5GAEJ

Rnc in complex with a translocating secyeg
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
KTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S rRNA
publication title Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2015-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
J PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 5gaeJ00
1YITI 1Y39A 5JVGF 1VQOI 5GAEJ 3CCUI 1HC8A 3PIOF 1ACIA 4V19K 3CC7I 3CCEI 2K3FA 1MMSA 3I55I 1VQMI 1YI2I 2E36A 3J7ZI 3G4SI 3DLLF 1VQPI 1YJNI 3I56I 3CCRI 3CCVI 4IOCF 5GAHJ 1FOXA 2QEXI 1VQ9I 4UY8I 3CCLI 2FOWA 1YIJI 2ZJQF 4IO9F 1VQNI 2E34A 1VQLI 5GADJ 2E35A 1FOWA 1VQ4I 1YJ9I 1S72I 4IOAF 3CCSI 2H8WA 1QA6A 2QA4I 3CF5F 3CC2I 3G6EI 3CMEI 3CMAI 3CCMI 3J7YJ 3G71I 1YJWI 3PIPF 1VQKI 3CJTB 2JQ7A 2OTJI 1VQ8I 1YHQI 3CD6I 2OTLI 5GAGJ 1VQ7I 5DM7F 3CCJI 1FOYA 5DM6F 2ZJPF 1VQ6I 3CCQI 3CC4I 2NXNB 2ZJRF 1VQ5I
chains in the Genus database with same CATH superfamily
3F22A 5TISC 4UVCA 1E17A 5ILUA 4BXUA 3KETA 2HQAA 5E20A 2Z33A 3J7AY 2G7UA 5E3OA 3L1PA 5LHHA 1R1TA 3KZIC 3H35A 1B8IA 5ED4A 4P9UA 3S93A 3DTEA 2LY1A 4XIDA 1D0XA 3EQLF 2LD5A 4X6AJ 3AG4H 3DBRB 2VC0A 2EQRA 4B48A 2CGPA 3S1NJ 1ZR2A 2H1LA 2W1OA 3F8NA 1YRNB 3BG9A 4PGHA 4UV9A 3VDXA 2DA1A 2OPTA 4LB6B 4BS9A 3K4KA 3OYLA 1GV5A 4CDGA 3BR3A 3T8RA 4A69C 4BL0B 1VQPI 3EETA 3OYDA 4FISA 4TV7A 1B9NA 2H6BA 1FYKA 5EF6A 1ZREA 2XV4S 1HF0A 1QZYA 2MBFA 3ZQIA 3DCFA 5LGTA 2WY8Q 5HS9A 2KT0A 2V26A 5F1RA 2R7QA 3FM3A 1L3LA 2OF7A 2L54A 3DEUA 4KN7X 1TW2A 1EV7A 2D2WA 3DV8A 3ESWB 4LMYA 4D0PA 2UZKA 3OSFA 2VKVA 5CYVA 1R4NB 1ZK8A 1V3FA 1GUUA 4KN4X 2QF7A 4UHTA 4ZDLA 2KZGA 4U0WA 5L3BA 2A6HF 4IO9F 5EGOB 4IL6C 3OYBA 2YX7A 3KEOA 1O3QA 4R8HA 2VJIA 3JRDA 4EQQA 2IPQX 4V2FA 2PLYA 1HW5A 2BZTA 1YQAA 3OIPA 4E7ZA 1ZGAA 2KZVA 1WH5A 3HG9A 4ESJA 1DU0A 3HUGA 1HW2A 5E17F 1X1CA 3CCMI 2YSRA 2XIGA 5EYRA 2CV2A 1JTXA 1BC7C 2CQKA 4DJAA 1FSHA 2KJCA 5J1RA 1ZRCA 4G9YA 2HZDA 3O2PE 2A69F 2EA4A 2K9QA 2X1CA 2PFBA 4P55A 5HOOA 1W7PA 1L0OC 2DK8A 2EFWA 1YHQI 1SFKA 3OYCA 2EZHA 2DMQA 4RBOA 3WGIA 4RB0A 3SFZA 4BAYA 5C4JJ 4C2TA 2R7FA 2DFHA 5IT9K 1MZBA 3DEEA 2XASA 2VBXA 1HBXG 4CH7A 4KMFA 1TQMA 1VQ6I 2L01A 4RS8A 1OCZH 4V2GA 3CZ6A 3OYHA 1QQIA 3X2QH 1VQ5I 2F2EA 3CQZJ 3HTSB 5IOZA 5L3EA 1GHCA 1SMTA 3LMMA 1VI0A 3B6CA 1B6AA 2BXZA 2G9WA 1XPXA 4HYEA 1LVAA 3AAFA 1BI1A 1BR4A 1B9MA 4I0BA 1HC8A 3H9GA 2YUSA 1O57A 3CCEI 3C1DA 1MNMC 1YE9A 3GMEA 4II3A 2M34A 1A04A 1M1EB 3C7JA 2KL4A 2PMZA 3D5LA 5LHIA 2DMPA 4M74A 3HL2A 2STWA 2L9RA 2XDVA 2P81A 4A3LJ 3V7SA 1KA8A 5HDNA 3S3NA 5M3MJ 3MZ8A 1I6XA 2HDCA 1S7EA 1JKQC 4ZDPA 1T98A 3A01A 2DU9A 2IGNA 1K4TA 2A68F 2A07F 4PSXA 4IHTA 2VONA 1QZEA 2O03A 4J19A 1A31A 4XKBA 3RZDJ 3GTQJ 3F8BA 1ZKGA 1FIAA 5AONA 1I50J 3E6CC 4M9XA 5BQTA 1JTYA 2NYXA 4DBRA 4XNFA 3LWFA 3M07A 3QU6A 5DDGA 3HTUA 2LF8A 3MN2A 2WBMA 3KP7A 3TW6A 2M7BA 3KE2A 2DXIA 4PJ0C 2H1KA 2HOEA 2K40A 3BR2A 3Q9SA 2IS1A 1JE8A 1HKQA 4MNUA 2Q1ZB 1D1AA 2M87A 1LVKA 4C30A 4F91B 5D5UB 1T2KA 3C3WA 4NC6A 4L5EA 2GBYA 2IGOA 4HQEA 3D5RC 2FNAA 1SD7A 1DPUA 1VF9A 4HV6A 1TWHJ 2VASA 3F3XA 3TO7A 5HS7A 3E5QA 2JRTA 5F6FA 4BYYA 1JJ8C 1G3WA 1NTCA 1MDMA 2NS8A 3GEZA 2CG4A 4FE7A 4F3QA 4JOMA 3AL0B 3LSGA 3MZYA 4RM2A 3COAC 4UB8C 1SFEA 1C0WA 3IRRA 3HRUA 2HOSA 1D5YA 4CCJA 4I99C 4ETSA 2H8RA 3MD2A 3W2WA 1WQ2A 3A4CA 2QGUA 4RAZA 3WU2C 5D5WB 2R5ZB 4HG2A 4IRIA 1HSTA 1H8AC 4G12A 2CV0A 3QPSA 1G3TA 1P92A 3ZCOA 1XS9A 2MD0A 1IN5A 1FBQA 1XMAA 5TGTA 3JTHA 3RTRA 1OFCX 2EILH 1ITYA 1VFCA 1EH8A 2GIZA 1MSEC 2ZB9A 4MFEA 1USTA 1GVJA 2PMZN 3HIFA 2DFIA 4KMUX 4LITA 3WTTC 2E19A 1UHWA 3K6GA 3H36A 2ZMEB 2E1MC 3OS2A 4Y4RA 3FF5A 1KQ8A 1FZPB 2CWEA 1DPRA 4I01A 3R0JA 2X6OA 2Z2SB 2B7EA 5DUIA 1REPC 1FYLA 2LK2A 5M3FJ 2DTRA 2IGKA 9ANTA 1MGTA 5B3SH 1RUOA 4NC8A 4RLQA 4E7JA 4ZYGA 4M3GA 3REOA 4KT6A 3DPTA 4BGDA 3HOSA 4GYGA 4ON0A 2LYCA 1FIPA 1QPMA 2BY1A 3CCRI 3KYDB 3QWLA 2M2EA 3W2VA 2EFQA 2E2IJ 4A6DA 4LLLA 4L9TA 2FRHA 5GAHJ 3BZCA 5M5YJ 3KZZA 1E3HA 2QEXI 2DPUA 1VQ9I 4KIGA 1Y56A 5F0FA 4DNCA 3TL4X 4UUSB 5EJCA 2XRNA 1QGPA 2X48A 2L4AA 1JGSA 4AIDA 1K61A 4PZJA 3V7RA 4ZDOA 1YS7A 2FBKA 2K86A 4HF2A 4FETA 5IP9J 3FM5A 1W4MA 2VE9A 4KJZA 3RYPA 4JX5A 2XGXA 1S5LC 5DS9A 1ZHFA 1J2XA 2DOEA 2FQ4A 2IVMA 3PQJA 5K5RA 2Q8KA 3BTJA 1AU7A 1U5TC 4KIFA 2E71A 1WVRA 3DBLB 3FZVA 4MHGA 4LD5A 2MW8A 5B1AH 1ZELA 4WK8F 1Y6IA 3TDUC 4Y13A 3G1OA 3GO5A 4M9ZA 4BBSJ 3V7CA 5EG0A 1LB2A 3QQAA 1IN8A 3BP8A 4XKCA 3RKQA 2IRFG 1OLTA 4XLAA 2DA2A 1S29A 4OIOF 5BMZA 1JXSA 1RPWA 4Y3OA 4GO1A 2ETHA 1G2HA 3S8PA 1Z3YA 1XD7A 3PJRA 2V9VA 1D1BA 5DD8A 4AU7A 3WTVC 4J00A 4A3BJ 5L3FA 1FNNA 3AG2H 3L2QA 2LH9A 4F55A 4ENMA 1PYVA 2P5KA 2XROA 2Y48A 2Y0SA 2FUG2 3DU6A 3N97A 4PSWA 5EZHA 2L7KA 3B73A 3BCBA 3ZQCA 2O9LA 5F04A 3GVAA 1WZ2A 2FA5A 2DBBA 2Q2EB 3DKYA 1TNSA 3F0CA 1I1SA 2P7VB 2CSOA 2X6XA 3M1CA 1H89C 1Y39A 3ZMDA 4UNOA 2XVCA 5JVGF 1FMVA 3MFKA 1IZ1A 4XLPF 1FP2A 3O8HA 2FE3A 1FT9A 3S2HJ 2LMDA 2XPWA 2YU9J 2DN0A 4NQWA 1ETOA 1BI3A 1OCCH 1WI9A 2DJNA 2IXSA 3PNYA 3OYJA 1IV6A 4MTEA 3OOPA 2QM3A 2H6CA 4XQFA 3HXLA 1PUFA 1FJLA 4A3CJ 2NS0A 2HTSA 2ZSHB 2EZLA 3WTUC 5JVTA 2XGDA 3J7AO 3FXQA 1TWCJ 2RREA 3I0TA 3MWMA 4U0VA 5DEQA 4E7SA 1EF4A 1WI3A 4A3GJ 4PFOA 1OCOH 3FISA 3FWEA 4YELA 3OSGA 1MBKA 1X2MA 3IH2A 1S7OA 1ON2A 2DA3A 4FHTA 3CJRB 2ZJ2A 3E6DA 3CCLI 1R1UA 3M4OJ 1IN6A 2VLAA 2BVMA 2GQQA 2ZXIA 3L2UA 2VQHA 3CESA 2CYYA 4BNCA 2W84A 2OJED 3J81Z 4KUMA 3S3OA 3N05A 5HNHA 2P6SA 5AIQA 2WB1A 3E7LA 3PUBA 2E2HJ 2E2JJ 1HA8A 1Z7UA 4F93B 2GXAA 2CW0F 4WXCA 2XAHA 2ESNA 2VB6A 1DQUA 1LDDA 2O6GE 3ZQ7A 1TLHB 1FSEA 1P6RA 3IKTA 4QIWN 4FT8A 3RKWA 3PQKA 4HF0A 1PP8F 2E7WA 2Z5UA 2KMUA 2L2OA 1XDSA 1UAAA 1Z9CA 3C2GA 1HW1A 4BY1J 2VE8A 2JUGA 2M0CA 2LKSA 1I39A 2K9SA 4A0XA 2LKPA 1TZLA 2JA2A 2Y0SN 4CCKA 2OZ6A 2Z1DA 4II2A 1VQ8I 1BR2A 2QLZA 4X1EA 3HOTA 2QBYA 3OYMA 4ENNA 3FXJA 3N4MA 2OBPA 3TOAA 4BE1A 3S1QJ 5IYDJ 3TO9A 3S2DJ 3MZHA 3RKYA 2GXBA 1WHUA 2LOOA 1DDNA 3A2KA 4EM0B 2CQQA 4AVZA 3SJMA 1UJ8A 1SVOA 1MJ9A 2TCTA 2V9PA 1FC3A 2FD5A 4HAMA 4JYKA 3JTGA 2ZJRF 1IN4A 4EGZA 1RR7A 2KRHA 2B9SA 2HOTA 2EFNA 1WWXA 4L9JA 2FF4A 2HYFA 1FPQA 3D1NI 3WGHA 2ECCA 4S04A 4Y15A 1R22A 3CCUI 3F6OA 4V19K 1K83J 4AC0A 5IP7J 4HX4A 2B0LA 3QPLA 2GLOA 2K3FA 2DMUA 1HXDA 1D0YA 2VL8A 4P1WA 4IKFA 3CDHA 1APLC 1ZLJA 3I55I 5BPIA 3ZN1A 4QLCU 3H0GJ 3JRAA 2VXZA 1EKEA 3U21A 3JREA 4HA8A 4IQJA 1QVUA 2BW3B 3GLXA 3HGGA 5D8LB 4GDFA 4S05A 5D6FA 1OKRA 3A1YA 4QWQA 2YR2A 4IRGA 2HYGD 3B6AA 4GCVA 4CYCA 