5GAEI

Rnc in complex with a translocating secyeg
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
125
Chain Sequence
ALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYVTEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQIDRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S rRNA
publication title Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2015-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00466 Ribosomal_L10 Ribosomal protein L10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5gaeI00
3J7Z5 5GAHI 1ZAWA 5GAGI 3J7YI 4NWBA 5GAEI 5D6GA 5GADI 4UY85 5D8HB 4V19J 3A1YG 1ZAVA 2QA4G 3JSYA 1ZAXA
chains in the Genus database with same CATH superfamily
3M7VA 2XZDB 4ELVA 4USIA 4OHYA 4WE1A 2BQ3A 1QE1B 3BN7A 4NLDA 1WF1A 1NPPA 3BQ0A 1DBDA 2CQ1A 3HM9A 4NZ7A 3CCVS 1OO0B 3AODA 4TU9A 3CCTA 3P45B 5B0BA 1IQZA 4PQUA 5CYQA 2LYVA 1HW8A 4JI3F 2RRAA 2OEKA 3MI7X 1TZ0A 4RU2A 4CYUB 2ZKUA 1LQ9A 2ZBRA 2HHUA 3FVYA 4LBPA 3K57A 4OYMA 1UW4A 3PDNA 2AJ1A 3PTWA 2EPIA 3BH6B 1IXKA 3ZZUA 3IR5B 4OZNA 2FC8A 2IBOA 2LKZA 3I96A 4PAAA 4USHA 1VQMS 4ANDA 3K7RA 3KJFB 2OHDA 2HHQA 3CPWR 5I3UA 2UXCF 2HS3A 4O3SA 5IT4A 1IBMJ 2LQ8A 4BBYA 5IWAJ 4RUAA 3MM9A 4M5NA 3IRXA 2B5JA 1AFJA 1EQMA 2VUGA 4YY3J 4M5JA 3PKYA 3CDAA 2B4OA 3LUYA 2HNZB 3GMGA 1KQFB 2D3OR 3KG0A 1AT1B 4ZHRA 3P5BP 1GFWB 2MQNA 4X4TA 4ZJLA 2ZM6F 4I1TA 5A8KA 1ZM3A 2J0WA 4E2FB 5MLCV 3QZ7A 4RKUC 3BSOA 1K9MT 4ZA1A 2B6AB 4F02A 3V4IA 2R3VA 1EHWA 3L7OA 5IZHA 5DDOC 3GQCA 2RUGA 2E5LF 4R8UB 2HQDA 4MKVA 1UFWA 1F9HA 4DV6F 2IDEA 5I3UB 5B0AA 3MR6A 3IRXB 4M1KA 2RQ4A 4DBQA 3DLJA 4QR2A 2B4VA 4DG1A 4FKXA 3ZZTA 2KFZA 4HLBA 4UY85 3NBPA 2LLZA 3Q86A 4Z2XA 2GHPA 3IN5A 1NSPA 2KRBA 1HBOA 3UNYA 2G0CA 4QIWD 1UFKA 1DQAA 2RAQA 1MU2B 4ZHRB 5KT6A 1FFWB 4O0IA 2DNLA 1TUWA 1OMSA 2IC3B 5A8KB 1PG5B 5C2GA 2B8QA 3V4IB 2RDJA 1YSJA 3QNWB 4PQAA 5H9FK 4Q45A 3RRKA 4LF8J 1NMEB 1REVB 4FYYB 1NK5A 4FP9A 1KSPA 2OMLA 4IDKB 5HANA 1GH8A 3NNHA 2QA4G 3SQGB 3BS9A 4PWUA 3BGRB 1JXLA 3IMQJ 2KZMA 3HJVA 1U45A 2RRBA 2ILZA 4HYKA 3EZ5A 1SC1B 4YB6A 1Z1ZA 1HI8A 5HK4A 2B8PA 3D2WA 4NYZA 5DETA 2ZH2A 4TXSA 1J5OA 1PJ7A 2JOQA 2R8GA 3MOZA 1HBOB 4BCAA 3DCAA 1WNEA 3R1HA 4X4PA 3OVSA 4OLPA 1TV6B 3OBIA 1X4GA 4ERDA 3JTNA 2R9LA 4ED2A 4RNHA 5KT7A 4K4VA 2CIMA 4JI4F 4IYQA 1RAJA 5GAGU 3HO1A 4EO8A 3Q89A 3N01A 2W8LA 4BLGA 1VS3A 4YR0A 1SC4B 2J76E 3CIMA 1WHWA 2HW3A 1H72C 3QFWA 3R7NB 1PBUA 4F0MA 2EXUA 1DURA 2MMYA 4LMZA 4RU9A 1WG5A 3HI9A 5IXUA 1KLNA 2D9PA 2DR9A 1P1LA 2VC1A 2R7WA 5G0RA 1YI2S 1SL1A 4DLGA 3UR0A 1GQEA 4L3NA 3N6MA 2CADA 3CC2S 1QSYA 1NJIT 2Z8QA 3T41A 4PG4A 1RSCA 3ZTQA 1HBMA 3D0HE 3CJ3A 4X62F 3DRYA 3NGSA 4HI2A 3CT9A 3QSIA 2DPJA 2MQPA 2A3JA 3G87A 1XNQF 4USMA 2HWIA 2KYZA 4DR6J 2LDIA 3CB4A 1QSLA 2ZJRQ 4KKOA 4MFBA 1BWVA 1RHQB 5B0CA 3B6BA 3T5HA 2RJZA 4ECZA 3UFCX 4D3GA 4KHPJ 4IUFA 4NYOA 1UKUA 5IFMA 3AB4B 5AT1B 1OIAA 2XMUA 2E7VA 3U7JA 2X1AA 1N0UA 5K20B 1L3KA 1KKHA 3ETOA 1HPZA 3CULA 3W63A 4OX6A 5CZVA 1SC6A 1I94J 1S0NA 5KFJA 4DR7J 2K3IA 1VBZA 1WEXA 4FS1A 1Q53A 1HQEB 2VG5A 1FO1A 4NL5A 4LRBA 1HBMB 4USKA 1ZAVA 2ZH3A 3J81Y 3RGIA 1B7YB 2W4DA 2DTJA 3B82A 1RA7A 2UVRA 1S12A 1KQKA 2FJWA 1F5CA 1TFYA 4DCOB 4X4SA 8AT1B 3MEGA 2HQGA 1PJ5A 2UXBF 4N76A 1FXDA 1X60A 1U2CA 4GMKA 3MR2A 2JZ5A 1XBWA 4J9NA 1KHVA 3OL9A 3ZTRA 1M5KC 2FYXA 5LOQA 3AT1B 2K1RA 2ZZNA 2CPZA 4BC9A 3H5YA 1WG1A 4PG8A 2W2NP 1KOOA 2CPXA 3O8WA 3W2VB 5THWA 5B0GA 2OP5A 2IVFB 2Z4PA 2DO4A 3ZZRA 1FTRA 2XO6A 2KM8B 1HPZB 2WSFC 2J5AA 3D6MB 5ETKA 2V8GA 4CLFA 4R5PA 1YITS 4RBTA 3OHAA 4EYHB 2ZFHA 4KB7A 4ES3A 2W2OP 3GTYX 2VG5B 3M2VA 3I0RA 3R97A 4KY3A 2YX1A 2YNFA 1NDKA 4PRFA 4KYZA 5HROA 5FLXU 4ILMA 4CLWA 2GA7A 1JLGB 3MEGB 3D0GE 1B7FA 5KTQA 4IRDA 3DN9A 2I1RA 1DRZA 5CD4H 1VGYA 4LSLA 2OGUA 4I2QB 4XAKA 5A0YB 4ICLA 2K1RB 5K8NA 2XLIA 4RW7B 2DHXA 3HHLD 4OHZA 3AOAA 3PX6A 3H25A 2OJ3A 3GCWP 3FCVA 1JLEA 3GZ7A 5KG7A 5BYRA 4YP3A 4EZ6A 3DXSX 5JVHQ 4DQPA 2EBEA 3M2VB 2FVQA 2OFGX 1KLMA 1WKJA 3D9BA 1VOMA 4FNIA 1RBAA 1IBKJ 5HROB 1FDDA 4XDCA 5E41A 2M8HA 2BJ7A 2FB0A 2VPXB 1OY9A 1U4BA 4UY8T 1IR2A 2CQ0A 2GMJA 2N3LA 4DQRA 1N5VA 1S1VA 2IJFA 2HSEB 5B0FA 2UVVA 1N32J 1LWEB 3THPA 4C0HA 2CJKA 3G9CA 2VPYB 4K4SA 2DIVA 1UEUA 1UEKA 3R2DJ 4QU7A 1JLCA 1AZSA 2VZ9A 2LA4A 2VDHA 4G3IA 2SXLA 2I5JA 3MHYA 4CZCA 3OUYB 2GZOA 2AV5A 1FDBA 1KLMB 3HHLB 1RU2A 3QFHA 4DR2F 3PYDA 2COLA 3EPGA 5KFPA 4NLVA 3IR7B 1UFLA 4ZVEA 3HZEA 3A1YG 3HVRA 2APOA 1HL6A 1JJ4A 2C22A 1VHIA 4LJMA 3DLKB 3PW5A 2QGFB 1S57A 4C8NA 1YJRA 4MMOA 4AL5A 1S1VB 4ZN3A 3IXQA 4Y00A 1S1TA 2BOAA 1PC4A 1U48A 5D3GB 2AQ4A 1FD2A 1H73A 2HAFA 3FEZA 2MQOA 4AYBD 1JLCB 2DITA 5HBMA 2E7WA 1QUVA 3KWMA 4RBVA 3W5ZA 4BHQA 4MTPA 3NWRA 2O1PA 1U2RA 3NAHA 4CLZA 2HLUA 4KJIA 1LFPA 5L1IA 2EFGA 3QMQA 1FKOA 4U6PA 3L9ZA 4WKYA 4TLRA 2YXLA 1P9YA 2GIFA 4IG3A 1QVFR 5K9FA 1GMUA 3HHNB 3RG6A 5T14A 1V9OA 4QYZJ 1K8AT 2NYIA 2FPHX 4ER8A 1ITPA 3GJTB 2UVWA 1NDCA 3BQ1A 1RT6A 2QLWA 3QIPA 2XMJA 1JX4A 2N4DA 2VQFJ 1A0OB 5LJ5Y 2X1BA 5GAEI 2JH3A 5HLFA 3ILIA 4LF7J 1S1TB 5AE3A 1WSVA 2WK4A 2YKAA 1F5AA 2MEWA 2XGQA 2NXCA 1SIWB 2OIHA 4P72A 5HBMB 3LW5C 3UN5A 4K4ZA 4ECYA 1PCAA 2OPRB 3QLHA 4C98A 