5GAGJ

Rnc in complex with srp-sr in the closed state
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
134
structure length
134
Chain Sequence
YVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SRP 4.5S RNA
publication title Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 23
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
J PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 5gagJ02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 5gagJ01
3CC7I 2E34A 1YHQI 2ZJQF 1YJ9I 3DLLF 5GAGJ 1YIJI 1VQKI 2H8WA 3PIOF 1VQ4I 3G71I 3CCMI 1WIBA 1VQOI 3CMAI 3CCQI 2QA4I 3CMEI 2E35A 5JVGF 3EGVB 1FOWA 1VQLI 5GAHJ 3CCJI 1FOYA 1S72I 2FOWA 3CJTB 3J7ZI 4IO9F 3CCLI 1YJNI 3CD6I 5DM6F 1YI2I 3CCUI 3PIPF 2JQ7A 3CJRB 4UY8I 1Y39A 1VQ7I 2K3FA 5GAEJ 3CCEI 1VQ6I 1VQMI 3I56I 2NXNB 4V19K 2OTJI 1VQ5I 3CCVI 1MMSA 3CCRI 1FOXA 3CF5F 2ZJRF 1YITI 2ZJPF 1YJWI 3G4SI 1VQ9I 1QA6A 2E36A 1ACIA 2QEXI 1HC8A 3G6EI 3CJSB 5DM7F 5GADJ 3J7YJ 4IOCF 3CC4I 1VQ8I 1VQNI 3I55I 3CJQB 3CC2I 2OTLI 1VQPI 3CCSI 4IOAF
chains in the Genus database with same CATH superfamily
3OOPA 3HRTA 4MO7A 1R4NB 3EPZA 3S14J 2VT3A 5D5XB 2O61A 2RAEA 1K7AA 1XG1A 1YJ9I 3A2KA 3KZYA 2A61A 3CLQA 1UHMA 4PGHA 3HB9A 4LD5A 5FFZA 1T0FC 4LK1F 4QTRA 3H5RA 4M6YA 2WY8Q 3CCMI 2DOEA 4G12A 1FJLA 2M8GX 2XAUA 3CDIA 2W00A 4RBOA 4BBSJ 3C18A 1AOYA 3FXRA 2FBIA 2VJ4A 4RM3A 1FP2A 2ZMEC 3TDZC 1S5LC 1K6OA 1WJFA 3D0SA 3BPXA 5E1ZB 1OISA 3VSKA 3GTJJ 2CU7A 2NVUB 4B4CA 3C2BA 2IAIA 1J7KA 3QYBA 4JX6A 4M3GA 2PI0A 3H9JA 4NUBA 1FNNA 4HNTA 3IRQA 2M4GA 3JAMZ 5EF6A 3GEZA 4BHBA 4Y33A 1XCBA 4DYCA 1A5JA 1O3QA 4B8XA 2V1DA 3OSFA 3LFUA 3F23A 5FFXA 5J1YA 1U5TC 1HF0A 2P0WA 4FASD 4AIKA 4AU7A 2KPMA 3JW4A 4IRIA 1JHHA 2Z3YA 3BZCA 2DA6A 1E3HA 5DDGA 2LD5A 4ZTJA 1LFPA 2VI6A 4I7HA 4P9UA 4R79A 2F48A 1XGSA 1ZK8A 4A5MA 2B9SA 2XGEA 1ON1A 2WV0A 3GTOJ 5FKMA 1EH8A 2AO9A 4DNCA 4IRGA 2DA4A 5L3GA 5F0FA 1SD4A 1R9TJ 3VDXA 3IH4A 3WTUC 5H6QA 3HHGA 1IG7A 3J81Z 4O5VA 2DCEA 1YE9A 3N05A 2E1OA 1TW3A 2QM3A 2E2JJ 3C2GA 3TP3A 1TLHB 4BKXA 4B3AA 1CF7B 1JI8A 2AQEA 2AXTC 2L0KA 4FT8A 3H36A 2H1KA 2JA5J 1Y8RB 4N0BA 3EUAA 5AONA 4XKCA 5HDGA 3TO7A 1FSHA 3L2RA 1ETWA 2Y0SA 1DQUA 2BXZA 3MKYB 1AU7A 4EEFG 2EIKH 2RC4A 2XPUA 5A2QZ 3H3VK 2WBMA 2XC7A 1DGRM 1E0EA 1WKMA 3E97A 2GXGA 2AXLA 2E1MC 1I27A 2KRHA 5E79C 5BOXA 4MLOA 5CYVA 5GTIC 4PSWA 1L3LA 1FBSA 3Q0WA 5HS7A 4Y7NJ 2LLKA 5EGOA 4A3FJ 4RS8A 3BR0A 2ISYA 4HSRA 4A3IJ 2E2HJ 2R7UA 5E3OA 5LLQA 1LE8B 4DZPA 1SMTA 2M0MA 2PMUA 2QWWA 3WU2C 2I5UA 3T0YA 2DTRA 2EJRA 1MMGA 3W6KB 4UB8C 1B9MA 1Z05A 1KU2A 2L5QA 3HUGA 3CO6C 2BW3A 1GHCA 1TWCJ 1KONA 2BVLA 2ME6A 4HNVA 4RDUA 1T39A 4MIMA 4BY7J 3WE3A 2VUMJ 1ZR2A 2PN6A 2EFPA 3AG2H 1BIBA 5LHGA 3HXLA 1MMAA 3A01B 3GMEA 2VKEA 1W36C 1ZH5A 3GFIA 2DJNA 3AAFA 5D6EA 1R22A 3WHCA 4AYBN 1EH7A 5HODA 2R3SA 1Z7UA 4LLNA 1KU3A 3RKYA 3FK7A 3RPUA 5BPIA 1FSEA 5CKTA 3F8NA 3JTHA 2GA2A 4JX5A 3RIRA 4C2TA 1RKWA 5D4RA 1BIAA 3RQ4A 2VASA 4E4HA 5F08A 2UWMA 1BR1A 1P6RA 2BY2A 3KP4A 3S93A 5B3SH 4J01A 3QYEA 2ZO4A 4HLYA 4C2MJ 4ENNA 4A3BJ 3CO7C 2V79A 3LQQA 2HYJA 1ETKA 3I56I 4UV8A 4WK8F 1HKTA 1V55H 2MSYA 4BACA 1MMSA 2OQGA 2IEKA 4A5NA 5K7HA 2KIUA 2ECCA 2M9HA 2QCOA 1GXPA 1MW7A 2H8RA 4X1EA 2MYSA 2HOAA 1XGOA 3K2AA 2G0EA 4LMYA 4ZYDA 3FZVA 1U6GA 2H6BA 2R7OA 3ABKH 3BTCA 4YELA 1XS9A 1JGGA 2HDCA 3EYIA 1HC8A 2NS8A 3ZQIA 3B73A 5LFAA 5GPAA 2XSJC 3G6EI 2HDDA 2GXBA 3CJSB 2HVQA 2HQAA 1TWFJ 3SEQA 1G3YA 2XDVA 3QOPA 2LRDA 2RQQA 3L2QA 2NRAC 2DXIA 1ZG3A 3NWSA 3RQIA 3CC4I 1QZYA 1YRNB 2JUGA 2DFEA 4GXOA 5ILUA 2KMUA 1ZGJA 3HSFA 2K7LA 1A6QA 1GXQA 2H6CA 3CUQC 2LF8A 3BR2A 1UELB 3FXLA 2HU9A 5LRRA 1RR8C 2XROA 4HV5A 4BL0B 4FX4A 4LITA 1FLIA 4F91B 1MH3A 2O8XA 2OA4A 3LA7A 4H0EA 2QF7A 3O2PE 5FO5A 3PFYA 1WIBA 1IDYA 1BM9A 1T98A 2ETHA 3T5XA 2OAZA 5CQGA 1WJEA 5BNGA 4G7OF 3EUKL 3F8BA 3KP3A 4DIQA 3FXKA 1RC9A 5GAHJ 4M72A 5LD2C 5M5YJ 3L2WA 3T8RA 4IL6C 2LDUA 3V7CA 2R7TA 3DTIA 4IPAA 1T38A 1CF7A 4PJJA 2XB0X 1REPC 3FHNA 2Y30A 5KVRA 3LMMA 3GTKJ 3PUBA 2K9QA 4FE7A 3M1CA 3ZN1A 4DJAA 4DOZA 4W1UA 2D1HA 1OR7C 4BS9A 1H9GA 4P96A 1Y56A 3D5LA 2ESHA 2JK3A 1PVEA 3CJNA 3MCZA 4D7MA 2E7WA 2FRHA 1S6LA 4HDUA 3GTMJ 6PAXA 2CUZA 1WCMJ 2HKXA 3DU5A 9ANTA 3TW6A 3RPUD 1HSJA 1QVTA 2K3FA 1VFCA 1P92A 4IXAA 1V54H 1WI9A 3GWZA 3R61A 3CCEI 2XRNA 2M3AA 4DBQA 2L7MP 2KZGA 2MD0A 3FMSA 3PNYA 3FWEA 3DTKA 2M1BA 1B6AA 3F22A 3IH2A 4KT5C 1V5EA 2L2OA 4PZJA 3QPLA 1BI3A 5KCMA 2QSHX 5IY5H 2JRMA 2V1XA 2DOAA 2LFBA 4BJ5C 1LE8A 4QLCU 2DA2A 4D9JA 1BR4A 1IDZA 1H8AC 3SDGA 3U1KA 4M6XA 2A69F 2PFBA 1D8JA 2F5CA 2FU4A 3OL4A 2IT0A 4K2EA 2LNBA 4AUXA 2KIMA 3W6VA 1TQMA 2A6TA 3KPHA 5LBQA 5EDNA 2HOEA 2VJ5A 4OIRF 1LNWA 2A07F 4A6EA 1U9NA 4EM2A 3A01A 1X1PA 2IGNA 4IKFA 1VQPI 2DMPA 3DQVC 2GAUA 2XVCA 4BJTA 2EFNA 3KP7A 3BY6A 5DD4A 2EIJH 4EATA 2KJBA 2JZYA 2VE8A 1FPQA 3N97A 2VBYA 3KEQA 4LK0F 4F3QA 1WJAA 3BJ6A 4I2OA 1DU0A 2R93J 5IT9K 2EV6A 3K2ZA 2P5VA 3DFGA 2XAFA 5BPDA 2LKPA 3DXJF 3ULQB 3M4OJ 1R5ID 1JKQC 3BR6A 5M5XJ 4ENKA 3ZN0A 2P7CB 1PDNC 4BQNA 4P9FA 2CWEA 4CH7A 4CUGA 2QA4I 2VONA 1YO5C 1ZLJA 5JLXA 2EZIA 2JVHA 1RKTA 1PUEE 3ZQHA 4II2A 2X48A 4AIDA 2WB1N 2DA3A 1TL8A 2KDOA 2LP0A 3V7RA 5IYDJ 3MAJA 5BS6A 1MBJA 1QBJA 1Z91A 2F6CA 3Q9SA 3LSHA 2JRTA 3COAC 4H4KC 1F9NA 1YJNI 4IQJA 5E8GA 2VQLA 1W5TA 5DTDA 4WF2A 2VODA 2VBWA 1X58A 1APLC 1IRXA 1QHGA 4XORA 2W85A 1DPUA 3L2CA 3CDHA 4G6TB 1Z67A 3PJRA 1KQ0A 1SFEA 2K40A 4Y13A 2WV1A 2QSGX 2JN6A 5AIPA 4QPQA 5E3LA 4EGZA 1A31A 1YRNA 5IYBJ 3AFHA 2QSFX 3AG4H 1GV5A 3LFKA 2EINH 4D0PA 2XGXA 5J6XA 1MBEA 1R6RA 1D1CA 1W0UA 5CVIA 1FBQA 4PCQA 1S7OA 1DP7P 2HPIA 4AIHA 4M71A 4MTEA 1LUJB 1SMYF 3HM5A 1D5YA 1F4KA 2ZXJA 3WGIA 1VI0A 4XKWA 2MG4A 2GXAA 1T08B 4O6JA 3L9FA 2WAFA 2ZJPF 1MNMC 3P9CA 5IP9J 3G4SI 1NG6A 2Z2SB 2NVYJ 5LHIA 1R58A 2M34A 3EDPA 4LB6B 2XKOA 5D6FA 4UB6C 5J4YA 3H5AA 3OYLA 3O3KA 3KEOA 2XIGA 4NC7A 5H2FC 3ZMTA 3J7AO 4KIBA 1YX5A 3CJQB 3CMMA 4BUPA 4XM3A 3BTLA 3BCAA 4CA0A 3HOWJ 4IEJA 4L9JA 1Z9CA 1WH5A 3FISA 4BBRJ 3BTJA 3SZGA 2L54A 3VYRB 2M7BA 2Q0OA 1Z77A 2WTEA 3VPRA 1WZ2A 1H0MA 4BXXJ 3IAS2 4ZZLA 2E34A 1Z6TA 2Y69H 5JR3A 4UUVA 3ABUA 4UVBA 4I6ZA 1B72B 3T8TA 2HQNA 3TOAA 1VQ4I 1XX5A 3FXJA 1UAAA 3DV8A 3TP0A 4OAYA 4XOPA 4EQQA 5J8FA 4IHYA 3MN2A 1OLTA 3S17J 2M2EA 2Y9YA 1VQOI 3SJMA 3CCQI 3TOBA 1MSFC 1IV8A 1QVUA 4NB5A 3QPTA 2COBA 3G1MA 5FGMA 3F21A 4E7SA 1DP3A 2LYCA 3IC7A 1QU3A 3WTYC 1ETVA 2RVCA 3K7AJ 4CICA 5C4JJ 3M8EA 1SANA 2X1CA 5B1AH 5F64A 1I1SA 3H5NA 3W3CA 4KN4X 2JA8J 2ESNA 3RYRA 