4Q47A 3RCOA 4I2OA 4P9FA 2ZXHA 3FHZA 4LIUA 2OA4A 2WB1N 2OQRA 5J4YA 2ID3A 3P5JA 2PJPA 4MTDA 2CUFA 2RGVA 2WAEA 1Z7LA 2EINH 1J0RA 2WWYA 2DTZA 2VQLA 1RKTA 3BTCA 4G7OF 3KP2A 4BUPA 1QO0D 5CPRB 3RJPA 1Q1HA 1IRFA 1Z77A 2E35A 2LLKA 5M5XJ 1TNTA 3CLQA 1B4AA 3WTWC 2D1VA 5ERIA 2DDAA 2MSYA 5E79C 3KYCB 5LGUA 1XMKA 2WA0A 2BEOA 3GTMJ 2ZXWH 1X2NA 2LRDA 3G6EI 3PSFA 2VT3A 2CJJA 1D5VA 3RQ4A 4HQMA 1XX5A 1BN5A 4PK4A 4RGXA 4XLNF 3SZTA 4BQOA 5TJJA 2KIUA 4IRHA 5LRSA 3ONQA 2R0QC 2E1CA 4B3AA 2JN6A 3CO7C 1HLVA 3BR0A 2CFOA 2L7MP 4A0ZA 1R9TJ 2EJRA 3L2VA 4MEYF 4XONA 2Z99A 2QKMB 3CUQB 3JRIA 5E3LA 3ABLH 1LE8B 1XSDA 4BKXA 4H4KC 4OIPF 1OQYA 2Z16A 2ZBKA 3GTPJ 2BE5F 1X3ZB 5H20A 1O4XA 3DKXA 4OAYA 1FOYA 2OQGA 5KHDA 3A03A 3EUAA 1Z0XA 3SEZA 4HX8A 5J47A 1RRJA 2JPBA 3E6MA 3WHBA 5GPCA 1H0MA 2K02A 5K7FA 1H9TA 2RC4A 3IAM2 3CP8A 4NC7A 4FX4A 2DYRH 5FKOA 2CQNA 1O3TA 4M6VA 4NBQA 1F4KA 2JA7J 3ZQLA 3M3YJ 3I53A 1ZRDA 4JK1X 1SAXA 5FFXA 1JKOC 2R93J 1IO2A 3L09A 2F5DA 4AYBA 3C2HA 4IEJA 3K4MA 1ZH5A 2HI3A 1TC3C 1ZRFA 2WY7Q 4UUVA 1TWFJ 1W5SA 4EJWA 4IHXA 1Y1VJ 4BDYA 3S32A 4XK4A 4XBFA 3PFIA 3ROUA 1N75A 1J75A 4IZZA 2O7OA 4XR6A 2M45A 2V1DA 2D45A 2F6CA 1G6NA 2NVTJ 1I5ZA 4CA0A 2AQEA 2EA2A 2O8XA 4E4HA 5E18F 2O61A 4L9NA 1WKMA 3KZYA 2OZUA 4XOTA 4A2UA 5DCMA 3H9QA 1W0TA 2CW8A 4CYDA 4W1UA 3CP2A 4IF4A 3ABKH 1Y8RB 2Y2ZA 4IQ4A 1U5TA 2QSHX 4ZYHA 1PP7U 1F5TA 3IH4A 1KU2A 4HRIA 2XF6A 1I3QJ 3AG1H 1UMQA 2ZCWA 5KK1A 2LY2A 4EJOA 3IL2A 1Y1WJ 1GXQA 2E7XA 4OOIA 3RQIA 3CCSI 1ZQ3P 1T56A 2R7WA 1Z3XA 3HKZA 2HDWA 4M71A 1QNTA 1UG0A 2BHYA 1IUYA 3PNVA 2O8KA 2HKOA 2ACJA 2JPCA 1ETXA 4D5FA 3QPTA 3DQVC 1ZAOA 3WTYC 1YW9A 1V55H 4DIQA 2PJRA 1YX3A 2IW5A 2GWRA 3EUHA 1B72A 5L3DA 3OYKA 3TEDA 3ISPA 1SANA 2ZC2A 4KIBA 4C3HJ 4HLYA 2VOOA 3FDYA 3K4LA 2R4GA 4RGRA 1CF7B 4MQVA 4P96A 3HOXJ 2COMA 2LREA 1W0UA 1N25A 1W1WE 3E97A 2KPMA 2DA5A 2ZFWA 5CVVA 2V9KA 1FX7A 5L3GA 4ZYDA 1ORKA 1BR1A 4B43A 1XC5A 3P9KA 1Z1DA 4KYWA 2EIJH 4AYBN 2W25A 3AG3H 1SFUA 4NHJA 1B8IB 1TW3A 1XMXA 3QOPA 1FP1D 2QVOA 1K78A 1ZG3A 1RKWA 3BTLA 5E8GA 1E3PA 2HGCA 4JBAA 4U7BA 2EFOA 1D3YA 4AIJA 5FRMA 2FBIA 2JUCA 1ZGWA 3BT9A 2DDBA 2W00A 3ERMA 1X3UA 2VPRA 4IVNA 1O7FA 1GVDA 1A36A 4RGSA 2HOAA 2J5OA 3IRQA 2MD5A 3KP6A 1JGGA 2JRMA 1IC8A 3GZ5A 5C3EJ 2F4IA 1IV8A 1O3RA 4EMSA 3RPQA 3HRMA 2G0EA 3FMQA 3TGNA 5FLVA 1ETVA 5A2QZ 5K1YA 1K6YA 2IA2A 4FQGA 5CQGA 4BE0A 3WHCA 2VJJA 1JHHA 2GOMA 4C3JJ 3GTGJ 1B59A 3HHGA 5DV5A 2GA2A 4M3FA 1R71A 3K1PA 4RM3A 1S3JA 5FKNA 2XRLA 1IRGA 2DLLA 3KP3A 4HOBA 3DPUA 1QBJA 2LBFA 2EZIA 2RV8A 2OUMA 4DOZA 3HKZN 5DYMA 1XSXA 3ASOH 4E7IA 1YJ9I 1AKHA 3RZOJ 2DA6A 5F0CA 5KAIC 3HUGB 3O6BB 4BU2A 5J40A 2L0KA 3IV5A 1V4RA 2R3SA 4HF1A 2R7DA 4B8XA 3CC2I 1FY7A 4LK1F 1N77A 3J7YJ 3TO6A 3LSRA 1W7PB 2R5ZA 4U88A 4IHSA 2P5VA 4LG3A 3EYYA 2JJ7A 1P7IA 2PN6A 3ZPLA 2VJ5A 5CVJA 3IHUA 1W36C 2JVGA 2XPVA 1FYMA 2QCOA 2OTJI 4EEFG 3L9FA 3LFKA 2Y9ZA 2HQRA 3HSFA 4WXHA 1W5CC 1ONVA 3HC7A 2MH2A 4UB6C 3SFIA 3CCYA 2J5PA 3BG7A 2ESHA 4PDKA 5B1BH 2NNNA 2XAJA 3ZMVA 3DU5A 3IH3A 1YW8A 3OYEA 4XLHA 1UHMA 3OS1A 4P5OA 2YS9A 1JJ6C 1JI8A 4WWCA 5D5VB 2XAGA 3FK7A 1HDPA 4BY7J 2VT2A 3T5XA 2VI6A 1T08B 4HNUA 5KAFC 1UFMA 2CMPA 2KFDA 3OS0A 3JSPA 3R6SA 3ZMZA 3S2WA 1LKXA 1OYYA 2R7ZJ 3IKVA 5FO5A 2A5WA 5IT9Z 3VEPA 2MYSA 2FSWA 2UUZA 1KQ9A 2NOGA 5FLXZ 3K10A 1J09A 2XC7A 4FE4A 1D8KA 4CSWA 5LBQA 1T0FC 4N9HA 4PGGA 5ICFA 2ISZA 3A01B 1RETA 3VB2A 4UUSA 3WU1B 1ODDA 1WGXA 1T33A 1XCVA 1LDJA 3SDGA 4YG2F 3NEUA 2VKEA 2VUMJ 1TBXA 1S7AA 1TWGJ 1X3WB 2RQQA 2GM4A 2VOPA 1SEUA 3Q0WA 1YTYA 5J4VA 3LAPA 5JLWA 4YIRX 1ZLKA 1X1DA 2K9NA 1AWCA 2V4JC 3FMSA 2L7FP 3Q0UA 5C44J 3UKGA 4AM3A 1X1BA 4H0EA 1Z6TA 1X1PA 5EEGA 4L5IA 3QRFF 2V79A 2HFHA 3KYLA 2YPRA 2NS7A 3R60A 4LG0A 3TQNA 2HKXA 3OR1C 5CLSA 4LK0F 2GAUA 3HHHA 4MGRA 2HVSA 2KP6A 3A0BC 4WXDA 3VYRB 5J1YA 4IOAF 3DPLC 1Z6RA 1O7LA 2A5YB 1TP4A 1U8RA 4EJVA 3BR6A 4HDVA 3CF5F 2IS4A 2DT5A 4XICA 3HEFA 3OV8A 1YFHA 2EV5A 1MDMB 4ESBA 2A6TA 4PJMA 3H5NA 2JWTA 2P4WA 3D0SA 4GGGA 4WF2A 2XKPA 3W3CA 1U6GA 2L3DA 2EIMH 2DK5A 4UVBA 1BM9A 3K4CA 1LEAA 4GFBA 1MBGA 3CJNA 3LSTA 3MQ0A 1GT0C 1XTAA 2E1NA 5LEJA 2CH0A 1U0JA 4G6TB 3DFGA 2XKOA 4BXFA 1CGPA 1S6LA 1BOAA 3WGGA 1TWAJ 5DM7F 3GFLA 4HBLA 1IJWC 3CCJI 4EVIA 3TOBA 1HKSA 1ZTRA 2VIXA 1WFXA 1IN7A 2M30A 3HOUJ 3E3VA 3I64A 1JKPC 4Q48A 3VODA 1F9NA 3GFIA 3CO6C 3M9AA 1I6HJ 4MLOA 3H5AA 2CW7A 2K3PA 2KRFA 1X58A 3K4BA 2WAQA 1BBYA 2DJIA 5FROA 3JRHA 1MNEA 1RNLA 2PQ8A 2XF5A 1IXSB 1U2WA 1LFPA 1XSVA 2QQ9A 2BVLA 2H27A 3DBHB 2MFZA 3CF2A 4N4OB 4NB5A 5DD4A 1D0ZA 2DFEA 4UXNA 3GW2A 4B1RA 1U8BA 4MIMA 2V6CA 3CJQB 2O3FA 2WC2A 4G7ZF 3RIRA 4DW6A 3C18A 4RB2C 4QTRA 4CICA 3BG6A 2O5RA 1FWZA 4ZZLA 5GTIC 4LB5A 1PUEE 3GWZA 2MLKA 3DTKA 5K7ZA 3HOVJ 3T0YA 2MC4A 5FKKA 3J81K 2L4MA 3F8FA 4CGZA 3W6JB 4CZCA 4XKVA 1RIOH 5CJ9A 2LSOA 2MGQA 3ECHA 3NARA 1U9OA 3K70C 1IF1A 1Y0UA 5J8CA 3L2CA 3FX3A 5HODA 2R5YA 1AA7A 3ULQB 5GADJ 1WPKA 4AIKA 4RAFA 2EPFA 2CV1A 1RI7A 3SEQA 1LFBA 2Y69H 3V8KA 2NVQJ 5D4RA 2EV6A 2PX9A 4HEA2 5EG0B 1P9QC 1OCTC 2VXDA 2KKOA 5FKLA 2KQRA 3NWSA 4KA4A 3PSIA 3RPUA 2V7FA 1WRJA 2R7RA 4E7KA 4D1QA 3G71I 5H2FC 1HCRA 1TQPA 2M3AA 3MEXA 4HNVA 4XL9A 3K4NA 1RESA 4KNYA 3LSKA 1MBEA 1IG7A 1R58A 3M8FA 2EK5A 3IP4B 3PNTA 3VSLA 5ILSA 3BQYA 1BW5A 5DCFA 1V54H 1LNWA 2WADA 5EEAA 3H0DA 3CMYA 1J59A 1JT6A 2W48A 4QSHA 4XKWA 2HYJA 2V6EA 1ETKA 1XN7A 3GTJJ 3AL0C 3HRTA 3O8GA 3A0HC 4B47A 1JT0A 2KIFA 2LF7A 5CQEA 1ZR4A 2IP2A 2LP0A 3CCQI 3Q9VA 1IAWA 3CC4I 1R36A 4GXOA 2WAQN 2K7LA 4IHYA 3RSNA 3BJ6A 4HX7A 1STZA 3H3VK 4IPAA 2COBA 4NQWB 1D8JA 1YS6A 4R79A 3B02A 2P8TA 2ELHA 1PUFB 2LVSA 3OL3A 2BW3A 3BC8A 1ACIA 3ZQHA 5BS6A 2RQPA 3CC7I 5JHFA 4XRSG 1SD4A 5FD6A 4R1HA 3BOQA 1BJZA 2PEXA 3AKZA 1U3EM 4PJLA 3RPUD 2M4KA 2C6YA 1J7KA 4M3EA 2DYSH 2FBHA 2ZMEC 2HS5A 1UG2A 2K4BA 1FOKA 1X1AA 4KFCA 3HPHA 4N0BA 2A3SA 2NNYA 3I59A 3NRVA 3KFWX 2Y9YA 4GRIA 3DKWA 1FBSA 1FOXA 3S17J 3KLNA 4WCGA 2QYOA 3LQRA 2FEZA 3QPHA 1A6IA 1ULYA 2CUEA 2XGEA 2VN2A 5M5WJ 1KU3A 3QP5A 1BC8C 5KVRA 2XHKA 2ADUA 4DYRA 5H6RA 4D7MA 3FHNA 1F1ZA 4M6YA 5HLIA 4L0ZB 2M5WA 3BZKA 3FXKA 2FOKA 4LIVA 3JRBA 1SFXA 2OD5A 3U1DA 2BV6A 3Q3SA 1WCMJ 1T39A 5FFZA 1EH7A 3J80K 4HDUA 3QOEA 5F1JA 3BDDA 4BDZA 1JUMA 3H3ZA 3ELKA 1IUFA 3E5XA 2H8WA 1ZN2A 4M3DA 3MKLA 4IJAA 4CZZA 4BXXJ 1LPQA 5D4SA 1E2XA 2K85A 3LNQA 1DGRM 4K2EA 2CQ7A 4L5JA 1YJWI 1IDZA 1SD5A 2L9VA 2QQBA 4BH9A 2ZSIB 2AXLA 1TT0A 1JHFA 1KQ0A 4UVAA 3PO2J 2Y75A 4O6JA 3S15J 4ENKA 4HZFA 3CUOA 