5GAGJ

Rnc in complex with srp-sr in the closed state
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
134
structure length
134
Chain Sequence
b'YVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SRP 4.5S RNA
publication title Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 23
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
J PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 5gagJ02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 5gagJ01
1YIJI 1VQPI 1VQ6I 3DLLF 3I56I 3J7YJ 3CMEI 3EGVB 1YJNI 1FOYA 1VQ5I 3CC7I 3I55I 5GAGJ 1VQ4I 3G6EI 2E36A 3CCLI 2OTJI 1VQ7I 3G71I 2K3FA 2ZJQF 1VQNI 1MMSA 2OTLI 1YITI 4IOCF 3CC2I 2FOWA 1VQOI 3CCEI 4IO9F 1YHQI 1VQLI 2H8WA 1VQMI 5JVGF 2ZJPF 1YJ9I 5DM7F 3J7ZI 1WIBA 2QA4I 5GAHJ 3CCMI 1HC8A 3CCUI 2E35A 2QEXI 1VQ9I 3CJQB 1S72I 4V19K 3CCSI 3PIOF 2JQ7A 5GADJ 2E34A 3CD6I 1FOWA 3CJRB 2ZJRF 1VQKI 4IOAF 5GAEJ 3CJTB 3CCJI 3CCQI 1VQ8I 2NXNB 1QA6A 3CF5F 3CCVI 5DM6F 4UY8I 3CJSB 1Y39A 1FOXA 3G4SI 3CCRI 1YI2I 3PIPF 1ACIA 3CC4I 3CMAI 1YJWI
chains in the Genus database with same CATH superfamily
4EQQA 4PGGA 3KETA 1QO0D 1W0TA 1DQUA 2GXAA 3WGIA 3LQRA 5L3FA 2FBKA 5LGNA 2XPWA 3MKLA 3JRAA 3SHFA 2ZCWA 2Y30A 1ON2A 4OU0A 3COAC 2E5NA 3L2VA 9ANTA 4M73A 3I59B 2CRGA 4XLEA 3EGVB 1VZ0A 4ZYHA 4D0PA 2NVXJ 2LD5A 1MBKA 3NEUA 2JUCA 5L3GA 1R1TA 1WRJA 4K2EA 2ZFUA 4A69C 4YEJA 4A6DA 4G6QA 2G7UA 2QLZA 3BCBA 2WV1A 2GZWA 4HEA2 2OTJI 3LAJA 3I64A 3OV8A 2O3FA 4MO7A 4M3FA 2HPIA 3FBNB 1KA8A 3NWTA 1Z7UA 2ID6A 3DBLB 3FXOA 4HV5A 5LHHA 2E2HJ 2JA8J 4CYCA 3LNQA 1LFBA 4BEHB 3ZRGA 5E18F 2ID3A 2O61A 2IBDA 2PFBA 1YX5A 2IVMA 3JRGA 1VQMI 3SDGA 5C44J 3JW4A 4AVZA 2MD5A 3KX2A 3E0JB 1E3OC 4LG0B 5GTIC 4KMFA 1K83J 5DD4A 5FLMJ 4B44A 1JKOC 3U1KA 4CO8A 2Z16A 3F6VA 1IUFA 2M8GX 1XSXA 4I0AA 4ZDLA 3S15J 3K4LA 4ZTFA 1W5SA 3TQNA 1QU3A 1IDYA 4QTRA 1TP4A 4S05A 3M3YJ 5AIPA 2ZBKA 1BC8C 2NS8A 4HSTA 3TP0A 4AUXA 1IZ1A 2JMWA 1B9NA 5CQGA 3CO6C 3LQQA 2V1NA 1MJ9A 1QA6A 3OYKA 1O4XA 2XB5A 1XGMA 3G1MA 1LNWA 3K4JA 3ZP5A 2FA5A 2DJIA 3HOUJ 3I0TA 2XKOA 3C7JA 3CUQB 2K02A 5L3DA 3K10A 2KRHA 2W7NA 3LSIA 4AC0A 1B8IA 4PUSA 3I54A 2OF7A 4Z2YA 3DLAA 2DPDA 3U21A 2K27A 4PFOA 2A5WA 3ESWB 2X6XA 4PJNA 5C3EJ 3HZJA 1YIJI 2RREA 3RKYA 2Q8KA 2O9LA 1T56A 1LDKB 2QZ8A 3W6KB 5EEAA 3D1NI 1KQ8A 1ZH5A 3BTCA 3M07A 1U3EM 2A6HF 2F2EA 1APLC 1MH3A 2P6SA 3E3VA 5FKMA 3VODA 2PBIA 4XN3A 4F3QA 4L5IA 2Z5UA 1ZRCA 2M3AA 3C2GA 4BQQA 5CVUA 4AYBN 1T2KA 3PJRA 4JP0A 3WG7H 2WAEA 4BYYA 5CQEA 1TWHJ 2DA6A 1TLHB 3ABLH 3AG4H 4B4CA 2DAOA 2DMUA 2LRDA 2VJIA 3HOWJ 3P9IA 1GUUA 5FKKA 2V1XA 1Y8QB 2COMA 3F8BA 4BXXJ 4BE1A 4OOIA 3GCMA 4A0XA 1X3WB 4M3BA 4KUMA 2LDUA 4UXNA 1YITI 3RTRA 2VXDA 2X48A 2K9NA 1EH8A 2H1KA 2XF7A 4XK4A 4ANJA 2ACJA 1Z6RA 4XR6A 4BQOA 1D8KA 3C1DA 1PUEE 2JRTA 3MN2A 1JUMA 1USSA 4DNCA 2IS1A 1IDZA 1R58A 2P0WA 3VYUB 3EUKL 3KCCA 5M5XJ 4EJTA 1XGNA 1TWGJ 2H1LA 3I59A 4I09A 1UG2A 3LSGA 1IRXA 2HYJA 1SMYF 1TC3C 5H2FC 1T38A 5D4SA 1OCTC 1H9GA 2KFDA 4IJAA 4BAYA 2BE5F 3KP5A 2K9LA 1CQTA 2CUZA 2EB7A 1L3LA 2HXOA 5TISC 1WJBA 3BJOA 2Q2EB 1HBXG 5DDGA 3RZDJ 4DIQA 2PX9A 2HKXA 3GFJA 3VPRA 4G8XA 3HM5A 4KFCA 3LA2A 2ESNA 2EZIA 3RDIA 1IRFA 4IX7A 2K9SA 1LKXA 1QZZA 4XORA 5JHUA 2EFWA 2DYRH 1GHCA 3AKZA 1AHDP 3WGHA 2IRFG 2QENA 2FEZA 2UV1A 1JT6A 2P5VA 1Z21A 3Q0VA 4RGUA 4WXCA 5D5XB 3U1DA 5HNFA 4FCYA 3TEDA 2BVMA 1YW8A 4L0YB 4A12A 3MKZA 1ZRDA 3GWZA 5HLTA 5D4RA 3GFMA 3BP8A 2FBHA 4UUSB 2PMUA 4M72A 2HVSA 4EM1A 1MZBA 1J09A 1HDPA 2HYFA 3HOVJ 3DTKA 2V7FA 4N4NB 5TGTA 3KYLA 2DQRA 3QP6A 1OCPA 4LG3A 4ZH4F 2STTA 1VI0A 4RAYA 3TDUC 1Z05A 1SC7A 1UZCA 5B3SH 5B66C 2GA2A 1I27A 4C30A 3LMMA 1BW5A 2A5YB 1D0XA 1FBSA 4Y52J 3K2AA 2CYYA 2AHQA 2KDOA 2W48A 3I53A 4O5VA 4CDGA 1WQ2A 4CYDA 4PSXA 1T6SA 1B72B 3GTMJ 3A02A 4EMSA 1DU0A 1TW2A 3O3KA 5E1WA 1BI1A 3MKYB 3DF8A 4WK8F 1FMVA 1ZGAA 3FDYA 3CCLI 3S2WA 2VT3A 2XROA 4A3KJ 2RQPA 1OKRA 4O6JA 1LFUP 3ABMH 3FWEA 3I5UA 3F21A 1OR7C 1PYVA 3LSRA 3G1OA 2CQXA 5F08A 4UB6C 3TKYA 1U2WA 4KYWA 2FJ1A 1R9TJ 1HKTA 3H35A 3KPHA 3CCEI 3MZYA 2DA7A 1Z67A 4W1UA 4OIQF 4W97A 2E7WA 4S04A 3C3WA 3CESA 2K3PA 1O3SA 1YTYA 2PJRB 1WI3A 1YIOA 4F7ZA 1JTYA 2LFBA 4HBLA 2VBWA 2EZHA 1UELB 3QU6A 1FT9A 2G7HA 2GOXB 2A05A 4N9HA 2WB1N 2QKLB 2HTJA 1HC8A 2VKEA 1HA8A 1BJZA 1F1ZA 2QEXI 5FKLA 2PI0A 5IP6A 1MDMB 4BNCA 1EV7A 1WFXA 4CSWA 2DA1A 2DK8A 2GBYA 2OJED 3E5UA 4B43A 1R7JA 1BI0A 1V5EA 3P9CA 3QOPA 4LIVA 3HHGA 2YX7A 1KYWA 5J8FA 2Y48A 4M3DA 3ZQCA 2J5PA 5J40A 1TWAJ 1F36A 1E0EA 3CJRB 3IC7A 2ESHA 1AKHA 3ERED 2HZTA 4IKFA 1BR4A 2HOEA 1FPQA 1KU3A 2L0KA 4IL6C 3S1RJ 3RYRA 1W5TA 4BKXA 5C4JJ 3N05A 1TZLA 3LOCA 1FLIA 1WJCA 1ZYRF 5EF6A 2IXSA 2IT0A 3CJSB 4XLCA 2PMZN 1WCMJ 3PNYA 3IWZA 3BG3A 2PN6A 2I10A 5ILUA 1R5GA 5E8IA 5FO5A 2WBMA 3M9AA 3PIPF 3A2KA 4R8HA 2H8RA 2OQRA 3BG9A 4D1QA 3IH4A 4ENMA 3HC7A 2Q2EA 1Y1WJ 5FD6A 5LFAA 3OYDA 2IA1A 2BY2A 3K4BA 2Y75A 3ZMTA 4IVNA 5DUKA 3PO2J 2OCEA 4A3LJ 4G9YA 3CMEI 2Y0SN 1O3RA 3LAPA 1USTA 4AM3A 1MJAA 5J1UA 2FD5A 1SFUA 5FLXK 2FUG2 1UG0A 3B02A 2X0LA 3H5RA 2EFPA 1F4KA 4IRIA 1HW5A 4XL9A 1J5YA 2DT7B 2ETHA 3G6EI 5HS8A 2HFHA 1WZ2A 2P8TA 3HOYJ 2HXIA 3H3ZA 3H0GJ 2R92J 3BR2A 2RDPA 3M4OJ 3IKVA 2Z9OA 1ZQ3P 4BQNA 4UUSA 1OR7A 1SANA 3RCOA 1GV5A 4XMYA 3FXMA 3ZQGA 1UAAA 3OS2A 3JREA 3QYBA 2RKHA 3Q0UA 5DCMA 