2BZTA 2NNYA 5HS8A 1F1ZA 4I76A 5EG0A 4M9ZA 5GTHC 1J75A 3GTQJ 4M73A 3NWTA 3IAM2 5JI6A 4L9VA 3G73A 2XUBA 3H1CA 2E5ZA 2Q1ZB 2MD5A 3ABTA 4NC8A 3ASNH 3MKLA 2ZMEB 3ELKA 3PNVA 3ASOH 2L7FP 1QO0D 2KJCA 3ZPLA 2K4BA 2XF6A 1Z6RA 4CGZA 4BGDA 2A5WA 2IA0A 5DCMB 3IRRA 3JR9A 4XKBA 3ZQCA 2VQCA 1WJ5A 1S7EA 5DD8A 1VTNC 1WJDA 4HLXA 2LKXA 4ABZA 4CDGA 4ZYEA 1DDNA 4P1WA 1ORKA 5M3FJ 1STZA 5FROA 1O3SA 1U5TB 3KZIC 3QAHA 4XLCA 4ESBA 1I3AA 4C30A 2NS7A 4E7HA 3ZMVA 3AL0C 2XV4S 5L3BA 4BY1J 2DU9A 3PNTA 1TWGJ 1W5SA 4UVCA 2KP6A 1ZRFA 5CVRA 3J80K 3HSRA 1E17A 1LDJA 4N4NB 1X3WB 1OCOH 1VQ8I 1VQNI 2K5CA 2FE3A 3OYJA 5EZHA 3IKTA 1IN8A 1SFKA 2M0CA 3HHHA 3JRHA 1HXDA 1WPKA 2IGKA 4RGSA 1Z0XA 4WWCA 3PUFA 1JJ6C 4MEXF 3BLYA 3BG9A 4FETA 4E7LA 2FUG2 2M87A 4Y3OA 2PLYA 2KDZA 3GZNB 5BMZA 2YSRA 1I6XA 1UHSA 3GFMA 2H8WA 3OYEA 3GX4X 1W7PB 3MEXA 2Y75A 3QRFF 5JHFA 2EV5A 4U0VA 2HDWA 2HNHA 4G8XA 3VYUB 4FX0A 1Y8QB 2FQ3A 3HL2A 2EFOA 3QP6A 4CCJA 4XLPF 1VF9A 5KK1A 2LVSA 4PJLA 3RSNA 3GZ6A 2V9KA 2VL8A 4CSWA 2MC4A 3KP6A 4U87A 2XASA 3EGVB 3RDIA 1LFBA 3GW2A 4BYYA 1A04A 1XSXA 1VQLI 3DPUA 2E1MB 4NBQA 1FOYA 2XB5A 2CFOA 4XQFA 1ZG1A 1D8KA 2HTSA 2HOTA 2LY2A 3ISPA 3SZTA 3L2VA 4IRHA 1ZELA 2DPDA 1S3JA 1QZEA 4XLNF 2JA6J 2IW5A 2FNAA 3DP7A 2RQPA 2GWRA 3R0JA 4Z2YA 4UUSB 4WX9A 1OYWA 2KFDA 1E3PA 1ENHA 1J59A 2BE5F 3I0TA 2IA2A 4CYCB 3RI4A 5JLWA 3E5UA 2HXOA 4S0HB 2WADA 3LSGA 2CQNA 2IGMA 4XBFA 3TQNA 1IN4A 4P55A 3OYDA 1XN7A 3KLNA 2IXSA 2CO5A 1AA7A 4N9IA 2COMA 3TL4X 2EA4A 2FX0A 4PUSA 1J5YA 4EJWA 1B4AA 2ZJ2A 2X0LA 4NQWA 1USSA 2R7WA 3SFIA 1P2FA 2DT5A 2AHQA 3L2UA 2ZKZA 3CTAA 1PP7U 5ICGA 5L3EA 3OY9A 2K27A 4XMYA 2B0LA 3H9QA 4S05A 2Z5UA 1B9NA 1O7LA 2DQRA 3PQKA 1CQTA 3BR1A 2GBYA 4M6VA 1V4RA 3LOCA 1XMKA 2H1LA 4RAZA 2DN0A 1WQ2A 2EB7A 5E3NA 3K1NA 3PO2J 1TQIA 2DLLA 5DM7F 3H9GA 1IAWA 4LIVA 2V1UA 2ISZA 4ZH4F 3BCBA 4IHVA 1MMNA 2IP2A 3HRSA 4HX8A 3OS0A 1SC7A 1DU6A 2NS0A 2R0QC 5D4SA 1BL0A 3X2QH 1O7FA 3DPTA 5IT3A 3JRIA 3K4JA 1D3YA 2IA1A 3I54A 3CUOA 3S1MJ 2DMQA 1YW7A 2W57A 1KYZA 2PMHA 5JFRA 3KYLA 1YIJI 1P9QC 1Y0UA 4FCYA 2P7VB 1ONVA 2W24A 2K4JA 3L00A 3TO9A 2L9SA 1MJ9A 4KIFA 4A3EJ 1BN5A 3BP8A 1I5ZA 3A02A 3I71A 4O3MA 1K4SA 1XB4A 2AQFA 2CW8A 3FF5A 2R7RA 1P4AA 4YIFA 4U0YA 1HDDC 4UNOA 1X3ZB 2HWVA 3S1QJ 3ZMUA 4Y17A 5DCMA 2CUJA 4B09A 4TV7A 2VBXA 1V5FA 1ETYA 2VPRA 4EV0A 5E17F 1SFUA 2WY7Q 4RGXA 1X19A 3CUQB 1RNLA 4A12A 4HYEA 3S1NJ 2M7AA 2W48A 2M30A 1U5TA 4OOIA 5HDKA 3ZQ7A 4CYDA 4RB0A 3L1PA 2HYGD 2LTPA 1BOAA 2ZCWA 1N78A 1ETQA 4MQVA 2F4IA 4QIWN 3F8FA 5J47A 4U7DA 2ZSIB 1HLVA 4X6AJ 1X3UA 1KA8A 2A6HF 2L02A 4CCLA 2Z33A 3V8KA 1K78B 3P9KA 3DBLB 2HQRA 3BDDA 5ICCA 1MGTA 2JPCA 4LFUA 3M9AA 4Q4ZF 3I9V2 2JTVA 2JJ7A 3D1NI 2ICWG 1UG0A 3G1LA 3E7LA 5HLIA 1RPWA 1LB2A 4XRSG 3OYFA 3ZGKA 3B02A 2O9LA 2X85A 4OMZA 1YITI 2R92J 3FXQA 5LEKA 3P9IA 1DUXC 1E2XA 4LLLA 5HS9A 3K70C 2CV0A 2BVMA 1XGMA 1F36A 2CRGA 1XSVA 3PFIA 4M3DA 1RUNA 2K86A 1A35A 3M8JA 4BQOA 5FD5A 2WAQN 3GCMA 1FMVA 4OWRB 1G4DA 1EJ9A 1ZRDA 4L0ZB 3RZDJ 3VOEA 2HGCA 3WE2A 2L9RA 1ZTRA 4BQAA 2ZSHB 4HDVA 3SDBA 5FKKA 3OR1C 1ZLKA 4C3HJ 2LKSA 4JYKA 1OMIA 4IOCF 4G6QA 3QPHA 1TZLA 4MNUA 2OUMA 3K0LA 4G6DA 2X6OA 1S7AA 2L9NA 5EYRA 3HPHA 2ZFUA 1V5GA 4AD9A 4JQFA 2EK5A 3E5XA 4D5CA 2ZBKA 3WU0A 2P5LC 1FYLA 2PJPA 1P7IA 2K9NA 2QQ9A 3D5RC 2XAJA 1QPIA 5GPCA 1K83J 3QU3A 2W82A 1S8NA 3S15J 4P5OA 5EZGA 2NOJB 2Y0MA 1QNTA 5CLSA 3TO6A 4HEA2 3ABMH 5B1BH 4BEHB 3JRDA 2F5VA 3O8HA 3N4MA 3ZMZA 3MD2A 1OCTC 2X6XA 4L5IA 4GFBA 1FWZA 3JTGA 5C3EJ 2ZXHA 5F1RA 3HJEA 3A1YA 1NK2P 4RLFA 3E5QA 3CJTB 2X9DA 4A93J 3MZ8A 1UHWA 2DA1A 4KMUX 1UCRA 3E1SA 3FXOA 5IP7J 3L7WA 3LSJA 1QZZA 2RDPA 3I64A 3K4NA 1MMDA 2DA5A 2DO7A 4WXHA 1SFOJ 1YS7A 4XONA 3C3WA 3AG3H 2DMTA 2HZTA 3E3VA 2O5RA 3C2HA 1G3TA 2P81A 1TQPA 2F4MB 2L7ZA 4ZYAA 4F7ZA 4BDZA 2JQ7A 2CH0A 4A3KJ 1OYIA 4OMYA 3S3OA 2R4GA 3OYBA 1MZBA 5IYCJ 5K1YA 4A3CJ 2RV8A 1T6SA 3R4KA 1QGPA 3I53A 2EZKA 3E0JB 5FD6A 4YG2F 3IV5A 4XLEA 1VQMI 2NXNB 5HLTA 3OYHA 4M3EA 2KRCA 1YFHA 3IHUA 4LB5A 1WWXA 5C4XJ 5IT9Z 4AC0A 2O7OA 2VKHA 4OINF 3JCUC 4OU0A 3ERED 2BXYA 2FOKA 4B1RA 2L4AA 1HDPA 2B63J 4G7HF 1LDKB 2KIQA 2CJJA 3SEZA 3OYKA 4I98B 4N9HA 1LJ9A 1VQ9I 3QWLA 2E36A 4A0ZA 4BXUA 5L3DA 1JJ8C 2W1OA 2LC2A 2MABA 3QP5A 4IHSA 2XGDA 3I58A 4DZJA 1X2NA 1K4TA 1IF1A 4HPQA 1RETA 5GADJ 2F5FA 3RPQA 1WVRA 1IXRC 4KITB 3V8LA 2RNGA 3LQRA 2K9LA 1BJZA 3LNQA 2CMPA 3CDLA 1RZ4A 1JE8A 2BBYA 4CO8A 3CUQA 2DODA 2L7KA 2VQHA 4DBRA 2V6EA 1X1CA 1EV7A 2F2EA 3E6DA 1R49A 2ZXWH 4PJMA 1R1TA 1BW6A 5J4VA 3Q0UA 1D0ZA 1R23A 3BG6A 2MFZA 4R8HA 3O8GA 2Y31A 4BH9A 5ICFA 5KAFC 4HRIA 4KJZA 2KISA 5K5OA 1K78A 1G6NA 1JXSA 2UV1A 2QUFA 3M3YJ 4GRIA 5E18F 2VOOA 3S3NA 1OJLA 5CPRB 4ZYGA 2VXDA 2O03A 4E7IA 1TBXA 4RB1A 1JT0A 1D5VA 2DYRH 2KT0A 2A6EF 2N8GA 3CP8A 4HA8A 3WODF 3S2HJ 1KGSA 3P5JA 5LGUA 3MQ0A 2EIMH 2XPVA 1ZQ3P 1C0WA 2I10A 4GO1A 1JUPA 4XNFA 4ITVA 4EM0B 1OCCH 3RTRA 1NG7A 2QKMB 1G8XA 4A3JJ 1Z3XA 2DYSH 4Z6YA 5FLXK 1USTA 3CCYA 1IXCA 2IS4A 4LG0B 3O6BB 3GTPJ 3ROUA 3OIPA 3D5SC 3F3XA 3U2RA 1T8IA 4AYBA 1OQYA 1SVLA 1ZKGA 4XN3A 1PUFB 1X4OA 1ZN2A 2FJ1A 1IJWC 2KKOA 3W6JB 4ZDLA 2VLAA 1WJCA 2X1DA 4ZZDA 3K9TA 1JUSA 3CZ6A 4GGGA 3HDDA 1MD0A 3KZZA 2OV7A 2BY1A 4CHUA 3CLOA 4HOBA 4A6DA 3FM5A 4KMFA 3HC7A 1SFXA 3HKZN 4L18B 2M4KA 2P8TA 4WXCA 3FK6A 5FB2A 2Q2EB 4E70A 1ULYA 2MW8A 3ZP5A 5B5EC 3BTIA 2A3SA 3TDUC 4D1QA 4UUTA 2QKLB 3IH3A 2FD5A 2QVOA 3I55I 2M8EA 2OJED 3PL8A 2EPFA 3ZQQA 4RA2A 5IPAA 4A0YA 2WA0A 1O57A 5JVTA 1FOKA 5FJ8J 1YW8A 1IW7F 1FIPA 1UJ8A 1ZRCA 1TT0A 2CS3A 1YHQI 3FKJA 1IRFA 1OPCA 2MBFA 1UZCA 5FLMJ 4A69C 4XLFA 2UZKA 3ZMSA 1IN6A 1JT6A 3G71I 1V3FA 4FE4A 3AL0B 4YIIA 4PSXA 5FKLA 1T33A 2V1NA 4GYGA 1H89C 1Y1WJ 2D5VA 1M1EB 1J9IA 2WAEA 5JVGF 1ITYA 4PDKA 5LGTA 2DFHA 3E6BA 4HQMA 3ERMA 5BQTA 3BWGA 5CVJA 3F6VA 2HVRA 2FOWA 3MWMA 4ESFA 4L0YB 3CMYA 2VC0A 2STWA 2A05A 4BHPA 3FMRA 5LRSA 1OCPA 3KIOA 1GDTA 3RKQA 2HEOA 1GT0C 1U8BA 1ZGWA 2GA1A 3J80Z 1YOVB 3K1MA 2OZUA 3W2VA 3BG5A 5DEQA 2IS6A 3MMYB 2OC6A 3WG7H 3VODA 5FRMA 4IHXA 2CG4A 5FLVA 1MDMB 4YEJA 1FTTA 2M5WA 1H9TA 2VN2A 3F72A 3DBRB 1XMXA 2LSOA 3I3LA 1B1BA 5IP6A 2R7VA 4OIPF 3JRBA 4OAZA 2FSWA 4HZFA 2BOLA 1R1VA 2FXAA 3I5UA 4EJVA 4AM3A 2OTJI 3H3ZA 1SEUA 1FOXA 1ZG5A 2Y0SN 3ZMDA 3BQYA 3CF5F 1TT5B 5TJJA 1WGXA 4KICA 4V2GA 5ICEA 4A3MJ 3DLAA 1XDUA 3WG9A 4AVZA 5CVVA 1I1GA 1OFCX 2TDXA 5F27A 3IL2A 1QA6A 1R5GA 1XPXA 5H6RA 4ZDPA 4CCMA 3EUHC 3SYTA 2E60A 2QEXI 2PG4A 1FYKA 3VSLA 2NOGA 3ZQGA 4Y52J 1EA3A 3P7NA 1HBXG 1BI0A 2HTJA 2ME0A 1POGA 