3TW7A 5IPAA 3CDIA 1NHAA 3FXUA 2JA6J 1IXRC 1VNDA 3J80Z 2H94A 2R7XA 5E1XA 3HOZJ 4BEHA 4F7ZA 4OIQF 3BJAA 1V5GA 1T8IA 5HNFA 4M72A 3BY6A 1JKRC 3IUOA 2FU4A 1WJFA 4B09A 1XGNA 1JUPA 1DUXC 2KDZA 4EJTA 2JMWA 4RLFA 1BW6A 2JVHA 3LSMA 2M7AA 2HXIA 4UUTA 1MBJA 5CVIA 2LNBA 3FKIJ 3BWGA 1A6QA 4CUGA 2X0LA 1E0EA 3PIOF 2D1HA 3FXLA 4B44A 4CCLA 1T0FA 1P4XA 3GFMA 2FJ1A 2QWWA 3ERED 3PO3J 4LOCA 3ABTA 2IS6A 2ZO4A 1NK2P 1EJ9A 2FQ3A 5EDNA 2KIQA 1G3YA 1WJCA 4CCOA 5F08A 2STTA 3S1MJ 3TMOA 3BTIA 2VODA 2IGMA 3OMYA 3TDZC 1W36D 2K4JA 1YRNA 4XLCA 3P9IA 2ID6A 4Y33A 1MH3A 3ASNH 4BJ6C 5IOYA 1T6SA 3SQNA 2XAFA 4I98B 1MBFA 2KJBA 4LFUA 3VPRA 1LQ1A 1KYWA 3W2AA 1I1GA 4JP0A 4HNTA 4A3EJ 2B63J 3S14J 1XDUA 3VFZA 3VYUB 3E6BA 5LHGA 5LEKA 2DAOA 2LY9A 1HKTA 5CKTA 3BPVA 3KEYA 3TP3A 1Z91A 1GXPA 2PG4A 2V1NA 1FLIA 4RMNA 3I4PA 3WG7H 1XGSA 3ECOA 3CTAA 1S72I 4L9VA 5EGOA 1IRZA 2DT6A 1BIAA 3EYIA 1LDKB 2XAUA 1HSJA 3LAJA 4EJUA 1SD6A 2F4OB 4DGWB 5CVRA 2UXNA 5F0HA 4EM1A 2HZTA 3L2WA 4A5MA 1RC9A 1KU7A 3VYSB 5D5XB 2E60A 3A02A 5B5EC 2HDDA 2EBIA 3Q0VA 1P2FA 3GBGA 1H88C 1RZ4A 2QSFX 3FIWA 4G94A 2VQGA 3LSHA 1UHSA 3RDIA 3MCZA 1A35A 5DTDA 1MMAA 1FTTA 5HLGA 2LDUA 2BGCA 5IT3A 5LD2C 1P4AA 3KIOA 3GLLA 5FJ8J 2BOLA 4C3IJ 1MSFC 1TTYA 2CU7A 2IJLA 2JK3A 1MJAA 2OU2A 3E0JB 2DW4A 3F21A 1IDYA 5F64A 1OCPA 3TKYA 1HOMA 1TQIA 5D8KB 3FK6A 4WX9A 1F36A 2E1MB 3VWBA 3NAUA 3HOYJ 2K9MA 3KLOA 4CCMA 3L00A 4RB3C 1U9NA 1XB4A 3NQOA 4XOPA 2DQLA 5C4XJ 4HSRA 1MJBA 1OR7C 4OMYA 4RAGA 2P7CB 1MD0A 2QKLB 3LSPA 1YW7A 3BQZA 4A3JJ 1DP7P 3DEWA 1ZGJA 3ZR8X 2F5EA 4G8XA 2DCEA 2NVUB 2MG4A 3PL8A 2ZKZA 1P7JA 3H1CA 1QRYA 4DBQA 3O3KA 3V8JA 1QU3A 3BJOA 1IGNA 3KCCA 1TL8A 1Z67A 3WU0A 3QP6A 3S3MA 3DXJF 2F5FA 1H9GA 2CUZA 3K4JA 2HWVA 3J7ZI 1MH4A 4YIIA 2A6EF 1KU9A 5E8IA 1R7JA 4HPQA 3SZPA 5A2QK 1CQTA 3I56I 4B4CA 4Q5SF 5DCMB 1NG7A 5E1ZB 3OYNA 3C2BA 3FXMA 4RAYA 4RGUA 4DYCA 1S9HA 4I76A 2EB7A 2TDXA 4EGYA 2R7OA 4G7HF 3KP4A 1AOYA 2NAZA 3SHFA 2EH3A 2BY0A 2G7HA 1LUJB 2X6WA 3OYIA 2XGCA 1U5TB 5JI6A 2XUBA 1KONA 2ME0A 3IC7A 3L2RA 5K7HA 2AS5F 1V5EA 5LLQA 5K5QA 3V8LA 1YIOA 1MIJA 2R92J 4OAZA 1VQNI 1WJ5A 2GIVA 3U1KA 3JW4A 5BPDA 1NG6A 3QYEA 2XB0X 2JA5J 4GYIA 2RNJA 2DFFA 5J1UA 4A3KJ 5FRNA 1F43A 4XSZF 2PBIA 4BHPA 3DLAA 2EFPA 3IAS2 1OYWA 3ML6A 3IWFA 3ZMSA 1NH3A 3S16J 1TT5B 3M7GA 3KX2A 4E7LA 2PJRB 3CMEI 1B72B 2HXOA 2E5NA 3F72A 4HV5A 5ICCA 4Y52J 2EWNA 4W97A 2PI0A 4QPQA 4C2UA 1SFOJ 2V1XA 2KDOA 3FKJA 3K7AJ 2K27A 3H5RA 4ANJA 3ZN0A 4XRMA 5TRDA 3CD6I 2AHQA 1QHGA 2GXGA 3MKWB 2XSJC 5FD5A 4IHWA 2UWMA 4U87A 2CUJA 2IS2A 3WODF 4FASD 4D9JA 1EA3A 2K9LA 2QZ8A 3Q5FA 1FEXA 4XLFA 4BBRJ 1Q1VA 4JX4A 5B66C 5ICGA 5DM6F 2L9NA 2WV0A 3BCAA 2W7NA 4M6XA 1BL0A 1K78B 3CUQC 4KISA 5AIPA 2P0WA 3K70D 1RR8C 3SDBA 2NXNB 4JX6A 3HDDA 2DOFA 4N9IA 4MEXF 3RKXA 3LA3A 2YU3A 4PUSA 3WG9A 1WSUA 2CRGA 2JT1A 2RVCA 1W7PD 2LTPA 5FLXK 4NUBA 3BZ6A 1YO5C 1ON1A 1ZARA 2Y0MA 5FB2A 3QU3A 3I54A 2W4SA 1ERDA 2LFBA 2Y31A 2P6TA 2CFXA 1R49A 2ZMEA 2HPMA 5F27A 4EM2A 2AO9A 2ICWG 4MQ9F 3HSEA 3G4SI 1V5FA 4ITVA 3HBLA 2IA0A 2DPDA 2HQ5A 2GZWA 2JZYA 2ELKA 3FBIB 3RYRA 3BLYA 3MAJA 3D5SC 3F6VA 3GUDA 2QENA 4G6QA 1QVTA 4A3IJ 1WJEA 1J5YA 4XRSA 5DUKA 4E6KG 1FTZA 2KHMA 1BIBA 3FXOA 2LBFB 2FOWA 2IT0A 2WTEA 3WTSC 2ECBA 3W6VA 2AQFA 5EZGA 4C2MJ 5FKMA 5IYBJ 1WH7A 3V4GA 4MO7A 1G4DA 4RB1A 1UELB 3OOUA 5JLXA 3ZMTA 3GF2A 2ZJQF 1AKHB 1RUNA 2BXYA 1OYIA 3K2ZA 3MVPA 4I0AA 3OY9A 3ZQFA 3OL4A 1VQLI 2PMUA 2W82A 2BY3A 4UV8A 2XSDC 2DI3A 4NNJA 3GZ6A 1MMGA 3H9JA 2DA4A 2MH9A 2DA7A 2VQCA 2F5VA 4BJ5C 5LFAA 1O3SA 2QA4I 4XN3A 1MW7A 3OIQA 4DZPA 1A5JA 2ZNYA 3ABUA 4MFDA 2DO7A 3U2RA 3L7WA 4BQQA 3G73A 3T1BA 5HLHA 3S1RJ 1VZ0A 3FBNB 1B1BA 3I4MJ 3U9GA 3ZMUA 4F92B 1EH6A 4BHBA 3VYTB 3GYHX 3ZQQA 3BG3A 5E1WA 5J3LA 1Y0NA 2OTLI 5GTHC 3HJEA 4YRVA 4RDUA 2R7SA 3HYIA 3OYAA 2BY2A 4OIRF 3QODA 4A3FJ 4YIFA 3R4KA 4E70A 3ZP5A 4X0GA 4AD9A 1R5ID 3ABMH 1YOVB 3GFJA 1G8XA 1ENHA 4JQFA 1XGOA 2K5CA 2DOAA 3TBIA 4BHCA 3OYGA 1U78A 3ZXSA 4LLGF 2QSGX 2JSPA 4AVPA 4EV0A 2Q0OA 2Q2EA 3CMMA 3R0AA 4XMYA 4A5NA 2DMTA 3H3UA 2L7ZA 3KP5A 2CQXA 2KISA 2R7UA 2CO5A 2X1EA 3F8CA 4DZJA 1K6OA 1YI2I 3F9KA 2RN7A 3HPGA 1YG2A 2W85A 2OV7A 5FGMA 4YFKF 2R7VA 2FX0A 5HS8A 4OMZA 1S8NA 1LJ9A 5J6XA 3JR9A 1BI2A 4ABZA 4O3MA 3SZGA 2M8EA 3WE3A 1BJAA 2IAIA 2ISYA 2X1DA 2CS3A 4IOCF 3HRSA 1KYZA 3W6KB 4UY8I 4Z2YA 5ILVA 4ZH4F 1FMWA 3VSKA 1WJDA 2BYVE 2IBDA 1PVEA 3LQQA 4LG0B 3IWZA 1YIJI 3M1EA 1G59A 5GPAA 3H92A 1MKMA 3MMYB 4PJNA 4ZC3A 4D5CA 2KIMA 3SXYA 2ZFUA 3HB9A 1T38A 1E3OC 3KEQA 4I02A 1VQ4I 3EUHC 1R4MB 3V42A 2TRTA 2W57A 3I9V2 3HZJA 4ENJA 1NK3P 2V1UA 2A05A 2OCCH 4LLNA 1X4OA 1MMNA 2E1OA 2WAFA 3ZQGA 1KZHA 5HVQC 1I3AA 2EIKH 3HGYA 1LFUP 4G6DA 2PMHA 2N8GA 4BE2A 1JUSA 2EZKA 1Z05A 1MMDA 2DQRA 1K79A 2X51A 4DQ2A 2X9DA 1FBUA 2JQ7A 4E7HA 5IP6A 2VBZA 3GZNB 1SVLA 4OU0A 2QUFA 1YLFA 4OINF 4BACA 2D5VA 2JA8J 3PUFA 3M8EA 5GAGJ 4A0YA 4U7DA 2HPIA 3PFYA 2HVQA 2I5UA 1WJBA 2UV1A 4AIHA 1J9IA 5IYCJ 2GA1A 4CO8A 4BJTA 3BR1A 3K9TA 2VC1A 2MABA 2EV0A 1PJRA 3TP0A 4RA2A 1OR7A 3NWTA 2HTJA 2FXAA 2X85A 4M9SA 1IRXA 1YITI 4ZZDA 2GOXB 5BOXA 1PDNC 1AHDP 2ZNZA 1ZYRF 4FX0A 1GDTA 2BBYA 2NVYJ 2I10A 1MBHA 3HSRA 3I71A 2DMNA 2VKDA 5J8FA 1BI0A 3HOWJ 1YX5A 3RI4A 2HEOA 3OIOA 4CHUA 2MLGA 4O5VA 3OYFA 1MMSA 2HU9A 3K1NA 1XG1A 3BPXA 5HDKA 2XPUA 1HDDC 1VQMI 5D6EA 4AUXA 1GLNA 3JAMK 4OWRB 3GXOA 3WTZA 2P5LC 5FLMJ 4XLEA 4EATA 5K5OA 3CCVI 2NVXJ 1OJLA 1R1VA 2LG4A 4ASNA 4CXFA 5HLTA 2HVRA 1P4WA 3ZRGA 3T8TA 4XSXF 1ETYA 1GV2A 2O0YA 2M8GX 1Z21A 3AFHA 2R5YB 3GTKJ 2OC6A 2OAZA 4BQAA 4NDLA 4PFPA 1G3SA 2BHZA 4YFXF 2E34A 2RKHA 5KNLA 2M4GA 3LOCA 4HSTA 2LKXA 1IXCA 4A3MJ 1UB9A 1FOWA 4IXAA 3QAHA 1SC7A 2HNHA 3DWLE 4A6EA 5HDGA 3JAMZ 4B3XA 3FMRA 1R5GA 4ESFA 4A3DJ 2QQ8A 3P9CA 3EPZA 1QA6A 5CVUA 3DTIA 1K4SA 1USSA 2XAQA 2IA1A 3I4NJ 3BROA 1DGWY 3K1MA 1I27A 4F52A 4AWXB 3FXRA 4U0YA 3LA7A 5LRRA 3PIPF 4FCYA 1T95A 3JRGA 3JRCA 3QYBA 3CJTB 2L02A 3OR2C 1YYVA 2M0MA 1OCRH 1WJAA 1KGSA 4L0YB 3LL7A 2MC3A 2X6YA 3JCUC 1OMIA 1ETWA 2DT7B 1SMYF 2VBYA 4XORA 3QYFA 2ME6A 5JHUA 3K2AA 5JR3A 3CUQA 2ZJPF 4L18B 1LE8A 4C9YA 2IEKA 4KITB 3G1LA 3UNGC 4IX7A 1D1CA 2A61A 4I6ZA 1BA5A 2F5CA 2JTVA 2HQNA 4ZTFA 1R5HA 4KT5C 3F8MA 4J01A 2DODA 2ZXJA 3PM1A 4ZYAA 3EDPA 2NRAC 2FNPA 5BNGA 2MA3A 2LC2A 1OPCA 2QBYB 2FMYA 1Y8QB 4LGWA 4I7HA 4XRFA 1VQOI 3BR5A 2FMLA 3E1SA 5GAEJ 1DU6A 4YFNF 4A93J 4HLXA 1UCRA 2JSCA 1MNDA 4CCNA 1R00A 2R7TA 2NOJB 3R61A 1DP3A 3LSJA 3WE2A 2KRCA 3WTXC 3GCMA 3CLOA 2E36A 2M1BA 4Y17A 3DLLF 3I59B 3G1MA 5GP9A 1YJNI 2QQAA 4IHVA 5E3NA 3E5UA 3VOEA 3LA2A 2F48A 2RNGA 3BG5A 1LEBA 4N4NB 2LR8A 3LSIA 2WV1A 1QZZA 3LFUA 4KDPA 2L5QA 4PCQA 1W5TA 4PJJA 3ZOBA 3K69A 5E3MA 6PAXA 4LJZF 4QPOA 2ELJA 1HQCA 4M3BA 1QHHD 5L3CA 4A12A 2Y30A 2RAEA 2X4HA 4Q4ZF 2VBWA 4S0HB 4XM3A 2OCEA 4HW0A 1R23A 1ZG1A 4D7NA 5EEHA 5LGNA 4Z6YA 2Z9OA 3KPHA 3CDLA 1ZG5A 2M9HA 1ETQA 2F4MB 3OWTA 4FTHA 2AXTC 1IW7F 2UXXA 4CYCB 3I58A 3K0LA 1QPIA 4YEJA 4BQNA 4KICA 1SAUA 3GTLJ 5H6QA 2Z3YA 4M73A 2W24A 5KCMA 3JRFA 3UR3C 1N78A 3GTOJ 3CMAI 2KLOA 2VJ4A 1XCBA 4ZYEA 2YX4A 2H09A 3M8JA 3I5UA 1VQKI 2E5ZA 1VTNC 2XB5A 3DP7A 3F23A 4XN0A 3JSOA 1XGMA 3SYTA 3G3ZA 4Y7NJ 3I3LA 5JFRA 3ZGKA 3GX4X 3P7NA 2XF7A 1OISA 3G2BA 4BEHB 1POGA 1R6RA 3EUKL 2VPLA 1X19A 1VQ7I 4I09A 2HR3A 1X4PA 4ZJZA 1SVMA 4DYQA 4ZTJA 1CF7A 2VKHA 5ICEA 5IY5H 2RDPA 3DF8A 1UZCA 3MKYB 2L9SA 3HM5A 2I8DA 1K7AA 3MKZA 1BOBA