3ZCOA 4DGWB 3GTLJ 4U87A 3DKXA 1BOAA 2MD0A 3GMEA 1GT0C 1FX7A 2JK3A 2XAUA 4WXHA 2GOMA 3A01B 1ZREA 1U5TB 3ROUA 4BDZA 3BY6A 3VOEA 3GFLA 4E70A 2IPQX 2O03A 4A3GJ 1OYWA 2CUEA 4C3HJ 4ZDPA 3FXRA 5D8LB 2Y0MA 3B73A 3BPXA 4BDYA 1I39A 4WWCA 2DW4A 4XOTA 4DZPA 4ENJA 5IYBJ 2JUGA 2XAGA 4V19K 2XKPA 3O6BB 3VEPA 1MSEC 1BN5A 2X1CA 2KP6A 4A2UA 5ICEA 5K5RA 4FE7A 2NS0A 4DQ2A 2HOSA 4IZZA 4I98B 1H0MA 3K4CA 5FROA 3RIRA 3W6JB 2QVOA 5E1XA 1AA7A 1FBQA 2L9RA 4IOAF 4ASNA 2DK5A 2LY1A 3OYJA 5KHDA 4RB1A 2R7RA 2DOEA 2OQGA 1OJLA 3BJAA 1U5TC 2ADUA 1FYLA 1Y1VJ 1XTAA 4IHYA 2VUMJ 2M4GA 3E6MA 1RUNA 4CCLA 2E1CA 3PUFA 5BS6A 1P7IA 2HKOA 1OCRH 3G1LA 4Y15A 1R00A 1QQIA 3DPTA 4II3A 4CCMA 4D7MA 1P9QC 4LOCA 1ZRFA 3CTAA 3PM1A 4DYQA 4ZZLA 5ILSA 1R36A 5DEQA 4HZFA 1JKRC 3TW6A 2L9NA 2KRCA 1A5JA 4PCQA 3LFUA 1VQ6I 4A6EA 5C4XJ 1BC7C 4B47A 2DT6A 4P9FA 3RZOJ 1S8NA 1LVKA 2L5QA 3FK7A 1RZ4A 4HX8A 2EA4A 4LMYA 2BW3B 3J7YJ 1EA3A 1QPMA 1EJ9A 3S1MJ 2QSFX 2MC3A 3DBRB 4G7HF 3RQIA 3OYEA 3QOEA 4IHSA 4YRVA 3BZCA 4NC8A 5IP7J 4UNOA 2KKOA 2WA0A 3L1PA 2R3SA 4BUPA 2OV7A 3HRUA 3ZQFA 4DYRA 3E6CC 2CG4A 4CCNA 3FZVA 1X19A 2V79A 2JPBA 1JHFA 4E7IA 3MFKA 3OYIA 4MQVA 2DTRA 2ZFWA 1NHAA 1WKMA 1MBEA 4PJMA 3DXJF 3OS0A 5EGOA 1RIOH 1P4WA 3V7SA 2RVCA 3HKZN 4BE2A 1KQ0A 2P4WA 5JLWA 3OIOA 1WIBA 2DO7A 4G6DA 4UVAA 1ERDA 1L0OC 1U8BA 4KIGA 1MH4A 1W7PB 2E1MB 3E6BA 4LGWA 3WTSC 1XD7A 1ZHFA 4LFUA 1R5HA 5KK1A 3CCUI 1OYYA 2X51A 3BR5A 3PSIA 3GTKJ 1H8AC 3OYAA 3RPQA 4LK1F 3M8FA 4IXAA 1SVOA 2MLGA 3ASOH 2V1UA 3SDBA 3L2RA 3J80Z 2VE9A 4KJZA 3CCSI 2F5DA 3C18A 3H9JA 3VSLA 4NC7A 2EV5A 3PQJA 1R71A 1K78A 3E97A 2X6YA 2CS3A 5GADJ 3WODF 1I3QJ 1QHGA 3DEWA 4L18B 3I4NJ 3F6OA 3I58A 3DKYA 1QZYA 3BTJA 1FNNA 3GEZA 1YQAA 2ELJA 4XKBA 4CZZA 2XAHA 1FC3A 2HGCA 2KZGA 1NK2P 3A01A 1VQ8I 2VQGA 2DA3A 2W85A 3QP5A 1B8IB 2IP2A 3G3ZA 3RPUD 2EIJH 2Q0OA 4B48A 4UVCA 2KDZA 3JAMZ 1Y56A 1R1VA 1D1AA 2MC4A 3D0SA 3WG9A 3P5JA 1VF9A 1PP8F 2K4JA 3A0HC 1QNTA 5ICGA 3ML6A 1IGNA 2X4HA 5A2QK 1IRZA 2XB0X 4WCGA 1J0RA 1S29A 3W2AA 1SD5A 1I50J 1XB4A 3DLLF 3FIWA 1ZLJA 4EGYA 1A04A 2A61A 1DGWY 2QKMB 5CVJA 1FIPA 4YIRX 4FX4A 4GO1A 4M9SA 2ECCA 4M9XA 3KEYA 1REPC 5K7HA 2D45A 3JSPA 4HRIA 2IS2A 4NHJA 1GVJA 4ZJZA 4HQEA 2L9VA 2OC6A 3KLNA 4D7NA 4H0EA 2VASA 1U78A 3GBGA 3HHHA 3SEZA 3SZGA 2PEXA 4IQJA 2P6TA 2VC0A 4L5EA 1O3TA 2FQ3A 2Z99A 3S2DJ 2VT2A 2ZC2A 4HSRA 2BVLA 4PSWA 5CYVA 4EJVA 2P5LC 1I1SA 2IW5A 3DEEA 1YS6A 2BW3A 1N25A 5JVTA 2Y9YA 4XKVA 4OMZA 3J81K 2KISA 5DCFA 1MD0A 1YOVB 3S93A 3MQ0A 3DP7A 4E7LA 1YW7A 2NNYA 4IHVA 4I2OA 3KP3A 2E60A 2CQKA 4RDUA 2FOKA 3WE2A 4CCKA 4U7BA 4KITB 2KLOA 3CLOA 2M9HA 2JQ7A 3V4GA 2R7WA 2CV0A 1Z7LA 2ZXWH 3BR3A 3TGNA 1MW7A 4HDVA 3MEXA 4KNYA 1V5GA 2VE8A 3CJTB 1S6LA 1S5LC 1SD4A 3W6VA 5LEJA 4EGZA 2FNPA 3KP2A 3TP3A 3H1CA 1W7PA 1Q1VA 2L4AA 1EF4A 2R0QC 3LSKA 2XGCA 2PMHA 2PJPA 2QQ9A 1XMAA 2PLYA 1M1EB 2LG4A 3H3VK 2JVHA 2HQAA 1YG2A 1SFXA 4M6VA 4BBRJ 2WAQA 4J00A 3TOBA 1MBHA 2V26A 4NC6A 2XPUA 2KIMA 2HDCA 1F43A 1DP7P 2LF7A 4XRMA 3ZGKA 2R7QA 4XICA 2ECBA 3LSHA 2MW8A 5H6QA 1MIJA 2DA2A 4GGGA 4BY1J 5KAFC 2JWTA 2V4JC 4XM3A 1C0WA 5K5QA 1R23A 2H09A 3PSFA 5LHGA 4PFPA 4OAYA 2R7OA 4ESBA 5HOOA 3RYPA 1KU9A 3FHZA 3O2PE 3FXJA 2HDWA 2K86A 1QRYA 4A3BJ 4XLAA 3TW7A 4QPQA 1HKQA 4UUTA 1LE8B 1IUYA 3GW2A 3OL3A 3CMYA 3BR6A 2XASA 1FTZA 1J75A 3OSFA 1QHHD 2X1DA 3EYIA 3J7ZI 2MFZA 2O7OA 1XSVA 1JKQC 2CFXA 1X1DA 2LTPA 5BNGA 4UVBA 1OISA 2W57A 1WPKA 2R7SA 1G2HA 2NVQJ 2R7ZJ 1AKHB 3ZR8X 5KAIC 2CWEA 1U9OA 4WXDA 2H94A 2GIVA 4FQGA 3ZN1A 5CVVA 1YRNB 1OYIA 1Q1HA 2H6BA 2RGVA 5IT9Z 4RAZA 1BIAA 1RESA 2E34A 2JSCA 1FOWA 1JGSA 3KZYA 4BQAA 1W36C 1AWCA 2DMTA 2KL4A 4MIMA 2CQ7A 4HNVA 1GV2A 4XOPA 3SQNA 2VN2A 2CV2A 4ZZDA 2XV4S 2KJCA 3RKQA 3FKIJ 1RC9A 1I1GA 2LNBA 3OR1C 4E7ZA 3NRVA 1S9HA 5E8GA 2R4GA 1WJDA 2NNNA 5HVQC 2GXBA 4MFDA 1IXRC 4LITA 3PUBA 2HU9A 4ZDOA 4U7DA 5FKNA 2VQCA 2VODA 3QYEA 1W5CC 2PQ8A 3OS1A 2DPUA 3SFZA 1QVTA 2DMPA 3BOQA 4YG2F 1LB2A 4P96A 2R7DA 2VC1A 1BA5A 4MFEA 1NH3A 2EFQA 1B6AA 4MEXF 1GDTA 2AO9A 5LGTA 1E3PA 1XC5A 1SFOJ 3T5XA 4RM3A 5IPAA 2L7FP 2M45A 4ITVA 4NQWB 4BACA 4RGSA 2BY0A 5DCMB 3EETA 1ZG1A 2MLKA 3HIFA 4B3AA 1FZPB 2QWWA 2NVUB 3S1QJ 2ZNZA 4HNTA 2I8DA 2CQNA 2BHZA 3Q3SA 3JTHA 1KYZA 2OAZA 2VKHA 2VKVA 2ISYA 4L5JA 4IO9F 2QSGX 2E2JJ 2WY8Q 1WJ5A 1NTCA 2H8WA 2VONA 3OL4A 3VWBA 3KZIC 1U9NA 2ZXJA 1X2MA 1W36D 1TWFJ 3NARA 1P6RA 4HX7A 2R7XA 2XVCA 2RAEA 2LKPA 3KZZA 3F3XA 2CGPA 3CO7C 1RETA 3FMSA 4WF2A 2V9PA 2LSOA 1RR8C 1IJWC 1BR1A 1PJRA 5B1AH 4CCOA 3V7CA 5K7ZA 1K79A 3R0JA 3TOAA 3T8RA 4D5CA 4XLHA 4S0HB 2NVYJ 4KA4A 1B4AA 4GFBA 4MLOA 1MNEA 4NDLA 1LQ1A 3BZ6A 1TQMA 4B09A 1IV8A 2PG4A 5EYRA 3K69A 4ZYGA 2L2OA 3V7RA 1LE8A 3CUOA 1VFCA 4C3JJ 1P92A 1XX5A 1HLVA 1QVUA 2V1DA 1DP3A 1XCVA 3EQLF 4HV6A 1JE8A 2M0CA 4XSXF 4D5FA 3ECOA 1NG6A 3ZMZA 2TDXA 3HBLA 4R1HA 3G73A 2ZNYA 1HKSA 2CW7A 5D5WB 4RMNA 4PJJA 1IN4A 3CCYA 1MMNA 2UWMA 5IOZA 2YU9J 3IH3A 4YIFA 4XRFA 4HAMA 2VOPA 4XRSA 4C2TA 1ZGWA 1X1PA 1SMTA 3A1YA 1KU7A 2BHYA 4M6XA 1YRNA 1IF1A 1UHMA 3BJ6A 1R4MB 5FKOA 4J19A 3E5QA 4Y4RA 3FHNA 4BXUA 4F55A 5ERIA 1ZTRA 3WU1B 2OCCH 4DZJA 4I99C 2EBIA 5JR3A 1X1BA 1MJBA 2R93J 2K4BA 3I4MJ 5E20A 1MNDA 2X1EA 2Y2ZA 3I55I 1EH7A 1MGTA 1BI3A 1WH5A 5GAGJ 2CUFA 4OINF 2LC2A 4NUBA 2MG4A 2HS5A 3GO5A 3RSNA 4FETA 4D9JA 