2JVGA 2HYFA 3ZXSA 1SAXA 3OS1A 1YX3A 2C6YA 3BZKA 3A03A 4HF1A 4GYIA 4BHCA 3BJAA 2OQRA 1YG2A 5ERIA 5EEAA 5D5UB 2CYYA 4X0GA 2V4JC 1WH7A 2OBPA 5HDNA 2EA2A 1O3TA 1BA5A 2ELKA 4JOMA 4ZC3A 4ANJA 5F6FA 2ZNYA 2DK5A 3AKZA 2Q8KA 1S29A 2LOOA 1VQKI 3EETA 3PIOF 4XR6A 3RCOA 2LY9A 1JGSA 2GLOA 5J1RA 1O3RA 3IKVA 3LL7A 3U21A 5EGOB 1A36A 2GIVA 4C2UA 2DQLA 2V6CA 3ZCOA 2EFQA 1UFMA 3CMAI 1FIAA 2CGPA 1GLNA 2XF7A 2DT6A 1IN5A 4MQ9F 1W0TA 2X6WA 4BJ6C 4KDPA 2RNJA 4U88A 4CCKA 2P6SA 3KYCB 1TWHJ 4KUMA 4E7JA 2VQGA 3FX3A 3A0HC 4UV9A 1MKMA 3I4NJ 2ELHA 2ZXIA 3HTUA 4A3GJ 1MNEA 2PBIA 4LLGF 4IO9F 3CCLI 3G3ZA 1ZR4A 3JREA 2BGCA 1FP1D 1YI2I 2CFXA 1QPMA 5B66C 3GLLA 3MZYA 4YFNF 2WB1A 5TGTA 1BR2A 5HLHA 3OS2A 3JRCA 4C3IJ 2IS2A 2DTZA 2IS1A 2CW7A 3HGYA 2D2WA 2QGUA 2KHMA 4HX4A 2LBFB 3RYPA 4B48A 1TNSA 1IXSB 3AG1H 3HBLA 3OYNA 3CP2A 3V42A 2H09A 4Y15A 2BY3A 5GAEJ 3W2WA 4V19K 4JK1X 2DT7B 2D1VA 2R7ZJ 3HOXJ 2DFFA 3M7GA 4PJ0C 3ONQA 5HOOA 2F5EA 2LY1A 1EKEA 3OOUA 5K7ZA 1ODDA 1U78A 3S32A 3CF2A 2KIFA 4QPOA 1TC3C 4QSHA 3IWZA 3IUOA 4QWQA 3PO3J 3NAUA 1DPRA 2UUZA 1MBKA 2CW0F 3BT9A 1ACIA 3DEEA 3KYDB 3BQZA 3FXUA 4U7BA 3S1RJ 4RMNA 1W5CC 2WC2A 4L5JA 3LSRA 2E1NA 2VIXA 5E1XA 4I0AA 3WGHA 3M8FA 3BJOA 3F6OA 5DS9A 3VYTB 1MBHA 2HR3A 1EH6A 2UXXA 4L9TA 3CC2I 1N75A 1JTYA 2FQ4A 4NNJA 1X4PA 1WFXA 5D5VB 1YTYA 4KFCA 2XPWA 3RJPA 1B72A 2GIZA 3GTLJ 4B3XA 2DMUA 1HW5A 2JWTA 2WWYA 4PK4A 1UG2A 4A3LJ 1RESA 1QQIA 1JUMA 3S8PA 3BG7A 2ID3A 2O3FA 4I01A 1U2WA 3GYHX 2FA5A 1MDMA 3S2DJ 4XSZF 1GVJA 3FDYA 1OYYA 3PQJA 3Q3SA 2MH2A 5HNFA 1BC7C 2MC3A 3A4CA 3BZ6A 4EMSA 2LG4A 2DPUA 2IRFG 2DK8A 4YFXF 2CUEA 3DKYA 2DA7A 3EYYA 2CV2A 1RRJA 1T95A 2CSOA 1G2HA 4DGWB 1FZPB 4JP0A 3OV8A 3JRFA 1ERDA 4HSTA 2LREA 2E35A 3CMEI 1BC8C 3ESWB 2FNPA 3K69A 5E20A 2HS5A 2XGCA 2D45A 1MIJA 1WRJA 4I0BA 3DBHB 3VFZA 1S72I 1ZAOA 1X1BA 4KA4A 2W25A 4EGYA 5DV5A 1ETOA 1SVMA 2PMZN 3GLXA 2JUCA 3HOYJ 1KU7A 1T0FA 1K6YA 2Y2ZA 3GZ5A 4BQQA 1IRGA 3ECHA 3GVAA 1DGWY 1FEXA 2UXNA 2EQRA 2ZMEA 3OYMA 1I3QJ 3KP5A 4RAGA 1KU9A 1ZGAA 1RR7A 2E71A 4UY8I 2FF4A 1Q1VA 3V8JA 1VQ7I 4LGWA 4RGUA 1WI3A 3K4BA 1RUOA 5L3FA 3LSIA 1VQ6I 3VYSB 2DDBA 3HIFA 3CCVI 2E7XA 2JSPA 5IOZA 1JTXA 5K5QA 2DJIA 2VKVA 2YR2A 5FKOA 5E8IA 2K02A 3DEUA 3DKWA 4F52A 4ENJA 1SD5A 4UHTA 1ETXA 1BI2A 2L3DA 5J3LA 3OYCA 3KEYA 1K79A 2F4OB 3DCFA 3TBIA 2BY0A 3F9KA 2YUSA 3K4KA 2RGVA 4PFPA 2R5YB 1MJAA 2JPBA 4LJZF 2CQKA 3OL3A 3V4GA 2RREA 2GOXB 2ZB9A 3HG9A 3JAMK 2P4WA 1Z7LA 3TMOA 3MFKA 4ENMA 4KT6A 2E19A 3HTSB 4KN7X 2OCCH 1HQCA 3I4MJ 1HSTA 3J7YJ 2J5OA 3QQAA 2QQAA 4IVNA 2R5ZB 3GFJA 4AWXB 4E6KG 3OYIA 2W7NA 3U9GA 4ZYHA 4L5EA 4XKVA 1FC3A 4A3DJ 5LEJA 2PQ8A 4CCNA 5F0CA 3QOEA 1W7PA 4V2FA 3J7AY 1MBGA 4BE0A 3DPLC 1U3EM 2QLZA 3HSEA 3UR3C 3DF8A 2ZJQF 4I09A 1X2MA 4FQGA 4ZTFA 4JBAA 2VJIA 3KLOA 4XIDA 1OKRA 3WU1B 2PEXA 3Q9VA 5C44J 1H88C 1HCRA 1XCVA 3S3MA 2PX9A 3LSMA 4YRVA 5J8CA 2LBFA 3J81K 1R00A 1MBFA 2OZ6A 3GF2A 1TWAJ 4MGRA 3WTWC 3CESA 2DW4A 3GXOA 3M1EA 1G3SA 4XSXF 2XSDC 4XOTA 1TNTA 1FBUA 1N25A 4IHWA 3FBNB 1ZHFA 4PGGA 3MKWB 2XAQA 3GUDA 1D1AA 1FY7A 5FRNA 3NRVA 3S2WA 4KYWA 1P7JA 2XAHA 4EJOA 2L4MA 1FOWA 2X51A 3B6CA 3IP4B 2O8KA 1Y6IA 2YPRA 2YX7A 2DI3A 4Q5SF 1FMWA 3HRUA 1F43A 2ECBA 5CQEA 1FX7A 5EEHA 4UUSA 2FEZA 1PP8F 4NHJA 3J7ZI 3FM3A 2XKPA 3HOVJ 1MSEC 4CYCA 4UVAA 5A2QK 1YQAA 3ZR8X 4Y4RA 1R1UA 2BV6A 1YIOA 1ON2A 4XLAA 1XTAA 4MEYF 3ECOA 1B8IB 5J40A 2VT2A 3K6GA 1IC8A 4RAYA 1UB9A 3OYGA 4DYRA 4I99C 1NHAA 4XLHA 4IQ4A 5E1WA 1CGPA 2BHYA 4RLQA 1WHUA 3DKXA 3A0BC 1U8RA 3I59B 3H0DA 4JX4A 3TKYA 5F04A 1IRZA 3RZOJ 3LAPA 3QYFA 1Q1HA 3HEFA 5H20A 4IHTA 1QRYA 2R7DA 1J2XA 3SFZA 2EZHA 4PJNA 4CXFA 2ZJRF 3RKXA 3ML6A 1TW2A 5TRDA 1R71A 1JHFA 3H92A 4NC6A 2LR8A 4J19A 2GZWA 2OPTA 5DCFA 2O6GE 4XRSA 4A2UA 1KQ8A 4HNUA 2VBZA 2IPQX 3G2BA 4E7ZA 4Q48A 1I39A 2QBYB 1MJBA 1AKHB 2EFWA 1JKOC 2OU2A 4HG2A 5E3MA 2VE9A 2LH9A 3WTXC 1TP4A 2L01A 2MH9A 2BHZA 1HKQA 2TRTA 5TISC 2LMDA 2EILH 4M74A 4ZJZA 4L9NA 2ZNZA 4LG3A 5D8LB 3BROA 2QZ8A 3K10A 4M9SA 5FLXZ 2K3PA 2VC1A 2YX4A 1LEBA 3UNGC 3ABLH 1O4XA 4GCVA 2YU9J 2G7UA 4WCGA 3DLLF 2EH3A 4EVIA 1W7PD 5GAGJ 1D1BA 4N4OB 1A6IA 3L09A 3H3UA 2HFHA 3T1BA 3HRMA 2HZDA 2KLOA 3SZPA 2M45A 3SXYA 5F1JA 2PMZA 1K61A 4R1HA 3WTZA 3K4LA 3KE2A 3WTTC 1LQ1A 2GM4A 3S16J 2VJJA 3HPGA 4EM1A 2L9VA 2YS9A 3PM1A 1UMQA 2K9SA 3BR3A 3KFWX 1RI7A 4ETSA 1P4WA 5HLGA 4KISA 4RAFA 3HOSA 5K7FA 4DYQA 3E6CC 1N77A 2R5YA 2P6TA 2EZLA 3H0GJ 4DQ2A 2PJRB 3R60A 3DTEA 2HQ5A 1EF4A 2W84A 2VOPA 1E3OC 1LVAA 2ADUA 1F5TA 5EEGA 1XMAA 3WTVC 2ID6A 2R5ZA 4FHTA 5EG0B 2ZFWA 2DOFA 1OCZH 2R7FA 1BOBA 4C9YA 5IOYA 1NTCA 4HF2A 4HQEA 1I6HJ 1IO2A 2XRLA 4XN0A 3JSOA 2E2IJ 4UXNA 1YYVA 2X6YA 3GTGJ 1P4XA 1SD7A 1OR7A 1PYVA 3CCRI 3G1OA 1FYMA 1Z21A 1W36D 1FTZA 1T2KA 1GVDA 4M3BA 3UKGA 1IUYA 2H94A 2YU3A 1Y1VJ 2JA2A 3REOA 3BG3A 3NEUA 4IF4A 3OIQA 4ZDOA 4FISA 5AIQA 1Y0NA 4BDYA 4XRFA 3GBGA 3K70D 2Z99A 4BU2A 3HYIA 4EJUA 2HOSA 4KNYA 4RGRA 2QYOA 5GP9A 1R5HA 5J1UA 4AIJA 4C3JJ 3ZQLA 4IZZA 3OR2C 2FMLA 2TCTA 5JHUA 4F55A 2FBHA 2MGQA 4MFDA 3V7SA 1I50J 3EQLF 3SQNA 1JKPC 1LKXA 3PSIA 4G7ZF 2OTLI 5ILSA 2R7QA 2WAQA 1RIOH 4IOAF 2RKHA 1ZYRF 3MKZA 2IJLA 4A0XA 5KAIC 2DDAA 1MH4A 2KRFA 1W4MA 3BOQA 3GO5A 2NAZA 4BEHA 3LA2A 3DU6A 1HW1A 3LWFA 2XAGA 1XDSA 3WTSC 1W1WE 2MLGA 1B8IA 2BYVE 2DBBA 1PJRA 3H35A 2CQXA 2HI3A 2X4HA 3M07A 3KX2A 2H27A 1FT9A 3QPSA 1R4MB 3HOUJ 5HNHA 1HW2A 2VXZA 2FBKA 2K85A 4M9XA 1YW9A 2R7SA 1KQ9A 4HBLA 2XHKA 3I59A 3BC8A 4XK4A 3TEDA 3BR5A 2OD5A 4S04A 1WSUA 3FKIJ 2V7FA 1BI1A 3HGGA 3QODA 1ZREA 2QQBA 4AVPA 3I4PA 1NH3A 5CVUA 3CCJI 5HVQC 3LSTA 1IUFA 3C7JA 4G94A 5K5RA 5D5WB 2F5DA 3CD6I 5DM6F 4RB3C 1IN7A 2EWNA 3VWBA 3PIPF 1GUUA 1G59A 5KHDA 3NARA 1TTYA 4BE1A 2HPMA 3CJRB 2QBYA 1AKHA 1BBYA 5DUIA 3OWTA 4E7KA 2HXIA 3ZOBA 2DMNA 4ASNA 4MFEA 1R7JA 2JT1A 1YS6A 2FMYA 3MZHA 1B59A 3HZJA 3ZQFA 4F93B 5DYMA 4BXFA 3MVPA 2STTA 2DAOA 2VB6A 1JKRC 1IV6A 1IGNA 3VB2A 1XGNA 1LDDA 1D0YA 3K1PA 3Q0VA 4HW0A 4CZZA 5EJCA 2IGOA 4RB2C 2GOMA 2NYXA 3B6AA 4HV6A 2ELJA 4XICA 2Y9ZA 1XSDA 4BNCA 2Z16A 4M3FA 3Q5FA 2NNNA 3F8CA 3IWFA 2A68F 2G7HA 2IVMA 1YJWI 4NQWB 3W2AA 3U1DA 5LHHA 2E1CA 1R36A 2NVQJ 2GQQA 1T56A 2OF7A 4G9YA 2Z1DA 1SD6A 2B7EA 2IBDA 3C1DA 4WXDA 1YLFA 3LAJA 1NK3P 2I8DA 2HKOA 1SAUA 3HOTA 3FBIB 1G3WA 5KNLA 3WGGA 3QU6A 3KCCA 2MLKA 2VKDA 1ZARA 2AS5F 4MHGA 2CQ7A 4XL9A 3CC7I 3K4CA 2ACJA 1BW5A 3SHFA 3F0CA 4RM2A 1U9OA 3R6SA 3FXMA 4Q47A 2PJRA 4J00A 4B47A 1Z1DA 5ED4A 1GV2A 4II3A 4FTHA 3KETA 3DEWA 4LOCA 2OCEA 2XF5A 4LIUA 5M3MJ 2KQRA 2V26A 1IZ1A 2MA3A 1AWCA 2E5NA 4I02A 4U0WA 5CJ9A 3OSGA 2EBIA 1J09A 4ON0A 1D0XA 3OYAA 2V9PA 1OCRH 3VEPA 2W4SA 1LEAA 1XC5A 5ILVA 2V9VA 4YIRX 4F92B 4ESJA 2ZC2A 3R0AA 2JSCA 4PFOA 1XD7A 1J0RA 1X1AA 4KIGA 4XRMA 4IJAA 3RKWA 2EV0A 4IX7A 1L0OC 3CQZJ 4BE2A 4DW6A 1WJBA 3ZRGA 2K9MA 3WHBA 5L3CA 1SVOA 3KP2A 5F0HA 4LG0A 3JRGA 3CCUI 2KZVA 2JA7J 2CV1A 3NQOA 2KL4A 2A5YB 3JSPA 1PUFA 2J5PA 3OIOA 3FIWA 2R7XA 3PSFA 5DUKA 1AHDP 1X1DA 3E6MA 1Y39A 2P5KA 2CQQA 3BPVA 1VNDA 1VZ0A 2CUFA 2VPLA 3DWLE 1Z3YA 3GFLA 3LA3A 4NDLA 4D7NA 3HUGB 2BW3B 1LVKA 1KZHA 2Z9OA 5FKNA 1LPQA 1VQ5I 5M5WJ 1LFUP 3FHZA 2DFIA 2BEOA 2G9WA 3F8MA 4B43A 2QENA 4HAMA 1MNDA 4CZCA 3HOZJ 3LSPA 1HKSA 4MTDA 2LF7A 3LSKA 4GDFA 2Q2EA 5D8KB 4CCOA 2O0YA 2QQ8A 2Y48A 4BAYA 1U0JA 3TW7A 4D5FA 3FMQA 4YFKF 3JRAA 2X1EA 3EUHA 1HA8A 2RN7A 3K4MA 2NVTJ 4W97A 2HVSA 4HF0A 4B44A 2LK2A 2NVXJ 1KYWA 4OIOF 1BJAA 1S9HA 4OIQF 5LGNA 3TGNA 3HKZA 4HX7A 1HOMA 1QHHD 3OMYA 4EJTA 2JMWA 3CCSI