chains in the Genus database with same CATH topology
1YITI 1Y39A 5JVGF 1VQOI 5GAEJ 3CCUI 1HC8A 3PIOF 1ACIA 4V19K 3CC7I 3CCEI 2K3FA 1MMSA 3I55I 1VQMI 1YI2I 2E36A 3J7ZI 3G4SI 3DLLF 1VQPI 1YJNI 3I56I 3CCRI 3CCVI 4IOCF 5GAHJ 1FOXA 2QEXI 1VQ9I 4UY8I 3CCLI 2FOWA 1YIJI 2ZJQF 4IO9F 1VQNI 2E34A 1VQLI 5GADJ 2E35A 1FOWA 1VQ4I 1YJ9I 1S72I 4IOAF 3CCSI 2H8WA 1QA6A 2QA4I 3CF5F 3CC2I 3G6EI 3CMEI 3CMAI 3CCMI 3J7YJ 3G71I 1YJWI 3PIPF 1VQKI 3CJTB 2JQ7A 2OTJI 1VQ8I 1YHQI 3CD6I 2OTLI 5GAGJ 1VQ7I 5DM7F 3CCJI 1FOYA 5DM6F 2ZJPF 1VQ6I 3CCQI 3CC4I 2NXNB 2ZJRF 1VQ5I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT I;  1Y39 A;  5JVG F;  1VQO I;  5GAE J;  3CCU I;  1HC8 A;  3PIO F;  1ACI A;  4V19 K;  3CC7 I;  3CCE I;  2K3F A;  1MMS A;  3I55 I;  1VQM I;  1YI2 I;  2E36 A;  3J7Z I;  3G4S I;  3DLL F;  1VQP I;  1YJN I;  3I56 I;  3CCR I;  3CCV I;  4IOC F;  5GAH J;  1FOX A;  2QEX I;  1VQ9 I;  4UY8 I;  3CCL I;  2FOW A;  1YIJ I;  2ZJQ F;  4IO9 F;  1VQN I;  2E34 A;  1VQL I;  5GAD J;  2E35 A;  1FOW A;  1VQ4 I;  1YJ9 I;  1S72 I;  4IOA F;  3CCS I;  2H8W A;  1QA6 A;  2QA4 I;  3CF5 F;  3CC2 I;  3G6E I;  3CME I;  3CMA I;  3CCM I;  3J7Y J;  3G71 I;  1YJW I;  3PIP F;  1VQK I;  3CJT B;  2JQ7 A;  2OTJ I;  1VQ8 I;  1YHQ I;  3CD6 I;  2OTL I;  5GAG J;  1VQ7 I;  5DM7 F;  3CCJ I;  1FOY A;  5DM6 F;  2ZJP F;  1VQ6 I;  3CCQ I;  3CC4 I;  2NXN B;  2ZJR F;  1VQ5 I; 
#chains in the Genus database with same CATH topology
 3F22 A;  5TIS C;  4UVC A;  1E17 A;  5ILU A;  4BXU A;  3KET A;  2HQA A;  5E20 A;  2Z33 A;  3J7A Y;  2G7U A;  5E3O A;  3L1P A;  5LHH A;  1R1T A;  3KZI C;  3H35 A;  1B8I A;  5ED4 A;  4P9U A;  3S93 A;  3DTE A;  2LY1 A;  4XID A;  1D0X A;  3EQL F;  2LD5 A;  4X6A J;  3AG4 H;  3DBR B;  2VC0 A;  2EQR A;  4B48 A;  2CGP A;  3S1N J;  1ZR2 A;  2H1L A;  2W1O A;  3F8N A;  1YRN B;  3BG9 A;  4PGH A;  4UV9 A;  3VDX A;  2DA1 A;  2OPT A;  4LB6 B;  4BS9 A;  3K4K A;  3OYL A;  1GV5 A;  4CDG A;  3BR3 A;  3T8R A;  4A69 C;  4BL0 B;  1VQP I;  3EET A;  3OYD A;  4FIS A;  4TV7 A;  1B9N A;  2H6B A;  1FYK A;  5EF6 A;  1ZRE A;  2XV4 S;  1HF0 A;  1QZY A;  2MBF A;  3ZQI A;  3DCF A;  5LGT A;  2WY8 Q;  5HS9 A;  2KT0 A;  2V26 A;  5F1R A;  2R7Q A;  3FM3 A;  1L3L A;  2OF7 A;  2L54 A;  3DEU A;  4KN7 X;  1TW2 A;  1EV7 A;  2D2W A;  3DV8 A;  3ESW B;  4LMY A;  4D0P A;  2UZK A;  3OSF A;  2VKV A;  5CYV A;  1R4N B;  1ZK8 A;  1V3F A;  1GUU A;  4KN4 X;  2QF7 A;  4UHT A;  4ZDL A;  2KZG A;  4U0W A;  5L3B A;  2A6H F;  4IO9 F;  5EGO B;  4IL6 C;  3OYB A;  2YX7 A;  3KEO A;  1O3Q A;  4R8H A;  2VJI A;  3JRD A;  4EQQ A;  2IPQ X;  4V2F A;  2PLY A;  1HW5 A;  2BZT A;  1YQA A;  3OIP A;  4E7Z A;  1ZGA A;  2KZV A;  1WH5 A;  3HG9 A;  4ESJ A;  1DU0 A;  3HUG A;  1HW2 A;  5E17 F;  1X1C A;  3CCM I;  2YSR A;  2XIG A;  5EYR A;  2CV2 A;  1JTX A;  1BC7 C;  2CQK A;  4DJA A;  1FSH A;  2KJC A;  5J1R A;  1ZRC A;  4G9Y A;  2HZD A;  3O2P E;  2A69 F;  2EA4 A;  2K9Q A;  2X1C A;  2PFB A;  4P55 A;  5HOO A;  1W7P A;  1L0O C;  2DK8 A;  2EFW A;  1YHQ I;  1SFK A;  3OYC A;  2EZH A;  2DMQ A;  4RBO A;  3WGI A;  4RB0 A;  3SFZ A;  4BAY A;  5C4J J;  4C2T A;  2R7F A;  2DFH A;  5IT9 K;  1MZB A;  3DEE A;  2XAS A;  2VBX A;  1HBX G;  4CH7 A;  4KMF A;  1TQM A;  1VQ6 I;  2L01 A;  4RS8 A;  1OCZ H;  4V2G A;  3CZ6 A;  3OYH A;  1QQI A;  3X2Q H;  1VQ5 I;  2F2E A;  3CQZ J;  3HTS B;  5IOZ A;  5L3E A;  1GHC A;  1SMT A;  3LMM A;  1VI0 A;  3B6C A;  1B6A A;  2BXZ A;  2G9W A;  1XPX A;  4HYE A;  1LVA A;  3AAF A;  1BI1 A;  1BR4 A;  1B9M A;  4I0B A;  1HC8 A;  3H9G A;  2YUS A;  1O57 A;  3CCE I;  3C1D A;  1MNM C;  1YE9 A;  3GME A;  4II3 A;  2M34 A;  1A04 A;  1M1E B;  3C7J A;  2KL4 A;  2PMZ A;  3D5L A;  5LHI A;  2DMP A;  4M74 A;  3HL2 A;  2STW A;  2L9R A;  2XDV A;  2P81 A;  4A3L J;  3V7S A;  1KA8 A;  5HDN A;  3S3N A;  5M3M J;  3MZ8 A;  1I6X A;  2HDC A;  1S7E A;  1JKQ C;  4ZDP A;  1T98 A;  3A01 A;  2DU9 A;  2IGN A;  1K4T A;  2A68 F;  2A07 F;  4PSX A;  4IHT A;  2VON A;  1QZE A;  2O03 A;  4J19 A;  1A31 A;  4XKB A;  3RZD J;  3GTQ J;  3F8B A;  1ZKG A;  1FIA A;  5AON A;  1I50 J;  3E6C C;  4M9X A;  5BQT A;  1JTY A;  2NYX A;  4DBR A;  4XNF A;  3LWF A;  3M07 A;  3QU6 A;  5DDG A;  3HTU A;  2LF8 A;  3MN2 A;  2WBM A;  3KP7 A;  3TW6 A;  2M7B A;  3KE2 A;  2DXI A;  4PJ0 C;  2H1K A;  2HOE A;  2K40 A;  3BR2 A;  3Q9S A;  2IS1 A;  1JE8 A;  1HKQ A;  4MNU A;  2Q1Z B;  1D1A A;  2M87 A;  1LVK A;  4C30 A;  4F91 B;  5D5U B;  1T2K A;  3C3W A;  4NC6 A;  4L5E A;  2GBY A;  2IGO A;  4HQE A;  3D5R C;  2FNA A;  1SD7 A;  1DPU A;  1VF9 A;  4HV6 A;  1TWH J;  2VAS A;  3F3X A;  3TO7 A;  5HS7 A;  3E5Q A;  2JRT A;  5F6F A;  4BYY A;  1JJ8 C;  1G3W A;  1NTC A;  1MDM A;  2NS8 A;  3GEZ A;  2CG4 A;  4FE7 A;  4F3Q A;  4JOM A;  3AL0 B;  3LSG A;  3MZY A;  4RM2 A;  3COA C;  4UB8 C;  1SFE A;  1C0W A;  3IRR A;  3HRU A;  2HOS A;  1D5Y A;  4CCJ A;  4I99 C;  4ETS A;  2H8R A;  3MD2 A;  3W2W A;  1WQ2 A;  3A4C A;  2QGU A;  4RAZ A;  3WU2 C;  5D5W B;  2R5Z B;  4HG2 A;  4IRI A;  1HST A;  1H8A C;  4G12 A;  2CV0 A;  3QPS A;  1G3T A;  1P92 A;  3ZCO A;  1XS9 A;  2MD0 A;  1IN5 A;  1FBQ A;  1XMA A;  5TGT A;  3JTH A;  3RTR A;  1OFC X;  2EIL H;  1ITY A;  1VFC A;  1EH8 A;  2GIZ A;  1MSE C;  2ZB9 A;  4MFE A;  1UST A;  1GVJ A;  2PMZ N;  3HIF A;  2DFI A;  4KMU X;  4LIT A;  3WTT C;  2E19 A;  1UHW A;  3K6G A;  3H36 A;  2ZME B;  2E1M C;  3OS2 A;  4Y4R A;  3FF5 A;  1KQ8 A;  1FZP B;  2CWE A;  1DPR A;  4I01 A;  