5FLXZ 1RNLA 2YUSA 2D1VA 3W2WA 3K1NA 2CFOA 3T0YA 5E3MA 3GUDA 3WTYC 2A6TA 1SVLA 3QPTA 4I01A 3M1CA 5EGOB 1H9TA 2MSYA 1ZAOA 2UXXA 1PUFA 4A0ZA 3WTTC 3B6AA 5FFZA 4LJZF 3U2RA 2C6YA 5GPAA 5HLHA 3OYFA 1IC8A 3WU0A 4BGDA 1T33A 2LREA 1IO2A 4PGHA 1TNSA 3QRFF 3BZKA 3QQAA 4CZCA 1MNMC 3J7AY 1MBFA 1Z6TA 1JKPC 4AIDA 4H4KC 4C2MJ 5E79C 2X6OA 6PAXA 2L9SA 4EATA 5J1YA 2Y9ZA 4NQWA 2FU4A 4IHWA 1K78B 1VQ9I 1X3UA 1S72I 2R5YA 5F0FA 3HUGA 3R0AA 4IQ4A 4FISA 3QWLA 1ULYA 1O3QA 2HQ5A 2IA2A 3OWTA 1HW1A 4FHTA 1I6XA 2CV1A 4UHTA 3PIOF 5ICCA 2CO5A 3A0BC 3I71A 2JZYA 3TO7A 5HODA 2K5CA 4G7ZF 1DDNA 3FMRA 4ETSA 1E3HA 3J7AO 4G6TB 2VJJA 2K40A 4C9YA 1A6IA 2EA2A 3PNTA 5CLSA 3FISA 4ZYEA 2B0LA 3HGYA 2NS7A 2E7XA 2W1OA 4ZYAA 4QWQA 2XGXA 1D0YA 3PL8A 2XGDA 1Z0XA 2MABA 2EIMH 1DPRA 3Q0WA 3R60A 4AWXB 4P9UA 5LBQA 4GXOA 1YI2I 1QZEA 4P1WA 1UHSA 2BY3A 1FP2A 1KZHA 5KNLA 2D5VA 1AOYA 3KP4A 1ZARA 1Y6IA 1TTYA 1TT5B 1DGRM 3JRFA 1K61A 2XRLA 3WU2C 3H9QA 2VPRA 2XUBA 3LSMA 3JRDA 4GYIA 3I56I 3F8MA 2Y31A 5LRRA 2KHMA 3JRBA 2ZSIB 1BR2A 4G94A 5E3OA 1D5YA 4YFKF 5J1RA 2DMQA 3DBHB 2IGNA 1ON1A 3T1BA 4YFNF 4AIKA 1FSHA 3L09A 1YLFA 4Q48A 3L2UA 3FXUA 2LBFA 3VB2A 2O8XA 2LKXA 1PVEA 2HYGD 3SZTA 4AVPA 4EJUA 3LWFA 4A3MJ 4OWRB 4XLNF 3EPZA 4HOBA 1YFHA 3DEUA 3JSOA 4EM0B 3OOUA 4AIHA 5D8KB 4E7JA 3FK6A 2F6CA 2HDDA 4U0YA 4EJOA 1FSEA 1YHQI 3OYMA 3F23A 3PNVA 3AL0B 1BJAA 3I3LA 1XPXA 1PP7U 2FNAA 3MVPA 5DM7F 4DJAA 1D8JA 2BEOA 5E17F 2NAZA 5KVRA 4DYCA 5HDNA 4BU2A 3OIQA 3R4KA 4GRIA 1RR7A 2NRAC 5LLQA 3Q9SA 3ERMA 1WWXA 2XRNA 2NOGA 2HTSA 2BBYA 5ICFA 1E17A 2XGEA 1HCRA 4M9ZA 3SXYA 1IAWA 1XMXA 2KZVA 4CH7A 4FT8A 3KLOA 4RB2C 5J3LA 1V55H 1V5FA 4GCVA 3ZMVA 1W0UA 2GWRA 1LDDA 2CH0A 2V6EA 3CD6I 4HX4A 1X4PA 4LK0F 3HTSB 3GTOJ 2P5KA 1A31A 1ZLKA 4EV0A 5GAEJ 1BBYA 2DOAA 1JXSA 2DU9A 2WTEA 3KYDB 1IG7A 5IYCJ 3H5NA 1Y8RB 4RAFA 3AL0C 2LR8A 5F64A 5HS9A 2YU3A 2LKSA 4A3JJ 3BLYA 3KYCB 3G4SI 3HTUA 1G59A 1GVDA 2EJRA 3F8CA 4RLFA 2DDBA 5HS7A 1G4DA 3GX4X 2O0YA 3K70C 4GYGA 3H36A 1X58A 1D1BA 1J2XA 1ZR4A 3H0DA 5EDNA 2WADA 2F5FA 1R22A 1IN8A 4QSHA 4A93J 3OOPA 4JQFA 4J01A 3K4NA 4MTEA 3HSEA 3OSGA 1RRJA 3HDDA 1ZG3A 1ETXA 5A2QZ 2EINH 4UV9A 2KRFA 1ODDA 1KU2A 1KONA 3CZ6A 2Y69H 5GPCA 1JUPA 3HOSA 1WSUA 3OYGA 3CC7I 4QLCU 1X4OA 4L9TA 3WE3A 5IT3A 3MD2A 2QCOA 2R5ZB 2Z1DA 4M74A 5BPDA 4UUVA 2COBA 2EQRA 3IH2A 3GTJJ 3HOXJ 5B5EC 5J4VA 1Z3YA 3ECHA 3FXQA 3K2ZA 3ULQB 3M8EA 3VYRB 4EM2A 4M3EA 2WAFA 2BXYA 2K9QA 4ON0A 3MWMA 2ZJQF 4IHXA 1IRGA 4P55A 2DFEA 2W24A 4L0ZB 5FRMA 5TJJA 3TMOA 1VQOI 5L3EA 3PFIA 3K6GA 3D5SC 1XN7A 4ESFA 2LK2A 4E7KA 2IEKA 2K7LA 3L2WA 4DBQA 1ZN2A 2JVGA 1Z9CA 2EV0A 5JVGF 3BCAA 4A3EJ 2ZJPF 4AU7A 4ZC3A 3FBIB 3IP4B 2JPCA 4G12A 2MYSA 2BYVE 2QA4I 2EZLA 3DQVC 3FKJA 1ONVA 4F91B 2BXZA 4R79A 2ZXHA 3J81Z 3ZPLA 1S7EA 2IS6A 4TV7A 1NG7A 3DTEA 2M5WA 2V9VA 4XKWA 3HEFA 2LYCA 3K70D 4BJ5C 3CP8A 2WAQN 3W2VA 2W84A 3WTWC 3GZNB 2QF7A 4ZTJA 3WTVC 4XIDA 2ZJRF 2HQRA 1BIBA 3ELKA 1Z91A 5EG0B 1FTTA 5HLGA 2DN0A 1LJ9A 2B9SA 4IRHA 2ISZA 3CDIA 1QGPA 2VLAA 2QBYB 1D1CA 2FQ4A 3E6DA 4RM2A 3S3OA 1P2FA 1W7PD 4YIIA 5FB2A 3F72A 2DCEA 2VQLA 1STZA 2GLOA 2XF5A 1ZG5A 5HDGA 2R7VA 1W4MA 1GLNA 5CPRB 1SVMA 1MMDA 2ZMEB 1IN5A 1ACIA 4F92B 3CC4I 2M34A 2HQNA 3CMAI 1CF7A 4PDKA 5DYMA 3KIOA 1MMGA 3KEOA 4A5NA 2IA0A 1SEUA 5AONA 1K4TA 1ITYA 2P81A 3HSRA 2JA7J 1X1CA 2M4KA 2V6CA 3QODA 1D0ZA 5DTDA 4RBOA 2DDAA 1XGOA 3GZ5A 3CDHA 2M7BA 2XSDC 1FOYA 3ZQLA 1ZELA 3OY9A 4B3XA 2VOOA 1ZR2A 2JA6J 4IRGA 3CQZJ 1G3YA 1YX3A 3FF5A 3FM3A 5F0CA 2HOAA 1TQIA 2A3SA 1S7OA 2EPFA 3OYCA 4Q47A 3VFZA 1B59A 2KJBA 5JHFA 1IN6A 3Q5FA 4II2A 5F27A 3S3MA 4N9IA 3G71I 3FM5A 1TL8A 4M6YA 2LVSA 5J4YA 2OPTA 3IRQA 1VQNI 2BZTA 2X9DA 2QQBA 2ZMEC 2EH3A 3VYTB 1R49A 5D6FA 4N4OB 4A3CJ 1WI9A 2O6GE 2K85A 2HPMA 1OMIA 1Y0NA 5IYDJ 2ZO4A 1J9IA 2AXLA 4N0BA 2LLKA 1H89C 2B63J 5BQTA 2DMNA 1GXQA 1P4XA 1JJ8C 4QPOA 3Q9VA 1RPWA 4JOMA 4BS9A 1G8XA 1ZGJA 2OD5A 1ETYA 2X6WA 3ASNH 2J5OA 2XPVA 3WTXC 2JN6A 3L9FA 1XG1A 2CW8A 3MMYB 3LA3A 2BY1A 2R5ZA 3E7LA 4ENKA 2M87A 2XAFA 3E5XA 3K1MA 4HF0A 1X1AA 2L01A 2DBBA 1R5ID 1B1BA 3O8HA 1XDSA 3WHCA 2WV0A 3GVAA 3LSJA 3ZMSA 4ZYDA 1TW3A 4CA0A 4A3DJ 5EJCA 1TWCJ 2Q1ZB 4A3FJ 5M5YJ 2NOJB 2YS9A 2A69F 2EZKA 2WY7Q 5D5UB 4BL0B 5J47A 5TRDA 5LHIA 3DV8A 3REOA 1AU7A 2W00A 3DU5A 1ETWA 3WTZA 2F4OB 3PFYA 1BOBA 2VJ4A 2DFHA 2X85A 3CCVI 4OMYA 1LVAA 2H6CA 1ORKA 4UY8I 2NYXA 3HRTA 2I5UA 1Y39A 4HW0A 3GTPJ 3EUAA 4XBFA 4L9NA 3I4PA 3S17J 1IW7F 2ICWG 3W3CA 3K4KA 3GZ6A 2EFOA 1TNTA 2DA4A 2QQ8A 2F5CA 4IPAA 1BW6A 2H27A 1OQYA 3JRHA 4L9JA 3SEQA 3KEQA 3HOZJ 3HL2A 2L7ZA 3K4MA 3ZXSA 1HQCA 4PJ0C 2DYSH 3CUQC 3SZPA 4A3IJ 2UZKA 5JFRA 5GTHC 4KICA 3HGGA 3UKGA 4DBRA 2L7MP 5F1RA 2FMYA 3F0CA 3M1EA 4RB3C 1SD6A 4CXFA 3JRIA 4NBQA 5EG0A 3U9GA 2QM3A 3GXOA 1YW9A 3WGGA 1QBJA 4LB6B 1VQ5I 4M3GA 3AG1H 1R1UA 1JGGA 2KIUA 4U88A 4BHPA 3PQKA 2FE3A 2IS4A 1T95A 1PUFB 2JSPA 2QBYA 3OYNA 2A6EF 2CW0F 3S8PA 4FASD 3HPGA 1ETQA 2A68F 2XC7A 2QUFA 5IT9K 2CSOA 2Z3YA 1X2NA 4M71A 3BTIA 2N8GA 3HYIA 4E7SA 1VNDA 2ZMEA 4OIOF 3RJPA 4XLPF 1OLTA 4BBSJ 3H9GA 2RNJA 1RKTA 5FD5A 2V9KA 1ETKA 4P5OA 1SFEA 3LA7A 1J7KA 1XSDA 4XKCA 4I76A 3HOTA 3ZQIA 2XIGA 1ENHA 3NQOA 5JI6A 3CP2A 3DCFA 2STWA 1GXPA 2JA2A 2R5YB 3HUGB 4FX0A 3ZMUA 3GYHX 4BEHA 2AQFA 2F48A 2OA4A 4HPQA 3V8LA 3VSKA 4AYBA 4BHCA 