA 3JX5A 5AD4A 5ADGA 4K5KA 2G6JA 5G6DA 3NLHA 4D36A 3JT6A 1OM4A 3NLOA 3TYOA 4UGHA 5FVQA 1MMWA 3N6GA 1DF1A 3NLGA 3JX4A 3NODA 4UPNA 1NOSA 2AN2A 3UFWA 1NODA 4NOSA 4CX1A 1DWWA 3HSOA 4UH3A 4K5EA 2G6KA 1Q2OA 5AGOA 5FVPA 3RQMA 3NLYA 3E6NA 6NSEA 1ZZUA 2AMOA 1P6KA 4UH1A 4CTVA 4LWAA 3E6OA 4CAOA 5AD5A 3JWSA 4GQEA 5ADEA 4CTZA 3N6DA 1P6JA 1ZZTA 5FVUA 2ORPA 4UGQA 4D1NA 4K5JA 4V3XA 4CWVA 4K5IA 5AGKA 1FOLA 3N66A 3Q99A 4CX4A 4UGYA 3NLPA 4UG5A 4UGEA 4CFTB 4CTYA 4JSHA 3DQTA 4D7IA 4UH9A 4UGPA 5ADIA 3JT8A 2FBZX 3NLUA 5G0OA 3N6FA 3RQOA 3EAIA 4UGBA 4UGZA 2NSEA 4D2YA 1D1VA 3NLVA 3N5XA 1M9QA 3DQRA 3N69A 1FOPA 1MJTA 4CFTA 1D1XA 4CU0A 1DMKA 2NSIA 4JSJA 4CWZA 5ADAA 4KCQA 1M9KA 1NSEA 4UH2A 4UQRA 1NOCA 3Q9AA 5G67A 5G6LA 4FVWA 4CTRA 4KCSA 4UQSA 1R35A 4JSLA 1M7ZA 3N65A 1RS6A 3N67A 1P6MA
chains in the Genus database with same CATH topology
4IMTA 4UGJA 3PNHA 5AGLA 4UGOA 3EAHA 3NLEA 4KCOA 5G6CA 1OM5A 5AGPA 1M9MA 3SVQA 4UH5A 3RQLA 4D38A 2AN0A 3JX2A 4D3VA 3EBFA 5FVVA 1P6LA 4UH6A 5G66A 3SVPA 4CTUA 1ED6A 1M00A 1DM8A 5ADBA 4UPPA 4KCPA 4LUXA 1ZZQA 4D7JA 2G6OA 4UPRA 4D3KA 1QW4A 3JWUA 5G6QA 3JX1A 2ORTA 1M7VA 4CU1B 4UGXA 3N2RA 4CTWA 4CTPA 3E7SB 3N5YA 5G6BA 3TYLA 3NLRA 5ADMA 4CX2A 1K2UA 4V3YA 4D3JA 4D7HA 4UG8A 5G6KA 4CU1A 4D3UA 4CAQA 3NLJA 1P6NA 4UGRA 4UG6A 5FVYA 5ADDA 4UH4A 4KCRA 1ZZRA 4UHAA 3RQNA 3FC5A 4UGSA 4KCJA 1M9RA 4UGFA 4CX6A 5G6GA 3E7SA 1VAGA 4V3UA 4K5FA 1M9JA 2G6MA 4UGKA 4K5GA 5G68A 3HSNA 4UH7A 1NSIA 1QW5A 4D31A 1JWKA 4JSKA 4UGVA 4D33A 3NLDA 4IMWA 5G6PA 4D2ZA 1RS8A 4UPSA 5FW0A 4LUWA 4K5DA 5ADFA 3B3OA 3NW2A 1DM7A 4UGCA 3PNEA 3UFSA 4CWWA 3N64A 3NLKA 4D3BA 3NLIA 5G6AA 4D37A 3NQSA 1DMIA 1VAFA 3JWYA 5FVOA 1DMJA 4FVZA 1K2SA 5ADKA 3JWZA 3JT4A 3RQJA 4D3IA 1M8IA 1ZVIA 4UGTA 5G0PA 4NSEA 3RQPA 3UFOA 3NLXA 4UGDA 3NSEA 3JX3A 3NLWA 3UFVA 2G6NA 4UG7A 4KCMA 3N5QA 3E6TA 1DD7A 5ADCA 1K2RA 3N6AA 3UFPA 4CX3A 4CDTA 7NSEA 3DQSA 3JWVA 4KCLA 5FVZA 4CTXA 4JSEA 4D35A 4IMUA 4KCNA 5G6NA 3NNZA 4UPTA 1D0CA 5FVXA 5G0NA 1RS7A 4CUMA 1P6HA 4UPMA 4UGGA 1ZZSA 4UH0A 3JT3A 1FOOA 2BHJA 4IMXA 4UH8A 4D32A 3JT9A 1K2TA 4JSMA 5AD7A 5FJ2A 3N60A 1D1WA 5ADJA 1I83A 3EJ8A 4LWBA 4V3ZA 4CARA 5AGNA 5AD6A 1ED4A 1M8DA 4CAMA 1DWVA 1D1YA 3E7MA 5AGMA 3E67A 2ORQA 5G6IA 1M8EA 3NLQA 3N5TA 4D34A 3UFQA 3JX6A 3TYNA 5G6HA 4JS9A 3N6BA 5NSEA 2NODA 3N61A 4D1OA 