4P7VA 2N82B 5HVHA 4ZVRB 4F4XA 3MPYA 3WBZA 1FKOB 4B3SJ 4Q44A 3HLUA 1RADB 1TK0A 1VQ7S 5KT5A 4ANCA 4RUCA 4IG3B 2YNHB 2K3KA 5IV3A 4LF1A 4B9TA 3RU0A 4UQGA 5KFYA 2QMXA 3MPVA 4F4WA 3U27A 4XPCA 4CH7A 2GQQA 2B9YA 1XK8A 4Q8EA 2VU5A 2K7JA 3DOMB 1VISA 2DJWA 2VH7A 2B43A 3D0IE 5FIIA 4Q8FA 3M9OB 1S48A 4JI6J 2AD9A 2UUCF 3GFHA 2J7WA 3M8YA 2W4CA 2XWYA 3KXDA 2MZ1A 2BE2A 5ETTA 4F3QA 3QLHB 2M52A 1TR0A 2EKYA 3N6LA 3KHLA 3K59A 1RBLA 4HDGA 2IY5B 2V8DA 3G8SA 1ZTWA 2X7IA 5DM7Q 4CM0A 1NPKA 1FJ7A 3DOLA 2XYHB 2QSWA 4K4WA 2MZSA 2P6TA 4C9DA 1FRHA 5D77A 1F3VA 4DQQA 1OJ4A 2E5HA 1U6FA 2HAIA 3KLHA 2OEJA 1ULRA 1SJ1A 3SDEA 1B70B 1YJWS 3KUGA 4PYAA 4CT9A 3KUHA 5LL6d 2DH9A 1UPMB 4I7FB 3CVKA 4ZVGA 5IT9U 4WZMA 2KXNB 4EMDA 2WCXA 1HARA 3GV8B 3UE2A 1OWXA 5J2NA 3NL0A 4C4WA 4K4XA 1NK9A 3AJDA 2DR6A 3NKYA 1NU4A 3C16A 2V0NA 4RW9B 2YQ3A 1H38A 3LGHA 1HMVA 2FD2A 3DGPA 1VBXA 2ZH5A 3RAXA 1R8BA 1N34F 4NMLA 3DOLB 4B3TJ 3VAIA 2W7PA 4CWBA 3ZZYA 2G1DA 1EKSA 3I31A 1JJ2R 2DIUA 2A6MA 1W25A 5C25A 3PRBA 4NPOA 3MM6B 2MSSA 2JFDA 4WIQA 1RBOB 4A8KA 4PWDA 4WFNQ 2ZNZA 3IM8A 4HHJA 2HQIA 3I32A 5KFCA 3OFEA 4HACA 2DR8A 4DS4A 5J2NB 4DV3F 1ZBTA 2W2PP 4F67A 5LMNJ 2VD3A 2BYCA 3DFEA 3UDVA 2LEPA 5CD4A 5AE1A 1DZ5A 1JNZB 3C16B 3A8JA 1HMVB 2FJDB 1GNKA 4ED7A 5IT0A 2DGOA 2Z2MA 3D1QA 2O67A 4NZ6A 3OTOF 5IC4B 2EK6A 1CLFA 1RGVA 1L5UA 5D4PA 2EEYA 4QW8A 4YFUA 4O44A 1RWWB 4J9SA 4NLXA 2P8IA 3E2EA 2IRXA 2PI5A 3QO9A 4G6VB 1JLBA 1R8HA 4HH1A 2CZVC 1K0VA 4I69A 4OYWA 4WU2A 2V63A 1S77D 3BSAA 1HD0A 2I6WA 3HSJA 4BWJA 4HACB 5B08A 1XMQJ 1VIXA 2D69A 4IFVA 3IBWA 4EGLA 4EUVA 3CJTA 2JJ4D 4A4JA 2L9NA 3GG1A 3EGNA 2I0XA 2HYIB 5IOLA 3VR1A 5HMWA 4LRCA 5CABA 3MPDA 3I55S 4ILLA 4W90B 1RT7A 2B3TB 2GV1A 2ADCA 5HQMA 3L09A 2RF2A 3HVAA 5EDWA 1IKYA 5SZTA 2NUUG 2VA3A 4FBUA 1RE1B 4OJGA 1VQPS 1F3FA 2EFVA 5F8HA 4LREA 1ZETA 2AZ3A 2KXHA 2ZE2A 3OJUA 4KGVB 2BRKA 2DVIA 4RWWA 5EWEA 2IRUA 4LIWA 1D09B 2AJFE 4C8LA 3KG4A 2HGLA 2KHDA 1T9YA 2ACYA 1UWBA 3P6YC 2E5GA 4DV1J 1Q8BA 5E3PA 5DQHA 1XQIA 4WJBA 3ZXWA 2ZZMA 1YQHA 2DY9A 2BX6A 4EWTA 4WCEQ 1HFEL 2ZHBA 4OZJA 3G2XA 1T05A 4TY8B 3H90A 4B9NA 3N9UC 3NMAA 4ECVA 4A8OA 3CUNA 3RRGA 3R2CJ 1HI1A 5IWAF 3GONA 1S99A 2AHOB 4NMXA 1RT7B 2IDLA 2C42A 1JXEA 2V68A 9RUBA 5J1EB 1NSAA 3ITHB 1RCOB 4PZVA 2C2OB 3CIZA 3W8GA 4X66J 2HVDA 3R1LA 2EG1A 3DHWC 3F44A 4NLPA 7FD1A 1ZPWX 1PYTA 3QSYB 4JI0J 3MMBA 5FLXY 3J7Z5 3F0NA 2BXJA 1PAUB 1UWBB 4ZS6A 1WOSA 4DDFA 1R8CA 3QATA 3K8VA 1HWJA 4ZN1A 1D3WA 3KLGA 3ENAA 1T05B 2KHCA 3OHBA 2X51A 1AB8A 3ADAC 5BYSA 1S6PA 5HP1A 2HIYA 2FHJD 3I6PA 2YKMA 1R89A 2RUSA 4LF9J 1NH8A 4QIEA 1RT1A 3I5CA 4HH0A 1RCXB 2VF3A 1Q16B 2HFUA 4IQXA 4NLRA 2IM3A 1FK9A 4KAIA 2UP1A 3HHKA 1TKTB 1LFWA 4U8YA 4RW8A 2V4RA 3QQCD 1UVKA 3UCUP 4TNOA 2R7UA 2YPYA 4YB5A 1KFDA 2CQ4A 2FHJA 1FFGB 2LA6A 4KQZA 4U7UD 2FJAB 3KMQA 4LF8F 4B3RF 1OYEA 3G82A 1X5OA 1YBUA 2ZWPA 4Y2KA 4H4MA 3MUVP 2B4PA 1Y10A 3KLGB 2IBKA 1BHNA 1S6PB 3AB2B 5HP1B 1F60B 1JLAA 4RNMA 1HD1A 2WVDA 1WC3A 5HL7Q 4DN9A 3LWMA 2L3MA 4YDDB 1NJWA 4LFBJ 1N5QA 4DOZA 1RT1B 3GP9A 2D3ZA 1UW9A 4KPCA 5E3CA 1FK9B 1NZAA 1T11A 4KTQA 4CLTA 1KQSR 1OS5A 1R6VA 1QM9A 4LT6A 1C1BB 1KRPA 2E1AA 2H1YA 1S7HA 1ZAXA 2CFXA 2DEJA 1UWAA 1TKXB 1N8RT 2DT9A 4PCQA 3W9JA 4OHVA 3G82B 3M9MB 5U47A 4DL6A 2V69A 3M32A 4OLOA 4OYZA 2DNOA 5AXNA 5JVGQ 2JEGA 4F3OA 1N4LA 2E5IA 1YRTA 1X5PA 2GJFA 1H7XA 4ZPVR 4TLQA 2ABYA 1RT2A 3H8YA 2JC0A 3DRPA 2MJUA 3ZTSA 3HCXA 4ZVPB 1H3DA 2QFIA 4AQYJ 1U1QA 1TFWA 3UO0A 2CJAA 3CE8A 2BKOA 2CDQA 1CC8A 1QDUB 2W2MP 4G65A 1CJKA 2GJ2A 4KHMA 1TUVA 4CDIA 1KOHA 1TK8A 3AD7C 4P2XA 2JWNA 5K5MA 2HHSA 3HF5A 1FNOA 3G96A 1HA1A 2HVHA 2DO0A 2IM1A 2NZCA 4M8LA 3BKUA 4L3KA 1ELOA 4YUDA 1JIHA 1RAOA 5AE2A 1NKCA 2A1BA 4O3NA 1T02A 4DPUA 4OX8A 1T9TA 1BMQB 1UJ6A 3M8RA 3I9ZA 1RHMB 4DX5A 2UUAJ 3PW7A 1VQ8S 3DRPB 4N7TA 2CQIA 1VC5A 3FBBA 3CD6S 2CPJA 1H0HB 1XMOF 3DI6A 3G86A 2Q66A 4ZPCA 5T7LB 4OX7A 1VI7A 2XMAA 4A8YA 1WC4A 3FSIA 1A9NB 3V81A 2HS4A 2GHVC 2YKQA 2NPIA 4LRDA 1J5EJ 1HLWA 2B9WA 3T9ZA 4WP9A 1UVMA 4XTTA 6AT1B 4FYDA 4QJVA 4Y2CA 1DTQA 3RAMA 3M6XA 3OJSA 2UVUA 4OX9J 5GVQA 4M5HA 3AD8C 1NHVA 2O5DA 4HTIA 1OY6A 3GJRB 4NI2A 3KHHA 1IM6A 2RHQB 3NS6A 2E9ZA 1RDRA 4DUYJ 3H0PA 1I1GA 3MM8A 4O23A 5HI7A 2F4VJ 3DI6B 2DXDA 1MMNA 3I4HX 2DR5A 4P73A 2MXYA 2BRLA 3TVYA 4F2RA 2BABA 2QL9B 5RUBA 2AIRB 4GVBA 3V81B 2Q6BA 4X65J 4QQBA 5EX0A 1IKWA 2MZJA 1U1OA 4OL8A 3C66A 2RKIA 3MEEA 5E0OA 3Q8UA 1RKJA 1FHTA 4H4OA 2XG8A 1S1WB 4PYDA 1FE4A 1S7IA 4CLKA 3DDKA 2HFVA 5L9XA 4JV5F 2V2VA 4UF4A 2CXEA 4CLYA 1C0TA 2BM1A 3MEDB 2F4FA 4NI2B 4K4YA 2PMHA 1YZ7A 2ZC4A 3DU5A 3I56S 4OZLA 5CCLA 5D0RA 2GW8A 1RTDA 3SSQA 1G1XA 3MM8B 4WBFA 2F9DA 2BJ8A 2KXFA 4DSJA 2GGPA 4C3MA 1O51A 4NCGA 1U49A 3VHQA 2X3GA 4GVBB 3DRRA 1RTHA 3PW0A 5KFUA 1IKWB 5D15A 3GWCA 4DWIA 3PYGA 3NGKA 1URRA 1HNZF 4NZ0A 4C8ZA 4LQ9A 1YVFA 5DZ6A 1RAAB 1FVQA 1Y0HA 2VFUA 5HQLA 2HBQB 5D4LA 4P6QA 2A2DA 1OQ6A 3OSPA 5K8PA 4ED6A 3EJMA 4DU7A 1R6YA 2ZC3A 1C0TB 4P71A 4DL3A 1FT8A 2DH8A 4LF2A 5HMZA 2VG6A 2RD5C 2V8HA 3HFVA 3R8YA 1PSDA 2FLOA 5HQ8A 1QAXA 5KFXA 3OL6A 2GGPB 3KK2A 4NCGB 2E1RA 4FZVA 3KK1B 2XCAA 1JXVA 4AXJA 3AA9A 1F9EB 4DHVA 3DRRB 2RU3A 1BXNA 