2VKDA 5E3LA 1ZKGA 2HNHA 3V8JA 2VL8A 4EVIA 2FMLA 1A36A 1UMQA 1W1WE 2GM4A 3WTUC 2HVRA 1LEAA 3OIPA 3R6SA 2JRMA 3BG6A 4EJWA 4YFXF 3RI4A 4LG0A 2F4IA 1N77A 1JUSA 1SD7A 2CJJA 3TDZC 5DD8A 4X1EA 1FJLA 4RB0A 3RQ4A 4BH9A 3HJEA 1YE9A 2IJLA 1XS9A 1DPUA 1T0FC 1VQKI 2E2IJ 1SAXA 1V3FA 3CCQI 1G3WA 2R7TA 1T98A 5K7FA 2ZXIA 3MZHA 3D5RC 1OCOH 2NXNB 3TBIA 3L7WA 5IOYA 3ZOBA 4OIPF 1U8RA 3GTGJ 3OMYA 1ZK8A 2KIQA 2YR2A 2VB6A 5F04A 1LPQA 4IF4A 1S3JA 4ABZA 4RGXA 3ISPA 2DT5A 4AIJA 3D5LA 5D5VB 1J59A 2HEOA 3BC8A 3NAUA 1FWZA 3CCRI 2OZUA 2CUJA 3TO9A 4LB5A 2L02A 1FBUA 5DV5A 3WHBA 1FOKA 5DUIA 3S3NA 3RKXA 1YJWI 4KN4X 3CUQA 2VXZA 3IKTA 4XRSG 2LY9A 1B9MA 3IV5A 1VQPI 4NNJA 1HOMA 5LD2C 3HXLA 2LBFB 2R7FA 3HPHA 4DW6A 3MKWB 1LUJB 2QGUA 4AD9A 1I6HJ 2LY2A 5B1BH 4KT5C 3OYHA 1TT0A 5BOXA 1LEBA 1EH6A 3X2QH 3QU3A 2W25A 3GLXA 3S16J 2CMPA 2ZJ2A 2L3DA 4JK1X 2ELKA 4CHUA 4GDFA 2JT1A 2M2EA 3I9V2 3L2CA 2EWNA 4NB5A 2M0MA 1YYVA 3C2HA 1N75A 1Z1DA 5CJ9A 2RV8A 3ONQA 3QPSA 4RA2A 3R61A 1U0JA 4B8XA 4IOCF 3OR2C 3TL4X 1K6YA 3H92A 2OBPA 3ZQHA 4Y33A 5HNHA 1HDDC 1UFMA 2EFNA 2ME0A 2BOLA 2G0EA 4I0BA 3LSPA 5FRNA 3M7GA 3OYLA 2F5VA 3P7NA 5M3MJ 2XSJC 2LP0A 2K9MA 3TO6A 3IRRA 2DOFA 4Q4ZF 1WJEA 2DFFA 1HF0A 4OAZA 4C3IJ 5FJ8J 2GA1A 2UXNA 2DXIA 4XSZF 5J8CA 2FXAA 3L00A 1FMWA 3LSTA 4LIUA 1MKMA 4RGRA 2AXTC 1O57A 2E71A 2OZ6A 3UNGC 1WJFA 3BG7A 5LRSA 4HF1A 1WGXA 3GTQJ 3B6CA 1T0FA 3OYBA 1RI7A 3ABTA 5IY5H 1UHWA 1JHHA 2FF4A 4HG2A 2G9WA 2VI6A 3F8FA 5E3NA 4IEJA 3HRSA 2NVTJ 2D2WA 2HVQA 4BJTA 2EK5A 3CF5F 4Y7NJ 4LD5A 3KE2A 4JYKA 2HR3A 3AG2H 1V54H 4Y17A 3JRCA 1D5VA 2VBXA 2WB1A 2VJ5A 4UB8C 2GXGA 5FGMA 1ETOA 3H5AA 3S32A 3PO3J 2HZDA 3CLQA 1E2XA 3QAHA 1JT0A 1BL0A 1MSFC 2M1BA 1KGSA 2KPMA 4JX5A 4DOZA 4E6KG 4KN7X 2EILH 5D6EA 3DPUA 2E19A 2YSRA 1G6NA 1UCRA 4MTDA 1MBJA 2MA3A 3FXKA 4F93B 5H6RA 2FSWA 1KQ9A 2TRTA 1SAUA 1Z77A 2BV6A 2HWVA 2KT0A 4BY7J 5EEGA 1YS7A 1OPCA 2ZB9A 3CJNA 1YJNI 2XHKA 3V8KA 2LH9A 1T39A 3ABKH 2E1OA 2IGOA 3LL7A 2R7UA 2P7VB 4ENNA 3DTIA 4XNFA 5F6FA 1T08B 2AQEA 3EDPA 4U0VA 4Z6YA 2W82A 3IAS2 1H88C 2PMZA 3VDXA 1WHUA 2FBIA 2VQHA 2QYOA 1HXDA 3HG9A 3IHUA 3P9KA 4MQ9F 2JA5J 1B72A 1FYMA 3DPLC 2OU2A 4XONA 4KIFA 3BT9A 1SFKA 2K3FA 5F0HA 3KFWX 4JX6A 4G7OF 1PDNC 2ZSHB 5BPIA 1T8IA 1BI2A 1WH7A 3IUOA 3IL2A 3E1SA 2EIKH 4BHBA 2E5ZA 2DTZA 1R6RA 3A03A 3ABUA 2CQQA 4V2GA 3JTGA 2DFIA 1FYKA 3N4MA 4CGZA 1X3ZB 4LLGF 2DQLA 1RUOA 3EUHC 5J6XA 1JTXA 2JTVA 3BDDA 4HQMA 1YJ9I 3S14J 2RQQA 2Y0SA 2L54A 4MGRA 4HLYA 4HF2A 1G3SA 3ZN0A 5M5WJ 4JX4A 5EZHA 4UV8A 2GQQA 2MH9A 4B1RA 3DU6A 1N78A 5GAHJ 2DA5A 2IAIA 3FXLA 2E35A 1S7AA 2XAQA 3K7AJ 4KISA 4Y13A 3SFIA 1FIAA 3FX3A 5ED4A 4BE0A 2PJRA 5ILVA 4X6AJ 3DWLE 3GFIA 2WC2A 4I7HA 5L3BA 3C2BA 3SYTA 2F5EA 3K1PA 2LF8A 2M7AA 3NWSA 1DUXC 2KQRA 1IN7A 1LDJA 3MAJA 1MDMA 1JJ6C 1OCCH 2ZKZA 2GAUA 4V2FA 1TQPA 4HNUA 2QQAA 1F9NA 2LOOA 1A35A 1D3YA 3GLLA 1U6GA 2HI3A 2DLLA 5IP9J 4CCJA 4XN0A 1LFPA 2VIXA 2A07F 5DM6F 1HSJA 3K0LA 1WJAA 4XLFA 5DS9A 3CF2A 4KIBA 1FOXA 2RNGA 2O8KA 1CF7B 1F5TA 4XQFA 2KIFA 2TCTA 3V42A 3VYSB 4KMUX 2XAJA 1FEXA 3JCUC 2FRHA 3T8TA 5FLVA 3BG5A 3ZQQA 1UB9A 2YX4A 2DODA 1I3AA 4HLXA 5CKTA 4OIRF 1P7JA 4CICA 3HB9A 1OCZH 4HDUA 4CYCB 1I5ZA 3O8GA 1WVRA 2DI3A 2VBZA 2MH2A 4C2UA 4Q5SF 3M8JA 4CUGA 4FE4A 1MMAA 5EEHA 1Z3XA 1OFCX 4WX9A 1MBGA 3JR9A 5M3FJ 4E7HA 3ZMDA 3CDLA 2LMDA 4QIWN 2JJ7A 2VBYA 2QSHX 3S2HJ 4PJLA 3BWGA 4RLQA 2WWYA 1Y0UA 3SJMA 1VQ4I 2E36A 4YELA 5HLIA 1IXSB 4HA8A 4HYEA 2RN7A 1QPIA 4I6ZA 1VQ7I 3FMQA 4A5MA 5K5OA 3IAM2 1K6OA 2W4SA 3BQZA 4KT6A 2ME6A 1O7FA 3KP7A 2XF6A 2HOTA 3MZ8A 3L2QA 2OTLI 2M8EA 1MMSA 1JI8A 3CC2I 4FTHA 3DFGA 2FOWA 2MBFA 2OUMA 1IXCA 3BROA 4F52A 4PZJA 1NK3P 2XDVA 2Z2SB 3QPHA 1VQLI 1XDUA 5E1ZB 3BR0A 4Y3OA 2ELHA 3BR1A 1XCBA 3EUHA 3IWFA 5H20A 4MNUA 1YO5C 4L9VA 1TBXA 4A0YA 1A6QA 4MEYF 4RS8A 2B7EA 3KP6A 3CCMI 5CVRA 3J80K 2AS5F 3DKWA 3AAFA 4LLNA 1V4RA 3BPVA 5JLXA 1U5TA 4LLLA 3CJQB 1VTNC 2F4MB 1RKWA 1P4AA 1UJ8A 3BQYA 4JBAA 3RKWA 5K1YA 2FX0A 2P7CB 1XMKA 2E1NA 2E1MC 3QYFA 5FFXA 4MHGA 4X0GA 3ZQ7A 3HRMA 3EYYA 5EZGA 1HW2A 2Z33A 5KCMA 1O7LA 3QPLA 2IGKA 4PK4A 5L3CA 3F22A 5CVIA 3S1NJ 3K9TA 2L4MA 3LFKA 3N97A 1CGPA 2EV6A 1HSTA 1XGSA 3MCZA 2O5RA 1R4NB 3F9KA 3A4CA 1FP1D 2M30A 2MGQA 1ETVA 4KDPA 2RC4A 4EEFG 5LGUA 2UUZA 5HDKA 1G3TA 3CCJI 4IHTA 3JAMK 1DU6A 4E4HA 2YPRA 4U0WA 1EKEA 5BMZA 3HKZA 4BJ6C 1FY7A 2GIZA 3H3UA 4O3MA 2DJNA 3UR3C 1K7AA 4BXFA 2BGCA 3RPUA 2D1HA 1BM9A 2KMUA 3BTLA 5GP9A 3CMMA 3F8NA 3G2BA 3GF2A 5F1JA 2VPLA 1IV6A 3AFHA 1K4SA 5LEKA 3AG3H 5AIQA 4ESJA 2L7KA 2CU7A 2IGMA 4I02A 3HSFA 1POGA 4RAGA
chains in the Genus database with same CATH topology