chains in the Genus database with same CATH topology
3CC7I 2E34A 1YHQI 2ZJQF 1YJ9I 3DLLF 5GAGJ 1YIJI 1VQKI 2H8WA 3PIOF 1VQ4I 3G71I 3CCMI 1WIBA 1VQOI 3CMAI 3CCQI 2QA4I 3CMEI 2E35A 5JVGF 3EGVB 1FOWA 1VQLI 5GAHJ 3CCJI 1FOYA 1S72I 2FOWA 3CJTB 3J7ZI 4IO9F 3CCLI 1YJNI 3CD6I 5DM6F 1YI2I 3CCUI 3PIPF 2JQ7A 3CJRB 4UY8I 1Y39A 1VQ7I 2K3FA 5GAEJ 3CCEI 1VQ6I 1VQMI 3I56I 2NXNB 4V19K 2OTJI 1VQ5I 3CCVI 1MMSA 3CCRI 1FOXA 3CF5F 2ZJRF 1YITI 2ZJPF 1YJWI 3G4SI 1VQ9I 1QA6A 2E36A 1ACIA 2QEXI 1HC8A 3G6EI 3CJSB 5DM7F 5GADJ 3J7YJ 4IOCF 3CC4I 1VQ8I 1VQNI 3I55I 3CJQB 3CC2I 2OTLI 1VQPI 3CCSI 4IOAF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 I;  2E34 A;  1YHQ I;  2ZJQ F;  1YJ9 I;  3DLL F;  5GAG J;  1YIJ I;  1VQK I;  2H8W A;  3PIO F;  1VQ4 I;  3G71 I;  3CCM I;  1WIB A;  1VQO I;  3CMA I;  3CCQ I;  2QA4 I;  3CME I;  2E35 A;  5JVG F;  3EGV B;  1FOW A;  1VQL I;  5GAH J;  3CCJ I;  1FOY A;  1S72 I;  2FOW A;  3CJT B;  3J7Z I;  4IO9 F;  3CCL I;  1YJN I;  3CD6 I;  5DM6 F;  1YI2 I;  3CCU I;  3PIP F;  2JQ7 A;  3CJR B;  4UY8 I;  1Y39 A;  1VQ7 I;  2K3F A;  5GAE J;  3CCE I;  1VQ6 I;  1VQM I;  3I56 I;  2NXN B;  4V19 K;  2OTJ I;  1VQ5 I;  3CCV I;  1MMS A;  3CCR I;  1FOX A;  3CF5 F;  2ZJR F;  1YIT I;  2ZJP F;  1YJW I;  3G4S I;  1VQ9 I;  1QA6 A;  2E36 A;  1ACI A;  2QEX I;  1HC8 A;  3G6E I;  3CJS B;  5DM7 F;  5GAD J;  3J7Y J;  4IOC F;  3CC4 I;  1VQ8 I;  1VQN I;  3I55 I;  3CJQ B;  3CC2 I;  2OTL I;  1VQP I;  3CCS I;  4IOA F; 
#chains in the Genus database with same CATH topology
 3OOP A;  3HRT A;  4MO7 A;  1R4N B;  3EPZ A;  3S14 J;  2VT3 A;  5D5X B;  2O61 A;  2RAE A;  1K7A A;  1XG1 A;  1YJ9 I;  3A2K A;  3KZY A;  2A61 A;  3CLQ A;  1UHM A;  4PGH A;  3HB9 A;  4LD5 A;  5FFZ A;  1T0F C;  4LK1 F;  4QTR A;  3H5R A;  4M6Y A;  2WY8 Q;  3CCM I;  2DOE A;  4G12 A;  1FJL A;  2M8G X;  2XAU A;  3CDI A;  2W00 A;  4RBO A;  4BBS J;  3C18 A;  1AOY A;  3FXR A;  2FBI A;  2VJ4 A;  4RM3 A;  1FP2 A;  2ZME C;  3TDZ C;  1S5L C;  1K6O A;  1WJF A;  3D0S A;  3BPX A;  5E1Z B;  1OIS A;  3VSK A;  3GTJ J;  2CU7 A;  2NVU B;  4B4C A;  3C2B A;  2IAI A;  1J7K A;  3QYB A;  4JX6 A;  4M3G A;  2PI0 A;  3H9J A;  4NUB A;  1FNN A;  4HNT A;  3IRQ A;  2M4G A;  3JAM Z;  5EF6 A;  3GEZ A;  4BHB A;  4Y33 A;  1XCB A;  4DYC A;  1A5J A;  1O3Q A;  4B8X A;  2V1D A;  3OSF A;  3LFU A;  3F23 A;  5FFX A;  5J1Y A;  1U5T C;  1HF0 A;  2P0W A;  4FAS D;  4AIK A;  4AU7 A;  2KPM A;  3JW4 A;  4IRI A;  1JHH A;  2Z3Y A;  3BZC A;  2DA6 A;  1E3H A;  5DDG A;  2LD5 A;  4ZTJ A;  1LFP A;  2VI6 A;  4I7H A;  4P9U A;  4R79 A;  2F48 A;  1XGS A;  1ZK8 A;  4A5M A;  2B9S A;  2XGE A;  1ON1 A;  2WV0 A;  3GTO J;  5FKM A;  1EH8 A;  2AO9 A;  4DNC A;  4IRG A;  2DA4 A;  5L3G A;  5F0F A;  1SD4 A;  1R9T J;  3VDX A;  3IH4 A;  3WTU C;  5H6Q A;  3HHG A;  1IG7 A;  3J81 Z;  4O5V A;  2DCE A;  1YE9 A;  3N05 A;  2E1O A;  1TW3 A;  2QM3 A;  2E2J J;  3C2G A;  3TP3 A;  1TLH B;  4BKX A;  4B3A A;  1CF7 B;  1JI8 A;  2AQE A;  2AXT C;  2L0K A;  4FT8 A;  3H36 A;  2H1K A;  2JA5 J;  1Y8R B;  4N0B A;  3EUA A;  5AON A;  4XKC A;  5HDG A;  3TO7 A;  1FSH A;  3L2R A;  1ETW A;  2Y0S A;  1DQU A;  2BXZ A;  3MKY B;  1AU7 A;  4EEF G;  2EIK H;  2RC4 A;  2XPU A;  5A2Q Z;  3H3V K;  2WBM A;  2XC7 A;  1DGR M;  1E0E A;  1WKM A;  3E97 A;  2GXG A;  2AXL A;  2E1M C;  1I27 A;  2KRH A;  5E79 C;  5BOX A;  4MLO A;  5CYV A;  5GTI C;  4PSW A;  1L3L A;  1FBS A;  3Q0W A;  5HS7 A;  4Y7N J;  2LLK A;  5EGO A;  4A3F J;  4RS8 A;  3BR0 A;  2ISY A;  4HSR A;  4A3I J;  2E2H J;  2R7U A;  5E3O A;  5LLQ A;  1LE8 B;  4DZP A;  1SMT A;  2M0M A;  2PMU A;  2QWW A;  3WU2 C;  2I5U A;  3T0Y A;  2DTR A;  2EJR A;  1MMG A;  3W6K B;  4UB8 C;  1B9M A;  1Z05 A;  1KU2 A;  2L5Q A;  3HUG A;  3CO6 C;  2BW3 A;  1GHC A;  1TWC J;  1KON A;  2BVL A;  2ME6 A;  4HNV A;  4RDU A;  1T39 A;  4MIM A;  4BY7 J;  3WE3 A;  2VUM J;  1ZR2 A;  2PN6 A;  2EFP A;  3AG2 H;  1BIB A;  5LHG A;  3HXL A;  1MMA A;  3A01 B;  3GME A;  2VKE A;  1W36 C;  1ZH5 A;  3GFI A;  2DJN A;  3AAF A;  5D6E A;  1R22 A;  3WHC A;  4AYB N;  1EH7 A;  5HOD A;  2R3S A;  1Z7U A;  4LLN A;  1KU3 A;  3RKY A;  3FK7 A;  3RPU A;  5BPI A;  1FSE A;  5CKT A;  3F8N A;  3JTH A;  2GA2 A;  4JX5 A;  3RIR A;  4C2T A;  1RKW A;  5D4R A;  1BIA A;  3RQ4 A;  2VAS A;  4E4H A;  5F08 A;  2UWM A;  1BR1 A;  1P6R A;  2BY2 A;  3KP4 A;  3S93 A;  5B3S H;  4J01 A;  3QYE A;  2ZO4 A;  4HLY A;  4C2M J;  4ENN A;  4A3B J;  3CO7 C;  2V79 A;  3LQQ A;  2HYJ A;  1ETK A;  3I56 I;  4UV8 A;  4WK8 F;  1HKT A;  1V55 H;  2MSY A;  4BAC A;  1MMS A;  2OQG A;  2IEK A;  4A5N A;  5K7H A;  2KIU A;  2ECC A;  2M9H A;  2QCO A;  1GXP A;  1MW7 A;  2H8R A;  4X1E A;  2MYS A;  2HOA A;  1XGO A;  3K2A A;  2G0E A;  4LMY A;  4ZYD A;  3FZV A;  1U6G A;  2H6B A;  2R7O A;  3ABK H;  3BTC A;  4YEL A;  1XS9 A;  1JGG A;  2HDC A;  3EYI A;  1HC8 A;  2NS8 A;  3ZQI A;  3B73 A;  5LFA A;  5GPA A;  2XSJ C;  3G6E I;  2HDD A;  2GXB A;  3CJS B;  2HVQ A;  2HQA A;  1TWF J;  3SEQ A;  1G3Y A;  2XDV A;  3QOP A;  2LRD A;  2RQQ A;  3L2Q A;  2NRA C;  2DXI A;  1ZG3 A;  3NWS A;  3RQI A;  3CC4 I;  1QZY A;  1YRN B;  2JUG A;  2DFE A;  4GXO A;  5ILU A;  2KMU A;  1ZGJ A;  3HSF A;  2K7L A;  1A6Q A;  1GXQ A;  2H6C A;  3CUQ C;  2LF8 A;  3BR2 A;  1UEL B;  3FXL A;  2HU9 A;  5LRR A;  1RR8 C;  2XRO A;  4HV5 A;  4BL0 B;  4FX4 A;  4LIT A;  1FLI A;  4F91 B;  1MH3 A;  2O8X A;  2OA4 A;  3LA7 A;  4H0E A;  2QF7 A;  3O2P E;  5FO5 A;  3PFY A;  