3QIDA 3D4JA 1ZH5A 4B9VA 1X7VA 2RMLA 3NS5A 4NCBA 1VLYA 2VPZB 3VCDA 1T9XA 2HURA 1MSWD 1WF2A 1IKVA 3AQPA 1KN6A 4JB8B 2VB6A 3GJQB 4KFBB 5KFDA 2DNHA 2CQ2A 4C11A 3US5A 3LAMA 2YPZA 2MGZB 1K73T 2FLPA 2CWXA 4JI5J 4NA3A 2M8DB 1NHUA 2ALZA 3KK2B 2QO3A 2BJ3A 3TAMB 3KMSA 3CMAS 1T3OA 3QT5A 3FZ2A 3SZ2A 1VDHA 4ZJOA 5DG7A 1RK8A 4JI1J 1N33J 4AUKA 2XTJP 3M1VA 4PXEA 1Q8IA 2UUBJ 5CXTA 3D6HB 4P9SA 2XHWA 2W2QP 4DR4J 5E2QA 2VQFF 1KVKA 4DX8H 3K5MA 3BGUA 5ETVA 1IKVB 4JUZA 1NK0A 2KT3A 3JSRA 4OV1A 4P2FA 1RWMB 3LP0A 4C11B 1R0CB 3H7HB 3NLCA 3JSBA 4WXOA 4Y0FA 1FXRA 2KTQA 2KT2A 4P2SA 3DLGB 2JRSA 2NXNA 4B3SF 3SI8A 3P3DA 3M1VB 1EIYB 4Q2MA 3DKDA 4TU7A 5LSOA 3PY8A 5JJBA 2ZHAA 2H5JB 3I4PA 1X4DA 2DNMA 5MAOA 2JC1A 4KIAA 4JOUA 3MR3A 4ZLNA 4Y2MA 1SCJB 3R9LA 4M94A 1EQ0A 3LP2B 4Q7AA 2WW4A 3AXMA 2L08A 4OYIA 3RZAA 5HATA 1ZAWA 3WZ0A 3E51A 1HR0J 5BR8J 4NWBA 3LP0B 4ZDNA 2D41A 2CNOB 4I2PA 4RNNA 1B99A 1SQFA 3NNCA 5ETNA 1TL7A 1X4HA 2K8GA 2P2CB 3EZOA 1RTZA 4IOCQ 4MAKA 2ZZTA 1FKAF 1SI9A 2IM0A 4TKTA 4QIGA 1F2GA 3CCLS 4NLTA 2Z56B 3CCJS 3DDIA 4OMFG 5D4OA 2B9EA 3PKMA 2UU9F 1ZM2A 3ONQA 2Z2LA 4MT1A 4FN5A 1X0PA 5C2CA 2D9OA 2GJIA 2VKRA 2J6UA 5A76A 2DHAA 3CF5Q 2AJ2A 3EYZA 4DJBA 2P6SA 5L46A 2NXJA 1N88A 1U1PA 1FXLA 1URNA 4J9MA 4DV2J 1Y9OA 2JL9A 3M8WA 2QV6A 2BZ2A 2PSZA 4MYUA 1V3ZA 2RS8A 1RYRA 4OIXA 4Q5VA 2ASLA 3CJSA 2CVIA 1CJTB 1S9GA 1UP1A 4ZLLA 3IP0A 4DL5A 1GMWA 4TU8A 3SCIE 2GAGC 1QJHA 3NOCA 2MQ8A 4B3TF 3OR1A 3BN4A 1T9VA 2WAQD 4UT4A 3SXLA 2YWHA 3HJFA 3NXZA 3FQLA 2V2QA 1SJFA 3M8SA 1NBEB 5EHHA 2LDYA 4QR0A 3PNIA 3VWSA 1JLFB 4J9VA 1MROA 2GO9A 1RWKB 2HHTA 3E01B 3PXGa 2PO4A 3OFGA 2BM0A 3K5LA 1YBTA 3PW4A 3HDSA 3QT8A 4OI4A 1Q86T 3WHIA 3PCOB 1W2IA 5E7OB 2XSFA 3BKTA 3FEYB 3ZZ0A 3J80U 4FNHA 5I3QA 4ECXA 1TL1A 1VHFA 1T03A 4CLPA 4QCLA 3DC2A 2DKOB 1D0EA 2XB2D 2QX0A 3KLEA 4YDXA 1DHMA 4JI8J 4IG0B 4RNFA 2B4UA 5KOWA 2I8EA 4A48A 3UWTA 4A8FA 5ETMA 2GNKA 4ECRA 1TL3A 1Q4RA 1Z2ZA 3IWNC 4FPIA 2C28A 3VQTA 3CGIA 3MUMP 4AE5A 1RTJA 2R8KA 2M3DA 3C8YA 3VAHA 3TA2A 4PKDB 3IFEA 4F36A 2FLNA 4X4OA 4RWXA 4HTJA 3HP6A 2P9CA 5AXKA 1X5TA 3CO0P 5FDLA 4BS2A 2D7SA 4KO0B 3W2WA 3TUIC 3OTBA 2FC9A 4FVCA 4PWWA 1RT4B 4Y65A 5L1JA 1T03B 1RHUB 1BWEA 1Y5NB 1C1CB 3PO4A 4FYWB 4S0MA 4A8XA 1KNZA 5KFRA 1CBKA 3OPKA 3FRYA 1QAJA 5ETPA 4O3OA 4UQTA 1NNDA 5KFZA 2F65A 2N7YA 1HWUA 3F56A 1WELA 1NK4A 4ZITA 4IO9Q 4L6V3 2BQRA 2HG4A 1TL3B 1XWLA 3PV8A 3GFXA 2V2ZA 1RTJB 4HEA9 2MKYA 3OSNA 5C7PA 1VRTA 2VFTA 1IR1A 4F50A 2H65B 4GKJF 4QZVB 3DYAA 3MCSA 2RHSB 3O44A 2OD6A 3TX0A 4B3MF 4D3HA 2HWTA 2VL1A 3AY0A 3W2WB 2NR0A 3DMJA 2H54B 2G0IA 1QAYA 2WHOA 3X1LB 1U7LA 1HHQA 3H42A 2D3UA 4LSNA 4DL0C 4DUZF 5IQ6A 3Q8QB 1BC6A 3QGPA 2VOOA 1T9UA 3TI0A 3NGDA 3KJVA 2VJUA 1WHYA 1R3NA 1D9AA 3R5JB 2PEBA 3EVWA 1MW7A 3OR2A 3AFGA 7FDRA 2ZVSA 3B54A 4Z37A 2DXEA 3V4MA 1M1GA 4DV0F 3R7BB 4H54A 2HHVA 3QGGA 2KRRA 4C2MA 3PR4A 4GKKF 4DV7J 4P74A 3AJ2A 3Q23A 2A0FB 4C7QA 4QWBA 4LBHA 2DPIA 1RWOB 4MKBA 4ZVFA 2QLBB 5HVGA 2OD4A 1BQMA 3NNAA 3EICA 1U26A 1Q5YA 2ZUGA 2J6TA 4ZP6A 3KFWX 3J81j 3CMES 4PABA 1F1BB 3OLAA 3V6HA 2J0QD 5KG3A 1CQNA 1DARA 3D28A 1VRQC 3MECA 2B7CB 1R8AA 4O4GB 1SV5A 4NLUA 2KZZA 3KJVB 4CO4A 2FTRA 2X1FA 3IO1A 2Y0BB 4FBTA 5LM7E 1FA0A 2F8EX 3MWBA 2ILYA 3UNGC 4WTYA 5CQGA 1GMVA 3OXFA 1HBUB 3AQOA 3EGZA 3ILLA 2AEJA 3CJQA 5JXSA 2NPFA 4U8VA 3Q0AA 3MMCB 1F0XA 2VFSA 4M5KA 2OLWA 1UETA 2YWEA 3N6NA 3TNVA 4LFBF 5CYMB 3C3LA 4LF6J 2AYBA 1VQNS 1NPRA 1Y3JA 3MXHP 2P9EA 1QE1A 2V50A 3HSZA 2QA1A 3Q8YA 4JI3J 5LJ3Y 1N48A 1BQNB 1SV5B 3IM9A 1OPZA 4IKAA 5I42B 2FVPA 4ZLPA 2ZH8A 1U1LA 4CNZA 2BBEA 2XCPA 3CEDA 2P5VA 2V2KA 2O01C 3H5XA 2ASYA 2PGCA 4TQSA 1IN0A 3A8EA 2Q3PA 4MIBA 1SH2A 2LQBA 4OYXA 3IWXA 1IJFB 1FNMA 1LK5A 2OTJS 2Q43A 4ZCLA 3GPAA 4ILRA 1N54B 3GV5B 4LR9A 4J9UE 1Y4ZB 5KG5A 1IVZA 2H9ZA 3C46A 2LU1A 2WRMA 2WONB 3C19A 2KI2A 3UD4P 4YB1P 5AXMA 5A8RA 5DLGA 2HNZA 2MZRA 3EXCX 3CCRS 2MB0B 2Z0GA 3H4BA 3VAMA 3CJRA 2PFFB 1F2HA 2LEBA 2VBYA 1M1HA 4DV6J 4RO0A 3ENVA 2B6AA 3GSIA 3TX8A 4RZRA 4ECSA 1H7WA 1GK8A 3BREA 4R8UA 2KVIA 4CNYA 5DG9A 5E5NA 4MKAA 4K5RA 4A46A 3W3SA 1LEOA 4J5OA 2BANA 5KFEA 2MHEA 2OUGA 2A6OA 1Q81T 2P9GA 1J5EF 1YKWA 2R7VA 3BO2A 3GU0A 1CEZA 2KH9A 3CC4S 1DLOB 1CJVB 1TMJA 2V4JA 2ERRA 1QTNB 4U95A 2U1AA 5A8RB 1EP4B 3JQMA 1G3OA 2Y8WA 1EX8A 1E6VB 1RLDA 2O66A 1BY9A 2QMWA 3HHDA 1MU2A 2ZOMA 1RAFB 4IH7A 4JV1A 2E44A 5J2PB 3VAFA 3S1TA 1PYOB 1EAYC 2IC3A 2WOMB 3SBMA 5F41A 1P9QC 1FF2A 2HMIA 8RUCA 4I4BA 1NXIA 4ES2A 2ROPA 1REVA 3TQEA 3FDSA 2KL8A 1U24A 2XSJA 2KG0A 2R42A 1RZMA 1FX2A 4DSEA 4IDKA 2HHWA 2DYAA 3QYYA 2MKCA 3SQGA 3BGRA 2BANB 2R2RA 3BBBA 1Q95G 4LFCF 3UR3C 3BBCA 3H98A 2WBRA 3BF4A 4FKYA 5AJ3J 2V4JB 5KT4A 4E0DA 1GT8A 4KPYA 3QWUA 1SH0A 5D4NA 2R7OA 1KS2A 3GIJA 4L73A 1VQ6S 1TV6A 2R4FA 1XR7A 2DCUB 3TAPA 5B09A 3UDCA 4TYAA 3NGRA 1YG0A 3Q8VA 5CCMA 1X0FA 3GYGA 2OFHX 4OZ2A 2HMIB 3ULHA 4DQSA 6FDRA 2EFOA 2XSJB 1FCAA 2E1CA 4N8OA 4DFPA 4Z7YA 2CQPA 2W25A 3DLBA 5B7WA 4NLWA 3TJ8A 1SB6A 2PA3A 3TEGA 1EZZB 2IPOB 1U1MA 1VQ4S 2VQEJ 2DHGA 1SIZA 3HVWA 2AYEA 3TO8A 1RHKB 3HT3A 2AW0A 2ZUAA 4CI0B 1QAIA 3WC0A 1HNXJ 1Q8KA 3K17A 2BW7A 1YGYA 1I5OB 3LA0A 1JKHA 1RYSA 3AD9C 2A2CA 