3JWXA 3JT5A 4KCIA 4V3WA 5FJ3A 1JWJA 3E7IA 3UFUA 5G6EA 4CULA 5FVWA 5G6OA 9NSEA 4C3AA 3E7TA 4CX5A 5FVRA 5FVSA 4CX0A 3UFTA 4FVYA 3NLFA 4UGIA 5G65A 3E65A 4CX7A 2OROA 3N5SA 4KCHA 3HSPA 4CWYA 4D7OA 5AD9A 3JX0A 4CWXA 1DWXA 4UGUA 3NLTA 4CAPA 3NLZA 2FC1A 4EUXA 3JWTA 3N5WA 1LZXA 1RS9A 1QOMA 3E68A 4UGLA 1ED5A 1LZZA 4JSGA 3UFRA 1M9TA 2HX3A 4D1PA 1DM6A 2HX2A 3DWJA 4K5HA 4UGMA 4V3VA 3N63A 2G6HA 4CVGA 3NLMA 5ADLA 2G6LA 1D0OA 2G6IA 3NOSA 2ORSA 3JT7A 1MMVA 3B3MA 4CTQA 3E7GA 1QWCA 3JWWA 4KCKA 5G6FA 4CUNA 1P6IA 4D3AA 4D3OA 4FVXA 4UPQA 5G6JA 3N68A 8NSEA 2HX4A 5G6MA 3N6EA 5G69A 3N5ZA 3PNGA 4D3TA 2NOSA 2FC2A 3RQKA 3N5VA 3EBDA 3E6LA 1M8HA 4CANA 4D30A 3B3NA 1FOIA 4CTTA 3N62A 1N2NA 4C39A 3PNFA 2ORRA 1FOJA 3TYMA 4JSFA 5AD8A 3N6CA 2FLQA 3NNYA 2Y37A 3JTAA 4UCHA 4UPOA 4JSIA 4FW0A 3NLNA 4UGWA 4UG9A 3N5PA 4D3MA 1QW6A 3N5RA 5ADNA 4D39A 3NM0A 4UGNA 5FVTA 4D3NA 4UGAA 3B3PA 1ZVLA 4IMSA 3JX5A 5AD4A 5ADGA 4K5KA 2G6JA 5G6DA 3NLHA 4D36A 3JT6A 1OM4A 3NLOA 3TYOA 4UGHA 5FVQA 1MMWA 3N6GA 1DF1A 3NLGA 3JX4A 3NODA 4UPNA 1NOSA 2AN2A 3UFWA 1NODA 4NOSA 4CX1A 1DWWA 3HSOA 4UH3A 4K5EA 2G6KA 1Q2OA 5AGOA 5FVPA 3RQMA 3NLYA 3E6NA 6NSEA 1ZZUA 2AMOA 1P6KA 4UH1A 4CTVA 4LWAA 3E6OA 4CAOA 5AD5A 3JWSA 4GQEA 5ADEA 4CTZA 3N6DA 1P6JA 1ZZTA 5FVUA 2ORPA 4UGQA 4D1NA 4K5JA 4V3XA 4CWVA 4K5IA 5AGKA 1FOLA 3N66A 3Q99A 4CX4A 4UGYA 3NLPA 4UG5A 4UGEA 4CFTB 4CTYA 4JSHA 3DQTA 4D7IA 4UH9A 4UGPA 5ADIA 3JT8A 2FBZX 3NLUA 5G0OA 3N6FA 3RQOA 3EAIA 4UGBA 4UGZA 2NSEA 4D2YA 1D1VA 3NLVA 3N5XA 1M9QA 3DQRA 3N69A 1FOPA 1MJTA 4CFTA 1D1XA 4CU0A 1DMKA 2NSIA 4JSJA 4CWZA 5ADAA 4KCQA 1M9KA 1NSEA 4UH2A 4UQRA 1NOCA 3Q9AA 5G67A 5G6LA 4FVWA 4CTRA 4KCSA 4UQSA 1R35A 4JSLA 1M7ZA 3N65A 1RS6A 3N67A 1P6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IMT A;  4UGJ A;  3PNH A;  5AGL A;  4UGO A;  3EAH A;  3NLE A;  4KCO A;  5G6C A;  1OM5 A;  5AGP A;  1M9M A;  3SVQ A;  4UH5 A;  3RQL A;  4D38 A;  2AN0 A;  3JX2 A;  4D3V A;  3EBF A;  5FVV A;  1P6L A;  4UH6 A;  5G66 A;  3SVP A;  4CTU A;  1ED6 A;  1M00 A;  1DM8 A;  5ADB A;  4UPP A;  4KCP A;  4LUX A;  1ZZQ A;  4D7J A;  2G6O A;  4UPR A;  4D3K A;  1QW4 A;  3JWU A;  5G6Q A;  3JX1 A;  2ORT A;  1M7V A;  4CU1 B;  4UGX A;  3N2R A;  4CTW A;  4CTP A;  3E7S B;  3N5Y A;  5G6B A;  3TYL A;  3NLR A;  5ADM A;  4CX2 A;  1K2U A;  4V3Y