3R0J A;  2X6O A;  2Z2S B;  2B7E A;  5DUI A;  1REP C;  1FYL A;  2LK2 A;  5M3F J;  2DTR A;  2IGK A;  9ANT A;  1MGT A;  5B3S H;  1RUO A;  4NC8 A;  4RLQ A;  4E7J A;  4ZYG A;  4M3G A;  3REO A;  4KT6 A;  3DPT A;  4BGD A;  3HOS A;  4GYG A;  4ON0 A;  2LYC A;  1FIP A;  1QPM A;  2BY1 A;  3CCR I;  3KYD B;  3QWL A;  2M2E A;  3W2V A;  2EFQ A;  2E2I J;  4A6D A;  4LLL A;  4L9T A;  2FRH A;  5GAH J;  3BZC A;  5M5Y J;  3KZZ A;  1E3H A;  2QEX I;  2DPU A;  1VQ9 I;  4KIG A;  1Y56 A;  5F0F A;  4DNC A;  3TL4 X;  4UUS B;  5EJC A;  2XRN A;  1QGP A;  2X48 A;  2L4A A;  1JGS A;  4AID A;  1K61 A;  4PZJ A;  3V7R A;  4ZDO A;  1YS7 A;  2FBK A;  2K86 A;  4HF2 A;  4FET A;  5IP9 J;  3FM5 A;  1W4M A;  2VE9 A;  4KJZ A;  3RYP A;  4JX5 A;  2XGX A;  1S5L C;  5DS9 A;  1ZHF A;  1J2X A;  2DOE A;  2FQ4 A;  2IVM A;  3PQJ A;  5K5R A;  2Q8K A;  3BTJ A;  1AU7 A;  1U5T C;  4KIF A;  2E71 A;  1WVR A;  3DBL B;  3FZV A;  4MHG A;  4LD5 A;  2MW8 A;  5B1A H;  1ZEL A;  4WK8 F;  1Y6I A;  3TDU C;  4Y13 A;  3G1O A;  3GO5 A;  4M9Z A;  4BBS J;  3V7C A;  5EG0 A;  1LB2 A;  3QQA A;  1IN8 A;  3BP8 A;  4XKC A;  3RKQ A;  2IRF G;  1OLT A;  4XLA A;  2DA2 A;  1S29 A;  4OIO F;  5BMZ A;  1JXS A;  1RPW A;  4Y3O A;  4GO1 A;  2ETH A;  1G2H A;  3S8P A;  1Z3Y A;  1XD7 A;  3PJR A;  2V9V A;  1D1B A;  5DD8 A;  4AU7 A;  3WTV C;  4J00 A;  4A3B J;  5L3F A;  1FNN A;  3AG2 H;  3L2Q A;  2LH9 A;  4F55 A;  4ENM A;  1PYV A;  2P5K A;  2XRO A;  2Y48 A;  2Y0S A;  2FUG 2;  3DU6 A;  3N97 A;  4PSW A;  5EZH A;  2L7K A;  3B73 A;  3BCB A;  3ZQC A;  2O9L A;  5F04 A;  3GVA A;  1WZ2 A;  2FA5 A;  2DBB A;  2Q2E B;  3DKY A;  1TNS A;  3F0C A;  1I1S A;  2P7V B;  2CSO A;  2X6X A;  3M1C A;  1H89 C;  1Y39 A;  3ZMD A;  4UNO A;  2XVC A;  5JVG F;  1FMV A;  3MFK A;  1IZ1 A;  4XLP F;  1FP2 A;  3O8H A;  2FE3 A;  1FT9 A;  3S2H J;  2LMD A;  2XPW A;  2YU9 J;  2DN0 A;  4NQW A;  1ETO A;  1BI3 A;  1OCC H;  1WI9 A;  2DJN A;  2IXS A;  3PNY A;  3OYJ A;  1IV6 A;  4MTE A;  3OOP A;  2QM3 A;  2H6C A;  4XQF A;  3HXL A;  1PUF A;  1FJL A;  4A3C J;  2NS0 A;  2HTS A;  2ZSH B;  2EZL A;  3WTU C;  5JVT A;  2XGD A;  3J7A O;  3FXQ A;  1TWC J;  2RRE A;  3I0T A;  3MWM A;  4U0V A;  5DEQ A;  4E7S A;  1EF4 A;  1WI3 A;  4A3G J;  4PFO A;  1OCO H;  3FIS A;  3FWE A;  4YEL A;  3OSG A;  1MBK A;  1X2M A;  3IH2 A;  1S7O A;  1ON2 A;  2DA3 A;  4FHT A;  3CJR B;  2ZJ2 A;  3E6D A;  3CCL I;  1R1U A;  3M4O J;  1IN6 A;  2VLA A;  2BVM A;  2GQQ A;  2ZXI A;  3L2U A;  2VQH A;  3CES A;  2CYY A;  4BNC A;  2W84 A;  2OJE D;  3J81 Z;  4KUM A;  3S3O A;  3N05 A;  5HNH A;  2P6S A;  5AIQ A;  2WB1 A;  3E7L A;  3PUB A;  2E2H J;  2E2J J;  1HA8 A;  1Z7U A;  4F93 B;  2GXA A;  2CW0 F;  4WXC A;  2XAH A;  2ESN A;  2VB6 A;  1DQU A;  1LDD A;  2O6G E;  3ZQ7 A;  1TLH B;  1FSE A;  1P6R A;  3IKT A;  4QIW N;  4FT8 A;  3RKW A;  3PQK A;  4HF0 A;  1PP8 F;  2E7W A;  2Z5U A;  2KMU A;  2L2O A;  1XDS A;  1UAA A;  1Z9C A;  3C2G A;  1HW1 A;  4BY1 J;  2VE8 A;  2JUG A;  2M0C A;  2LKS A;  1I39 A;  2K9S A;  4A0X A;  2LKP A;  1TZL A;  2JA2 A;  2Y0S N;  4CCK A;  2OZ6 A;  2Z1D A;  4II2 A;  1VQ8 I;  1BR2 A;  2QLZ A;  4X1E A;  3HOT A;  2QBY A;  3OYM A;  4ENN A;  3FXJ A;  3N4M A;  2OBP A;  3TOA A;  4BE1 A;  3S1Q J;  5IYD J;  3TO9 A;  3S2D J;  3MZH A;  3RKY A;  2GXB A;  1WHU A;  2LOO A;  1DDN A;  3A2K A;  4EM0 B;  2CQQ A;  4AVZ A;  3SJM A;  1UJ8 A;  1SVO A;  1MJ9 A;  2TCT A;  2V9P A;  1FC3 A;  2FD5 A;  4HAM A;  4JYK A;  3JTG A;  2ZJR F;  1IN4 A;  4EGZ A;  1RR7 A;  2KRH A;  2B9S A;  2HOT A;  2EFN A;  1WWX A;  4L9J A;  2FF4 A;  2HYF A;  1FPQ A;  3D1N I;  3WGH A;  2ECC A;  4S04 A;  4Y15 A;  1R22 A;  3CCU I;  3F6O A;  4V19 K;  1K83 J;  4AC0 A;  5IP7 J;  4HX4 A;  2B0L A;  3QPL A;  2GLO A;  2K3F A;  2DMU A;  1HXD A;  1D0Y A;  2VL8 A;  4P1W A;  4IKF A;  3CDH A;  1APL C;  1ZLJ A;  3I55 I;  5BPI A;  3ZN1 A;  4QLC U;  3H0G J;  3JRA A;  2VXZ A;  1EKE A;  3U21 A;  3JRE A;  4HA8 A;  4IQJ A;  1QVU A;  2BW3 B;  3GLX A;  3HGG A;  5D8L B;  4GDF A;  4S05 A;  5D6F A;  1OKR A;  3A1Y A;  4QWQ A;  2YR2 A;  4IRG A;  2HYG D;  3B6A A;  4GCV A;  4CYC A;  4Q47 A;  3RCO A;  4I2O A;  4P9F A;  2ZXH A;  3FHZ A;  4LIU A;  2OA4 A;  2WB1 N;  2OQR A;  5J4Y A;  2ID3 A;  3P5J A;  2PJP A;  4MTD A;  2CUF A;  2RGV A;  2WAE A;  1Z7L A;  2EIN H;  1J0R A;  2WWY A;  2DTZ A;  2VQL A;  1RKT A;  3BTC A;  4G7O F;  3KP2 A;  4BUP A;  1QO0 D;  5CPR B;  3RJP A;  1Q1H A;  1IRF A;  1Z77 A;  2E35 A;  2LLK A;  5M5X J;  1TNT A;  3CLQ A;  1B4A A;  3WTW C;  2D1V A;  5ERI A;  2DDA A;  2MSY A;  5E79 C;  3KYC B;  5LGU A;  1XMK A;  2WA0 A;  2BEO A;  3GTM J;  2ZXW H;  1X2N A;  2LRD A;  3G6E I;  3PSF A;  2VT3 A;  2CJJ A;  1D5V A;  3RQ4 A;  4HQM A;  1XX5 A;  1BN5 A;  4PK4 A;  4RGX A;  4XLN F;  3SZT A;  4BQO A;  5TJJ A;  2KIU A;  4IRH A;  5LRS A;  3ONQ A;  2R0Q C;  2E1C A;  4B3A A;  2JN6 A;  3CO7 C;  1HLV A;  3BR0 A;  2CFO A;  2L7M P;  4A0Z A;  1R9T J;  2EJR A;  3L2V A;  4MEY F;  4XON A;  2Z99 A;  2QKM B;  3CUQ B;  3JRI A;  5E3L A;  3ABL H;  1LE8 B;  1XSD A;  4BKX A;  4H4K C;  4OIP F;  1OQY A;  2Z16 A;  2ZBK A;  3GTP J;  2BE5 F;  1X3Z B;  5H20 A;  1O4X A;  3DKX A;  4OAY A;  1FOY A;  2OQG A;  5KHD A;  3A03 A;  3EUA A;  1Z0X A;  3SEZ A;  4HX8 A;  5J47 A;  1RRJ A;  2JPB A;  3E6M A;  3WHB A;  5GPC A;  1H0M A;  2K02 A;  5K7F A;  1H9T A;  2RC4 A;  3IAM 2;  3CP8 A;  4NC7 A;  4FX4 A;  2DYR H;  5FKO A;  2CQN A;  1O3T A;  4M6V A;  4NBQ A;  1F4K A;  2JA7 J;  3ZQL A;  3M3Y J;  3I53 A;  1ZRD A;  4JK1 X;  1SAX A;  5FFX A;  1JKO C;  2R93 J;  1IO2 A;  3L09 A;  2F5D A;  4AYB A;  3C2H A;  4IEJ A;  3K4M A;  1ZH5 A;  2HI3 A;  1TC3 C;  1ZRF A;  2WY7 Q;  4UUV A;  1TWF J;  1W5S A;  4EJW A;  4IHX A;  1Y1V J;  4BDY A;  3S32 A;  4XK4 A;  4XBF A;  3PFI A;  3ROU A;  1N75 A;  1J75 A;  4IZZ A;  2O7O A;  4XR6 A;  2M45 A;  2V1D A;  2D45 A;  2F6C A;  1G6N A;  2NVT J;  1I5Z A;  4CA0 A;  2AQE A;  2EA2 A;  2O8X A;  4E4H A;  5E18 F;  2O61 A;  4L9N A;  1WKM A;  3KZY A;  2OZU A;  4XOT A;  4A2U A;  5DCM A;  3H9Q A;  1W0T A;  2CW8 A;  4CYD A;  4W1U A;  3CP2 A;  4IF4 A;  3ABK H;  1Y8R B;  2Y2Z A;  4IQ4 A;  1U5T A;  2QSH X;  4ZYH A;  1PP7 U;  1F5T A;  3IH4 A;  1KU2 A;  4HRI A;  2XF6 A;  1I3Q J;  3AG1 H;  1UMQ A;  2ZCW A;  5KK1 A;  2LY2 A;  4EJO A;  3IL2 A;  1Y1W J;  1GXQ A;  2E7X A;  4OOI A;  3RQI A;  3CCS I;  1ZQ3 P;  1T56 A;  2R7W