1W2BR 2XC9A 4OQJA 3PX4A 1WC1A 1O5JA 5EN1A 3PRDA 1X4BA 1YJTA 1FEHA 4DX7A 4I56A 2BUNA 4J37A 4UOHA 2F5GA 4PG6A 2DK2A 2HQFA 5CAAA 2H48B 1DJ0A 1QY7A 4FYVB 1M5OC 3PFEA 1HQEA 1S4EA 2UXBJ 1FWLA 4PPZA 3J80Y 4RX6A 3LP1A 3OTCA 4DZDA 4X64F 3AHPA 2OO4A 1U1NA 2C1EB 2VPWB 2VV5A 2PN6A 2ZDPA 5D0EA 4B02A 1JKHB 2GQ2A 4J90A 5A6WA 4UW2A 2IA0A 2FUG9 3M8QB 2R2UA 1R0AB 2NQPA 5HVFA 2FJXA 4ZIWA 1M1KT 3TR5A 2JDJA 3U1LA 4JI5F 2WVEA 1S79A 2IHR1 3W2VA 1V5IB 1WC0A 1KVIA 3M2UB 3SCJE 5KFKA 1KHWA 3VAGA 4GO5X 1M5VC 3PYFA 1N33F 3HHEA 1VFJA 4CP5A 4YOEA 1S0VA 1C0UA 1W7WA 2Z58B 1MWQA 2NREA 4EZ9A 3P8BB 2IMWP 4ECWA 3W9IA 3VTIA 4V19J 3LP1B 4H4KC 3NG8A 1WJ9A 5ETSA 5GMEA 4HT5A 1K44A 2WVCA 4ZPBA 3BYRA 1JLGA 3IG1B 4KH0B 2GMHA 3R3TA 3MFIA 2CQDA 1T8EA 4OI2A 2MTLA 3TZYA 3L95X 1JQGA 4R0JA 4I2QA 1KFSA 5A0YA 2ROEA 3BGOP 4M5IA 4ED4A 1NCLA 4RW7A 5DGAA 4IH6A 3DDNA 5KFBA 2XYGB 3SYZA 3V6DA 3QAEA 5FJ4A 3MEKA 2BVZA 3TEHB 2HIQA 3UN2A 2HGMA 4O3RA 4TVAB 1C0UB 1W26A 3KUEA 2RDIA 1FX4A 3BB5A 2V9WA 2DEIA 4RW4B 4U7UK 1KP6A 3OL7A 2A18A 2V8VA 2LFVA 2LQJA 3D6FB 1FRJA 1RISA 4MJKA 1P1TA 2J8AA 4NYPA 2IFXA 4MK8A 2XWXA 5ETLA 4Y2IA 1U8SA 4LUBA 3MD3A 2J9EA 3NRBA 3MGJA 5HN0A 1HR0F 1SJQA 5BR8F 2FZKB 2KYXA 1B0PA 2OSRA 3VGSA 2MZTA 4JI7F 2RDDA 1GX5A 3CDUA 1UJ5A 2VBXA 2PE8A 1TKZA 3R6LB 3V6DB 1LWEA 4QPXA 3BR9A 2XULA 1UA1A 3DRSA 3MM7A 4DR2J 4LIRA 4ED5A 3TUPA 2C2ZB 4WFYA 4C8OA 2NXEA 2XM3A 2XS7A 3BZQA 3CNQP 4DSIA 3I0SB 4NE9C 1ZTTA 4J9QA 1WSRA 3OUYA 1SBRA 2JLEA 2Y0SD 4KBIA 1S97A 2FY1A 2M4MA 3HHLA 2WVBA 5GMDA 1IJEB 4CRJA 3CCES 2DD8S 2MKSA 3FNNA 4O3QA 2GFFA 2UXDF 2QEXS 4WP3A 1RT3B 3OLBA 1ZA2B 4IR1A 4CIOA 2OELA 3KHGA 2JX2A 4WFZA 2CPHA 3DLKA 1ZPVA 5HJXA 3CJ8A 5ETOA 2XEXA 3SMZA 1PO6A 1VK3A 4DV2F 1KEKA 4FXWA 2OKQA 5LSRA 4RR5A 1TKZB 4BDPA 2X3DA 5IV4A 4L72B 5BXIA 1SJRA 4ENOA 3DRSB 5D3GA 4JYAF 3MM7B 3M8PB 1BE4A 5LT5A 4QWCA 3H40A 2YKPA 3UCZP 3CD7A 2HK2A 3BQ2A 2C3PA 5E3QA 1YJ9S 1XR6A 1HQUB 2K2PA 4DSKA 3JQJA 1YZ6A 2VC0A 1FERA 2J8SA 2DHHA 3LH2S 2DY1A 4DPYA 4USVA 2CG4A 2EI5A 4LFAF 2ACMA 2IAJA 3F41A 4K7QA 5HAOA 1U6BA 5CH7B 4DL7A 1FFSB 1Q7YT 4NXNJ 4PXBA 5I4MA 3VAKA 2PA8D 4OZ0A 5J2MB 5JUMA 4C3LA 3RB4A 1RWPB 2PDAA 1TVRB 2XGPA 5KFLA 5FD1A 2R7XA 2DCLA 5IQQA 1LK7A 4CM2A 2FJEB 1RACB 1O8BA 1NKBA 2PT0A 2V6AA 5F0UA 2R7TA 2LP4A 3TVZA 2H4WB 2AU0A 2KG1A 1BGXT 4MKYA 2MLXA 2RU9A 2KB2A 5GMKa 1MMLA 2AYMA 2OPRA 2HNYA 4F8RA 2AEMA 4DQIA 1SKSA 2CQBA 1SKRA 2BKPA 1WTBA 1NJZA 1EJ7L 5D8HB 4JI8F 1NJYA 2YNHA 2DISA 2ZH7A 2W9BB 3DLHA 4ZIVA 2IAJB 1VLOA 3M30B 1WOOA 5DRKA 4F25A 1RWUA 1T0TV 5KFHA 4WZQA 2GVDB 1LWFA 4KRWA 1NK6A 1RXOB 3D1HA 5C24B 4EBDA 4CLLA 3DOMA 2PIIA 1SJ3P 3PW2A 5IM0A 2BMBA 3M4XA 1T7PA 3GIRA 2ZBCA 3L3CA 2HPUA 5T41A 4LRAA 1IUJA 2LU2A 3SSRA 1V5VA 1GAOA 2ZH6A 2HNYB 2WZ1A 4J9RA 5LMUJ 3IGNA 4B3OA 3T19A 1AFIA 1N36J 2JHEA 1KD1T 3D5MA 3BGFA 4YQWA 5GADU 3NGTA 4FXDA 4ED3A 4YMEA 1LWFB 2UV8A 1DTTB 1U09A 1HWLA 4OJ1A 2MKJA 2BJ9A 3FFIA 3FEXB 1CVJA 2F8HA 5IM0B 2AZ1A 3EX7B 1UJ4A 2MLZA 4K5SA 3QT6A 4YR3A 5KG0A 3MD1A 2G13A 4I7FA 4ZPTR 2KJWA 1NH7A 4CH1A 1SH3A 2F63A 1H2VZ 3KLVA 2DNYA 5KFVA 3BSCA 1N34J 1S0MA 3JB9k 1LKZA 2FVCA 4U96A 3CCZA 2ZKTA 3LTOA 4B3OB 3RBXA 4RW9A 2L48A 4B17A 4UOGA 5KT3A 2W4PA 3KDOA 4QYZK 4F26A 3J7YI 1FNXH 1YJUA 2E1PA 2QYGA 1ZZFA 1S1UB 3WIVA 4DN0A 3T1HF 1X5SA 2OAUA 3CDWA 4OZ5A 1D9FA 1G7CB 2C2RA 2OMOA 4ZJQA 1RAIB 3MM6A 4DV3J 3KHRA 1OYDA 3M6UA 3T3FA 4NASA 3FFIB 1HYSA 1TTHB 2PFDA 1N6QB 3VV2B 1K1QA 2OPPA 2Q79A 3ZZZA 2XO7A 4CO1A 1XMBA 1FWPA 2QC3A 2DRAA 2BE7D 2DH7A 5DG8A 2KM8C 2DGQA 2VHGA 3FK4A 1U1RA 2PI4A 2HKEA 2HQ3A 2J0XA 2CNNB 3MPWA 3UQSA 3LO3A 2JEJA 1TL5A 2YNGA 3UW1A 2KDOA 4UOFA 4NRUA 3B8HA 3FBCA 4ZVUB 4CQ1A 2CJ9A 3WX4A 4RW6B 3DGVA 2YNIB 4GC6A 1NDPA 1UVNA 1CSJA 2G2YA 1NB7A 1MN7A 2M5YA 5L38A 3MMAB 2BDPA 1KQGB 1EB0A 1HYSB 1T9WA 3M2RA 4HL9A 3H5UA 1FDAA 2OPPB 5LSLA 1MLAA 4M95A 5DGBA 1S6QB 2AGOA 3BR8A 3RR8A 2YKNA 3IGVA 3HKWA 2DHSA 4X4UA 2EFNA 3HVTB 3FSYA 1R8PA 1UCNA 4WYLA 4N56A 1S0OA 2C3UA 4XPEA 4LF6F 2ZH9A 3W9HA 2YNGB 3TARA 3U02A 3VGTA 3FUYA 2H4YB 1WWHA 1RWNB 1N5YB 3G4SS 1WACA 3HULA 2GVZB 2V5HG 1VRUB 3LPYA 1F5BA 3THVA 1IBLF 2EK1A 3GFYA 2KVQE 1AROP 4R25A 3GR1A 3KLFA 4WKRA 3JSMA 1CG2A 4ELUA 6FD1A 5H9FJ 4WE1B 1YIJS 5ETRA 2EBGA 2YY3A 3M8ZA 1VQSA 5DLFA 3M2RB 3GYXB 1NAQA 1U8WA 3U1NA 2YKNB 2Y1RI 1F6TA 3CMQA 3UPFA 1GXTA 4K59A 1FD8A 2H5EA 2MPUA 1UVJA 2HFNA 1K1SA 4TY8A 3X3UA 1WC6A 1XNRJ 2WW8A 4PQUB 5CYQB 1FRLA 4DI6A 1D8YA 1NRKA 3MPUB 2LXIA 2N4CA 1FEEA 3WDOA 3HHLC 3TP2A 3GIIA 5F9NA 5J1EA 2CPEA 3ITHA 1XERA 2FGOA 2C3OA 1QVGR 1VQOS 2ZDOA 2DBBA 3MUTP 3KLFB 4XDDA 3BBFA 3MDFA 1HNWJ 1MNEA 1TQLA 3JSMB 4DV5J 4AL6A 5J1PA 3R27A 1VQYA 2OH2A 1KDNA 1OSDA 2HNDA 1WKKA 1N5SA 4CLUA 2IVYA 4EYIB 2BE9B 3MM9B 3D3CJ 3IAM9 3MZIA 2B5JB 4J9PA 4ZCMA 2DNPA 4CO0A 2BJ1A 4EU0A 4HT7A 5E33A 4C97A 1YLXA 2YQ0A 4ZK7M 1IBMF 1KTVA 3Q24A 2MYFA 5KFOA 2DNQA 3IRWP 2EFQA 4YY3F 1PAEX 1L3TA 4A8SA 4E8UA 5DDPC 3P4UB 2NCKL 2MY8A 4B3RJ 4WFAQ 1TKTA 4LR8A 1TELA 4ANEA 3CXCR 1S1XA 2RS2A 1MN9A 2GQCA 2W7OA 2MSTA 2ZITA 3MCMA 5L8RC 1UZDA 2HNDB 1QD1A 4PPDA 9ATCB 2DRBA 2XY6A 2CYYA 2KT5A 4MIAA 3ENQA 3W7BA 2QLXA 2AJQA 4ZPAA 4DG1B 