A;  4D3J A;  4D7H A;  4UG8 A;  5G6K A;  4CU1 A;  4D3U A;  4CAQ A;  3NLJ A;  1P6N A;  4UGR A;  4UG6 A;  5FVY A;  5ADD A;  4UH4 A;  4KCR A;  1ZZR A;  4UHA A;  3RQN A;  3FC5 A;  4UGS A;  4KCJ A;  1M9R A;  4UGF A;  4CX6 A;  5G6G A;  3E7S A;  1VAG A;  4V3U A;  4K5F A;  1M9J A;  2G6M A;  4UGK A;  4K5G A;  5G68 A;  3HSN A;  4UH7 A;  1NSI A;  1QW5 A;  4D31 A;  1JWK A;  4JSK A;  4UGV A;  4D33 A;  3NLD A;  4IMW A;  5G6P A;  4D2Z A;  1RS8 A;  4UPS A;  5FW0 A;  4LUW A;  4K5D A;  5ADF A;  3B3O A;  3NW2 A;  1DM7 A;  4UGC A;  3PNE A;  3UFS A;  4CWW A;  3N64 A;  3NLK A;  4D3B A;  3NLI A;  5G6A A;  4D37 A;  3NQS A;  1DMI A;  1VAF A;  3JWY A;  5FVO A;  1DMJ A;  4FVZ A;  1K2S A;  5ADK A;  3JWZ A;  3JT4 A;  3RQJ A;  4D3I A;  1M8I A;  1ZVI A;  4UGT A;  5G0P A;  4NSE A;  3RQP A;  3UFO A;  3NLX A;  4UGD A;  3NSE A;  3JX3 A;  3NLW A;  3UFV A;  2G6N A;  4UG7 A;  4KCM A;  3N5Q A;  3E6T A;  1DD7 A;  5ADC A;  1K2R A;  3N6A A;  3UFP A;  4CX3 A;  4CDT A;  7NSE A;  3DQS A;  3JWV A;  4KCL A;  5FVZ A;  4CTX A;  4JSE A;  4D35 A;  4IMU A;  4KCN A;  5G6N A;  3NNZ A;  4UPT A;  1D0C A;  5FVX A;  5G0N A;  1RS7 A;  4CUM A;  1P6H A;  4UPM A;  4UGG A;  1ZZS A;  4UH0 A;  3JT3 A;  1FOO A;  2BHJ A;  4IMX A;  4UH8 A;  4D32 A;  3JT9 A;  1K2T A;  4JSM A;  5AD7 A;  5FJ2 A;  3N60 A;  1D1W A;  5ADJ A;  1I83 A;  3EJ8 A;  4LWB A;  4V3Z A;  4CAR A;  5AGN A;  5AD6 A;  1ED4 A;  1M8D A;  4CAM A;  1DWV A;  1D1Y A;  3E7M A;  5AGM A;  3E67 A;  2ORQ A;  5G6I A;  1M8E A;  3NLQ A;  3N5T A;  4D34 A;  3UFQ A;  3JX6 A;  3TYN A;  5G6H A;  4JS9 A;  3N6B A;  5NSE A;  2NOD A;  3N61 A;  4D1O A;  3JWX A;  3JT5 A;  4KCI A;  4V3W A;  5FJ3 A;  1JWJ A;  3E7I A;  3UFU A;  5G6E A;  4CUL A;  5FVW A;  5G6O A;  9NSE A;  4C3A A;  3E7T A;  4CX5 A;  5FVR A;  5FVS A;  4CX0 A;  3UFT A;  4FVY A;  3NLF A;  4UGI A;  5G65 A;  3E65 A;  4CX7 A;  2ORO A;  3N5S A;  4KCH A;  3HSP A;  4CWY A;  4D7O A;  5AD9 A;  3JX0 A;  4CWX A;  1DWX A;  4UGU A;  3NLT A;  4CAP A;  3NLZ A;  2FC1 A;  4EUX A;  3JWT A;  3N5W A;  1LZX A;  1RS9 A;  1QOM A;  3E68 A;  4UGL A;  1ED5 A;  1LZZ A;  4JSG A;  3UFR A;  1M9T A;  2HX3 A;  4D1P A;  1DM6 A;  2HX2 A;  3DWJ A;  4K5H A;  4UGM A;  4V3V A;  3N63 A;  2G6H A;  4CVG A;  3NLM A;  5ADL A;  2G6L A;  1D0O A;  2G6I A;  3NOS A;  2ORS