1YIJI 1VQPI 1VQ6I 3DLLF 3I56I 3J7YJ 3CMEI 3EGVB 1YJNI 1FOYA 1VQ5I 3CC7I 3I55I 5GAGJ 1VQ4I 3G6EI 2E36A 3CCLI 2OTJI 1VQ7I 3G71I 2K3FA 2ZJQF 1VQNI 1MMSA 2OTLI 1YITI 4IOCF 3CC2I 2FOWA 1VQOI 3CCEI 4IO9F 1YHQI 1VQLI 2H8WA 1VQMI 5JVGF 2ZJPF 1YJ9I 5DM7F 3J7ZI 1WIBA 2QA4I 5GAHJ 3CCMI 1HC8A 3CCUI 2E35A 2QEXI 1VQ9I 3CJQB 1S72I 4V19K 3CCSI 3PIOF 2JQ7A 5GADJ 2E34A 3CD6I 1FOWA 3CJRB 2ZJRF 1VQKI 4IOAF 5GAEJ 3CJTB 3CCJI 3CCQI 1VQ8I 2NXNB 1QA6A 3CF5F 3CCVI 5DM6F 4UY8I 3CJSB 1Y39A 1FOXA 3G4SI 3CCRI 1YI2I 3PIPF 1ACIA 3CC4I 3CMAI 1YJWI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ I;  1VQP I;  1VQ6 I;  3DLL F;  3I56 I;  3J7Y J;  3CME I;  3EGV B;  1YJN I;  1FOY A;  1VQ5 I;  3CC7 I;  3I55 I;  5GAG J;  1VQ4 I;  3G6E I;  2E36 A;  3CCL I;  2OTJ I;  1VQ7 I;  3G71 I;  2K3F A;  2ZJQ F;  1VQN I;  1MMS A;  2OTL I;  1YIT I;  4IOC F;  3CC2 I;  2FOW A;  1VQO I;  3CCE I;  4IO9 F;  1YHQ I;  1VQL I;  2H8W A;  1VQM I;  5JVG F;  2ZJP F;  1YJ9 I;  5DM7 F;  3J7Z I;  1WIB A;  2QA4 I;  5GAH J;  3CCM I;  1HC8 A;  3CCU I;  2E35 A;  2QEX I;  1VQ9 I;  3CJQ B;  1S72 I;  4V19 K;  3CCS I;  3PIO F;  2JQ7 A;  5GAD J;  2E34 A;  3CD6 I;  1FOW A;  3CJR B;  2ZJR F;  1VQK I;  4IOA F;  5GAE J;  3CJT B;  3CCJ I;  3CCQ I;  1VQ8 I;  2NXN B;  1QA6 A;  3CF5 F;  3CCV I;  5DM6 F;  4UY8 I;  3CJS B;  1Y39 A;  1FOX A;  3G4S I;  3CCR I;  1YI2 I;  3PIP F;  1ACI A;  3CC4 I;  3CMA I;  1YJW I; 
#chains in the Genus database with same CATH topology
 4EQQ A;  4PGG A;  3KET A;  1QO0 D;  1W0T A;  1DQU A;  2GXA A;  3WGI A;  3LQR A;  5L3F A;  2FBK A;  5LGN A;  2XPW A;  3MKL A;  3JRA A;  3SHF A;  2ZCW A;  2Y30 A;  1ON2 A;  4OU0 A;  3COA C;  2E5N A;  3L2V A;  9ANT A;  4M73 A;  3I59 B;  2CRG A;  4XLE A;  3EGV B;  1VZ0 A;  4ZYH A;  4D0P A;  2NVX J;  2LD5 A;  1MBK A;  3NEU A;  2JUC A;  5L3G A;  1R1T A;  1WRJ A;  4K2E A;  2ZFU A;  4A69 C;  4YEJ A;  4A6D A;  4G6Q A;  2G7U A;  2QLZ A;  3BCB A;  2WV1 A;  2GZW A;  4HEA 2;  2OTJ I;  3LAJ A;  3I64 A;  3OV8 A;  2O3F A;  4MO7 A;  4M3F A;  2HPI A;  3FBN B;  1KA8 A;  3NWT A;  1Z7U A;  2ID6 A;  3DBL B;  3FXO A;  4HV5 A;  5LHH A;  2E2H J;  2JA8 J;  4CYC A;  3LNQ A;  1LFB A;  4BEH B;  3ZRG A;  5E18 F;  2ID3 A;  2O61 A;  2IBD A;  2PFB A;  1YX5 A;  2IVM A;  3JRG A;  1VQM I;  3SDG A;  5C44 J;  3JW4 A;  4AVZ A;  2MD5 A;  3KX2 A;  3E0J B;  1E3O C;  4LG0 B;  5GTI C;  4KMF A;  1K83 J;  5DD4 A;  5FLM J;  4B44 A;  1JKO C;  3U1K A;  4CO8 A;  2Z16 A;  3F6V A;  1IUF A;  2M8G X;  1XSX A;  4I0A A;  4ZDL A;  3S15 J;  3K4L A;  4ZTF A;  1W5S A;  3TQN A;  1QU3 A;  1IDY A;  4QTR A;  1TP4 A;  4S05 A;  3M3Y J;  5AIP A;  2ZBK A;  1BC8 C;  2NS8 A;  4HST A;  3TP0 A;  4AUX A;  1IZ1 A;  2JMW A;  1B9N A;  5CQG A;  3CO6 C;  3LQQ A;  2V1N A;  1MJ9 A;  1QA6 A;  3OYK A;  1O4X A;  2XB5 A;  1XGM A;  3G1M A;  1LNW A;  3K4J A;  3ZP5 A;  2FA5 A;  2DJI A;  3HOU J;  3I0T A;  2XKO A;  3C7J A;  3CUQ B;  2K02 A;  5L3D A;  3K10 A;  2KRH A;  2W7N A;  3LSI A;  4AC0 A;  1B8I A;  4PUS A;  3I54 A;  2OF7 A;  4Z2Y A;  3DLA A;  2DPD A;  3U21 A;  2K27 A;  4PFO A;  2A5W A;  3ESW B;  2X6X A;  4PJN A;  5C3E J;  3HZJ A;  1YIJ I;  2RRE A;  3RKY A;  2Q8K A;  2O9L A;  1T56 A;  1LDK B;  2QZ8 A;  3W6K B;  5EEA A;  3D1N I;  1KQ8 A;  1ZH5 A;  3BTC A;  3M07 A;  1U3E M;  2A6H F;  2F2E A;  1APL C;  1MH3 A;  2P6S A;  3E3V A;  5FKM A;  3VOD A;  2PBI A;  4XN3 A;  4F3Q A;  4L5I A;  2Z5U A;  1ZRC A;  2M3A A;  3C2G A;  4BQQ A;  5CVU A;  4AYB N;  1T2K A;  3PJR A;  4JP0 A;  3WG7 H;  2WAE A;  4BYY A;  5CQE A;  1TWH J;  2DA6 A;  1TLH B;  3ABL H;  3AG4 H;  4B4C A;  2DAO A;  2DMU A;  2LRD A;  2VJI A;  3HOW J;  3P9I A;  1GUU A;  5FKK A;  2V1X A;  1Y8Q B;  2COM A;  3F8B A;  4BXX J;  4BE1 A;  4OOI A;  3GCM A;  4A0X A;  1X3W B;  4M3B A;  4KUM A;  2LDU A;  4UXN A;  1YIT I;  3RTR A;  2VXD A;  2X48 A;  2K9N A;  1EH8 A;  2H1K A;  2XF7 A;  4XK4 A;  4ANJ A;  2ACJ A;  1Z6R A;  4XR6 A;  4BQO A;  1D8K A;  3C1D A;  1PUE E;  2JRT A;  3MN2 A;  1JUM A;  1USS A;  4DNC A;  2IS1 A;  1IDZ A;  1R58 A;  2P0W A;  3VYU B;  3EUK L;  3KCC A;  5M5X J;  4EJT A;  1XGN A;  1TWG J;  2H1L A;  3I59 A;  4I09 A;  1UG2 A;  3LSG A;  1IRX A;  2HYJ A;  1SMY F;  1TC3 C;  5H2F C;  1T38 A;  5D4S A;  1OCT C;  1H9G A;  2KFD A;  4IJA A;  4BAY A;  2BE5 F;  3KP5 A;  2K9L A;  1CQT A;  2CUZ A;  2EB7 A;  1L3L A;  2HXO A;  5TIS C;  1WJB A;  3BJO A;  2Q2E B;  1HBX G;  5DDG A;  3RZD J;  4DIQ A;  2PX9 A;  2HKX A;  3GFJ A;  3VPR A;  4G8X A;  3HM5 A;  4KFC A;  3LA2 A;  2ESN A;  2EZI A;  3RDI A;  1IRF A;  4IX7 A;  2K9S A;  1LKX A;  1QZZ A;  4XOR A;  5JHU A;  2EFW A;  2DYR H;  1GHC A;  3AKZ A;  1AHD P;  3WGH A;  2IRF G;  2QEN A;  2FEZ A;  2UV1 A;  1JT6 A;  2P5V A;  1Z21 A;  3Q0V A;  4RGU A;  4WXC A;  5D5X B;  3U1D A;  5HNF A;  4FCY A;  3TED A;  2BVM A;  1YW8 A;  4L0Y B;  4A12 A;  3MKZ A;  1ZRD A;  3GWZ A;  5HLT A;  5D4R A;  3GFM A;  3BP8 A;  2FBH A;  4UUS B;  2PMU A;  4M72 A;  2HVS A;  4EM1 A;  1MZB A;  1J09 A;  1HDP A;  2HYF A;  3HOV J;  3DTK A;  2V7F A;  4N4N B;  5TGT A;  3KYL A;  2DQR A;  3QP6 A;  1OCP A;  4LG3 A;  4ZH4 F;  2STT A;  1VI0 A;  4RAY A;  3TDU C;  1Z05 A;  1SC7 A;  1UZC A;  5B3S H;  5B66 C;  2GA2 A;  1I27 A;  4C30 A;  3LMM A;  1BW5 A;  2A5Y B;  1D0X A;  1FBS A;  4Y52 J;  3K2A A;  2CYY A;  2AHQ A;  2KDO A;  2W48 A;  3I53 A;  4O5V A;  4CDG A;  1WQ2 A;  4CYD A;  4PSX A;  1T6S A;  1B72 B;  3GTM J;  3A02 A;  4EMS A;  1DU0 A;  1TW2 A;  3O3K A;  5E1W A;  1BI1 A;  3MKY B;  3DF8 A;  4WK8 F;  1FMV A;  1ZGA A;  3FDY A;  3CCL I;  3S2W A;  2VT3 A;  2XRO A;  4A3K J;  2RQP A;  1OKR A;  4O6J A;  1LFU P;  3ABM H;  3FWE A;  3I5U A;  3F21 A;  1OR7 C;  1PYV A;  3LSR A;  3G1O A;  2CQX A;  5F08 A;  4UB6 C;  3TKY A;  1U2W A;  4KYW A;  2FJ1 A;  1R9T J;  1HKT A;  3H35 A;  3KPH A;  3CCE I;  3MZY A;  2DA7 A;  1Z67 A;  4W1U A;  4OIQ F;  4W97 A;  