1RLCL 1LWXA 4MH8A 1U0SA 4OYOA 3NBPB 2QIFA 3CDBA 5F8JA 2FLLA 2QRRA 1J2VA 3L7PA 3PZPA 4ZVOB 4AFFA 3CD5A 1WKLA 4LBIA 2DRDA 2XHCA 3W61A 2V4QA 5AJ3F 3TUZC 1H2UX 4DR5J 3FJ2A 4PXDA 2RQMA 2W8KA 1PGZA 1K0TA 1X31C 3MAHA 3J7A1 3NCPA 3JS9A 2QN6B 1S1XB 2CPDA 1KTQA 2CNKB 3MAQA 1C1BA 4UTGA 2VG7A 3SV3A 1TKXA 2ZH4A 2M2BA 1X4FA 1YJ7A 3LGMA 3H20A 1O0PA 1FVSA 2OEMA 4ES1A 2J6SA 5B0DA 2J0SD 3HPOA 2NUHA 4CO2A 1J5OB 4AD6A 2BJDA 4USUA 3SSSA 5C5JA 4ED0A 4DX6A 3BDPA 2VBZA 2CJQA 2HHHJ 1NSKL 2Z30B 4NLYA 1HNVA 1AXQA 3G8QA 1JWWA 3Q2SC 3R7SB 2VFRA 4P7TA 2VQEF 3S7RA 4I68A 5GAHI 3JTPA 3JXOA 3NWGA 2XS2A 1QLNA 2VBWA 4FDFA 3NP5A 4USTA 3E8OA 1HNXF 3HD1A 4K8RA 3PEJA 2V9KA 4KSEB 5E3AA 1RI7A 2VG7B 1H74A 3Q2TC 1GXLA 1VCTA 3ELHA 5G0RB 4DV4J 1H98A 3RB6A 4YHHJ 2AGPA 3BV8A 1XMOJ 2O3DA 2G4BA 2E9TA 3IBCB 4F2SA 1MG7A 1YRXA 2HHXA 1R31A 2CPIA 4WTOB 1X9MA 4N41A 4RNOA 1VQLS 3ETMA 2IA6A 3BO4A 3I5AA 5DDRC 1HNVB 3D1OA 3KLIA 4UUWA 1I6JA 4ED8A 1T94A 4P2MA 5T7LA 4B9LA 1Y3KA 1FDNA 1VJQA 4KKOB 4MFBB 1HIYA 4R0EA 2F1FA 1B4SA 4J7CA 3DM2A 3OQ2A 2L9WA 3T5LA 2YTCA 3LF0A 1X9WA 4ZCIA 3KK3A 2QJ3A 4WPAA 3EM1A 3G6ES 1PILA 4DR6F 3AXKA 3R5DA 3S01A 1WEZA 2CKWA 4P10A 4IQMA 2IIHA 4DPOA 5LXRA 4KHPF 4QBUA 3O1LA 1P6TA 1S9FA 4LF5J 5M2PA 3PHEA 2MQMA 3KDNA 3BEGB 4DEZA 1UZHA 4MK9A 3PVXA 1M5PC 3I82A 3G71S 3KLIB 5H9EK 1I94F 1NZ8A 4A8MP 4DR7F 2ZD1A 2EFPA 2F7VA 3Q83A 2C3YA 2CPFA 4KHRA 1GX6A 4ETXA 3PIPQ 4DL4A 1S9EA 2FJVA 4JV5J 3WC2A 2J7UA 1WI8A 1NEEA 3DM2B 3RYLA 2R2SA 3KK3B 4M5MA 1CJUA 5A6PA 1S1WA 5J1NA 1I51B 1PIEA 1GTHA 4M63A 2C2MB 1G6BA 4R5PB 4WXWA 2AKWB 5KG2A 3HSDA 5L1LA 2ZH1A 1S6OA 3VGUA 3FC9A 3Q8SB 3KJNB 3EMTA 5F3ZA 1UTAA 2YWGA 3MEDA 4URSA 2E5JA 4DR3J 3I0RB 2HVEA 2YNFB 1IQTA 1IWGA 3M9NB 4HHHA 4KGMA 2FHMA 2YWFA 3NY0A 4OV6A 2XQCA 3WQPA 2ZD1B 4O0NA 4A8WA 1HNZJ 4F7VA 2UUWA 3N5FA 4LVOP 1R43A 4NLGA 4LSLB 4DSFA 1S9EB 2C3MA 4ICLB 3GB0A 2FY8A 5CYJA 3CCSS 4OJ3A 4LF4J 4CTAA 1CJUB 4FXVA 1V3RA 4FS2A 4RBUA 3VVTA 1XIQA 1JLEB 1YRUA 4TYBA 1WTFA 4IRCA 2XI2A 3MFHA 2HGNA 3ICLA 4C0OC 1KBRA 3EGWB 2YX4A 3OXLA 3QJLA 2AJ4A 3PX0A 4B9SA 3EXYA 2HZCA 3BDEA 3VALA 1ZS6A 2GS8A 2ZJQQ 3P5TL 4NLOA 4PUOA 5IC6B 3OTDA 2KFYA 4DPWA 5IT9Y 2CJXB 3KK1A 4X4NA 2J7KA 3GIKA 3PM9A 1SUQA 2VICA 3V6KA 1IBKF 1XR5A 2J9CA 1LXNA 3U1MA 3T1YJ 4KE5A 1S10A 2YX7A 4M5DA 4CTAB 2XMMA 3H59A 4Q2LA 4KGXB 2FHOB 3UD5A 3MTJA 3PHTA 3K5PA 3BJYA 2RQKA 2XS5A 1WHXA 1AZSB 3D3BJ 1ZZNA 3W64A 2I5JB 2PMZD 1FTCA 2C2DA 1N32F 4IOAQ 1RHRB 4KFBA 2HEKA 1Z4UA 1UEVA 3TRGA 2MGZA 2M70A 4OHWA 4V19X 4URQU 2LEAA 2RE1A 1OSCA 2Y1JA 2IYGA 2XZTB 4QU6A 4PUOB 1PJ6A 3B4DA 2XYPB 2LQ5A 3TAMA 1MWYA 3C2PA 4OI0A 2CQCA 4YEAA 1IKXA 4IO1A 5GAGI 3IR6B 4C6AA 2I2YA 4DXLA 2WB1D 3THTA 3ISZA 1SUQB 2W9AA 3JYTA 2FZGB 4M5DB 1Q0NA 4FVMA 3PJ9A 2W01A 2H51B 5KT2A 2R7RA 2XZWA 3BM7A 1TU0B 2MY7A 4NXNF 5KFGA 2DNZA 3KG1A 3LALA 1G2EA 4QR1A 4LQ3A 5A8WA 3I9V9 2B0GA 2RIJA 3PO5A 1RAEB 1DFDA 2GMLA 2ASDA 2VASA 4WF9Q 3C14A 4OI1A 2VODA 5KG4A 4N5SA 3W5YA 1SPBP 2OPSA 3UI3A 2JLGA 3VAJA 4UZCA 2RRNA 3LQVA 3GV7B 4HHUA 1B0VA 2GIQA 3RB0A 3T5KA 4CCHA 1UA0A 4PEOA 3CJ0A 1RT6B 3PJWA 3DLGA 1IKXB 3R5BA 3QIPB 2QT7A 1JMTA 2ALYB 3N4WA 1AA1B 3JYTB 1TMMA 2AJ0A 4NEYA 3A8KA 3TA1A 1B0TA 1DY3A 5DS7A 5HLFB 2KU7A 5HO4A 2DXFA 1AUSL 5KFWA 3MR5A 3SQOP 3LP2A 1WC5A 4HDHA 5A8WB 3KNAA 3CW2C 2Y8YA 2E9RX 4C0BA 1VC6A 1NK7A 1ZA1B 3Q8RB 3C14B 2NLWA 3SIPB 3K2YA 4PXCA 3HXMA 2OPSB 4LF7F 2W24A 2AP6A 2V8PA 3NGUA 3TYTA 2K06A 3JTOA 5K8MA 3H2VE 2CDRB 4TQRA 5LMUF 1D1UA 2UU9J 4USJC 3OFFA 2MZQA 4K4TA 3IC1A 1N36F 1B64A 3EE3A 3MM5A 4M5GA 2HK3A 3ZFVA 2ZEJA 2CA9A 4WYWA 4JP8A 5A2QU 4WFXA 2ATCB 4DF8A 4L74A 5KG1A 1M0SA 2DGVA 5KFQA 2ADBA 5HMXA 1F9FA 3W65A 2BE2B 4C8MA 3KYLA 2WTFA 4TY9A 3CD0A 4JI6F 4ZVSB 3TJ9A 1AYEA 1RAHB 2HZVA 3N28A 4YS2A 1RUSA 2QMUB 1SJ4P 1FRXA 2M9KA 4F4AA 4CO5A 1I3OB 2CWKA 3GILA 3G6YA 2MQLA 2HBZB 2GAHC 3T6JA 1CJTA 3MM5B 3BGLA 5EUHA 3KLHB 4MIWA 2CQHA 2BV3A 3A12A 3SDEB 1NK8A 4WFBQ 2BQUA 2HLTA 2CG8A 3RTVA 1XJWB 3EGVA 4K0KJ 2PMWA 4DUTA 2AGQA 4IRKA 2JVRA 1JLFA 3WX8A 1KR4A 2QL5B 5ADZA 1RT5A 3RRHA 2HWHA 4XK8C 3RW6A 3KOAA 1N0VC 3E01A 4DU8A 3DGPB 2HRUA 3QRQA 2GIRA 3TZWA 1HHSA 1FJGJ 1S4FA 3VQSA 2F8MA 2EC2A 1U02A 2NSBA 4E98A 3FCHA 3IWLA 4DR1J 5C25B 4Y6IA 3RBDA 2YWWA 4PWDB 2DGXA 5DM6Q 3C6TA 2N3OA 2N7CA 4IG0A 1RAGB 4OZ1A 3K0JA 3FMWA 3RW7A 1VQKS 1RT5B 1X4CA 4JBCA 3D67A 4DCPB 1WG4A 3LAKA 2QZ8A 4P52A 1U1KA 5LMNF 4OYPA 1RABB 1R27B 4MK7A 3K5OA 2Q6CA 4BWMA 3HSGA 2HBYB 1UAWA 5CA5A 4O44B 4KO0A 8ATCB 3F73A 3NOGA 3ZZOA 3D66A 1RT4A 2AT1B 3CJ2A 2R8IA 1C1CA 1Y00A 3SFUA 3QO9B 2LXFA 4HVZA 1UVLA 1JLBB 3C6TB 3NAIA 4F04B 3IBFB 2CRLA 2EKNA 3VVUA 4U9RA 3CJ5A 1NSQA 4XO0A 3A3PB 4IFVB 5D0GA 4GKJJ 2DNRA 4C48A 3CCQS 1HI0P 1HNIA 2AX0A 2KO1A 2QFJA 5KAKA 3G6XA 4B3MJ 4F3MA 1TAQA 4IFYA 1XMQF 4WK1A 2M7SA 3QJPA 4RUHA 2WVFA 4W92B 3ET6A 3NCQA 3W8PA 2RF2B 1Q79A 4FF3A 1IKYB 5BYQA 3LOUA 2XMWA 1XNRF 3SCKE 1FESA 4DUZJ 2ZWOA 1QUPA 2ZE2B 1WI6A 2B7BB 2JVOA 1S59A 1UVIA 1LXJA 1VK8A 3ISND 4ZPDA 3SFGA 2FVSA 4JI2J 4UZBA 3EWGA 1TKDA 1RTIA 4NA2A 4I6AA 1YJNS 3H2UB 5KFNA 1LOUA 2GX8A 1HNWF 4L76A 1KONA 3NS7B 4DV5F 1XTZA 2V67A 4DV0J 2HFZA 4LVNP 1WDTA 