1WIB A;  1IDY A;  1BM9 A;  1T98 A;  2ETH A;  3T5X A;  2OAZ A;  5CQG A;  1WJE A;  5BNG A;  4G7O F;  3EUK L;  3F8B A;  3KP3 A;  4DIQ A;  3FXK A;  1RC9 A;  5GAH J;  4M72 A;  5LD2 C;  5M5Y J;  3L2W A;  3T8R A;  4IL6 C;  2LDU A;  3V7C A;  2R7T A;  3DTI A;  4IPA A;  1T38 A;  1CF7 A;  4PJJ A;  2XB0 X;  1REP C;  3FHN A;  2Y30 A;  5KVR A;  3LMM A;  3GTK J;  3PUB A;  2K9Q A;  4FE7 A;  3M1C A;  3ZN1 A;  4DJA A;  4DOZ A;  4W1U A;  2D1H A;  1OR7 C;  4BS9 A;  1H9G A;  4P96 A;  1Y56 A;  3D5L A;  2ESH A;  2JK3 A;  1PVE A;  3CJN A;  3MCZ A;  4D7M A;  2E7W A;  2FRH A;  1S6L A;  4HDU A;  3GTM J;  6PAX A;  2CUZ A;  1WCM J;  2HKX A;  3DU5 A;  9ANT A;  3TW6 A;  3RPU D;  1HSJ A;  1QVT A;  2K3F A;  1VFC A;  1P92 A;  4IXA A;  1V54 H;  1WI9 A;  3GWZ A;  3R61 A;  3CCE I;  2XRN A;  2M3A A;  4DBQ A;  2L7M P;  2KZG A;  2MD0 A;  3FMS A;  3PNY A;  3FWE A;  3DTK A;  2M1B A;  1B6A A;  3F22 A;  3IH2 A;  4KT5 C;  1V5E A;  2L2O A;  4PZJ A;  3QPL A;  1BI3 A;  5KCM A;  2QSH X;  5IY5 H;  2JRM A;  2V1X A;  2DOA A;  2LFB A;  4BJ5 C;  1LE8 A;  4QLC U;  2DA2 A;  4D9J A;  1BR4 A;  1IDZ A;  1H8A C;  3SDG A;  3U1K A;  4M6X A;  2A69 F;  2PFB A;  1D8J A;  2F5C A;  2FU4 A;  3OL4 A;  2IT0 A;  4K2E A;  2LNB A;  4AUX A;  2KIM A;  3W6V A;  1TQM A;  2A6T A;  3KPH A;  5LBQ A;  5EDN A;  2HOE A;  2VJ5 A;  4OIR F;  1LNW A;  2A07 F;  4A6E A;  1U9N A;  4EM2 A;  3A01 A;  1X1P A;  2IGN A;  4IKF A;  1VQP I;  2DMP A;  3DQV C;  2GAU A;  2XVC A;  4BJT A;  2EFN A;  3KP7 A;  3BY6 A;  5DD4 A;  2EIJ H;  4EAT A;  2KJB A;  2JZY A;  2VE8 A;  1FPQ A;  3N97 A;  2VBY A;  3KEQ A;  4LK0 F;  4F3Q A;  1WJA A;  3BJ6 A;  4I2O A;  1DU0 A;  2R93 J;  5IT9 K;  2EV6 A;  3K2Z A;  2P5V A;  3DFG A;  2XAF A;  5BPD A;  2LKP A;  3DXJ F;  3ULQ B;  3M4O J;  1R5I D;  1JKQ C;  3BR6 A;  5M5X J;  4ENK A;  3ZN0 A;  2P7C B;  1PDN C;  4BQN A;  4P9F A;  2CWE A;  4CH7 A;  4CUG A;  2QA4 I;  2VON A;  1YO5 C;  1ZLJ A;  5JLX A;  2EZI A;  2JVH A;  1RKT A;  1PUE E;  3ZQH A;  4II2 A;  2X48 A;  4AID A;  2WB1 N;  2DA3 A;  1TL8 A;  2KDO A;  2LP0 A;  3V7R A;  5IYD J;  3MAJ A;  5BS6 A;  1MBJ A;  1QBJ A;  1Z91 A;  2F6C A;  3Q9S A;  3LSH A;  2JRT A;  3COA C;  4H4K C;  1F9N A;  1YJN I;  4IQJ A;  5E8G A;  2VQL A;  1W5T A;  5DTD A;  4WF2 A;  2VOD A;  2VBW A;  1X58 A;  1APL C;  1IRX A;  1QHG A;  4XOR A;  2W85 A;  1DPU A;  3L2C A;  3CDH A;  4G6T B;  1Z67 A;  3PJR A;  1KQ0 A;  1SFE A;  2K40 A;  4Y13 A;  2WV1 A;  2QSG X;  2JN6 A;  5AIP A;  4QPQ A;  5E3L A;  4EGZ A;  1A31 A;  1YRN A;  5IYB J;  3AFH A;  2QSF X;  3AG4 H;  1GV5 A;  3LFK A;  2EIN H;  4D0P A;  2XGX A;  5J6X A;  1MBE A;  1R6R A;  1D1C A;  1W0U A;  5CVI A;  1FBQ A;  4PCQ A;  1S7O A;  1DP7 P;  2HPI A;  4AIH A;  4M71 A;  4MTE A;  1LUJ B;  1SMY F;  3HM5 A;  1D5Y A;  1F4K A;  2ZXJ A;  3WGI A;  1VI0 A;  4XKW A;  2MG4 A;  2GXA A;  1T08 B;  4O6J A;  3L9F A;  2WAF A;  2ZJP F;  1MNM C;  3P9C A;  5IP9 J;  3G4S I;  1NG6 A;  2Z2S B;  2NVY J;  5LHI A;  1R58 A;  2M34 A;  3EDP A;  4LB6 B;  2XKO A;  5D6F A;  4UB6 C;  5J4Y A;  3H5A A;  3OYL A;  3O3K A;  3KEO A;  2XIG A;  4NC7 A;  5H2F C;  3ZMT A;  3J7A O;  4KIB A;  1YX5 A;  3CJQ B;  3CMM A;  4BUP A;  4XM3 A;  3BTL A;  3BCA A;  4CA0 A;  3HOW J;  4IEJ A;  4L9J A;  1Z9C A;  1WH5 A;  3FIS A;  4BBR J;  3BTJ A;  3SZG A;  2L54 A;  3VYR B;  2M7B A;  2Q0O A;  1Z77 A;  2WTE A;  3VPR A;  1WZ2 A;  1H0M A;  4BXX J;  3IAS 2;  4ZZL A;  2E34 A;  1Z6T A;  2Y69 H;  5JR3 A;  4UUV A;  3ABU A;  4UVB A;  4I6Z A;  1B72 B;  3T8T A;  2HQN A;  3TOA A;  1VQ4 I;  1XX5 A;  3FXJ A;  1UAA A;  3DV8 A;  3TP0 A;  4OAY A;  4XOP A;  4EQQ A;  5J8F A;  4IHY A;  3MN2 A;  1OLT A;  3S17 J;  2M2E A;  2Y9Y A;  1VQO I;  3SJM A;  3CCQ I;  3TOB A;  1MSF C;  1IV8 A;  1QVU A;  4NB5 A;  3QPT A;  2COB A;  3G1M A;  5FGM A;  3F21 A;  4E7S A;  1DP3 A;  2LYC A;  3IC7 A;  1QU3 A;  3WTY C;  1ETV A;  2RVC A;  3K7A J;  4CIC A;  5C4J J;  3M8E A;  1SAN A;  2X1C A;  5B1A H;  5F64 A;  1I1S A;  3H5N A;  3W3C A;  4KN4 X;  2JA8 J;  2ESN A;  3RYR A;  2BZT A;  2NNY A;  5HS8 A;  1F1Z A;  4I76 A;  5EG0 A;  4M9Z A;  5GTH C;  1J75 A;  3GTQ J;  4M73 A;  3NWT A;  3IAM 2;  5JI6 A;  4L9V A;  3G73 A;  2XUB A;  3H1C A;  2E5Z A;  2Q1Z B;  2MD5 A;  3ABT A;  4NC8 A;  3ASN H;  3MKL A;  2ZME B;  3ELK A;  3PNV A;  3ASO H;  2L7F P;  1QO0 D;  2KJC A;  3ZPL A;  2K4B A;  2XF6 A;  1Z6R A;  4CGZ A;  4BGD A;  2A5W A;  2IA0 A;  5DCM B;  3IRR A;  3JR9 A;  4XKB A;  3ZQC A;  2VQC A;  1WJ5 A;  1S7E A;  5DD8 A;  1VTN C;  1WJD A;  4HLX A;  2LKX A;  4ABZ A;  4CDG A;  4ZYE A;  1DDN A;  4P1W A;  1ORK A;  5M3F J;  1STZ A;  5FRO A;  1O3S A;  1U5T B;  3KZI C;  3QAH A;  4XLC A;  4ESB A;  1I3A A;  4C30 A;  2NS7 A;  4E7H A;  3ZMV A;  3AL0 C;  2XV4 S;  5L3B A;  4BY1 J;  2DU9 A;  3PNT A;  1TWG J;  1W5S A;  4UVC A;  2KP6 A;  1ZRF A;  5CVR A;  3J80 K;  3HSR A;  1E17 A;  1LDJ A;  4N4N B;  1X3W B;  1OCO H;  1VQ8 I;  1VQN I;  2K5C A;  2FE3 A;  3OYJ A;  5EZH A;  3IKT A;  1IN8 A;  1SFK A;  2M0C A;  3HHH A;  3JRH A;  1HXD A;  1WPK A;  2IGK A;  4RGS A;  1Z0X A;  4WWC A;  3PUF A;  1JJ6 C;  4MEX F;  3BLY A;  3BG9 A;  4FET A;  4E7L A;  2FUG 2;  2M87 A;  4Y3O A;  2PLY A;  2KDZ A;  3GZN B;  5BMZ A;  2YSR A;  1I6X A;  1UHS A;  3GFM A;  2H8W A;  3OYE A;  3GX4 X;  1W7P B;  3MEX A;  2Y75 A;  3QRF F;  5JHF A;  2EV5 A;  4U0V A;  2HDW A;  2HNH A;  4G8X A;  3VYU B;  4FX0 A;  1Y8Q B;  2FQ3 A;  3HL2 A;  2EFO A;  3QP6 A;  4CCJ A;  4XLP F;  1VF9 A;  5KK1 A;  2LVS A;  4PJL A;  3RSN A;  3GZ6 A;  2V9K A;  2VL8 A;  4CSW A;  2MC4 A;  3KP6 A;  4U87 A;  2XAS A;  3EGV B;  3RDI A;  1LFB A;  3GW2 A;  4BYY A;  1A04 A;  1XSX A;  1VQL I;  3DPU A;  2E1M B;  4NBQ A;  1FOY A;  2XB5 A;  2CFO A;  4XQF A;  1ZG1 A;  1D8K A;  2HTS A;  2HOT A;  2LY2 A;  3ISP A;  3SZT A;  3L2V A;  4IRH A;  1ZEL A;  2DPD A;  1S3J A;  1QZE A;  4XLN F;  2JA6 J;  2IW5 A;  2FNA A;  3DP7 A;  2RQP A;  2GWR A;  3R0J A;  4Z2Y A;  4UUS B;  4WX9 A;  1OYW A;  2KFD A;  1E3P A;  1ENH A;  1J59 A;  2BE5 F;  3I0T A;  2IA2 A;  4CYC B;  3RI4 A;  5JLW A;  3E5U A;  2HXO A;  4S0H B;  2WAD A;  3LSG A;  2CQN A;  2IGM A;  4XBF A;  3TQN A;  1IN4 A;  4P55 A;  3OYD A;  1XN7 A;  3KLN A;  2IXS A;  2CO5 A;  1AA7 A;  4N9I A;  2COM A;  3TL4 X;  2EA4 A;  2FX0 A;  4PUS A;  1J5Y A;  4EJW A;  1B4A A;  2ZJ2 A;  2X0L A;  4NQW A;  1USS A;  2R7W A;  3SFI A;  1P2F A;  2DT5 A;  2AHQ A;  3L2U A;  2ZKZ A;  