2E7W A;  4S04 A;  3C3W A;  3CES A;  2K3P A;  1O3S A;  1YTY A;  2PJR B;  1WI3 A;  1YIO A;  4F7Z A;  1JTY A;  2LFB A;  4HBL A;  2VBW A;  2EZH A;  1UEL B;  3QU6 A;  1FT9 A;  2G7H A;  2GOX B;  2A05 A;  4N9H A;  2WB1 N;  2QKL B;  2HTJ A;  1HC8 A;  2VKE A;  1HA8 A;  1BJZ A;  1F1Z A;  2QEX I;  5FKL A;  2PI0 A;  5IP6 A;  1MDM B;  4BNC A;  1EV7 A;  1WFX A;  4CSW A;  2DA1 A;  2DK8 A;  2GBY A;  2OJE D;  3E5U A;  4B43 A;  1R7J A;  1BI0 A;  1V5E A;  3P9C A;  3QOP A;  4LIV A;  3HHG A;  2YX7 A;  1KYW A;  5J8F A;  2Y48 A;  4M3D A;  3ZQC A;  2J5P A;  5J40 A;  1TWA J;  1F36 A;  1E0E A;  3CJR B;  3IC7 A;  2ESH A;  1AKH A;  3ERE D;  2HZT A;  4IKF A;  1BR4 A;  2HOE A;  1FPQ A;  1KU3 A;  2L0K A;  4IL6 C;  3S1R J;  3RYR A;  1W5T A;  4BKX A;  5C4J J;  3N05 A;  1TZL A;  3LOC A;  1FLI A;  1WJC A;  1ZYR F;  5EF6 A;  2IXS A;  2IT0 A;  3CJS B;  4XLC A;  2PMZ N;  1WCM J;  3PNY A;  3IWZ A;  3BG3 A;  2PN6 A;  2I10 A;  5ILU A;  1R5G A;  5E8I A;  5FO5 A;  2WBM A;  3M9A A;  3PIP F;  3A2K A;  4R8H A;  2H8R A;  2OQR A;  3BG9 A;  4D1Q A;  3IH4 A;  4ENM A;  3HC7 A;  2Q2E A;  1Y1W J;  5FD6 A;  5LFA A;  3OYD A;  2IA1 A;  2BY2 A;  3K4B A;  2Y75 A;  3ZMT A;  4IVN A;  5DUK A;  3PO2 J;  2OCE A;  4A3L J;  4G9Y A;  3CME I;  2Y0S N;  1O3R A;  3LAP A;  1UST A;  4AM3 A;  1MJA A;  5J1U A;  2FD5 A;  1SFU A;  5FLX K;  2FUG 2;  1UG0 A;  3B02 A;  2X0L A;  3H5R A;  2EFP A;  1F4K A;  4IRI A;  1HW5 A;  4XL9 A;  1J5Y A;  2DT7 B;  2ETH A;  3G6E I;  5HS8 A;  2HFH A;  1WZ2 A;  2P8T A;  3HOY J;  2HXI A;  3H3Z A;  3H0G J;  2R92 J;  3BR2 A;  2RDP A;  3M4O J;  3IKV A;  2Z9O A;  1ZQ3 P;  4BQN A;  4UUS A;  1OR7 A;  1SAN A;  3RCO A;  1GV5 A;  4XMY A;  3FXM A;  3ZQG A;  1UAA A;  3OS2 A;  3JRE A;  3QYB A;  2RKH A;  3Q0U A;  5DCM A;  3ZCO A;  4DGW B;  3GTL J;  4U87 A;  3DKX A;  1BOA A;  2MD0 A;  3GME A;  1GT0 C;  1FX7 A;  2JK3 A;  2XAU A;  4WXH A;  2GOM A;  3A01 B;  1ZRE A;  1U5T B;  3ROU A;  4BDZ A;  3BY6 A;  3VOE A;  3GFL A;  4E70 A;  2IPQ X;  2O03 A;  4A3G J;  1OYW A;  2CUE A;  4C3H J;  4ZDP A;  3FXR A;  5D8L B;  2Y0M A;  3B73 A;  3BPX A;  4BDY A;  1I39 A;  4WWC A;  2DW4 A;  4XOT A;  4DZP A;  4ENJ A;  5IYB J;  2JUG A;  2XAG A;  4V19 K;  2XKP A;  3O6B B;  3VEP A;  1MSE C;  1BN5 A;  2X1C A;  2KP6 A;  4A2U A;  5ICE A;  5K5R A;  4FE7 A;  2NS0 A;  4DQ2 A;  2HOS A;  4IZZ A;  4I98 B;  1H0M A;  3K4C A;  5FRO A;  3RIR A;  3W6J B;  2QVO A;  5E1X A;  1AA7 A;  1FBQ A;  2L9R A;  4IOA F;  4ASN A;  2DK5 A;  2LY1 A;  3OYJ A;  5KHD A;  4RB1 A;  2R7R A;  2DOE A;  2OQG A;  1OJL A;  3BJA A;  1U5T C;  2ADU A;  1FYL A;  1Y1V J;  1XTA A;  4IHY A;  2VUM J;  2M4G A;  3E6M A;  1RUN A;  4CCL A;  2E1C A;  3PUF A;  5BS6 A;  1P7I A;  2HKO A;  1OCR H;  3G1L A;  4Y15 A;  1R00 A;  1QQI A;  3DPT A;  4II3 A;  4CCM A;  4D7M A;  1P9Q C;  4LOC A;  1ZRF A;  3CTA A;  3PM1 A;  4DYQ A;  4ZZL A;  5ILS A;  1R36 A;  5DEQ A;  4HZF A;  1JKR C;  3TW6 A;  2L9N A;  2KRC A;  1A5J A;  4PCQ A;  3LFU A;  1VQ6 I;  4A6E A;  5C4X J;  1BC7 C;  4B47 A;  2DT6 A;  4P9F A;  3RZO J;  1S8N A;  1LVK A;  2L5Q A;  3FK7 A;  1RZ4 A;  4HX8 A;  2EA4 A;  4LMY A;  2BW3 B;  3J7Y J;  1EA3 A;  1QPM A;  1EJ9 A;  3S1M J;  2QSF X;  2MC3 A;  3DBR B;  4G7H F;  3RQI A;  3OYE A;  3QOE A;  4IHS A;  4YRV A;  3BZC A;  4NC8 A;  5IP7 J;  4UNO A;  2KKO A;  2WA0 A;  3L1P A;  2R3S A;  4BUP A;  2OV7 A;  3HRU A;  3ZQF A;  4DYR A;  3E6C C;  2CG4 A;  4CCN A;  3FZV A;  1X19 A;  2V79 A;  2JPB A;  1JHF A;  4E7I A;  3MFK A;  3OYI A;  4MQV A;  2DTR A;  2ZFW A;  1NHA A;  1WKM A;  1MBE A;  4PJM A;  3DXJ F;  3OS0 A;  5EGO A;  1RIO H;  1P4W A;  3V7S A;  2RVC A;  3HKZ N;  4BE2 A;  1KQ0 A;  2P4W A;  5JLW A;  3OIO A;  1WIB A;  2DO7 A;  4G6D A;  4UVA A;  1ERD A;  1L0O C;  1U8B A;  4KIG A;  1MH4 A;  1W7P B;  2E1M B;  3E6B A;  4LGW A;  3WTS C;  1XD7 A;  1ZHF A;  4LFU A;  1R5H A;  5KK1 A;  3CCU I;  1OYY A;  2X51 A;  3BR5 A;  3PSI A;  3GTK J;  1H8A C;  3OYA A;  3RPQ A;  4LK1 F;  3M8F A;  4IXA A;  1SVO A;  2MLG A;  3ASO H;  2V1U A;  3SDB A;  3L2R A;  3J80 Z;  2VE9 A;  4KJZ A;  3CCS I;  2F5D A;  3C18 A;  3H9J A;  3VSL A;  4NC7 A;  2EV5 A;  3PQJ A;  1R71 A;  1K78 A;  3E97 A;  2X6Y A;  2CS3 A;  5GAD J;  3WOD F;  1I3Q J;  1QHG A;  3DEW A;  4L18 B;  3I4N J;  3F6O A;  3I58 A;  3DKY A;  1QZY A;  3BTJ A;  1FNN A;  3GEZ A;  1YQA A;  2ELJ A;  4XKB A;  4CZZ A;  2XAH A;  1FC3 A;  2HGC A;  2KZG A;  1NK2 P;  3A01 A;  1VQ8 I;  2VQG A;  2DA3 A;  2W85 A;  3QP5 A;  1B8I B;  2IP2 A;  3G3Z A;  3RPU D;  2EIJ H;  2Q0O A;  4B48 A;  4UVC A;  2KDZ A;  3JAM Z;  1Y56 A;  1R1V A;  1D1A A;  2MC4 A;  3D0S A;  3WG9 A;  3P5J A;  1VF9 A;  1PP8 F;  2K4J A;  3A0H C;  1QNT A;  5ICG A;  3ML6 A;  1IGN A;  2X4H A;  5A2Q K;  1IRZ A;  2XB0 X;  4WCG A;  1J0R A;  1S29 A;  3W2A A;  1SD5 A;  1I50 J;  1XB4 A;  3DLL F;  3FIW A;  1ZLJ A;  4EGY A;  1A04 A;  2A61 A;  1DGW Y;  2QKM B;  5CVJ A;  1FIP A;  4YIR X;  4FX4 A;  4GO1 A;  4M9S A;  2ECC A;  4M9X A;  3KEY A;  1REP C;  5K7H A;  2D45 A;  3JSP A;  4HRI A;  2IS2 A;  4NHJ A;  1GVJ A;  4ZJZ A;  4HQE A;  2L9V A;  2OC6 A;  3KLN A;  4D7N A;  4H0E A;  2VAS A;  1U78 A;  3GBG A;  3HHH A;  3SEZ A;  3SZG A;  2PEX A;  4IQJ A;  2P6T A;  2VC0 