A;  3JT7 A;  1MMV A;  3B3M A;  4CTQ A;  3E7G A;  1QWC A;  3JWW A;  4KCK A;  5G6F A;  4CUN A;  1P6I A;  4D3A A;  4D3O A;  4FVX A;  4UPQ A;  5G6J A;  3N68 A;  8NSE A;  2HX4 A;  5G6M A;  3N6E A;  5G69 A;  3N5Z A;  3PNG A;  4D3T A;  2NOS A;  2FC2 A;  3RQK A;  3N5V A;  3EBD A;  3E6L A;  1M8H A;  4CAN A;  4D30 A;  3B3N A;  1FOI A;  4CTT A;  3N62 A;  1N2N A;  4C39 A;  3PNF A;  2ORR A;  1FOJ A;  3TYM A;  4JSF A;  5AD8 A;  3N6C A;  2FLQ A;  3NNY A;  2Y37 A;  3JTA A;  4UCH A;  4UPO A;  4JSI A;  4FW0 A;  3NLN A;  4UGW A;  4UG9 A;  3N5P A;  4D3M A;  1QW6 A;  3N5R A;  5ADN A;  4D39 A;  3NM0 A;  4UGN A;  5FVT A;  4D3N A;  4UGA A;  3B3P A;  1ZVL A;  4IMS A;  3JX5 A;  5AD4 A;  5ADG A;  4K5K A;  2G6J A;  5G6D A;  3NLH A;  4D36 A;  3JT6 A;  1OM4 A;  3NLO A;  3TYO A;  4UGH A;  5FVQ A;  1MMW A;  3N6G A;  1DF1 A;  3NLG A;  3JX4 A;  3NOD A;  4UPN A;  1NOS A;  2AN2 A;  3UFW A;  1NOD A;  4NOS A;  4CX1 A;  1DWW A;  3HSO A;  4UH3 A;  4K5E A;  2G6K A;  1Q2O A;  5AGO A;  5FVP A;  3RQM A;  3NLY A;  3E6N A;  6NSE A;  1ZZU A;  2AMO A;  1P6K A;  4UH1 A;  4CTV A;  4LWA A;  3E6O A;  4CAO A;  5AD5 A;  3JWS A;  4GQE A;  5ADE A;  4CTZ A;  3N6D A;  1P6J A;  1ZZT A;  5FVU A;  2ORP A;  4UGQ A;  4D1N A;  4K5J A;  4V3X A;  4CWV A;  4K5I A;  5AGK A;  1FOL A;  3N66 A;  3Q99 A;  4CX4 A;  4UGY A;  3NLP A;  4UG5 A;  4UGE A;  4CFT B;  4CTY A;  4JSH A;  3DQT A;  4D7I A;  4UH9 A;  4UGP A;  5ADI A;  3JT8 A;  2FBZ X;  3NLU A;  5G0O A;  3N6F A;  3RQO A;  3EAI A;  4UGB A;  4UGZ A;  2NSE A;  4D2Y A;  1D1V A;  3NLV A;  3N5X A;  1M9Q A;  3DQR A;  3N69 A;  1FOP A;  1MJT A;  4CFT A;  1D1X A;  4CU0 A;  1DMK A;  2NSI A;  4JSJ A;  4CWZ A;  5ADA A;  4KCQ A;  1M9K A;  1NSE A;  4UH2 A;  4UQR A;  1NOC A;  3Q9A A;  5G67 A;  5G6L A;  4FVW A;  4CTR A;  4KCS A;  4UQS A;  1R35 A;  4JSL A;  1M7Z A;  3N65 A;  1RS6 A;  3N67 A;  1P6M A; 
#chains in the Genus database with same CATH topology
 4IMT A;  4UGJ A;  3PNH A;  5AGL A;  4UGO A;  3EAH A;  3NLE A;  4KCO A;  5G6C A;  1OM5 A;  5AGP A;  1M9M A;  3SVQ A;  4UH5 A;  3RQL A;  4D38 A;  2AN0 A;  3JX2 A;  4D3V A;  3EBF A;  5FVV A;  1P6L A;  4UH6 A;  5G66 A;  3SVP A;  4CTU A;  1ED6 A;  1M00 A;  1DM8 A;  5ADB A;  4UPP A;  4KCP A;  4LUX A;  1ZZQ A;  4D7J A;  2G6O A;  4UPR A;  4D3K A;  