3BKFA 1HNIB 4GKKJ 3AH6A 1AUDA 2DB1A 3DLLQ 2OPQA 2WSCC 4DV1F 1SXLA 4IFYB 4N47A 2CUYA 1M5SA 3PG9A 4KH1B 4EK2A 1FI4A 5DZ7A 3IAS9 2QL7B 3CCUS 3ET6B 2WSEC 1S72S 5GADI 2C2EA 2AF6A 2YVSA 5ITHA 3QWPA 5D78A 4J91A 1Z2LA 2YKOA 4J9OA 2FDNA 3GLJA 3S6EA 1ICEB 4Y3CA 4B08A 4O4RA 4HKQA 3TZXA 4CLSA 4F0HA 3UCGA 1GEHA 1Q7LB 2M88A 1VBKA 3MMBB 2MKKA 2F40A 2HBRB 3KJQB 1RTIB 3I5BA 3GFZA 3FZBA 3W1YC 4DFMA 3N5BA 3R5GA 3DXBA 4X66F 4NXMJ 3NCRA 4JV0A 3IA0A 4ZP8A 4O4GA 3M6WA 1M90T 2LMIA 3LGNA 2QA2A 4JI0F 1EARA 3QRRA 4ZOSA 1PBAA 4ID8A 1D9DA 1GTEA 1YJVA 2OPQB 3BPSP 2A10A 2NYHA 3S8SA 4DPXA 1A7GE 2YKMB 4X4RA 2H5IB 2QTWA 4TN2A 1ZM4A 4ECUA 3ZNUA 1S76D 1HBUA 3MR7A 5H9EJ 3AOCA 1Y5LB 2ZBQA 3MCOA 1VBYA 1IBCB 5F8LA 3RBEA 3MMCA 1YHQS 2ZJPQ 2W9CA 2E29A 3KTQA 4RW8B 5H1SV 2RILA 1IWAA 3PYEA 1YBAA 4V1Ak 2D74B 3K58A 2IJRA 2G2ZA 2YH0A 3FMBA 5JMNA 4LF9F 5CYMA 1CC7A 1QSSA 2CQ3A 4B9UA 2FIUA 4DR5F 2IJNA 3TQ1A 1L3SA 4USWA 3BSNA 1NLKL 4H4MB 5M2RA 1BQNA 3BPDA 4H4KA 2MKHA 5DJBA 1C4CA 5I42A 3POTA 4UUXA 2CNLB 3CCMS 5DO2A 1JLAB 2ZVIA 2OSQA 3EDRB 4NLQA 3UN3A 1RWXB 2BKNA 1Q5VA 1RKIA 1APSA 2L41A 1WEYA 5I3PA 4CO3A 5KFAA 3W66A 3HD2A 2XBPA 5B0EA 2V94A 2DNGA 2G9OA 2R2TA 2HHHF 2W9CB 4ZVHA 2XNQA 1UMJA 2BOPA 3FBEA 4EO6A 2CJYB 2EC0A 4K50A 4O3PA 3UDLA 3HX9A 1ACMB 2OI2A 1IM4A 3QGHA 4DLEA 3VF0B 1WUUA 2QSFA 2DNNA 4DFKA 4QWAA 1CULA 3M32B 2WONA 1A6LA 3JAMU 1HQ2A 3EZUA 1JK9B 4RUBA 3POTB 1NUEA 5F0WA 1RT2B 4DV4F 1P8GA 2XNRA 4YHHF 1S5ZA 5ETQA 2KN4A 1H2TZ 1NM2A 1KWMA 3H5SA 4ZPWR 1NB2A 1X4EA 4A8QA 3W62A 1N5TA 3I87A 1HBNA 2UXCJ 3M05A 3OVAA 2CQGA 1CJKB 4EEYA 2AYGA 3TUJC 5EWGA 2WBMA 3PEHA 2JFKA 3MOJB 4F4ZA 5AXLA 4N8NA 2JSXA 2X1GA 4AQYF 4U67Q 1VC0A 4URGA 3K8WA 4GO7X 3EVMA 5F9LA 3MF5A 3ZO7A 4EBCA 5F8NA 4GRSA 2LXUA 2B51A 2C2NA 4AXIA 1JJHA 1CULB 2ZM6J 4I64A 1DLOA 4NA1A 4EBEA 1BQXA 1CJVA 2EWHA 3MAAA 3CWJA 1EP4A 4OJHA 2ZBIA 1VIOA 1E6VA 4OYBA 1WDDA 4DCJB 2VOPA 3MMJA 3Q8PB 2E5LJ 2RH3A 5J2PA 1VMBA 1OQ3A 4KC5A 2Z2YB 2WOMA 4LR7A 3Q22A 4GVLA 3OFHA 4ITSA 4LF5F 1HBNB 1PC5A 3O3LA 4K4UA 2HVZA 4AL7A 2UUAF 1V3SA 4I6WA 1QTMA 4NCAA 1SVDA 4LFCJ 2FGCA 4GC7A 2UUTA 3V2UC 2HVIA 2I9SA 3UDEA 2HFSA 2L9DA 2IRYA 3AJ1A 3CC7S 4RPFA 1DTQB 2R8JA 4WK3A 2Y1IA 4DS5A 2IYIA 2RQCA 3EVOA 1TUGB 3DLEA 3CDEA 3MAAB 3GSDA 4OFZA 1ZOTA 5HJYA 3J7ZT 4RL1A 1TK5A 2HZAA 5A2QY 4X4QA 2EW9A 4I0WA 1EETA 4IR9A 4OX9F 2XLKA 1BD6A 2QE5A 5M2UA 2ZBPA 3P49B 2D1CA 1R7IA 4DR3F 1WHVA 2I38A 2HRTA 1FRIA 3GYNA 1RQ0A 1HWIA 2LQ9A 5EWFA 4DUYF 1KVJA 1BLUA 2DGUA 2RKIB 3MEEB 2NSCA 3L4BC 2F4VF 1DQ8A 1FE0A 4H4OB 3A3OB 5DQIA 1M5HA 4K2JA 2F9JA 3ZC4A 1RWVB 3DRXA 2Y3YA 4X65F 1GXUA 2MDAA 5L9NA 1FWKA 2Z57B 1ZM9A 4LF4F 2K7KA 4ZP7A 2QYCA 3L7UA 2DGSA 4JI4J 1Q1KA 2GHWA 3DLEB 2E66A 5EGYA 1S6UA 3OD2A 1RTDB 3T1AA 4C8KA 4P75A 1EETB 3C15A 3D6TB 2POKA 5KFFA 4IOBA 3FQKA 4YB7A 4I67A 4Y28C 3ZNJ1 5C42A 3ZZPA 1U2FA 3E3XA 4ZP9A 1RTHB 2VDIA 5F8GA 3SV4A 1EKRA 4DPTA 1J27A 1U25A 4WU3A 4AT1B 1AW0A 4HR2A 4WWSA 5F3TA 4X62J 2XMVA 4X64J 2DR7A 2B56A 5SUHA 1SQEA 1S49A 1RU1A 3CO9A 3M6VA 3OVBA 2UZAA 1Q8LA 2W1BA 4OYAA 3T1YF 3FSXA 1XNQJ 1ZYQA 2KFNA 5G4DA 3CSKA 3UVJA 2VFVA 2QLFB 3LWLA 3QBCA 3HFKA 4ED1A 3DU6A 2VG6B 1K47A 3C15B 3QAUA 3ISNC 2HS0A 4NRTA 1T95A 7AT1B 4RLEA 1VYAA 4ZMMA 3G6VA 1U0HA 1TL4A 2B9XA 3M8QA 5C42B 4ID5A 1R0AA 4ZVQB 3V5RA 2PD1A 2XY7A 2NZ4A 2FQQB 2FJBB 4X4VA 5GAEU 1DQ9A 3M2UA 2CVEA 3TAQA 3T9NA 3MCNA 2BA9A 1UPPA 2MLYA 3N0VA 3V6JA 4KGKA 2DNKA 3TZZA 2GO8A 3PR5B 4DL2A 2AX1A 2QA4S 3QZ8A 1LW0A 4LSZB 2ROGA 1CQMA 5D0HA 4QWDA 3B4MA 4C3KA 3UVJB 2R8HA 2VIHA 2DGTA 4QIFA 3EPIA 2BACA 3PACA 3IG1A 1N56A 1YK9A 4ECTA 5K14A 1X8DA 2CPYA 4M5LA 4FF1A 1U0HB 3EDQB 3ILJA 2MQQA 4ID5B 1D8ZA 1FRKA 1LW2A 3FCWA 2NS1B 3O2IA 3QRPA 3HMJG 4NOHA 5HSPA 3KNGA 4Y2AA 4KV8A 4B9MA 4ELTA 2FZCB 3TW0A 1SL0A 4YN3B 3OW2R 3GJSB 4JI1F 3FRZA 2UV8G 3BO3A 2UUBF 3CTRA 1G4CA 2E7XA 4CT8A 1LW0B 3PFOA 4NX9A 3DNCA 4RW4A 1X9SA 2AMCB 4DR4F 4QYRA 3J7YU 1E6YA 4DFJA 4HI1A 3A8IA 1FJCA 4OHXA 4JI7J 4PG7A 1SL2A 2VA2A 3HZGA 5K14B 2J9DE 2W7AA 3PIOQ 4J9KA 3QT7A 2M0GB 1RP5A 5CZXA 4ZKAA 4DSLA 4ZLJA 1LW2B 5KOXA 2CJBA 2GCFA 3NMRA 4KV8B 2C2KB 1RB0A 1LV5A 2GC8A 3K89A 2UXDJ 1YTYA 3D54A 3PJXA 4ECQA 1NKEA 2Z2ZA 2QLJB 3I0SA 3GCXP 1GMWD 1VQ9S 1SKUB 1SKWA 2E1MC 2AEFA 1E6YB 4I2PB 4OI6A 4XIUA 4RJVA 2J9DA 2QG9B 3NEKA 1RT3A 3CJKA 4Y34A 5L39A 3IS9A 1TL7B 1VQ5S 4PG5A 4F4YA 4JYAJ 1UL3A 2F3JA 1C4AA 3HK2A 1Q82T 1FRMA 3HFZB 4Q0BA 2HFOA 3H4DA 2Y1LB 2XMKA 2CZ4A 1CS4A 2RSQA 2XI3A 3M8PA 2G1HA 1L3VA 1Y7PA 3A4TA 2YH1A 4OZ3A 4DF4A 1HWKA 1PYSB 2YBVA 3QPIA 2ATLA 3AOBA 4LFAJ 1HQUA 3DHXA 4F4KA 2CZ9A 4K0KF 1DAXA 2G2OA 1B3TA 2XMTA 4A47A 2VJVA 3CJ4A 1Y5IB 3QGIA 2ZNYA 3CJKB 3IS9B 1C2PA 3T5JA 5DDQC 1T3NA 3J7AN 3B78A 1JLQA 3TWZA 1CPZA 1JJCB 3ZTOA 1S9GB 2IM2A 5J2MA 2CAJA 3MURP 2H3EB 5J2QA 2PEHA 1RJJA 4FF2A 1TVRA 3C6UA 1XC9A 4Q0BB 2FVRA 1FJGF 5KFSA 3OR1B 1FKPA 4X84A 1CS4B 4G1PA 2RVJA 4ETZA 4K2XA 1MMDA 1SC3B 4ZCKA 4DR1F 3O5TB 3R6GB 3KKFA 2JEFA 3OT9A 3GE9A 4QWEA 5LXYA 1MROB 1WORA 3D68A 4DZ6A 1NJXA 3SCLE 1H6KX 2AWZA 5KFMA 2W9BA 2LECA 4QPTA 3RAQA 4QIVA 4I6YA 2HRYA 3BH7B 3HKZD 3M30A 2ASJA 2GVDA 1JLQB 2BEFA 2JLFA 1L3UA 1U47A 3JAMY 3P96A 