A;  1Z3X A;  3HKZ A;  2HDW A;  4M71 A;  1QNT A;  1UG0 A;  2BHY A;  1IUY A;  3PNV A;  2O8K A;  2HKO A;  2ACJ A;  2JPC A;  1ETX A;  4D5F A;  3QPT A;  3DQV C;  1ZAO A;  3WTY C;  1YW9 A;  1V55 H;  4DIQ A;  2PJR A;  1YX3 A;  2IW5 A;  2GWR A;  3EUH A;  1B72 A;  5L3D A;  3OYK A;  3TED A;  3ISP A;  1SAN A;  2ZC2 A;  4KIB A;  4C3H J;  4HLY A;  2VOO A;  3FDY A;  3K4L A;  2R4G A;  4RGR A;  1CF7 B;  4MQV A;  4P96 A;  3HOX J;  2COM A;  2LRE A;  1W0U A;  1N25 A;  1W1W E;  3E97 A;  2KPM A;  2DA5 A;  2ZFW A;  5CVV A;  2V9K A;  1FX7 A;  5L3G A;  4ZYD A;  1ORK A;  1BR1 A;  4B43 A;  1XC5 A;  3P9K A;  1Z1D A;  4KYW A;  2EIJ H;  4AYB N;  2W25 A;  3AG3 H;  1SFU A;  4NHJ A;  1B8I B;  1TW3 A;  1XMX A;  3QOP A;  1FP1 D;  2QVO A;  1K78 A;  1ZG3 A;  1RKW A;  3BTL A;  5E8G A;  1E3P A;  2HGC A;  4JBA A;  4U7B A;  2EFO A;  1D3Y A;  4AIJ A;  5FRM A;  2FBI A;  2JUC A;  1ZGW A;  3BT9 A;  2DDB A;  2W00 A;  3ERM A;  1X3U A;  2VPR A;  4IVN A;  1O7F A;  1GVD A;  1A36 A;  4RGS A;  2HOA A;  2J5O A;  3IRQ A;  2MD5 A;  3KP6 A;  1JGG A;  2JRM A;  1IC8 A;  3GZ5 A;  5C3E J;  2F4I A;  1IV8 A;  1O3R A;  4EMS A;  3RPQ A;  3HRM A;  2G0E A;  3FMQ A;  3TGN A;  5FLV A;  1ETV A;  5A2Q Z;  5K1Y A;  1K6Y A;  2IA2 A;  4FQG A;  5CQG A;  4BE0 A;  3WHC A;  2VJJ A;  1JHH A;  2GOM A;  4C3J J;  3GTG J;  1B59 A;  3HHG A;  5DV5 A;  2GA2 A;  4M3F A;  1R71 A;  3K1P A;  4RM3 A;  1S3J A;  5FKN A;  2XRL A;  1IRG A;  2DLL A;  3KP3 A;  4HOB A;  3DPU A;  1QBJ A;  2LBF A;  2EZI A;  2RV8 A;  2OUM A;  4DOZ A;  3HKZ N;  5DYM A;  1XSX A;  3ASO H;  4E7I A;  1YJ9 I;  1AKH A;  3RZO J;  2DA6 A;  5F0C A;  5KAI C;  3HUG B;  3O6B B;  4BU2 A;  5J40 A;  2L0K A;  3IV5 A;  1V4R A;  2R3S A;  4HF1 A;  2R7D A;  4B8X A;  3CC2 I;  1FY7 A;  4LK1 F;  1N77 A;  3J7Y J;  3TO6 A;  3LSR A;  1W7P B;  2R5Z A;  4U88 A;  4IHS A;  2P5V A;  4LG3 A;  3EYY A;  2JJ7 A;  1P7I A;  2PN6 A;  3ZPL A;  2VJ5 A;  5CVJ A;  3IHU A;  1W36 C;  2JVG A;  2XPV A;  1FYM A;  2QCO A;  2OTJ I;  4EEF G;  3L9F A;  3LFK A;  2Y9Z A;  2HQR A;  3HSF A;  4WXH A;  1W5C C;  1ONV A;  3HC7 A;  2MH2 A;  4UB6 C;  3SFI A;  3CCY A;  2J5P A;  3BG7 A;  2ESH A;  4PDK A;  5B1B H;  2NNN A;  2XAJ A;  3ZMV A;  3DU5 A;  3IH3 A;  1YW8 A;  3OYE A;  4XLH A;  1UHM A;  3OS1 A;  4P5O A;  2YS9 A;  1JJ6 C;  1JI8 A;  4WWC A;  5D5V B;  2XAG A;  3FK7 A;  1HDP A;  4BY7 J;  2VT2 A;  3T5X A;  2VI6 A;  1T08 B;  4HNU A;  5KAF C;  1UFM A;  2CMP A;  2KFD A;  3OS0 A;  3JSP A;  3R6S A;  3ZMZ A;  3S2W A;  1LKX A;  1OYY A;  2R7Z J;  3IKV A;  5FO5 A;  2A5W A;  5IT9 Z;  3VEP A;  2MYS A;  2FSW A;  2UUZ A;  1KQ9 A;  2NOG A;  5FLX Z;  3K10 A;  1J09 A;  2XC7 A;  4FE4 A;  1D8K A;  4CSW A;  5LBQ A;  1T0F C;  4N9H A;  4PGG A;  5ICF A;  2ISZ A;  3A01 B;  1RET A;  3VB2 A;  4UUS A;  3WU1 B;  1ODD A;  1WGX A;  1T33 A;  1XCV A;  1LDJ A;  3SDG A;  4YG2 F;  3NEU A;  2VKE A;  2VUM J;  1TBX A;  1S7A A;  1TWG J;  1X3W B;  2RQQ A;  2GM4 A;  2VOP A;  1SEU A;  3Q0W A;  1YTY A;  5J4V A;  3LAP A;  5JLW A;  4YIR X;  1ZLK A;  1X1D A;  2K9N A;  1AWC A;  2V4J C;  3FMS A;  2L7F P;  3Q0U A;  5C44 J;  3UKG A;  4AM3 A;  1X1B A;  4H0E A;  1Z6T A;  1X1P A;  5EEG A;  4L5I A;  3QRF F;  2V79 A;  2HFH A;  3KYL A;  2YPR A;  2NS7 A;  3R60 A;  4LG0 A;  3TQN A;  2HKX A;  3OR1 C;  5CLS A;  4LK0 F;  2GAU A;  3HHH A;  4MGR A;  2HVS A;  2KP6 A;  3A0B C;  4WXD A;  3VYR B;  5J1Y A;  4IOA F;  3DPL C;  1Z6R A;  1O7L A;  2A5Y B;  1TP4 A;  1U8R A;  4EJV A;  3BR6 A;  4HDV A;  3CF5 F;  2IS4 A;  2DT5 A;  4XIC A;  3HEF A;  3OV8 A;  1YFH A;  2EV5 A;  1MDM B;  4ESB A;  2A6T A;  4PJM A;  3H5N A;  2JWT A;  2P4W A;  3D0S A;  4GGG A;  4WF2 A;  2XKP A;  3W3C A;  1U6G A;  2L3D A;  2EIM H;  2DK5 A;  4UVB A;  1BM9 A;  3K4C A;  1LEA A;  4GFB A;  1MBG A;  3CJN A;  3LST A;  3MQ0 A;  1GT0 C;  1XTA A;  2E1N A;  5LEJ A;  2CH0 A;  1U0J A;  4G6T B;  3DFG A;  2XKO A;  4BXF A;  1CGP A;  1S6L A;  1BOA A;  3WGG A;  1TWA J;  5DM7 F;  3GFL A;  4HBL A;  1IJW C;  3CCJ I;  4EVI A;  3TOB A;  1HKS A;  1ZTR A;  2VIX A;  1WFX A;  1IN7 A;  2M30 A;  3HOU J;  3E3V A;  3I64 A;  1JKP C;  4Q48 A;  3VOD A;  1F9N A;  3GFI A;  3CO6 C;  3M9A A;  1I6H J;  4MLO A;  3H5A A;  2CW7 A;  2K3P A;  2KRF A;  1X58 A;  3K4B A;  2WAQ A;  1BBY A;  2DJI A;  5FRO A;  3JRH A;  1MNE A;  1RNL A;  2PQ8 A;  2XF5 A;  1IXS B;  1U2W A;  1LFP A;  1XSV A;  2QQ9 A;  2BVL A;  2H27 A;  3DBH B;  2MFZ A;  3CF2 A;  4N4O B;  4NB5 A;  5DD4 A;  1D0Z A;  2DFE A;  4UXN A;  3GW2 A;  4B1R A;  1U8B A;  4MIM A;  2V6C A;  3CJQ B;  2O3F A;  2WC2 A;  4G7Z F;  3RIR A;  4DW6 A;  3C18 A;  4RB2 C;  4QTR A;  4CIC A;  3BG6 A;  2O5R A;  1FWZ A;  4ZZL A;  5GTI C;  4LB5 A;  1PUE E;  3GWZ A;  2MLK A;  3DTK A;  5K7Z A;  3HOV J;  3T0Y A;  2MC4 A;  5FKK A;  3J81 K;  2L4M A;  3F8F A;  4CGZ A;  3W6J B;  4CZC A;  4XKV A;  1RIO H;  5CJ9 A;  2LSO A;  2MGQ A;  3ECH A;  3NAR A;  1U9O A;  3K70 C;  1IF1 A;  1Y0U A;  5J8C A;  3L2C A;  3FX3 A;  5HOD A;  2R5Y A;  1AA7 A;  3ULQ B;  5GAD J;  1WPK A;  4AIK A;  4RAF A;  2EPF A;  2CV1 A;  1RI7 A;  3SEQ A;  1LFB A;  2Y69 H;  3V8K A;  2NVQ J;  5D4R A;  2EV6 A;  2PX9 A;  4HEA 2;  5EG0 B;  1P9Q C;  1OCT C;  2VXD A;  2KKO A;  5FKL A;  2KQR A;  3NWS A;  4KA4 A;  3PSI A;  3RPU A;  2V7F A;  1WRJ A;  2R7R A;  4E7K A;  4D1Q A;  3G71 I;  5H2F C;  1HCR A;  1TQP A;  2M3A A;  3MEX A;  4HNV A;  4XL9 A;  3K4N A;  1RES A;  4KNY A;  3LSK A;  1MBE A;  1IG7 A;  1R58 A;  3M8F A;  2EK5 A;  3IP4 B;  3PNT A;  3VSL A;  5ILS A;  3BQY A;  1BW5 A;  5DCF A;  1V54 H;  1LNW A;  2WAD A;  5EEA A;  3H0D A;  3CMY A;  1J59 A;  1JT6 A;  2W48 A;  4QSH A;  4XKW A;  2HYJ A;  2V6E A;  1ETK A;  1XN7 A;  3GTJ J;  3AL0 C;  3HRT A;  3O8G A;  3A0H C;  4B47 A;  1JT0 A;  2KIF A;  2LF7 A;  5CQE A;  1ZR4 A;  2IP2 A;  2LP0 A;  3CCQ I;  3Q9V A;  1IAW A;  3CC4 I;  1R36 A;  4GXO A;  2WAQ N;  2K7L A;  4IHY A;  3RSN A;  3BJ6 A;  4HX7 A;  1STZ A;  3H3V K;  4IPA A;  2COB A;  4NQW B;  1D8J A;  1YS6 A;  4R79 A;  3B02 A;  2P8T A;  2ELH A;  1PUF B;  2LVS A;  3OL3 A;  2BW3 A;  3BC8 A;  1ACI A;  3ZQH A;  5BS6 A;  2RQP A;  3CC7 I;  5JHF A;  4XRS G;  1SD4 A;  5FD6 A;  4R1H A;  3BOQ A;  1BJZ A;  2PEX A;  3AKZ A;  1U3E M;  4PJL A;  3RPU D;  2M4K A;  2C6Y A;  1J7K A;  4M3E A;  2DYS H;  2FBH A;  2ZME C;  2HS5 A;  1UG2 A;  2K4B A;  1FOK A;  1X1A A;  4KFC A;  3HPH A;  4N0B A;  