1QW4 A;  3JWU A;  5G6Q A;  3JX1 A;  2ORT A;  1M7V A;  4CU1 B;  4UGX A;  3N2R A;  4CTW A;  4CTP A;  3E7S B;  3N5Y A;  5G6B A;  3TYL A;  3NLR A;  5ADM A;  4CX2 A;  1K2U A;  4V3Y A;  4D3J A;  4D7H A;  4UG8 A;  5G6K A;  4CU1 A;  4D3U A;  4CAQ A;  3NLJ A;  1P6N A;  4UGR A;  4UG6 A;  5FVY A;  5ADD A;  4UH4 A;  4KCR A;  1ZZR A;  4UHA A;  3RQN A;  3FC5 A;  4UGS A;  4KCJ A;  1M9R A;  4UGF A;  4CX6 A;  5G6G A;  3E7S A;  1VAG A;  4V3U A;  4K5F A;  1M9J A;  2G6M A;  4UGK A;  4K5G A;  5G68 A;  3HSN A;  4UH7 A;  1NSI A;  1QW5 A;  4D31 A;  1JWK A;  4JSK A;  4UGV A;  4D33 A;  3NLD A;  4IMW A;  5G6P A;  4D2Z A;  1RS8 A;  4UPS A;  5FW0 A;  4LUW A;  4K5D A;  5ADF A;  3B3O A;  3NW2 A;  1DM7 A;  4UGC A;  3PNE A;  3UFS A;  4CWW A;  3N64 A;  3NLK A;  4D3B A;  3NLI A;  5G6A A;  4D37 A;  3NQS A;  1DMI A;  1VAF A;  3JWY A;  5FVO A;  1DMJ A;  4FVZ A;  1K2S A;  5ADK A;  3JWZ A;  3JT4 A;  3RQJ A;  4D3I A;  1M8I A;  1ZVI A;  4UGT A;  5G0P A;  4NSE A;  3RQP A;  3UFO A;  3NLX A;  4UGD A;  3NSE A;  3JX3 A;  3NLW A;  3UFV A;  2G6N A;  4UG7 A;  4KCM A;  3N5Q A;  3E6T A;  1DD7 A;  5ADC A;  1K2R A;  3N6A A;  3UFP A;  4CX3 A;  4CDT A;  7NSE A;  3DQS A;  3JWV A;  4KCL A;  5FVZ A;  4CTX A;  4JSE A;  4D35 A;  4IMU A;  4KCN A;  5G6N A;  3NNZ A;  4UPT A;  1D0C A;  5FVX A;  5G0N A;  1RS7 A;  4CUM A;  1P6H A;  4UPM A;  4UGG A;  1ZZS A;  4UH0 A;  3JT3 A;  1FOO A;  2BHJ A;  4IMX A;  4UH8 A;  4D32 A;  3JT9 A;  1K2T A;  4JSM A;  5AD7 A;  5FJ2 A;  3N60 A;  1D1W A;  5ADJ A;  1I83 A;  3EJ8 A;  4LWB A;  4V3Z A;  4CAR A;  5AGN A;  5AD6 A;  1ED4 A;  1M8D A;  4CAM A;  1DWV A;  1D1Y A;  3E7M A;  5AGM A;  3E67 A;  2ORQ A;  5G6I A;  1M8E A;  3NLQ A;  3N5T A;  4D34 A;  3UFQ A;  3JX6 A;  3TYN A;  5G6H A;  4JS9 A;  3N6B A;  5NSE A;  2NOD A;  3N61 A;  4D1O A;  3JWX A;  3JT5 A;  4KCI A;  4V3W A;  5FJ3 A;  1JWJ A;  3E7I A;  3UFU A;  5G6E A;  4CUL A;  5FVW A;  5G6O A;  9NSE A;  4C3A A;  3E7T A;  4CX5 A;  5FVR A;  5FVS A;  4CX0 A;  3UFT A;  4FVY A;  3NLF A;  4UGI A;  5G65 A;  3E65 A;  4CX7 A;  2ORO A;  3N5S A;  4KCH A;  3HSP A;  4CWY A;  4D7O A;  5AD9 A;  3JX0 A;  4CWX A;  1DWX A;  4UGU A;  3NLT A;  4CAP A;  3NLZ A;  2FC1 A;  4EUX A;  3JWT A;  3N5W A;  1LZX A;  1RS9 A;  1QOM A;  3E68 A;  4UGL A;  1ED5 A;  1LZZ A;  4JSG A;  