A;  4L5E A;  1O3T A;  2FQ3 A;  2Z99 A;  3S2D J;  2VT2 A;  2ZC2 A;  4HSR A;  2BVL A;  4PSW A;  5CYV A;  4EJV A;  2P5L C;  1I1S A;  2IW5 A;  3DEE A;  1YS6 A;  2BW3 A;  1N25 A;  5JVT A;  2Y9Y A;  4XKV A;  4OMZ A;  3J81 K;  2KIS A;  5DCF A;  1MD0 A;  1YOV B;  3S93 A;  3MQ0 A;  3DP7 A;  4E7L A;  1YW7 A;  2NNY A;  4IHV A;  4I2O A;  3KP3 A;  2E60 A;  2CQK A;  4RDU A;  2FOK A;  3WE2 A;  4CCK A;  4U7B A;  4KIT B;  2KLO A;  3CLO A;  2M9H A;  2JQ7 A;  3V4G A;  2R7W A;  2CV0 A;  1Z7L A;  2ZXW H;  3BR3 A;  3TGN A;  1MW7 A;  4HDV A;  3MEX A;  4KNY A;  1V5G A;  2VE8 A;  3CJT B;  1S6L A;  1S5L C;  1SD4 A;  3W6V A;  5LEJ A;  4EGZ A;  2FNP A;  3KP2 A;  3TP3 A;  3H1C A;  1W7P A;  1Q1V A;  2L4A A;  1EF4 A;  2R0Q C;  3LSK A;  2XGC A;  2PMH A;  2PJP A;  2QQ9 A;  1XMA A;  2PLY A;  1M1E B;  2LG4 A;  3H3V K;  2JVH A;  2HQA A;  1YG2 A;  1SFX A;  4M6V A;  4BBR J;  2WAQ A;  4J00 A;  3TOB A;  1MBH A;  2V26 A;  4NC6 A;  2XPU A;  2KIM A;  2HDC A;  1F43 A;  1DP7 P;  2LF7 A;  4XRM A;  3ZGK A;  2R7Q A;  4XIC A;  2ECB A;  3LSH A;  2MW8 A;  5H6Q A;  1MIJ A;  2DA2 A;  4GGG A;  4BY1 J;  5KAF C;  2JWT A;  2V4J C;  4XM3 A;  1C0W A;  5K5Q A;  1R23 A;  2H09 A;  3PSF A;  5LHG A;  4PFP A;  4OAY A;  2R7O A;  4ESB A;  5HOO A;  3RYP A;  1KU9 A;  3FHZ A;  3O2P E;  3FXJ A;  2HDW A;  2K86 A;  1QRY A;  4A3B J;  4XLA A;  3TW7 A;  4QPQ A;  1HKQ A;  4UUT A;  1LE8 B;  1IUY A;  3GW2 A;  3OL3 A;  3CMY A;  3BR6 A;  2XAS A;  1FTZ A;  1J75 A;  3OSF A;  1QHH D;  2X1D A;  3EYI A;  3J7Z I;  2MFZ A;  2O7O A;  1XSV A;  1JKQ C;  2CFX A;  1X1D A;  2LTP A;  5BNG A;  4UVB A;  1OIS A;  2W57 A;  1WPK A;  2R7S A;  1G2H A;  2NVQ J;  2R7Z J;  1AKH B;  3ZR8 X;  5KAI C;  2CWE A;  1U9O A;  4WXD A;  2H94 A;  2GIV A;  4FQG A;  3ZN1 A;  5CVV A;  1YRN B;  1OYI A;  1Q1H A;  2H6B A;  2RGV A;  5IT9 Z;  4RAZ A;  1BIA A;  1RES A;  2E34 A;  2JSC A;  1FOW A;  1JGS A;  3KZY A;  4BQA A;  1W36 C;  1AWC A;  2DMT A;  2KL4 A;  4MIM A;  2CQ7 A;  4HNV A;  1GV2 A;  4XOP A;  3SQN A;  2VN2 A;  2CV2 A;  4ZZD A;  2XV4 S;  2KJC A;  3RKQ A;  3FKI J;  1RC9 A;  1I1G A;  2LNB A;  3OR1 C;  4E7Z A;  3NRV A;  1S9H A;  5E8G A;  2R4G A;  1WJD A;  2NNN A;  5HVQ C;  2GXB A;  4MFD A;  1IXR C;  4LIT A;  3PUB A;  2HU9 A;  4ZDO A;  4U7D A;  5FKN A;  2VQC A;  2VOD A;  3QYE A;  1W5C C;  2PQ8 A;  3OS1 A;  2DPU A;  3SFZ A;  1QVT A;  2DMP A;  3BOQ A;  4YG2 F;  1LB2 A;  4P96 A;  2R7D A;  2VC1 A;  1BA5 A;  4MFE A;  1NH3 A;  2EFQ A;  1B6A A;  4MEX F;  1GDT A;  2AO9 A;  5LGT A;  1E3P A;  1XC5 A;  1SFO J;  3T5X A;  4RM3 A;  5IPA A;  2L7F P;  2M45 A;  4ITV A;  4NQW B;  4BAC A;  4RGS A;  2BY0 A;  5DCM B;  3EET A;  1ZG1 A;  2MLK A;  3HIF A;  4B3A A;  1FZP B;  2QWW A;  2NVU B;  3S1Q J;  2ZNZ A;  4HNT A;  2I8D A;  2CQN A;  2BHZ A;  3Q3S A;  3JTH A;  1KYZ A;  2OAZ A;  2VKH A;  2VKV A;  2ISY A;  4L5J A;  4IO9 F;  2QSG X;  2E2J J;  2WY8 Q;  1WJ5 A;  1NTC A;  2H8W A;  2VON A;  3OL4 A;  3VWB A;  3KZI C;  1U9N A;  2ZXJ A;  1X2M A;  1W36 D;  1TWF J;  3NAR A;  1P6R A;  4HX7 A;  2R7X A;  2XVC A;  2RAE A;  2LKP A;  3KZZ A;  3F3X A;  2CGP A;  3CO7 C;  1RET A;  3FMS A;  4WF2 A;  2V9P A;  2LSO A;  1RR8 C;  1IJW C;  1BR1 A;  1PJR A;  5B1A H;  4CCO A;  3V7C A;  5K7Z A;  1K79 A;  3R0J A;  3TOA A;  3T8R A;  4D5C A;  4XLH A;  4S0H B;  2NVY J;  4KA4 A;  1B4A A;  4GFB A;  4MLO A;  1MNE A;  4NDL A;  1LQ1 A;  3BZ6 A;  1TQM A;  4B09 A;  1IV8 A;  2PG4 A;  5EYR A;  3K69 A;  4ZYG A;  2L2O A;  3V7R A;  1LE8 A;  3CUO A;  1VFC A;  4C3J J;  1P92 A;  1XX5 A;  1HLV A;  1QVU A;  2V1D A;  1DP3 A;  1XCV A;  3EQL F;  4HV6 A;  1JE8 A;  2M0C A;  4XSX F;  4D5F A;  3ECO A;  1NG6 A;  3ZMZ A;  2TDX A;  3HBL A;  4R1H A;  3G73 A;  2ZNY A;  1HKS A;  2CW7 A;  5D5W B;  4RMN A;  4PJJ A;  1IN4 A;  3CCY A;  1MMN A;  2UWM A;  5IOZ A;  2YU9 J;  3IH3 A;  4YIF A;  4XRF A;  4HAM A;  2VOP A;  4XRS A;  4C2T A;  1ZGW A;  1X1P A;  1SMT A;  3A1Y A;  1KU7 A;  2BHY A;  4M6X A;  1YRN A;  1IF1 A;  1UHM A;  3BJ6 A;  1R4M B;  5FKO A;  4J19 A;  3E5Q A;  4Y4R A;  3FHN A;  4BXU A;  4F55 A;  5ERI A;  1ZTR A;  3WU1 B;  2OCC H;  4DZJ A;  4I99 C;  2EBI A;  5JR3 A;  1X1B A;  1MJB A;  2R93 J;  2K4B A;  3I4M J;  5E20 A;  1MND A;  2X1E A;  2Y2Z A;  3I55 I;  1EH7 A;  1MGT A;  1BI3 A;  1WH5 A;  5GAG J;  2CUF A;  4OIN F;  2LC2 A;  4NUB A;  2MG4 A;  2HS5 A;  3GO5 A;  3RSN A;  4FET A;  4D9J A;  5FLX Z;  1RNL A;  2YUS A;  2D1V A;  3W2W A;  3K1N A;  2CFO A;  3T0Y A;  5E3M A;  3GUD A;  3WTY C;  2A6T A;  1SVL A;  3QPT A;  4I01 A;  3M1C A;  5EGO B;  1H9T A;  2MSY A;  1ZAO A;  2UXX A;  1PUF A;  4A0Z A;  3WTT C;  3B6A A;  5FFZ A;  4LJZ F;  3U2R A;  2C6Y A;  5GPA A;  5HLH A;  3OYF A;  1IC8 A;  3WU0 A;  4BGD A;  1T33 A;  2LRE A;  1IO2 A;  4PGH A;  1TNS A;  3QRF F;  3BZK A;  3QQA A;  4CZC A;  1MNM C;  3J7A Y;  1MBF A;  1Z6T A;  1JKP C;  4AID A;  4H4K C;  4C2M J;  5E79 C;  2X6O A;  6PAX A;  2L9S A;  4EAT A;  5J1Y A;  2Y9Z A;  4NQW A;  2FU4 A;  4IHW A;  1K78 B;  1VQ9 I;  1X3U A;  1S72 I;  2R5Y A;  5F0F A;  3HUG A;  3R0A A;  4IQ4 A;  4FIS A;  3QWL A;  1ULY A;  1O3Q A;  2HQ5 A;  2IA2 A;  3OWT A;  1HW1 A;  4FHT A;  1I6X A;  2CV1 A;  4UHT A;  3PIO F;  5ICC A;  2CO5 A;  3A0B C;  3I71 