4IH5A 5C24A 5J2QB 2Q1LA 1TL1B 3J81U 1RA6A 3FBFA 3OV7A 3C6UB 4W98A 4YR2A 2XLJA 1FKPB 3RR7A 3AAWB 2BW2A 3KLEB 2YWKA 5DQGA 2VKZG 4F0KA 3ENWA 1KC8T 1R0BG 3LANA 1WD6A 4UOCA 4KR0B 4FF4A 3GG0A 4G1QA 2G0JA 5F8MA 5F8IA 2BJEA 3UD3P 3RJMB 2MHNA 4WIIA 1YX2A 1JB0C 4N77A 1NDLA 3K5NA 4NEZA 2UUCJ 1NO8A 1YWXA 2ZOFA 5FDLB 1DTTA 4NLSA 4G1IA 3PRVA 4FPRA 2YQ1A 5E3RA 4LRFA 1PKUA 1OY8A 2IVMA 5L1KA 3ILOA 4EI2A 2OTLS 1TAUA 2MJNA 3TA0A 3GIMA 3T1HJ 5K8OA 2WB4A 3LPEA 3R5CA 4G1QB 4ALZA 4DMZA 4JI2F 2VONA 5CHCB 1O6XA 1FJEB 1WF0A 1XEZA 2ZOGA 1Q78A 1S1UA 3R5AA 1VRTB 3A13A 5KG6A 4C8YA 3DYAB 4Z7CA 4W4MA 1HW9A 1YDLA 3GR0A 3EUNA 4U7CA 2RB7A 4KGZB 4JV2A 3DOKA 1HKAA 2D3O1 4X2BA 4MYTA 3DMJB 4WP8A 1MWZA 2LCWA 3MTKA 3O6QA 1HHTP 1NHKL 1VR6A 3HT0A 1V6HA 1N6QA 1OPIA 2PC6A 2NXUA 1RHJB 3T6BA 4LSNB 5KFTA 3N79A 3H2LA 5BJRA 2HHPA 4ATNA 1BUXA 3VGVA 5IS2A 3TANA 4FYXB 3RBZA 3BYPA 1JNRB 5EX3A 2JNJA 2V34A 5D6GA 4KT0C 5HMYA 4QOTA 3OR2B 4J9LA 1LWCA 4EFAC 4NXMF 3QJJA 3WIUA 3OTEA 3OL8A 5GAHU 4RW6A 2YNIA 2ZHOA 3TOQA 3A3NB 3FKBA 1P27B 2EG2A 2KJVA 4OI3A 2Y9HA 2JEIA 2KKHA 4PR6A 2RNEA 3FGVA 2U2FA 1SQGA 2IMOA 3MMAA 3DOKB 3TVKA 2BR0A 1IR0A 1X4AA 3W5XA 1BQMB 3VZIA 4QW9A 3G8TA 2LVWA 2HQCA 4L75A 1U6ZA 1S6QA 4DV7F 3JSYA 3RUBL 3W60A 1Y11A 3D7SB 1TP7A 2EVZA 3HVTA 2XY5A 3MECB 1REGX 3OTOJ 3TJAA 1IBLJ 5KFIA 2R7QA 4BC7A 1N5YA 4CYUA 1LWCB 2GVZA 4Q43A 1LNQA 3OXGA 3CCWA 2R7SA 1VJWA 1VRUA 1ROFA 3SEOA 3JQKA 4CH0S 4ZVTB 1N52B 2RT3A 3AA8A 3RB3A 2MKIA 3VZHA 1WOPA 1XN9A 2FHKA 3ZTPA 2DGWA
chains in the Genus database with same CATH topology
4RW4B 4ZPCA 4U7UK 5T7LB 4OX7A 4ELVA 4USIA 4OHYA 1VI7A 4WE1A 3OL7A 2AGQA 2A18A 2V8VA 4A8YA 4IRKA 2LQJA 1FRJA 1RISA 4MJKA 1P1TA 3FSIA 2J8AA 2BQ3A 1A9NB 4NYPA 2JVRA 2HS4A 3V81A 2IFXA 1JLFA 4MK8A 2XWXA 2GHVC 2YKQA 4Y2IA 1KR4A 1QE1B 2NPIA 3BN7A 1U8SA 4LUBA 5ADZA 3MD3A 4NLDA 1RT5A 2B9WA 2HWHA 3RRHA 2J9EA 3NRBA 4XK8C 3RW6A 3MGJA 3T9ZA 1WF1A 5HN0A 3BQ0A 3KOAA 1N0VC 1HR0F 3E01A 1DBDA 1UVMA 1SJQA 2CQ1A 4QJVA 4FYDA 5BR8F 2KYXA 3HM9A 2HRUA 4NZ7A 3CCVS 4Y2CA 2GIRA 1B0PA 2OSRA 1OO0B 4TU9A 1DTQA 3CCTA 1HHSA 1S4FA 2MZTA 5B0BA 1IQZA 4JI7F 4PQUA 5CYQA 2LYVA 3VQSA 3RAMA 1HW8A 2F8MA 1GX5A 3M6XA 3CDUA 1UJ5A 2VBXA 3OJSA 4JI3F 2RRAA 2UVUA 3MI7X 1TZ0A 5GVQA 2PE8A 4RU2A 1NHVA 1TKZA 3V6DB 1LWEA 4QPXA 3BR9A 2O5DA 2ZKUA 1LQ9A 2XULA 4HTIA 2NSBA 1UA1A 2HHUA 4E98A 3DRSA 3FCHA 3IWLA 3FVYA 3MM7A 3KHHA 5C25B 4LIRA 4ED5A 4WFYA 3NS6A 4Y6IA 3K57A 3RBDA 4C8OA 2E9ZA 2XS7A 1RDRA 3BZQA 1UW4A 1I1GA 3PDNA 3MM8A 4PWDB 4DSIA 4O23A 2AJ1A 5HI7A 2DGXA 3I0SB 5DM6Q 3C6TA 1ZTTA 3DI6B 2EPIA 2N3OA 4J9QA 2N7CA 1MMNA 1IXKA 3I4HX 3ZZUA 3IR5B 2DR5A 4OZNA 2FC8A 3OUYA 2IBOA 2MXYA 2LKZA 3I96A 4IG0A 1SBRA 2JLEA 2Y0SD 4KBIA 2BRLA 4OZ1A 4USHA 3TVYA 1S97A 3K0JA 1VQMS 2FY1A 2M4MA 3FMWA 3HHLA 4F2RA 2BABA 3K7RA 3RW7A 1IJEB 2HHQA 3CPWR 3V81B 5I3UA 2UXCF 2Q6BA 2HS3A 4QQBA 2DD8S 3CCES 4O3SA 5EX0A 2MKSA 1IKWA 3FNNA 2MZJA 5IT4A 4O3QA 2GFFA 1U1OA 1VQKS 2UXDF 2QEXS 4OL8A 3C66A 4BBYA 1RT5B 2RKIA 4RUAA 1RT3B 1X4CA 3MEEA 5E0OA 3MM9A 4JBCA 1RKJA 3IRXA 3OLBA 1FHTA 4IR1A 2B5JA 4H4OA 2XG8A 1S1WB 1AFJA 1FE4A 4CIOA 2VUGA 1WG4A 3KHGA 2JX2A 4WFZA 2CPHA 3DLKA 3LAKA 1ZPVA 2QZ8A 3PKYA 3CDAA 1U1KA 5LMNF 2XEXA 2B4OA 3SMZA 1PO6A 3DDKA 3LUYA 1VK3A 2HNZB 3GMGA 5L9XA 4DV2F 1KEKA 4FXWA 1KQFB 2D3OR 3KG0A 4JV5F 1R27B 2OKQA 5LSRA 4MK7A 3K5OA 2Q6CA 4BWMA 4ZHRA 1UAWA 1TKZB 5CA5A 4BDPA 2MQNA 4X4TA 4L72B 1SJRA 1C0TA 4O44B 2BM1A 4KO0A 2ZM6F 3F73A 3DRSB 3MEDB 5D3GA 4JYAF 4K4YA 2PMHA 3M8PB 3MM7B 4I1TA 5A8KA 3ZZOA 1RT4A 1ZM3A 2J0WA 2ZC4A 5MLCV 5LT5A 4QWCA 3QZ7A 2YKPA 4RKUC 3DU5A 3I56S 3H40A 3BSOA 3CJ2A 3UCZP 2R8IA 1K9MT 4OZLA 3CD7A 5CCLA 2GW8A 2B6AB 4ZA1A 1RTDA 3BQ2A 1C1CA 1Y00A 3SFUA 4F02A 3SSQA 3V4IA 3QO9B 1G1XA 2C3PA 3MM8B 5E3QA 2LXFA 1YJ9S 4HVZA 1UVLA 1XR6A 1JLBB 1HQUB 3L7OA 2F9DA 5IZHA 5DDOC 3C6TB 3NAIA 3GQCA 2RUGA 2K2PA 2E5LF 4R8UB 2KXFA 4DSJA 2GGPA 2CRLA 4C3MA 4DSKA 1O51A 2VC0A 1FERA 4NCGA 3CJ5A 4U9RA 1U49A 1UFWA 4XO0A 2X3GA 4IFVB 4DV6F 2DNRA 5I3UB 3LH2S 3DRRA 1RTHA 3PW0A 2CG4A 5KFUA 1IKWB 3CCQS 1HI0P 1HNIA 5B0AA 2EI5A 2AX0A 4LFAF 3GWCA 2KO1A 2IAJA 3F41A 2QFJA 5KAKA 4DWIA 3NGKA 1U6BA 3G6XA 3MR6A 3IRXB 4M1KA 5CH7B 1URRA 4DL7A 2RQ4A 4DBQA 3DLJA 4QR2A 4F3MA 1Q7YT 1HNZF 1TAQA 4NZ0A 2B4VA 4IFYA 4LQ9A 4PXBA 4DG1A 4C8ZA 5I4MA 1YVFA 3ZZTA 2KFZA 4HLBA 3VAKA 1FVQA 2PA8D 1XMQF 4UY85 1Y0HA 4OZ0A 2VFUA 3NBPA 2LLZA 5J2MB 4WK1A 5D4LA 4Z2XA 2M7SA 4P6QA 2GHPA 4C3LA 4RUHA 5JUMA 3IN5A 2KRBA 4W92B 3RB4A 3QJPA 1HBOA 2A2DA 1OQ6A 3NCQA 3OSPA 2RF2B 1Q79A 2PDAA 1TVRB 2G0CA 5K8PA 4QIWD 2XGPA 1IKYB 5BYQA 5KFLA 1DQAA 3LOUA 2XMWA 1XNRF 1MU2B 4ED6A 3SCKE 5FD1A 4ZHRB 2R7XA 1FESA 2DCLA 5IQQA 1LK7A 5KT6A 2FJEB 1R6YA 1O8BA 2ZC3A 4O0IA 1NKBA 1QUPA 1C0TB 2DNLA 2PT0A 5F0UA 2ZE2B 2R7TA 3TVZA 1WI6A 2B7BB 2IC3B 5A8KB 2JVOA 1UVIA 1LXJA 2AU0A 1VK8A 2KG1A 4DL3A 1BGXT 3ISND 4ZPDA 4MKYA 3SFGA 2RU9A 2KB2A 5GMKa 3V4IB 1MMLA 2RDJA 1YSJA 1FT8A 2AYMA 2DH8A 4PQAA 5HMZA 2FVSA 2VG6A 2OPRA 4Q45A 2RD5C 2HNYA 2V8HA 3RRKA 1RTIA 1TKDA 4F8RA 4NA2A 1REVB 1PSDA 2FLOA 4I6AA 5HQ8A 4DQIA 1NK5A 1YJNS 1QAXA 3H2UB 5KFNA 2CQBA 5KFXA 4FP9A 1SKSA 