2A3S A;  2NNY A;  3I59 A;  3NRV A;  3KFW X;  2Y9Y A;  4GRI A;  3DKW A;  1FBS A;  1FOX A;  3S17 J;  3KLN A;  4WCG A;  2QYO A;  3LQR A;  2FEZ A;  3QPH A;  1A6I A;  1ULY A;  2CUE A;  2XGE A;  2VN2 A;  5M5W J;  1KU3 A;  3QP5 A;  1BC8 C;  5KVR A;  2XHK A;  2ADU A;  4DYR A;  5H6R A;  4D7M A;  3FHN A;  1F1Z A;  4M6Y A;  5HLI A;  4L0Z B;  2M5W A;  3BZK A;  3FXK A;  2FOK A;  4LIV A;  3JRB A;  1SFX A;  2OD5 A;  3U1D A;  2BV6 A;  3Q3S A;  1WCM J;  1T39 A;  5FFZ A;  1EH7 A;  3J80 K;  4HDU A;  3QOE A;  5F1J A;  3BDD A;  4BDZ A;  1JUM A;  3H3Z A;  3ELK A;  1IUF A;  3E5X A;  2H8W A;  1ZN2 A;  4M3D A;  3MKL A;  4IJA A;  4CZZ A;  4BXX J;  1LPQ A;  5D4S A;  1E2X A;  2K85 A;  3LNQ A;  1DGR M;  4K2E A;  2CQ7 A;  4L5J A;  1YJW I;  1IDZ A;  1SD5 A;  2L9V A;  2QQB A;  4BH9 A;  2ZSI B;  2AXL A;  1TT0 A;  1JHF A;  1KQ0 A;  4UVA A;  3PO2 J;  2Y75 A;  4O6J A;  3S15 J;  4ENK A;  4HZF A;  3CUO A;  3TW7 A;  5IPA A;  3CDI A;  1NHA A;  3FXU A;  2JA6 J;  1IXR C;  1VND A;  3J80 Z;  2H94 A;  2R7X A;  5E1X A;  3HOZ J;  4BEH A;  4F7Z A;  4OIQ F;  3BJA A;  1V5G A;  1T8I A;  5HNF A;  4M72 A;  3BY6 A;  1JKR C;  3IUO A;  2FU4 A;  1WJF A;  4B09 A;  1XGN A;  1JUP A;  1DUX C;  2KDZ A;  4EJT A;  2JMW A;  4RLF A;  1BW6 A;  2JVH A;  3LSM A;  2M7A A;  2HXI A;  4UUT A;  1MBJ A;  5CVI A;  2LNB A;  3FKI J;  3BWG A;  1A6Q A;  4CUG A;  2X0L A;  1E0E A;  3PIO F;  2D1H A;  3FXL A;  4B44 A;  4CCL A;  1T0F A;  1P4X A;  3GFM A;  2FJ1 A;  2QWW A;  3ERE D;  3PO3 J;  4LOC A;  3ABT A;  2IS6 A;  2ZO4 A;  1NK2 P;  1EJ9 A;  2FQ3 A;  5EDN A;  2KIQ A;  1G3Y A;  1WJC A;  4CCO A;  5F08 A;  2STT A;  3S1M J;  3TMO A;  3BTI A;  2VOD A;  2IGM A;  3OMY A;  3TDZ C;  1W36 D;  2K4J A;  1YRN A;  4XLC A;  3P9I A;  2ID6 A;  4Y33 A;  1MH3 A;  3ASN H;  4BJ6 C;  5IOY A;  1T6S A;  3SQN A;  2XAF A;  4I98 B;  1MBF A;  2KJB A;  4LFU A;  3VPR A;  1LQ1 A;  1KYW A;  3W2A A;  1I1G A;  4JP0 A;  4HNT A;  4A3E J;  2B63 J;  3S14 J;  1XDU A;  3VFZ A;  3VYU B;  3E6B A;  5LHG A;  5LEK A;  2DAO A;  2LY9 A;  1HKT A;  5CKT A;  3BPV A;  3KEY A;  3TP3 A;  1Z91 A;  1GXP A;  2PG4 A;  2V1N A;  1FLI A;  4RMN A;  3I4P A;  3WG7 H;  1XGS A;  3ECO A;  3CTA A;  1S72 I;  4L9V A;  5EGO A;  1IRZ A;  2DT6 A;  1BIA A;  3EYI A;  1LDK B;  2XAU A;  1HSJ A;  3LAJ A;  4EJU A;  1SD6 A;  2F4O B;  4DGW B;  5CVR A;  2UXN A;  5F0H A;  4EM1 A;  2HZT A;  3L2W A;  4A5M A;  1RC9 A;  1KU7 A;  3VYS B;  5D5X B;  2E60 A;  3A02 A;  5B5E C;  2HDD A;  2EBI A;  3Q0V A;  1P2F A;  3GBG A;  1H88 C;  1RZ4 A;  2QSF X;  3FIW A;  4G94 A;  2VQG A;  3LSH A;  1UHS A;  3RDI A;  3MCZ A;  1A35 A;  5DTD A;  1MMA A;  1FTT A;  5HLG A;  2LDU A;  2BGC A;  5IT3 A;  5LD2 C;  1P4A A;  3KIO A;  3GLL A;  5FJ8 J;  2BOL A;  4C3I J;  1MSF C;  1TTY A;  2CU7 A;  2IJL A;  2JK3 A;  1MJA A;  2OU2 A;  3E0J B;  2DW4 A;  3F21 A;  1IDY A;  5F64 A;  1OCP A;  3TKY A;  1HOM A;  1TQI A;  5D8K B;  3FK6 A;  4WX9 A;  1F36 A;  2E1M B;  3VWB A;  3NAU A;  3HOY J;  2K9M A;  3KLO A;  4CCM A;  3L00 A;  4RB3 C;  1U9N A;  1XB4 A;  3NQO A;  4XOP A;  2DQL A;  5C4X J;  4HSR A;  1MJB A;  1OR7 C;  4OMY A;  4RAG A;  2P7C B;  1MD0 A;  2QKL B;  3LSP A;  1YW7 A;  3BQZ A;  4A3J J;  1DP7 P;  3DEW A;  1ZGJ A;  3ZR8 X;  2F5E A;  4G8X A;  2DCE A;  2NVU B;  2MG4 A;  3PL8 A;  2ZKZ A;  1P7J A;  3H1C A;  1QRY A;  4DBQ A;  3O3K A;  3V8J A;  1QU3 A;  3BJO A;  1IGN A;  3KCC A;  1TL8 A;  1Z67 A;  3WU0 A;  3QP6 A;  3S3M A;  3DXJ F;  2F5F A;  1H9G A;  2CUZ A;  3K4J A;  2HWV A;  3J7Z I;  1MH4 A;  4YII A;  2A6E F;  1KU9 A;  5E8I A;  1R7J A;  4HPQ A;  3SZP A;  5A2Q K;  1CQT A;  3I56 I;  4B4C A;  4Q5S F;  5DCM B;  1NG7 A;  5E1Z B;  3OYN A;  3C2B A;  3FXM A;  4RAY A;  4RGU A;  4DYC A;  1S9H A;  4I76 A;  2EB7 A;  2TDX A;  4EGY A;  2R7O A;  4G7H F;  3KP4 A;  1AOY A;  2NAZ A;  3SHF A;  2EH3 A;  2BY0 A;  2G7H A;  1LUJ B;  2X6W A;  3OYI A;  2XGC A;  1U5T B;  5JI6 A;  2XUB A;  1KON A;  2ME0 A;  3IC7 A;  3L2R A;  5K7H A;  2AS5 F;  1V5E A;  5LLQ A;  5K5Q A;  3V8L A;  1YIO A;  1MIJ A;  2R92 J;  4OAZ A;  1VQN I;  1WJ5 A;  2GIV A;  3U1K A;  3JW4 A;  5BPD A;  1NG6 A;  3QYE A;  2XB0 X;  2JA5 J;  4GYI A;  2RNJ A;  2DFF A;  5J1U A;  4A3K J;  5FRN A;  1F43 A;  4XSZ F;  2PBI A;  4BHP A;  3DLA A;  2EFP A;  3IAS 2;  1OYW A;  3ML6 A;  3IWF A;  3ZMS A;  1NH3 A;  3S16 J;  1TT5 B;  3M7G A;  3KX2 A;  4E7L A;  2PJR B;  3CME I;  1B72 B;  2HXO A;  2E5N A;  3F72 A;  4HV5 A;  5ICC A;  4Y52 J;  2EWN A;  4W97 A;  2PI0 A;  4QPQ A;  4C2U A;  1SFO J;  2V1X A;  2KDO A;  3FKJ A;  3K7A J;  2K27 A;  3H5R A;  4ANJ A;  3ZN0 A;  4XRM A;  5TRD A;  3CD6 I;  2AHQ A;  1QHG A;  2GXG A;  3MKW B;  2XSJ C;  5FD5 A;  4IHW A;  2UWM A;  4U87 A;  2CUJ A;  2IS2 A;  3WOD F;  4FAS D;  4D9J A;  1EA3 A;  2K9L A;  2QZ8 A;  3Q5F A;  1FEX A;  4XLF A;  4BBR J;  1Q1V A;  4JX4 A;  5B66 C;  5ICG A;  5DM6 F;  2L9N A;  2WV0 A;  3BCA A;  2W7N A;  4M6X A;  1BL0 A;  1K78 B;  3CUQ C;  4KIS A;  5AIP A;  2P0W A;  3K70 D;  1RR8 C;  3SDB A;  2NXN B;  4JX6 A;  3HDD A;  2DOF A;  4N9I A;  4MEX F;  3RKX A;  3LA3 A;  2YU3 A;  4PUS A;  3WG9 A;  1WSU A;  2CRG A;  2JT1 A;  2RVC A;  1W7P D;  2LTP A;  5FLX K;  4NUB A;  3BZ6 A;  1YO5 C;  1ON1 A;  1ZAR A;  2Y0M A;  5FB2 A;  3QU3 A;  3I54 A;  2W4S A;  1ERD A;  2LFB A;  2Y31 A;  2P6T A;  2CFX A;  1R49 A;  2ZME A;  2HPM A;  5F27 A;  4EM2 A;  2AO9 A;  2ICW G;  4MQ9 F;  3HSE A;  3G4S I;  1V5F A;  4ITV A;  3HBL A;  2IA0 A;  2DPD A;  2HQ5 A;  2GZW A;  2JZY A;  2ELK A;  3FBI B;  3RYR A;  3BLY A;  3MAJ A;  3D5S C;  3F6V A;  3GUD A;  2QEN A;  4G6Q A;  1QVT A;  4A3I J;  1WJE A;  1J5Y A;  4XRS A;  5DUK A;  4E6K G;  1FTZ A;  2KHM A;  1BIB A;  3FXO A;  2LBF B;  2FOW A;  2IT0 A;  2WTE A;  3WTS C;  2ECB A;  3W6V A;  2AQF A;  5EZG A;  4C2M J;  5FKM A;  5IYB J;  1WH7 A;  3V4G A;  4MO7 A;  1G4D A;  4RB1 A;  1UEL B;  3OOU A;  5JLX A;  3ZMT A;  3GF2 A;  2ZJQ F;  1AKH B;  1RUN A;  2BXY A;  1OYI A;  3K2Z A;  3MVP A;  4I0A A;  3OY9 A;  3ZQF A;  3OL4 A;  1VQL I;  2PMU A;  2W82 A;  2BY3 A;  4UV8 A;  2XSD C;  2DI3 A;  4NNJ A;  3GZ6 A;  1MMG A;  3H9J A;  2DA4 A;  2MH9 A;  2DA7 A;  2VQC A;  2F5V A;  4BJ5 C;  5LFA A;  1O3S A;  2QA4 I;  4XN3 A;  1MW7 A;  3OIQ A;  4DZP A;  1A5J A;  2ZNY A;  3ABU A;  4MFD A;  2DO7 A;  3U2R A;  3L7W A;  4BQQ A;  3G73 A;  3T1B A;  5HLH A;  3S1R J;  1VZ0 A;  3FBN B;  1B1B