3UFR A;  1M9T A;  2HX3 A;  4D1P A;  1DM6 A;  2HX2 A;  3DWJ A;  4K5H A;  4UGM A;  4V3V A;  3N63 A;  2G6H A;  4CVG A;  3NLM A;  5ADL A;  2G6L A;  1D0O A;  2G6I A;  3NOS A;  2ORS A;  3JT7 A;  1MMV A;  3B3M A;  4CTQ A;  3E7G A;  1QWC A;  3JWW A;  4KCK A;  5G6F A;  4CUN A;  1P6I A;  4D3A A;  4D3O A;  4FVX A;  4UPQ A;  5G6J A;  3N68 A;  8NSE A;  2HX4 A;  5G6M A;  3N6E A;  5G69 A;  3N5Z A;  3PNG A;  4D3T A;  2NOS A;  2FC2 A;  3RQK A;  3N5V A;  3EBD A;  3E6L A;  1M8H A;  4CAN A;  4D30 A;  3B3N A;  1FOI A;  4CTT A;  3N62 A;  1N2N A;  4C39 A;  3PNF A;  2ORR A;  1FOJ A;  3TYM A;  4JSF A;  5AD8 A;  3N6C A;  2FLQ A;  3NNY A;  2Y37 A;  3JTA A;  4UCH A;  4UPO A;  4JSI A;  4FW0 A;  3NLN A;  4UGW A;  4UG9 A;  3N5P A;  4D3M A;  1QW6 A;  3N5R A;  5ADN A;  4D39 A;  3NM0 A;  4UGN A;  5FVT A;  4D3N A;  4UGA A;  3B3P A;  1ZVL A;  4IMS A;  3JX5 A;  5AD4 A;  5ADG A;  4K5K A;  2G6J A;  5G6D A;  3NLH A;  4D36 A;  3JT6 A;  1OM4 A;  3NLO A;  3TYO A;  4UGH A;  5FVQ A;  1MMW A;  3N6G A;  1DF1 A;  3NLG A;  3JX4 A;  3NOD A;  4UPN A;  1NOS A;  2AN2 A;  3UFW A;  1NOD A;  4NOS A;  4CX1 A;  1DWW A;  3HSO A;  4UH3 A;  4K5E A;  2G6K A;  1Q2O A;  5AGO A;  5FVP A;  3RQM A;  3NLY A;  3E6N A;  6NSE A;  1ZZU A;  2AMO A;  1P6K A;  4UH1 A;  4CTV A;  4LWA A;  3E6O A;  4CAO A;  5AD5 A;  3JWS A;  4GQE A;  5ADE A;  4CTZ A;  3N6D A;  1P6J A;  1ZZT A;  5FVU A;  2ORP A;  4UGQ A;  4D1N A;  4K5J A;  4V3X A;  4CWV A;  4K5I A;  5AGK A;  1FOL A;  3N66 A;  3Q99 A;  4CX4 A;  4UGY A;  3NLP A;  4UG5 A;  4UGE A;  4CFT B;  4CTY A;  4JSH A;  3DQT A;  4D7I A;  4UH9 A;  4UGP A;  5ADI A;  3JT8 A;  2FBZ X;  3NLU A;  5G0O A;  3N6F A;  3RQO A;  3EAI A;  4UGB A;  4UGZ A;  2NSE A;  4D2Y A;  1D1V A;  3NLV A;  3N5X A;  1M9Q A;  3DQR A;  3N69 A;  1FOP A;  1MJT A;  4CFT A;  1D1X A;  4CU0 A;  1DMK A;  2NSI A;  4JSJ A;  4CWZ A;  5ADA A;  4KCQ A;  1M9K A;  1NSE A;  4UH2 A;  4UQR A;  1NOC A;  3Q9A A;  5G67 A;  5G6L A;  4FVW A;  4CTR A;  4KCS A;  4UQS A;  1R35 A;  4JSL A;  1M7Z A;  3N65 A;  1RS6 A;  3N67 A;  1P6M A; 
#chains in the Genus database with same CATH homology