3CTA A;  1PP7 U;  5ICG A;  5L3E A;  3OY9 A;  2K27 A;  4XMY A;  2B0L A;  3H9Q A;  4S05 A;  2Z5U A;  1B9N A;  1O7L A;  2DQR A;  3PQK A;  1CQT A;  3BR1 A;  2GBY A;  4M6V A;  1V4R A;  3LOC A;  1XMK A;  2H1L A;  4RAZ A;  2DN0 A;  1WQ2 A;  2EB7 A;  5E3N A;  3K1N A;  3PO2 J;  1TQI A;  2DLL A;  5DM7 F;  3H9G A;  1IAW A;  4LIV A;  2V1U A;  2ISZ A;  4ZH4 F;  3BCB A;  4IHV A;  1MMN A;  2IP2 A;  3HRS A;  4HX8 A;  3OS0 A;  1SC7 A;  1DU6 A;  2NS0 A;  2R0Q C;  5D4S A;  1BL0 A;  3X2Q H;  1O7F A;  3DPT A;  5IT3 A;  3JRI A;  3K4J A;  1D3Y A;  2IA1 A;  3I54 A;  3CUO A;  3S1M J;  2DMQ A;  1YW7 A;  2W57 A;  1KYZ A;  2PMH A;  5JFR A;  3KYL A;  1YIJ I;  1P9Q C;  1Y0U A;  4FCY A;  2P7V B;  1ONV A;  2W24 A;  2K4J A;  3L00 A;  3TO9 A;  2L9S A;  1MJ9 A;  4KIF A;  4A3E J;  1BN5 A;  3BP8 A;  1I5Z A;  3A02 A;  3I71 A;  4O3M A;  1K4S A;  1XB4 A;  2AQF A;  2CW8 A;  3FF5 A;  2R7R A;  1P4A A;  4YIF A;  4U0Y A;  1HDD C;  4UNO A;  1X3Z B;  2HWV A;  3S1Q J;  3ZMU A;  4Y17 A;  5DCM A;  2CUJ A;  4B09 A;  4TV7 A;  2VBX A;  1V5F A;  1ETY A;  2VPR A;  4EV0 A;  5E17 F;  1SFU A;  2WY7 Q;  4RGX A;  1X19 A;  3CUQ B;  1RNL A;  4A12 A;  4HYE A;  3S1N J;  2M7A A;  2W48 A;  2M30 A;  1U5T A;  4OOI A;  5HDK A;  3ZQ7 A;  4CYD A;  4RB0 A;  3L1P A;  2HYG D;  2LTP A;  1BOA A;  2ZCW A;  1N78 A;  1ETQ A;  4MQV A;  2F4I A;  4QIW N;  3F8F A;  5J47 A;  4U7D A;  2ZSI B;  1HLV A;  4X6A J;  1X3U A;  1KA8 A;  2A6H F;  2L02 A;  4CCL A;  2Z33 A;  3V8K A;  1K78 B;  3P9K A;  3DBL B;  2HQR A;  3BDD A;  5ICC A;  1MGT A;  2JPC A;  4LFU A;  3M9A A;  4Q4Z F;  3I9V 2;  2JTV A;  2JJ7 A;  3D1N I;  2ICW G;  1UG0 A;  3G1L A;  3E7L A;  5HLI A;  1RPW A;  1LB2 A;  4XRS G;  3OYF A;  3ZGK A;  3B02 A;  2O9L A;  2X85 A;  4OMZ A;  1YIT I;  2R92 J;  3FXQ A;  5LEK A;  3P9I A;  1DUX C;  1E2X A;  4LLL A;  5HS9 A;  3K70 C;  2CV0 A;  2BVM A;  1XGM A;  1F36 A;  2CRG A;  1XSV A;  3PFI A;  4M3D A;  1RUN A;  2K86 A;  1A35 A;  3M8J A;  4BQO A;  5FD5 A;  2WAQ N;  3GCM A;  1FMV A;  4OWR B;  1G4D A;  1EJ9 A;  1ZRD A;  4L0Z B;  3RZD J;  3VOE A;  2HGC A;  3WE2 A;  2L9R A;  1ZTR A;  4BQA A;  2ZSH B;  4HDV A;  3SDB A;  5FKK A;  3OR1 C;  1ZLK A;  4C3H J;  2LKS A;  4JYK A;  1OMI A;  4IOC F;  4G6Q A;  3QPH A;  1TZL A;  4MNU A;  2OUM A;  3K0L A;  4G6D A;  2X6O A;  1S7A A;  2L9N A;  5EYR A;  3HPH A;  2ZFU A;  1V5G A;  4AD9 A;  4JQF A;  2EK5 A;  3E5X A;  4D5C A;  2ZBK A;  3WU0 A;  2P5L C;  1FYL A;  2PJP A;  1P7I A;  2K9N A;  2QQ9 A;  3D5R C;  2XAJ A;  1QPI A;  5GPC A;  1K83 J;  3QU3 A;  2W82 A;  1S8N A;  3S15 J;  4P5O A;  5EZG A;  2NOJ B;  2Y0M A;  1QNT A;  5CLS A;  3TO6 A;  4HEA 2;  3ABM H;  5B1B H;  4BEH B;  3JRD A;  2F5V A;  3O8H A;  3N4M A;  3ZMZ A;  3MD2 A;  1OCT C;  2X6X A;  4L5I A;  4GFB A;  1FWZ A;  3JTG A;  5C3E J;  2ZXH A;  5F1R A;  3HJE A;  3A1Y A;  1NK2 P;  4RLF A;  3E5Q A;  3CJT B;  2X9D A;  4A93 J;  3MZ8 A;  1UHW A;  2DA1 A;  4KMU X;  1UCR A;  3E1S A;  3FXO A;  5IP7 J;  3L7W A;  3LSJ A;  1QZZ A;  2RDP A;  3I64 A;  3K4N A;  1MMD A;  2DA5 A;  2DO7 A;  4WXH A;  1SFO J;  1YS7 A;  4XON A;  3C3W A;  3AG3 H;  2DMT A;  2HZT A;  3E3V A;  2O5R A;  3C2H A;  1G3T A;  2P81 A;  1TQP A;  2F4M B;  2L7Z A;  4ZYA A;  4F7Z A;  4BDZ A;  2JQ7 A;  2CH0 A;  4A3K J;  1OYI A;  4OMY A;  3S3O A;  2R4G A;  3OYB A;  1MZB A;  5IYC J;  5K1Y A;  4A3C J;  2RV8 A;  1T6S A;  3R4K A;  1QGP A;  3I53 A;  2EZK A;  3E0J B;  5FD6 A;  4YG2 F;  3IV5 A;  4XLE A;  1VQM I;  2NXN B;  5HLT A;  3OYH A;  4M3E A;  2KRC A;  1YFH A;  3IHU A;  4LB5 A;  1WWX A;  5C4X J;  5IT9 Z;  4AC0 A;  2O7O A;  2VKH A;  4OIN F;  3JCU C;  4OU0 A;  3ERE D;  2BXY A;  2FOK A;  4B1R A;  2L4A A;  1HDP A;  2B63 J;  4G7H F;  1LDK B;  2KIQ A;  2CJJ A;  3SEZ A;  3OYK A;  4I98 B;  4N9H A;  1LJ9 A;  1VQ9 I;  3QWL A;  2E36 A;  4A0Z A;  4BXU A;  5L3D A;  1JJ8 C;  2W1O A;  2LC2 A;  2MAB A;  3QP5 A;  4IHS A;  2XGD A;  3I58 A;  4DZJ A;  1X2N A;  1K4T A;  1IF1 A;  4HPQ A;  1RET A;  5GAD J;  2F5F A;  3RPQ A;  1WVR A;  1IXR C;  4KIT B;  3V8L A;  2RNG A;  3LQR A;  2K9L A;  1BJZ A;  3LNQ A;  2CMP A;  3CDL A;  1RZ4 A;  1JE8 A;  2BBY A;  4CO8 A;  3CUQ A;  2DOD A;  2L7K A;  2VQH A;  4DBR A;  2V6E A;  1X1C A;  1EV7 A;  2F2E A;  3E6D A;  1R49 A;  2ZXW H;  4PJM A;  1R1T A;  1BW6 A;  5J4V A;  3Q0U A;  1D0Z A;  1R23 A;  3BG6 A;  2MFZ A;  4R8H A;  3O8G A;  2Y31 A;  4BH9 A;  5ICF A;  5KAF C;  4HRI A;  4KJZ A;  2KIS A;  5K5O A;  1K78 A;  1G6N A;  1JXS A;  2UV1 A;  2QUF A;  3M3Y J;  4GRI A;  5E18 F;  2VOO A;  3S3N A;  1OJL A;  5CPR B;  4ZYG A;  2VXD A;  2O03 A;  4E7I A;  1TBX A;  4RB1 A;  1JT0 A;  1D5V A;  2DYR H;  2KT0 A;  2A6E F;  2N8G A;  3CP8 A;  4HA8 A;  3WOD F;  3S2H J;  1KGS A;  3P5J A;  5LGU A;  3MQ0 A;  2EIM H;  2XPV A;  1ZQ3 P;  1C0W A;  2I10 A;  4GO1 A;  1JUP A;  4XNF A;  4ITV A;  4EM0 B;  1OCC H;  3RTR A;  1NG7 A;  2QKM B;  1G8X A;  4A3J J;  1Z3X A;  2DYS H;  4Z6Y A;  5FLX K;  1UST A;  3CCY A;  1IXC A;  2IS4 A;  4LG0 B;  3O6B B;  3GTP J;  3ROU A;  3OIP A;  3D5S C;  3F3X A;  3U2R A;  1T8I A;  4AYB A;  1OQY A;  1SVL A;  1ZKG A;  4XN3 A;  1PUF B;  1X4O A;  1ZN2 A;  2FJ1 A;  1IJW C;  2KKO A;  3W6J B;  4ZDL A;  2VLA A;  1WJC A;  2X1D A;  4ZZD A;  3K9T A;  1JUS A;  3CZ6 A;  4GGG A;  3HDD A;  1MD0 A;  3KZZ A;  2OV7 A;  2BY1 A;  4CHU A;  3CLO A;  4HOB A;  4A6D A;  3FM5 A;  4KMF A;  3HC7 A;  1SFX A;  3HKZ N;  4L18 B;  2M4K A;  2P8T A;  4WXC A;  3FK6 A;  5FB2 A;  2Q2E B;  4E70 A;  1ULY A;  2MW8 A;  3ZP5 A;  5B5E C;  3BTI A;  2A3S A;  3TDU C;  4D1Q A;  4UUT A;  2QKL B;  3IH3 A;  2FD5 A;  2QVO A;  3I55 I;  2M8E A;  2OJE D;  3PL8 A;  2EPF A;  3ZQQ A;  4RA2 A;  5IPA A;  4A0Y A;  2WA0 A;  1O57 A;  5JVT A;  1FOK A;  5FJ8 J;  1YW8 A;  1IW7 F;  1FIP A;  1UJ8 A;  1ZRC A;  1TT0 A;  2CS3 A;  1YHQ I;  3FKJ A;  1IRF A;  1OPC A;  2MBF A;  1UZC A;  5FLM J;  4A69 C;  4XLF A;  2UZK A;  3ZMS A;  1IN6 A;  1JT6 A;  3G71 I;  1V3F A;  4FE4 A;  3AL0 B;  4YII A;  4PSX A;  5FKL A;  1T33 A;  2V1N A;  4GYG A;  1H89 C;  1Y1W J;  2D5V A;  1M1E B;  1J9I A;  2WAE A;  5JVG F;  1ITY A;  4PDK A;  5LGT A;  2DFH A;  3E6B A;  4HQM A;  3ERM A;  5BQT A;  3BWG A;  5CVJ A;  3F6V A;  2HVR A;  2FOW A;  3MWM A;  4ESF A;  4L0Y B;  3CMY A;  2VC0 A;  2STW A;  2A05 A;  4BHP A;  3FMR A;  5LRS A;  1OCP A;  3KIO A;  1GDT A;  3RKQ A;  2HEO A;  1GT0 C;  1U8B A;  1ZGW A;  2GA1 A;  3J80 Z;  1YOV B;  3K1M