A;  3I4M J;  3U9G A;  3ZMU A;  4F92 B;  1EH6 A;  4BHB A;  3VYT B;  3GYH X;  3ZQQ A;  3BG3 A;  5E1W A;  5J3L A;  1Y0N A;  2OTL I;  5GTH C;  3HJE A;  4YRV A;  4RDU A;  2R7S A;  3HYI A;  3OYA A;  2BY2 A;  4OIR F;  3QOD A;  4A3F J;  4YIF A;  3R4K A;  4E70 A;  3ZP5 A;  4X0G A;  4AD9 A;  1R5I D;  3ABM H;  1YOV B;  3GFJ A;  1G8X A;  1ENH A;  4JQF A;  1XGO A;  2K5C A;  2DOA A;  3TBI A;  4BHC A;  3OYG A;  1U78 A;  3ZXS A;  4LLG F;  2QSG X;  2JSP A;  4AVP A;  4EV0 A;  2Q0O A;  2Q2E A;  3CMM A;  3R0A A;  4XMY A;  4A5N A;  2DMT A;  3H3U A;  2L7Z A;  3KP5 A;  2CQX A;  2KIS A;  2R7U A;  2CO5 A;  2X1E A;  3F8C A;  4DZJ A;  1K6O A;  1YI2 I;  3F9K A;  2RN7 A;  3HPG A;  1YG2 A;  2W85 A;  2OV7 A;  5FGM A;  4YFK F;  2R7V A;  2FX0 A;  5HS8 A;  4OMZ A;  1S8N A;  1LJ9 A;  5J6X A;  3JR9 A;  1BI2 A;  4ABZ A;  4O3M A;  3SZG A;  2M8E A;  3WE3 A;  1BJA A;  2IAI A;  2ISY A;  2X1D A;  2CS3 A;  4IOC F;  3HRS A;  1KYZ A;  3W6K B;  4UY8 I;  4Z2Y A;  5ILV A;  4ZH4 F;  1FMW A;  3VSK A;  1WJD A;  2BYV E;  2IBD A;  1PVE A;  3LQQ A;  4LG0 B;  3IWZ A;  1YIJ I;  3M1E A;  1G59 A;  5GPA A;  3H92 A;  1MKM A;  3MMY B;  4PJN A;  4ZC3 A;  4D5C A;  2KIM A;  3SXY A;  2ZFU A;  3HB9 A;  1T38 A;  1E3O C;  3KEQ A;  4I02 A;  1VQ4 I;  3EUH C;  1R4M B;  3V42 A;  2TRT A;  2W57 A;  3I9V 2;  3HZJ A;  4ENJ A;  1NK3 P;  2V1U A;  2A05 A;  2OCC H;  4LLN A;  1X4O A;  1MMN A;  2E1O A;  2WAF A;  3ZQG A;  1KZH A;  5HVQ C;  1I3A A;  2EIK H;  3HGY A;  1LFU P;  4G6D A;  2PMH A;  2N8G A;  4BE2 A;  1JUS A;  2EZK A;  1Z05 A;  1MMD A;  2DQR A;  1K79 A;  2X51 A;  4DQ2 A;  2X9D A;  1FBU A;  2JQ7 A;  4E7H A;  5IP6 A;  2VBZ A;  3GZN B;  1SVL A;  4OU0 A;  2QUF A;  1YLF A;  4OIN F;  4BAC A;  2D5V A;  2JA8 J;  3PUF A;  3M8E A;  5GAG J;  4A0Y A;  4U7D A;  2HPI A;  3PFY A;  2HVQ A;  2I5U A;  1WJB A;  2UV1 A;  4AIH A;  1J9I A;  5IYC J;  2GA1 A;  4CO8 A;  4BJT A;  3BR1 A;  3K9T A;  2VC1 A;  2MAB A;  2EV0 A;  1PJR A;  3TP0 A;  4RA2 A;  1OR7 A;  3NWT A;  2HTJ A;  2FXA A;  2X85 A;  4M9S A;  1IRX A;  1YIT I;  4ZZD A;  2GOX B;  5BOX A;  1PDN C;  1AHD P;  2ZNZ A;  1ZYR F;  4FX0 A;  1GDT A;  2BBY A;  2NVY J;  2I10 A;  1MBH A;  3HSR A;  3I71 A;  2DMN A;  2VKD A;  5J8F A;  1BI0 A;  3HOW J;  1YX5 A;  3RI4 A;  2HEO A;  3OIO A;  4CHU A;  2MLG A;  4O5V A;  3OYF A;  1MMS A;  2HU9 A;  3K1N A;  1XG1 A;  3BPX A;  5HDK A;  2XPU A;  1HDD C;  1VQM I;  5D6E A;  4AUX A;  1GLN A;  3JAM K;  4OWR B;  3GXO A;  3WTZ A;  2P5L C;  5FLM J;  4XLE A;  4EAT A;  5K5O A;  3CCV I;  2NVX J;  1OJL A;  1R1V A;  2LG4 A;  4ASN A;  4CXF A;  5HLT A;  2HVR A;  1P4W A;  3ZRG A;  3T8T A;  4XSX F;  1ETY A;  1GV2 A;  2O0Y A;  2M8G X;  1Z21 A;  3AFH A;  2R5Y B;  3GTK J;  2OC6 A;  2OAZ A;  4BQA A;  4NDL A;  4PFP A;  1G3S A;  2BHZ A;  4YFX F;  2E34 A;  2RKH A;  5KNL A;  2M4G A;  3LOC A;  4HST A;  2LKX A;  1IXC A;  4A3M J;  1UB9 A;  1FOW A;  4IXA A;  3QAH A;  1SC7 A;  2HNH A;  3DWL E;  4A6E A;  5HDG A;  3JAM Z;  4B3X A;  3FMR A;  1R5G A;  4ESF A;  4A3D J;  2QQ8 A;  3P9C A;  3EPZ A;  1QA6 A;  5CVU A;  3DTI A;  1K4S A;  1USS A;  2XAQ A;  2IA1 A;  3I4N J;  3BRO A;  1DGW Y;  3K1M A;  1I27 A;  4F52 A;  4AWX B;  3FXR A;  4U0Y A;  3LA7 A;  5LRR A;  3PIP F;  4FCY A;  1T95 A;  3JRG A;  3JRC A;  3QYB A;  3CJT B;  2L02 A;  3OR2 C;  1YYV A;  2M0M A;  1OCR H;  1WJA A;  1KGS A;  4L0Y B;  3LL7 A;  2MC3 A;  2X6Y A;  3JCU C;  1OMI A;  1ETW A;  2DT7 B;  1SMY F;  2VBY A;  4XOR A;  3QYF A;  2ME6 A;  5JHU A;  3K2A A;  5JR3 A;  3CUQ A;  2ZJP F;  4L18 B;  1LE8 A;  4C9Y A;  2IEK A;  4KIT B;  3G1L A;  3UNG C;  4IX7 A;  1D1C A;  2A61 A;  4I6Z A;  1BA5 A;  2F5C A;  2JTV A;  2HQN A;  4ZTF A;  1R5H A;  4KT5 C;  3F8M A;  4J01 A;  2DOD A;  2ZXJ A;  3PM1 A;  4ZYA A;  3EDP A;  2NRA C;  2FNP A;  5BNG A;  2MA3 A;  2LC2 A;  1OPC A;  2QBY B;  2FMY A;  1Y8Q B;  4LGW A;  4I7H A;  4XRF A;  1VQO I;  3BR5 A;  2FML A;  3E1S A;  5GAE J;  1DU6 A;  4YFN F;  4A93 J;  4HLX A;  1UCR A;  2JSC A;  1MND A;  4CCN A;  1R00 A;  2R7T A;  2NOJ B;  3R61 A;  1DP3 A;  3LSJ A;  3WE2 A;  2KRC A;  3WTX C;  3GCM A;  3CLO A;  2E36 A;  2M1B A;  4Y17 A;  3DLL F;  3I59 B;  3G1M A;  5GP9 A;  1YJN I;  2QQA A;  4IHV A;  5E3N A;  3E5U A;  3VOE A;  3LA2 A;  2F48 A;  2RNG A;  3BG5 A;  1LEB A;  4N4N B;  2LR8 A;  3LSI A;  2WV1 A;  1QZZ A;  3LFU A;  4KDP A;  2L5Q A;  4PCQ A;  1W5T A;  4PJJ A;  3ZOB A;  3K69 A;  5E3M A;  6PAX A;  4LJZ F;  4QPO A;  2ELJ A;  1HQC A;  4M3B A;  1QHH D;  5L3C A;  4A12 A;  2Y30 A;  2RAE A;  2X4H A;  4Q4Z F;  2VBW A;  4S0H B;  4XM3 A;  2OCE A;  4HW0 A;  1R23 A;  1ZG1 A;  4D7N A;  5EEH A;  5LGN A;  4Z6Y A;  2Z9O A;  3KPH A;  3CDL A;  1ZG5 A;  2M9H A;  1ETQ A;  2F4M B;  3OWT A;  4FTH A;  2AXT C;  1IW7 F;  2UXX A;  4CYC B;  3I58 A;  3K0L A;  1QPI A;  4YEJ A;  4BQN A;  4KIC A;  1SAU A;  3GTL J;  5H6Q A;  2Z3Y A;  4M73 A;  2W24 A;  5KCM A;  3JRF A;  3UR3 C;  1N78 A;  3GTO J;  3CMA I;  2KLO A;  2VJ4 A;  1XCB A;  4ZYE A;  2YX4 A;  2H09 A;  3M8J A;  3I5U A;  1VQK I;  2E5Z A;  1VTN C;  2XB5 A;  3DP7 A;  3F23 A;  4XN0 A;  3JSO A;  1XGM A;  3SYT A;  3G3Z A;  4Y7N J;  3I3L A;  5JFR A;  3ZGK A;  3GX4 X;  3P7N A;  2XF7 A;  1OIS A;  3G2B A;  4BEH B;  1POG A;  1R6R A;  3EUK L;  2VPL A;  1X19 A;  1VQ7 I;  4I09 A;  2HR3 A;  1X4P A;  4ZJZ A;  1SVM A;  4DYQ A;  4ZTJ A;  1CF7 A;  2VKH A;  5ICE A;  5IY5 H;  2RDP A;  3DF8 A;  1UZC A;  3MKY B;  2L9S A;  3HM5 A;  2I8D A;  1K7A A;  3MKZ A;  1BOB A; 
#chains in the Genus database with same CATH homology
 1YIT I;  1Y39 A;  5JVG F;  1VQO I;  5GAE J;  3CCU I;  1HC8 A;  3PIO F;  1ACI A;  4V19 K;  3CC7 I;  3CCE I;  2K3F A;  1MMS A;  3I55 I;  1VQM I;  1YI2 I;  2E36 A;  3J7Z I;  3G4S I;  3DLL F;  1VQP I;  1YJN I;  3I56 I;  3CCR I;  3CCV I;  4IOC F;  5GAH J;  1FOX A;  2QEX I;  1VQ9 I;  4UY8 I;  3CCL I;  2FOW A;  1YIJ I;  2ZJQ F;  4IO9 F;  1VQN I;  2E34 A;  1VQL I;  5GAD J;  2E35 A;  1FOW A;  1VQ4 I;  1YJ9 I;  1S72 I;  4IOA F;  3CCS I;  2H8W A;  1QA6 A;  2QA4 I;  3CF5 F;  3CC2 I;  3G6E I;  3CME I;  3CMA I;  3CCM I;  3J7Y J;  3G71 I;  1YJW I;  3PIP F;  1VQK I;  3CJT B;  2JQ7 A;  2OTJ I;  1VQ8 I;  1YHQ I;  3CD6 I;  2OTL I;  5GAG J;  1VQ7 I;  5DM7 F;  3CCJ I;  1FOY A;  5DM6 F;  2ZJP F;  1VQ6 I;  3CCQ I;  3CC4 I;  2NXN B;  2ZJR F;  1VQ5 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...