 4IMT A;  4UGJ A;  3PNH A;  5AGL A;  4UGO A;  3EAH A;  3NLE A;  4KCO A;  5G6C A;  1OM5 A;  5AGP A;  1M9M A;  3SVQ A;  4UH5 A;  3RQL A;  4D38 A;  2AN0 A;  3JX2 A;  4D3V A;  3EBF A;  5FVV A;  1P6L A;  4UH6 A;  5G66 A;  3SVP A;  4CTU A;  1ED6 A;  1M00 A;  1DM8 A;  5ADB A;  4UPP A;  4KCP A;  4LUX A;  1ZZQ A;  4D7J A;  2G6O A;  4UPR A;  4D3K A;  1QW4 A;  3JWU A;  5G6Q A;  3JX1 A;  2ORT A;  1M7V A;  4CU1 B;  4UGX A;  3N2R A;  4CTW A;  4CTP A;  3E7S B;  3N5Y A;  5G6B A;  3TYL A;  3NLR A;  5ADM A;  4CX2 A;  1K2U A;  4V3Y A;  4D3J A;  4D7H A;  4UG8 A;  5G6K A;  4CU1 A;  4D3U A;  4CAQ A;  3NLJ A;  1P6N A;  4UGR A;  4UG6 A;  5FVY A;  5ADD A;  4UH4 A;  4KCR A;  1ZZR A;  4UHA A;  3RQN A;  3FC5 A;  4UGS A;  4KCJ A;  1M9R A;  4UGF A;  4CX6 A;  5G6G A;  3E7S A;  1VAG A;  4V3U A;  4K5F A;  1M9J A;  2G6M A;  4UGK A;  4K5G A;  5G68 A;  3HSN A;  4UH7 A;  1NSI A;  1QW5 A;  4D31 A;  1JWK A;  4JSK A;  4UGV A;  4D33 A;  3NLD A;  4IMW A;  5G6P A;  4D2Z A;  1RS8 A;  4UPS A;  5FW0 A;  4LUW A;  4K5D A;  5ADF A;  3B3O A;  3NW2 A;  1DM7 A;  4UGC A;  3PNE A;  3UFS A;  4CWW A;  3N64 A;  3NLK A;  4D3B A;  3NLI A;  5G6A A;  4D37 A;  3NQS A;  1DMI A;  1VAF A;  3JWY A;  5FVO A;  1DMJ A;  4FVZ A;  1K2S A;  5ADK A;  3JWZ A;  3JT4 A;  3RQJ A;  4D3I A;  1M8I A;  1ZVI A;  4UGT A;  5G0P A;  4NSE A;  3RQP A;  3UFO A;  3NLX A;  4UGD A;  3NSE A;  3JX3 A;  3NLW A;  3UFV A;  2G6N A;  4UG7 A;  4KCM A;  3N5Q A;  3E6T A;  1DD7 A;  5ADC A;  1K2R A;  3N6A A;  3UFP A;  4CX3 A;  4CDT A;  7NSE A;  3DQS A;  3JWV A;  4KCL A;  5FVZ A;  4CTX A;  4JSE A;  4D35 A;  4IMU A;  4KCN A;  5G6N A;  3NNZ A;  4UPT A;  1D0C A;  5FVX A;  5G0N A;  1RS7 A;  4CUM A;  1P6H A;  4UPM A;  4UGG A;  1ZZS A;  4UH0 A;  3JT3 A;  1FOO A;  2BHJ A;  4IMX A;  4UH8 A;  4D32 A;  3JT9 A;  1K2T A;  4JSM A;  5AD7 A;  5FJ2 A;  3N60 A;  1D1W A;  5ADJ A;  1I83 A;  3EJ8 A;  4LWB A;  4V3Z A;  4CAR A;  5AGN A;  5AD6 A;  1ED4 A;  1M8D A;  4CAM A;  1DWV A;  1D1Y A;  3E7M A;  5AGM A;  3E67 A;  2ORQ A;  5G6I A;  1M8E A;  3NLQ A;  3N5T A;  4D34 A;  3UFQ A;  3JX6 A;  3TYN A;  5G6H A;  4JS9 A;  3N6B A;  5NSE A;  2NOD A;  3N61 A;  4D1O A;  3JWX A;  3JT5 A;  4KCI A;  4V3W A;  5FJ3 A;  1JWJ A;  3E7I A;  3UFU A;  5G6E A;  4CUL A;  5FVW A;  5G6O A;  9NSE A;  4C3A A;  3E7T A;  4CX5 A;  5FVR A;  5FVS A;  4CX0 A;  3UFT A;  4FVY A;  3NLF A;  4UGI A;  5G65 A;  3E65 A;  4CX7 A;  2ORO A;  3N5S A;  4KCH A;  3HSP A;  4CWY A;  4D7O A;  5AD9 