A;  2OZU A;  3W2V A;  3BG5 A;  5DEQ A;  2IS6 A;  3MMY B;  2OC6 A;  3WG7 H;  3VOD A;  5FRM A;  4IHX A;  2CG4 A;  5FLV A;  1MDM B;  4YEJ A;  1FTT A;  2M5W A;  1H9T A;  2VN2 A;  3F72 A;  3DBR B;  1XMX A;  2LSO A;  3I3L A;  1B1B A;  5IP6 A;  2R7V A;  4OIP F;  3JRB A;  4OAZ A;  2FSW A;  4HZF A;  2BOL A;  1R1V A;  2FXA A;  3I5U A;  4EJV A;  4AM3 A;  2OTJ I;  3H3Z A;  1SEU A;  1FOX A;  1ZG5 A;  2Y0S N;  3ZMD A;  3BQY A;  3CF5 F;  1TT5 B;  5TJJ A;  1WGX A;  4KIC A;  4V2G A;  5ICE A;  4A3M J;  3DLA A;  1XDU A;  3WG9 A;  4AVZ A;  5CVV A;  1I1G A;  1OFC X;  2TDX A;  5F27 A;  3IL2 A;  1QA6 A;  1R5G A;  1XPX A;  5H6R A;  4ZDP A;  4CCM A;  3EUH C;  3SYT A;  2E60 A;  2QEX I;  2PG4 A;  1FYK A;  3VSL A;  2NOG A;  3ZQG A;  4Y52 J;  1EA3 A;  3P7N A;  1HBX G;  1BI0 A;  2HTJ A;  2ME0 A;  1POG A;  2JVG A;  2HYF A;  3ZXS A;  1SAX A;  3OS1 A;  1YX3 A;  2C6Y A;  3BZK A;  3A03 A;  4HF1 A;  4GYI A;  4BHC A;  3BJA A;  2OQR A;  1YG2 A;  5ERI A;  5EEA A;  5D5U B;  2CYY A;  4X0G A;  2V4J C;  1WH7 A;  2OBP A;  5HDN A;  2EA2 A;  1O3T A;  1BA5 A;  2ELK A;  4JOM A;  4ZC3 A;  4ANJ A;  5F6F A;  2ZNY A;  2DK5 A;  3AKZ A;  2Q8K A;  1S29 A;  2LOO A;  1VQK I;  3EET A;  3PIO F;  4XR6 A;  3RCO A;  2LY9 A;  1JGS A;  2GLO A;  5J1R A;  1O3R A;  3IKV A;  3LL7 A;  3U21 A;  5EGO B;  1A36 A;  2GIV A;  4C2U A;  2DQL A;  2V6C A;  3ZCO A;  2EFQ A;  1UFM A;  3CMA I;  1FIA A;  2CGP A;  1GLN A;  2XF7 A;  2DT6 A;  1IN5 A;  4MQ9 F;  1W0T A;  2X6W A;  4BJ6 C;  4KDP A;  2RNJ A;  4U88 A;  4CCK A;  2P6S A;  3KYC B;  1TWH J;  4KUM A;  4E7J A;  2VQG A;  3FX3 A;  3A0H C;  4UV9 A;  1MKM A;  3I4N J;  2ELH A;  2ZXI A;  3HTU A;  4A3G J;  1MNE A;  2PBI A;  4LLG F;  4IO9 F;  3CCL I;  3G3Z A;  1ZR4 A;  3JRE A;  2BGC A;  1FP1 D;  1YI2 I;  2CFX A;  1QPM A;  5B66 C;  3GLL A;  3MZY A;  4YFN F;  2WB1 A;  5TGT A;  1BR2 A;  5HLH A;  3OS2 A;  3JRC A;  4C3I J;  2IS2 A;  2DTZ A;  2IS1 A;  2CW7 A;  3HGY A;  2D2W A;  2QGU A;  2KHM A;  4HX4 A;  2LBF B;  3RYP A;  4B48 A;  1TNS A;  1IXS B;  3AG1 H;  3HBL A;  3OYN A;  3CP2 A;  3V42 A;  2H09 A;  4Y15 A;  2BY3 A;  5GAE J;  3W2W A;  4V19 K;  4JK1 X;  2DT7 B;  2D1V A;  2R7Z J;  3HOX J;  2DFF A;  3M7G A;  4PJ0 C;  3ONQ A;  5HOO A;  2F5E A;  2LY1 A;  1EKE A;  3OOU A;  5K7Z A;  1ODD A;  1U78 A;  3S32 A;  3CF2 A;  2KIF A;  4QPO A;  1TC3 C;  4QSH A;  3IWZ A;  3IUO A;  4QWQ A;  3PO3 J;  3NAU A;  1DPR A;  2UUZ A;  1MBK A;  2CW0 F;  3BT9 A;  1ACI A;  3DEE A;  3KYD B;  3BQZ A;  3FXU A;  4U7B A;  3S1R J;  4RMN A;  1W5C C;  2WC2 A;  4L5J A;  3LSR A;  2E1N A;  2VIX A;  5E1X A;  4I0A A;  3WGH A;  3M8F A;  3BJO A;  3F6O A;  5DS9 A;  3VYT B;  1MBH A;  2HR3 A;  1EH6 A;  2UXX A;  4L9T A;  3CC2 I;  1N75 A;  1JTY A;  2FQ4 A;  4NNJ A;  1X4P A;  1WFX A;  5D5V B;  1YTY A;  4KFC A;  2XPW A;  3RJP A;  1B72 A;  2GIZ A;  3GTL J;  4B3X A;  2DMU A;  1HW5 A;  2JWT A;  2WWY A;  4PK4 A;  1UG2 A;  4A3L J;  1RES A;  1QQI A;  1JUM A;  3S8P A;  3BG7 A;  2ID3 A;  2O3F A;  4I01 A;  1U2W A;  3GYH X;  2FA5 A;  1MDM A;  3S2D J;  4XSZ F;  1GVJ A;  3FDY A;  1OYY A;  3PQJ A;  3Q3S A;  2MH2 A;  5HNF A;  1BC7 C;  2MC3 A;  3A4C A;  3BZ6 A;  4EMS A;  2LG4 A;  2DPU A;  2IRF G;  2DK8 A;  4YFX F;  2CUE A;  3DKY A;  2DA7 A;  3EYY A;  2CV2 A;  1RRJ A;  1T95 A;  2CSO A;  1G2H A;  4DGW B;  1FZP B;  4JP0 A;  3OV8 A;  3JRF A;  1ERD A;  4HST A;  2LRE A;  2E35 A;  3CME I;  1BC8 C;  3ESW B;  2FNP A;  3K69 A;  5E20 A;  2HS5 A;  2XGC A;  2D45 A;  1MIJ A;  1WRJ A;  4I0B A;  3DBH B;  3VFZ A;  1S72 I;  1ZAO A;  1X1B A;  4KA4 A;  2W25 A;  4EGY A;  5DV5 A;  1ETO A;  1SVM A;  2PMZ N;  3GLX A;  2JUC A;  3HOY J;  1KU7 A;  1T0F A;  1K6Y A;  2Y2Z A;  3GZ5 A;  4BQQ A;  1IRG A;  3ECH A;  3GVA A;  1DGW Y;  1FEX A;  2UXN A;  2EQR A;  2ZME A;  3OYM A;  1I3Q J;  3KP5 A;  4RAG A;  1KU9 A;  1ZGA A;  1RR7 A;  2E71 A;  4UY8 I;  2FF4 A;  1Q1V A;  3V8J A;  1VQ7 I;  4LGW A;  4RGU A;  1WI3 A;  3K4B A;  1RUO A;  5L3F A;  3LSI A;  1VQ6 I;  3VYS B;  2DDB A;  3HIF A;  3CCV I;  2E7X A;  2JSP A;  5IOZ A;  1JTX A;  5K5Q A;  2DJI A;  2VKV A;  2YR2 A;  5FKO A;  5E8I A;  2K02 A;  3DEU A;  3DKW A;  4F52 A;  4ENJ A;  1SD5 A;  4UHT A;  1ETX A;  1BI2 A;  2L3D A;  5J3L A;  3OYC A;  3KEY A;  1K79 A;  2F4O B;  3DCF A;  3TBI A;  2BY0 A;  3F9K A;  2YUS A;  3K4K A;  2RGV A;  4PFP A;  2R5Y B;  1MJA A;  2JPB A;  4LJZ F;  2CQK A;  3OL3 A;  3V4G A;  2RRE A;  2GOX B;  2ZB9 A;  3HG9 A;  3JAM K;  2P4W A;  1Z7L A;  3TMO A;  3MFK A;  4ENM A;  4KT6 A;  2E19 A;  3HTS B;  4KN7 X;  2OCC H;  1HQC A;  3I4M J;  1HST A;  3J7Y J;  2J5O A;  3QQA A;  2QQA A;  4IVN A;  2R5Z B;  3GFJ A;  4AWX B;  4E6K G;  3OYI A;  2W7N A;  3U9G A;  4ZYH A;  4L5E A;  4XKV A;  1FC3 A;  4A3D J;  5LEJ A;  2PQ8 A;  4CCN A;  5F0C A;  3QOE A;  1W7P A;  4V2F A;  3J7A Y;  1MBG A;  4BE0 A;  3DPL C;  1U3E M;  2QLZ A;  3HSE A;  3UR3 C;  3DF8 A;  2ZJQ F;  4I09 A;  1X2M A;  4FQG A;  4ZTF A;  4JBA A;  2VJI A;  3KLO A;  4XID A;  1OKR A;  3WU1 B;  2PEX A;  3Q9V A;  5C44 J;  1H88 C;  1HCR A;  1XCV A;  3S3M A;  2PX9 A;  3LSM A;  4YRV A;  5J8C A;  2LBF A;  3J81 K;  1R00 A;  1MBF A;  2OZ6 A;  3GF2 A;  1TWA J;  4MGR A;  3WTW C;  3CES A;  2DW4 A;  3GXO A;  3M1E A;  1G3S A;  4XSX F;  2XSD C;  4XOT A;  1TNT A;  1FBU A;  1N25 A;  4IHW A;  3FBN B;  1ZHF A;  4PGG A;  3MKW B;  2XAQ A;  3GUD A;  1D1A A;  1FY7 A;  5FRN A;  3NRV A;  3S2W A;  4KYW A;  1P7J A;  2XAH A;  4EJO A;  2L4M A;  1FOW A;  2X51 A;  3B6C A;  3IP4 B;  2O8K A;  1Y6I A;  2YPR A;  2YX7 A;  2DI3 A;  4Q5S F;  1FMW A;  3HRU A;  1F43 A;  2ECB A;  5CQE A;  1FX7 A;  5EEH A;  4UUS A;  2FEZ A;  1PP8 F;  4NHJ A;  3J7Z I;  3FM3 A;  2XKP A;  3HOV J;  1MSE C;  4CYC A;  4UVA A;  5A2Q K;  1YQA A;  3ZR8 X;  4Y4R A;  1R1U A;  2BV6 A;  1YIO A;  1ON2 A;  4XLA A;  1XTA A;  4MEY F;  3ECO A;  1B8I B;  5J40 A;  2VT2 A;  3K6G A;  1IC8 A;  4RAY A;  1UB9 A;  3OYG A;  4DYR A;  4I99 C;  1NHA A;  4XLH A;  4IQ4 A;  5E1W A;  1CGP A;  2BHY A;  4RLQ A;  1WHU A;  3DKX A;  3A0B C;  1U8R A;  3I59 B;  3H0D A;  4JX4 A;  3TKY A;  5F04 A;  1IRZ A;  3RZO J;  3LAP A;  3QYF A;  1Q1H A;  3HEF A;  5H20 A;  4IHT A;  1QRY A;  2R7D A;  1J2X A;  3SFZ A;  2EZH A;  4PJN A;  4CXF A;  2ZJR F;  3RKX A;  3ML6 A;  1TW2 A;  5TRD A;  1R71 A;  1JHF A;  3H92 A;  4NC6 A;  2LR8 A;  4J19 A;  2GZW A;  2OPT A;  5DCF A;  2O6G E;  4XRS A;  4A2U A;  1KQ8 A;  4HNU A;  