1KSPA 3OL6A 1SKRA 1LOUA 2GGPB 3KK2A 2GX8A 2OMLA 1WTBA 1NJZA 1HNWF 1KONA 4DV5F 4NCGB 2E1RA 4FZVA 3KK1B 2XCAA 4IDKB 1XTZA 5D8HB 4JI8F 4AXJA 2HFZA 3AA9A 1NJYA 4LVNP 1GH8A 3NNHA 4DHVA 2QA4G 2YNHA 3SQGB 3DRRB 3BS9A 4PWUA 2RU3A 3BGRB 1JXLA 3QIDA 1HNIB 2DISA 2ZH7A 2KZMA 2W9BB 3AH6A 1U45A 3DLHA 2RRBA 2IAJB 2ILZA 1AUDA 2DB1A 3DLLQ 2OPQA 2WSCC 4HYKA 1ZH5A 3EZ5A 4B9VA 3M30B 5DRKA 1X7VA 4F25A 4DV1F 4YB6A 1RWUA 1Z1ZA 1HI8A 5KFHA 4WZQA 1SXLA 4IFYB 2RMLA 3NS5A 4N47A 1LWFA 1M5SA 3D2WA 4NYZA 1VLYA 4KRWA 5DETA 4NCBA 2VPZB 2ZH2A 1NK6A 4TXSA 3VCDA 1J5OA 2JOQA 2R8GA 3D1HA 5C24B 3MOZA 3IAS9 4EBDA 3DOMA 3CCUS 2PIIA 1HBOB 4BCAA 1SJ3P 2WSEC 3PW2A 1S72S 3DCAA 1WNEA 3R1HA 5GADI 1MSWD 1WF2A 5IM0A 4X4PA 3OVSA 2C2EA 2AF6A 2YVSA 4OLPA 5ITHA 1IKVA 1TV6B 3AQPA 3OBIA 1X4GA 3M4XA 3QWPA 2ZBCA 3JTNA 5D78A 1T7PA 4ERDA 1KN6A 2R9LA 3L3CA 2HPUA 1Z2LA 4ED2A 2YKOA 4J9OA 2FDNA 3S6EA 5T41A 4Y3CA 4RNHA 5KT7A 4B08A 4O4RA 4HKQA 2VB6A 4K4VA 2CIMA 1IUJA 4JI4F 4KFBB 4IYQA 5KFDA 2DNHA 3UCGA 2LU2A 2CQ2A 1RAJA 1Q7LB 3SSRA 4C11A 5GAGU 2M88A 3US5A 3LAMA 3MMBB 2MKKA 3HO1A 2F40A 2MGZB 4EO8A 1GAOA 3N01A 1K73T 2FLPA 2W8LA 1VS3A 2HNYB 2ZH6A 1RTIB 3I5BA 4YR0A 4NA3A 4J9RA 3GFZA 3FZBA 2M8DB 2J76E 1NHUA 2ALZA 3CIMA 4DFMA 3N5BA 3IGNA 1WHWA 3KK2B 2HW3A 2QO3A 3DXBA 4X66F 3T19A 4B3OA 1AFIA 3TAMB 3KMSA 3CMAS 1T3OA 2MMYA 1DURA 3FZ2A 3SZ2A 3NCRA 4LMZA 4RU9A 2JHEA 4JV0A 3IA0A 1WG5A 3HI9A 1KD1T 4ZP8A 5IXUA 4O4GA 3M6WA 1KLNA 2D9PA 1M90T 1P1LA 5DG7A 3D5MA 2DR9A 2VC1A 2LMIA 1RK8A 3LGNA 2QA2A 2R7WA 3BGFA 4JI0F 4AUKA 3M1VA 4PXEA 4ZOSA 5G0RA 1Q8IA 1D9DA 4ID8A 1GTEA 5CXTA 1YI2S 1YJVA 1SL1A 4YQWA 2OPQB 5GADU 4DLGA 2A10A 3S8SA 3UR0A 4FXDA 1GQEA 1A7GE 3N6MA 4L3NA 3CC2S 4ED3A 1QSYA 1NJIT 2Z8QA 4YMEA 1LWFB 4PG4A 2YKMB 4X4RA 2UV8A 4TN2A 2XHWA 1DTTB 1ZM4A 1U09A 1HWLA 4ECUA 4OJ1A 1HBMA 3D0HE 3CJ3A 5E2QA 1HBUA 4X62F 3DRYA 2MKJA 5H9EJ 2VQFF 3FFIA 1Y5LB 3FEXB 4DX8H 3K5MA 1CVJA 4HI2A 2F8HA 1VBYA 5F8LA 3BGUA 5IM0B 3RBEA 3EX7B 3CT9A 3MMCA 1UJ4A 1IKVB 4K5SA 2DPJA 4JUZA 1YHQS 4YR3A 2ZJPQ 2W9CA 2E29A 5KG0A 2MQPA 3KTQA 3MD1A 1NK0A 2A3JA 2KT3A 4RW8B 5H1SV 2G13A 4I7FA 2RILA 2KJWA 4ZPTR 1NH7A 4CH1A 1SH3A 3JSRA 1XNQF 4OV1A 1YBAA 2D74B 3K58A 2HWIA 2KYZA 1H2VZ 3KLVA 3LP0A 4C11B 2YH0A 2DNYA 3FMBA 5KFVA 4LF9F 5CYMA 3BSCA 3NLCA 1CC7A 2LDIA 3CB4A 4FF3A 1QSSA 2CQ3A 4B9UA 1QSLA 3JSBA 4WXOA 4KKOA 2FIUA 4MFBA 2ZJRQ 1S0MA 3JB9k 4Y0FA 1FXRA 5B0CA 4DR5F 3T5HA 1LKZA 2FVCA 2RJZA 4ECZA 3CCZA 2IJNA 3UFCX 2ZKTA 4D3GA 3TQ1A 4IUFA 1L3SA 4B3OB 4NYOA 2KTQA 4RW9A 1UKUA 2L48A 4B17A 2KT2A 3AB4B 4P2SA 5IFMA 5KT3A 3BSNA 2W4PA 3DLGB 2JRSA 4H4MB 4F26A 3J7YI 5M2RA 1BQNA 1OIAA 1FNXH 1YJUA 2XMUA 3U7JA 1ZZFA 4H4KA 2X1AA 2MKHA 1S1UB 1N0UA 4B3SF 5DJBA 1L3KA 3SI8A 3P3DA 1C4CA 3ETOA 3M1VB 4DN0A 4Q2MA 1X5SA 3T1HF 1HPZA 3POTA 4TU7A 2OAUA 5LSOA 5I42A 4UUXA 3PY8A 3CULA 5JJBA 3CDWA 2ZHAA 3I4PA 4OX6A 5CZVA 4OZ5A 1X4DA 2DNMA 1G7CB 1D9FA 1SC6A 3CCMS 5MAOA 2JC1A 1S0NA 2C2RA 4KIAA 4JOUA 3MR3A 5DO2A 5KFJA 1JLAB 2K3IA 1VBZA 2OMOA 1WEXA 4FS1A 1Q53A 2OSQA 1HQEB 4NLQA 2VG5A 4Y2MA 1RKIA 1FO1A 1APSA 4NL5A 1HBMB 2L41A 4M94A 3LP2B 4Q7AA 1WEYA 3MM6A 5I3PA 4CO3A 3KHRA 5KFAA 1ZAVA 2L08A 3M6UA 2ZH3A 3FFIB 3RZAA 3T3FA 1HYSA 3J81Y 3WZ0A 1ZAWA 2XBPA 5B0EA 2W4DA 2DTJA 3B82A 1RA7A 2V94A 2UVRA 1KQKA 1N6QB 2DNGA 2G9OA 1K1QA 2OPPA 2Q79A 3ZZZA 2XO7A 2FJWA 1F5CA 1TFYA 4CO1A 2R2TA 2HHHF 4X4SA 1XMBA 3E51A 2W9CB 4ZVHA 3MEGA 2XNQA 2DRAA 5DG8A 2DH7A 2UXBF 4N76A 1FXDA 1UMJA 2BOPA 4GMKA 3MR2A 4EO6A 2KM8C 2DGQA 4NWBA 2JZ5A 3LP0B 2EC0A 4K50A 1XBWA 4O3PA 3UDLA 4J9NA 1U1RA 4ZDNA 2PI4A 2D41A 1KHVA 3HX9A 3OL9A 4I2PA 2HQ3A 1M5KC 1IM4A 2J0XA 3QGHA 4RNNA 3MPWA 3VF0B 4DLEA 3UQSA 3LO3A 2JEJA 1TL5A 2K1RA 2ZZNA 3NNCA 2CPZA 4BC9A 3H5YA 1WG1A 2QSFA 4PG8A 2DNNA 1KOOA 2CPXA 2YNGA 1X4HA 3UW1A 3O8WA 2K8GA 4QWAA 4DFKA 2KDOA 3W2VB 5THWA 3M32B 2WONA 4IOCQ 1A6LA 4NRUA 5B0GA 2OP5A 2IVFB 2Z4PA 3B8HA 4MAKA 4CQ1A 2DO4A 3EZUA 1FTRA 3ZZRA 2CJ9A 2KM8B 1JK9B 3WX4A 1FKAF 1HPZB 2WSFC 3POTB 1SI9A 4RW6B 2YNIB 2J5AA 2IM0A 4TKTA 4QIGA 4GC6A 5F0WA 1F2GA 1RT2B 2V8GA 4R5PA 1UVNA 1YITS 4RBTA 3CCLS 4DV4F 4NLTA 1P8GA 3CCJS 4YHHF 2XNRA 3OHAA 4EYHB 1CSJA 2ZFHA 4KB7A 1NB7A 2M5YA 4ES3A 2KN4A 5L38A 4OMFG 2VG5B 3MMAB 1H2TZ 5D4OA 3PKMA 2UU9F 2BDPA 3H5SA 4ZPWR 1ZM2A 3M2VA 3I0RA 1X4EA 3ONQA 4A8QA 1KQGB 2YX1A 2YNFA 1HYSB 1N5TA 3I87A 1HBNA 4PRFA 2Z2LA 3M05A 4FN5A 3OVAA 5HROA 2CQGA 1X0PA 4ILMA 4EEYA 3M2RA 4HL9A 3TUJC 2AYGA 3H5UA 1FDAA 2D9OA 2GJIA 2OPPB 2VKRA 5LSLA 2WBMA 5EWGA 2DHAA 2GA7A 3PEHA 3CF5Q 4M95A 1JLGB 2JFKA 1S6QB 5DGBA 3MOJB 3EYZA 4DJBA 3BR8A 2AGOA 3MEGB 5AXLA 4F4ZA 2YKNA 3RR8A 3D0GE 2P6SA 3IGVA 4N8NA 1B7FA 3HKWA 5KTQA 2DHSA 2JSXA 4IRDA 2X1GA 3DN9A 2I1RA 4AQYF 4X4UA 2EFNA 4U67Q 1N88A 3HVTB 1VC0A 1DRZA 4URGA 1U1PA 1FXLA 5CD4H 1VGYA 3FSYA 3K8WA 4GO7X 1URNA 4LSLA 5F9LA 1R8PA 4I2QB 4WYLA 4N56A 1S0OA 4XAKA 5A0YB 3MF5A 2C3UA 4J9MA 1Y9OA 4XPEA 4EBCA 5F8NA 2LXUA 2B51A 4ICLA 2JL9A 4LF6F 2K1RB 2ZH9A 5K8NA 2QV6A 2BZ2A 4AXIA 2XLIA 4RW7B 2DHXA 2PSZA 2YNGB 3HHLD 4MYUA 3TARA 3U02A 1JJHA 1V3ZA 4OHZA 2RS8A 1RYRA 1WWHA 4OIXA 1N5YB 4Q5VA 4I64A 3G4SS 1WACA 1DLOA 4NA1A 4EBEA 1BQXA