A;  3JX0 A;  4CWX A;  1DWX A;  4UGU A;  3NLT A;  4CAP A;  3NLZ A;  2FC1 A;  4EUX A;  3JWT A;  3N5W A;  1LZX A;  1RS9 A;  1QOM A;  3E68 A;  4UGL A;  1ED5 A;  1LZZ A;  4JSG A;  3UFR A;  1M9T A;  2HX3 A;  4D1P A;  1DM6 A;  2HX2 A;  3DWJ A;  4K5H A;  4UGM A;  4V3V A;  3N63 A;  2G6H A;  4CVG A;  3NLM A;  5ADL A;  2G6L A;  1D0O A;  2G6I A;  3NOS A;  2ORS A;  3JT7 A;  1MMV A;  3B3M A;  4CTQ A;  3E7G A;  1QWC A;  3JWW A;  4KCK A;  5G6F A;  4CUN A;  1P6I A;  4D3A A;  4D3O A;  4FVX A;  4UPQ A;  5G6J A;  3N68 A;  8NSE A;  2HX4 A;  5G6M A;  3N6E A;  5G69 A;  3N5Z A;  3PNG A;  4D3T A;  2NOS A;  2FC2 A;  3RQK A;  3N5V A;  3EBD A;  3E6L A;  1M8H A;  4CAN A;  4D30 A;  3B3N A;  1FOI A;  4CTT A;  3N62 A;  1N2N A;  4C39 A;  3PNF A;  2ORR A;  1FOJ A;  3TYM A;  4JSF A;  5AD8 A;  3N6C A;  2FLQ A;  3NNY A;  2Y37 A;  3JTA A;  4UCH A;  4UPO A;  4JSI A;  4FW0 A;  3NLN A;  4UGW A;  4UG9 A;  3N5P A;  4D3M A;  1QW6 A;  3N5R A;  5ADN A;  4D39 A;  3NM0 A;  4UGN A;  5FVT A;  4D3N A;  4UGA A;  3B3P A;  1ZVL A;  4IMS A;  3JX5 A;  5AD4 A;  5ADG A;  4K5K A;  2G6J A;  5G6D A;  3NLH A;  4D36 A;  3JT6 A;  1OM4 A;  3NLO A;  3TYO A;  4UGH A;  5FVQ A;  1MMW A;  3N6G A;  1DF1 A;  3NLG A;  3JX4 A;  3NOD A;  4UPN A;  1NOS A;  2AN2 A;  3UFW A;  1NOD A;  4NOS A;  4CX1 A;  1DWW A;  3HSO A;  4UH3 A;  4K5E A;  2G6K A;  1Q2O A;  5AGO A;  5FVP A;  3RQM A;  3NLY A;  3E6N A;  6NSE A;  1ZZU A;  2AMO A;  1P6K A;  4UH1 A;  4CTV A;  4LWA A;  3E6O A;  4CAO A;  5AD5 A;  3JWS A;  4GQE A;  5ADE A;  4CTZ A;  3N6D A;  1P6J A;  1ZZT A;  5FVU A;  2ORP A;  4UGQ A;  4D1N A;  4K5J A;  4V3X A;  4CWV A;  4K5I A;  5AGK A;  1FOL A;  3N66 A;  3Q99 A;  4CX4 A;  4UGY A;  3NLP A;  4UG5 A;  4UGE A;  4CFT B;  4CTY A;  4JSH A;  3DQT A;  4D7I A;  4UH9 A;  4UGP A;  5ADI A;  3JT8 A;  2FBZ X;  3NLU A;  5G0O A;  3N6F A;  3RQO A;  3EAI A;  4UGB A;  4UGZ A;  2NSE A;  4D2Y A;  1D1V A;  3NLV A;  3N5X A;  1M9Q A;  3DQR A;  3N69 A;  1FOP A;  1MJT A;  4CFT A;  1D1X A;  4CU0 A;  1DMK A;  2NSI A;  4JSJ A;  4CWZ A;  5ADA A;  4KCQ A;  1M9K A;  1NSE A;  4UH2 A;  4UQR A;  1NOC A;  3Q9A A;  5G67 A;  5G6L A;  4FVW A;  4CTR A;  4KCS A;  4UQS A;  1R35 A;  4JSL A;  1M7Z A;  3N65 A;  1RS6 A;  3N67 A;  1P6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...