2VBZ A;  2IPQ X;  3G2B A;  4E7Z A;  4Q48 A;  1I39 A;  2QBY B;  1MJB A;  1AKH B;  2EFW A;  1JKO C;  2OU2 A;  4HG2 A;  5E3M A;  2VE9 A;  2LH9 A;  3WTX C;  1TP4 A;  2L01 A;  2MH9 A;  2BHZ A;  1HKQ A;  2TRT A;  5TIS C;  2LMD A;  2EIL H;  4M74 A;  4ZJZ A;  4L9N A;  2ZNZ A;  4LG3 A;  5D8L B;  3BRO A;  2QZ8 A;  3K10 A;  4M9S A;  5FLX Z;  2K3P A;  2VC1 A;  2YX4 A;  1LEB A;  3UNG C;  3ABL H;  1O4X A;  4GCV A;  2YU9 J;  2G7U A;  4WCG A;  3DLL F;  2EH3 A;  4EVI A;  1W7P D;  5GAG J;  1D1B A;  4N4O B;  1A6I A;  3L09 A;  3H3U A;  2HFH A;  3T1B A;  3HRM A;  2HZD A;  2KLO A;  3SZP A;  2M45 A;  3SXY A;  5F1J A;  2PMZ A;  1K61 A;  4R1H A;  3WTZ A;  3K4L A;  3KE2 A;  3WTT C;  1LQ1 A;  2GM4 A;  3S16 J;  2VJJ A;  3HPG A;  4EM1 A;  2L9V A;  2YS9 A;  3PM1 A;  1UMQ A;  2K9S A;  3BR3 A;  3KFW X;  1RI7 A;  4ETS A;  1P4W A;  5HLG A;  4KIS A;  4RAF A;  3HOS A;  5K7F A;  4DYQ A;  3E6C C;  1N77 A;  2R5Y A;  2P6T A;  2EZL A;  3H0G J;  4DQ2 A;  2PJR B;  3R60 A;  3DTE A;  2HQ5 A;  1EF4 A;  2W84 A;  2VOP A;  1E3O C;  1LVA A;  2ADU A;  1F5T A;  5EEG A;  1XMA A;  3WTV C;  2ID6 A;  2R5Z A;  4FHT A;  5EG0 B;  2ZFW A;  2DOF A;  1OCZ H;  2R7F A;  1BOB A;  4C9Y A;  5IOY A;  1NTC A;  4HF2 A;  4HQE A;  1I6H J;  1IO2 A;  2XRL A;  4XN0 A;  3JSO A;  2E2I J;  4UXN A;  1YYV A;  2X6Y A;  3GTG J;  1P4X A;  1SD7 A;  1OR7 A;  1PYV A;  3CCR I;  3G1O A;  1FYM A;  1Z21 A;  1W36 D;  1FTZ A;  1T2K A;  1GVD A;  4M3B A;  3UKG A;  1IUY A;  2H94 A;  2YU3 A;  1Y1V J;  2JA2 A;  3REO A;  3BG3 A;  3NEU A;  4IF4 A;  3OIQ A;  4ZDO A;  4FIS A;  5AIQ A;  1Y0N A;  4BDY A;  4XRF A;  3GBG A;  3K70 D;  2Z99 A;  4BU2 A;  3HYI A;  4EJU A;  2HOS A;  4KNY A;  4RGR A;  2QYO A;  5GP9 A;  1R5H A;  5J1U A;  4AIJ A;  4C3J J;  3ZQL A;  4IZZ A;  3OR2 C;  2FML A;  2TCT A;  5JHU A;  4F55 A;  2FBH A;  2MGQ A;  4MFD A;  3V7S A;  1I50 J;  3EQL F;  3SQN A;  1JKP C;  1LKX A;  3PSI A;  4G7Z F;  2OTL I;  5ILS A;  2R7Q A;  2WAQ A;  1RIO H;  4IOA F;  2RKH A;  1ZYR F;  3MKZ A;  2IJL A;  4A0X A;  5KAI C;  2DDA A;  1MH4 A;  2KRF A;  1W4M A;  3BOQ A;  3GO5 A;  2NAZ A;  4BEH A;  3LA2 A;  3DU6 A;  1HW1 A;  3LWF A;  2XAG A;  1XDS A;  3WTS C;  1W1W E;  2MLG A;  1B8I A;  2BYV E;  2DBB A;  1PJR A;  3H35 A;  2CQX A;  2HI3 A;  2X4H A;  3M07 A;  3KX2 A;  2H27 A;  1FT9 A;  3QPS A;  1R4M B;  3HOU J;  5HNH A;  1HW2 A;  2VXZ A;  2FBK A;  2K85 A;  4M9X A;  1YW9 A;  2R7S A;  1KQ9 A;  4HBL A;  2XHK A;  3I59 A;  3BC8 A;  4XK4 A;  3TED A;  3BR5 A;  2OD5 A;  4S04 A;  1WSU A;  3FKI J;  2V7F A;  1BI1 A;  3HGG A;  3QOD A;  1ZRE A;  2QQB A;  4AVP A;  3I4P A;  1NH3 A;  5CVU A;  3CCJ I;  5HVQ C;  3LST A;  1IUF A;  3C7J A;  4G94 A;  5K5R A;  5D5W B;  2F5D A;  3CD6 I;  5DM6 F;  4RB3 C;  1IN7 A;  2EWN A;  3VWB A;  3PIP F;  1GUU A;  1G59 A;  5KHD A;  3NAR A;  1TTY A;  4BE1 A;  2HPM A;  3CJR B;  2QBY A;  1AKH A;  1BBY A;  5DUI A;  3OWT A;  4E7K A;  2HXI A;  3ZOB A;  2DMN A;  4ASN A;  4MFE A;  1R7J A;  2JT1 A;  1YS6 A;  2FMY A;  3MZH A;  1B59 A;  3HZJ A;  3ZQF A;  4F93 B;  5DYM A;  4BXF A;  3MVP A;  2STT A;  2DAO A;  2VB6 A;  1JKR C;  1IV6 A;  1IGN A;  3VB2 A;  1XGN A;  1LDD A;  1D0Y A;  3K1P A;  3Q0V A;  4HW0 A;  4CZZ A;  5EJC A;  2IGO A;  4RB2 C;  2GOM A;  2NYX A;  3B6A A;  4HV6 A;  2ELJ A;  4XIC A;  2Y9Z A;  1XSD A;  4BNC A;  2Z16 A;  4M3F A;  3Q5F A;  2NNN A;  3F8C A;  3IWF A;  2A68 F;  2G7H A;  2IVM A;  1YJW I;  4NQW B;  3W2A A;  3U1D A;  5LHH A;  2E1C A;  1R36 A;  2NVQ J;  2GQQ A;  1T56 A;  2OF7 A;  4G9Y A;  2Z1D A;  1SD6 A;  2B7E A;  2IBD A;  3C1D A;  4WXD A;  1YLF A;  3LAJ A;  1NK3 P;  2I8D A;  2HKO A;  1SAU A;  3HOT A;  3FBI B;  1G3W A;  5KNL A;  3WGG A;  3QU6 A;  3KCC A;  2MLK A;  2VKD A;  1ZAR A;  2AS5 F;  4MHG A;  2CQ7 A;  4XL9 A;  3CC7 I;  3K4C A;  2ACJ A;  1BW5 A;  3SHF A;  3F0C A;  4RM2 A;  1U9O A;  3R6S A;  3FXM A;  4Q47 A;  2PJR A;  4J00 A;  4B47 A;  1Z1D A;  5ED4 A;  1GV2 A;  4II3 A;  4FTH A;  3KET A;  3DEW A;  4LOC A;  2OCE A;  2XF5 A;  4LIU A;  5M3M J;  2KQR A;  2V26 A;  1IZ1 A;  2MA3 A;  1AWC A;  2E5N A;  4I02 A;  4U0W A;  5CJ9 A;  3OSG A;  2EBI A;  1J09 A;  4ON0 A;  1D0X A;  3OYA A;  2V9P A;  1OCR H;  3VEP A;  2W4S A;  1LEA A;  1XC5 A;  5ILV A;  2V9V A;  4YIR X;  4F92 B;  4ESJ A;  2ZC2 A;  3R0A A;  2JSC A;  4PFO A;  1XD7 A;  1J0R A;  1X1A A;  4KIG A;  4XRM A;  4IJA A;  3RKW A;  2EV0 A;  4IX7 A;  1L0O C;  3CQZ J;  4BE2 A;  4DW6 A;  1WJB A;  3ZRG A;  2K9M A;  3WHB A;  5L3C A;  1SVO A;  3KP2 A;  5F0H A;  4LG0 A;  3JRG A;  3CCU I;  2KZV A;  2JA7 J;  2CV1 A;  3NQO A;  2KL4 A;  2A5Y B;  3JSP A;  1PUF A;  2J5P A;  3OIO A;  3FIW A;  2R7X A;  3PSF A;  5DUK A;  1AHD P;  1X1D A;  3E6M A;  1Y39 A;  2P5K A;  2CQQ A;  3BPV A;  1VND A;  1VZ0 A;  2CUF A;  2VPL A;  3DWL E;  1Z3Y A;  3GFL A;  3LA3 A;  4NDL A;  4D7N A;  3HUG B;  2BW3 B;  1LVK A;  1KZH A;  2Z9O A;  5FKN A;  1LPQ A;  1VQ5 I;  5M5W J;  1LFU P;  3FHZ A;  2DFI A;  2BEO A;  2G9W A;  3F8M A;  4B43 A;  2QEN A;  4HAM A;  1MND A;  4CZC A;  3HOZ J;  3LSP A;  1HKS A;  4MTD A;  2LF7 A;  3LSK A;  4GDF A;  2Q2E A;  5D8K B;  4CCO A;  2O0Y A;  2QQ8 A;  2Y48 A;  4BAY A;  1U0J A;  3TW7 A;  4D5F A;  3FMQ A;  4YFK F;  3JRA A;  2X1E A;  3EUH A;  1HA8 A;  2RN7 A;  3K4M A;  2NVT J;  4W97 A;  2HVS A;  4HF0 A;  4B44 A;  2LK2 A;  2NVX J;  1KYW A;  4OIO F;  1BJA A;  1S9H A;  4OIQ F;  5LGN A;  3TGN A;  3HKZ A;  4HX7 A;  1HOM A;  1QHH D;  3OMY A;  4EJT A;  2JMW A;  3CCS I; 
#chains in the Genus database with same CATH homology
 3CC7 I;  2E34 A;  1YHQ I;  2ZJQ F;  1YJ9 I;  3DLL F;  5GAG J;  1YIJ I;  1VQK I;  2H8W A;  3PIO F;  1VQ4 I;  3G71 I;  3CCM I;  1WIB A;  1VQO I;  3CMA I;  3CCQ I;  2QA4 I;  3CME I;  2E35 A;  5JVG F;  3EGV B;  1FOW A;  1VQL I;  5GAH J;  3CCJ I;  1FOY A;  1S72 I;  2FOW A;  3CJT B;  3J7Z I;  4IO9 F;  3CCL I;  1YJN I;  3CD6 I;  5DM6 F;  1YI2 I;  3CCU I;  3PIP F;  2JQ7 A;  3CJR B;  4UY8 I;  1Y39 A;  1VQ7 I;  2K3F A;  5GAE J;  3CCE I;  1VQ6 I;  1VQM I;  3I56 I;  2NXN B;  4V19 K;  2OTJ I;  1VQ5 I;  3CCV I;  1MMS A;  3CCR I;  1FOX A;  3CF5 F;  2ZJR F;  1YIT I;  2ZJP F;  1YJW I;  3G4S I;  1VQ9 I;  1QA6 A;  2E36 A;  1ACI A;  2QEX I;  1HC8 A;  3G6E I;  3CJS B;  5DM7 F;  5GAD J;  3J7Y J;  4IOC F;  3CC4 I;  1VQ8 I;  1VQN I;  3I55 I;  3CJQ B;  3CC2 I;  2OTL I;  1VQP I;  3CCS I;  4IOA F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...