A;  2JZY A;  3TO7 A;  5HOD A;  2K5C A;  4G7Z F;  1DDN A;  3FMR A;  4ETS A;  1E3H A;  3J7A O;  4G6T B;  2VJJ A;  2K40 A;  4C9Y A;  1A6I A;  2EA2 A;  3PNT A;  5CLS A;  3FIS A;  4ZYE A;  2B0L A;  3HGY A;  2NS7 A;  2E7X A;  2W1O A;  4ZYA A;  4QWQ A;  2XGX A;  1D0Y A;  3PL8 A;  2XGD A;  1Z0X A;  2MAB A;  2EIM H;  1DPR A;  3Q0W A;  3R60 A;  4AWX B;  4P9U A;  5LBQ A;  4GXO A;  1YI2 I;  1QZE A;  4P1W A;  1UHS A;  2BY3 A;  1FP2 A;  1KZH A;  5KNL A;  2D5V A;  1AOY A;  3KP4 A;  1ZAR A;  1Y6I A;  1TTY A;  1TT5 B;  1DGR M;  3JRF A;  1K61 A;  2XRL A;  3WU2 C;  3H9Q A;  2VPR A;  2XUB A;  3LSM A;  3JRD A;  4GYI A;  3I56 I;  3F8M A;  2Y31 A;  5LRR A;  2KHM A;  3JRB A;  2ZSI B;  1BR2 A;  4G94 A;  5E3O A;  1D5Y A;  4YFK F;  5J1R A;  2DMQ A;  3DBH B;  2IGN A;  1ON1 A;  3T1B A;  4YFN F;  4AIK A;  1FSH A;  3L09 A;  1YLF A;  4Q48 A;  3L2U A;  3FXU A;  2LBF A;  3VB2 A;  2O8X A;  2LKX A;  1PVE A;  2HYG D;  3SZT A;  4AVP A;  4EJU A;  3LWF A;  4A3M J;  4OWR B;  4XLN F;  3EPZ A;  4HOB A;  1YFH A;  3DEU A;  3JSO A;  4EM0 B;  3OOU A;  4AIH A;  5D8K B;  4E7J A;  3FK6 A;  2F6C A;  2HDD A;  4U0Y A;  4EJO A;  1FSE A;  1YHQ I;  3OYM A;  3F23 A;  3PNV A;  3AL0 B;  1BJA A;  3I3L A;  1XPX A;  1PP7 U;  2FNA A;  3MVP A;  5DM7 F;  4DJA A;  1D8J A;  2BEO A;  5E17 F;  2NAZ A;  5KVR A;  4DYC A;  5HDN A;  4BU2 A;  3OIQ A;  3R4K A;  4GRI A;  1RR7 A;  2NRA C;  5LLQ A;  3Q9S A;  3ERM A;  1WWX A;  2XRN A;  2NOG A;  2HTS A;  2BBY A;  5ICF A;  1E17 A;  2XGE A;  1HCR A;  4M9Z A;  3SXY A;  1IAW A;  1XMX A;  2KZV A;  4CH7 A;  4FT8 A;  3KLO A;  4RB2 C;  5J3L A;  1V55 H;  1V5F A;  4GCV A;  3ZMV A;  1W0U A;  2GWR A;  1LDD A;  2CH0 A;  2V6E A;  3CD6 I;  4HX4 A;  1X4P A;  4LK0 F;  3HTS B;  3GTO J;  2P5K A;  1A31 A;  1ZLK A;  4EV0 A;  5GAE J;  1BBY A;  2DOA A;  1JXS A;  2DU9 A;  2WTE A;  3KYD B;  1IG7 A;  5IYC J;  3H5N A;  1Y8R B;  4RAF A;  3AL0 C;  2LR8 A;  5F64 A;  5HS9 A;  2YU3 A;  2LKS A;  4A3J J;  3BLY A;  3KYC B;  3G4S I;  3HTU A;  1G59 A;  1GVD A;  2EJR A;  3F8C A;  4RLF A;  2DDB A;  5HS7 A;  1G4D A;  3GX4 X;  2O0Y A;  3K70 C;  4GYG A;  3H36 A;  1X58 A;  1D1B A;  1J2X A;  1ZR4 A;  3H0D A;  5EDN A;  2WAD A;  2F5F A;  1R22 A;  1IN8 A;  4QSH A;  4A93 J;  3OOP A;  4JQF A;  4J01 A;  3K4N A;  4MTE A;  3HSE A;  3OSG A;  1RRJ A;  3HDD A;  1ZG3 A;  1ETX A;  5A2Q Z;  2EIN H;  4UV9 A;  2KRF A;  1ODD A;  1KU2 A;  1KON A;  3CZ6 A;  2Y69 H;  5GPC A;  1JUP A;  3HOS A;  1WSU A;  3OYG A;  3CC7 I;  4QLC U;  1X4O A;  4L9T A;  3WE3 A;  5IT3 A;  3MD2 A;  2QCO A;  2R5Z B;  2Z1D A;  4M74 A;  5BPD A;  4UUV A;  2COB A;  2EQR A;  3IH2 A;  3GTJ J;  3HOX J;  5B5E C;  5J4V A;  1Z3Y A;  3ECH A;  3FXQ A;  3K2Z A;  3ULQ B;  3M8E A;  3VYR B;  4EM2 A;  4M3E A;  2WAF A;  2BXY A;  2K9Q A;  4ON0 A;  3MWM A;  2ZJQ F;  4IHX A;  1IRG A;  4P55 A;  2DFE A;  2W24 A;  4L0Z B;  5FRM A;  5TJJ A;  3TMO A;  1VQO I;  5L3E A;  3PFI A;  3K6G A;  3D5S C;  1XN7 A;  4ESF A;  2LK2 A;  4E7K A;  2IEK A;  2K7L A;  3L2W A;  4DBQ A;  1ZN2 A;  2JVG A;  1Z9C A;  2EV0 A;  5JVG F;  3BCA A;  4A3E J;  2ZJP F;  4AU7 A;  4ZC3 A;  3FBI B;  3IP4 B;  2JPC A;  4G12 A;  2MYS A;  2BYV E;  2QA4 I;  2EZL A;  3DQV C;  3FKJ A;  1ONV A;  4F91 B;  2BXZ A;  4R79 A;  2ZXH A;  3J81 Z;  3ZPL A;  1S7E A;  2IS6 A;  4TV7 A;  1NG7 A;  3DTE A;  2M5W A;  2V9V A;  4XKW A;  3HEF A;  2LYC A;  3K70 D;  4BJ5 C;  3CP8 A;  2WAQ N;  3W2V A;  2W84 A;  3WTW C;  3GZN B;  2QF7 A;  4ZTJ A;  3WTV C;  4XID A;  2ZJR F;  2HQR A;  1BIB A;  3ELK A;  1Z91 A;  5EG0 B;  1FTT A;  5HLG A;  2DN0 A;  1LJ9 A;  2B9S A;  4IRH A;  2ISZ A;  3CDI A;  1QGP A;  2VLA A;  2QBY B;  1D1C A;  2FQ4 A;  3E6D A;  4RM2 A;  3S3O A;  1P2F A;  1W7P D;  4YII A;  5FB2 A;  3F72 A;  2DCE A;  2VQL A;  1STZ A;  2GLO A;  2XF5 A;  1ZG5 A;  5HDG A;  2R7V A;  1W4M A;  1GLN A;  5CPR B;  1SVM A;  1MMD A;  2ZME B;  1IN5 A;  1ACI A;  4F92 B;  3CC4 I;  2M34 A;  2HQN A;  3CMA I;  1CF7 A;  4PDK A;  5DYM A;  3KIO A;  1MMG A;  3KEO A;  4A5N A;  2IA0 A;  1SEU A;  5AON A;  1K4T A;  1ITY A;  2P81 A;  3HSR A;  2JA7 J;  1X1C A;  2M4K A;  2V6C A;  3QOD A;  1D0Z A;  5DTD A;  4RBO A;  2DDA A;  1XGO A;  3GZ5 A;  3CDH A;  2M7B A;  2XSD C;  1FOY A;  3ZQL A;  1ZEL A;  3OY9 A;  4B3X A;  2VOO A;  1ZR2 A;  2JA6 J;  4IRG A;  3CQZ J;  1G3Y A;  1YX3 A;  3FF5 A;  3FM3 A;  5F0C A;  2HOA A;  1TQI A;  2A3S A;  1S7O A;  2EPF A;  3OYC A;  4Q47 A;  3VFZ A;  1B59 A;  2KJB A;  5JHF A;  1IN6 A;  3Q5F A;  4II2 A;  5F27 A;  3S3M A;  4N9I A;  3G71 I;  3FM5 A;  1TL8 A;  4M6Y A;  2LVS A;  5J4Y A;  2OPT A;  3IRQ A;  1VQN I;  2BZT A;  2X9D A;  2QQB A;  2ZME C;  2EH3 A;  3VYT B;  1R49 A;  5D6F A;  4N4O B;  4A3C J;  1WI9 A;  2O6G E;  2K85 A;  2HPM A;  1OMI A;  1Y0N A;  5IYD J;  2ZO4 A;  1J9I A;  2AXL A;  4N0B A;  2LLK A;  1H89 C;  2B63 J;  5BQT A;  2DMN A;  1GXQ A;  1P4X A;  1JJ8 C;  4QPO A;  3Q9V A;  1RPW A;  4JOM A;  4BS9 A;  1G8X A;  1ZGJ A;  2OD5 A;  1ETY A;  2X6W A;  3ASN H;  2J5O A;  2XPV A;  3WTX C;  2JN6 A;  3L9F A;  1XG1 A;  2CW8 A;  3MMY B;  3LA3 A;  2BY1 A;  2R5Z A;  3E7L A;  4ENK A;  2M87 A;  2XAF A;  3E5X A;  3K1M A;  4HF0 A;  1X1A A;  2L01 A;  2DBB A;  1R5I D;  1B1B A;  3O8H A;  1XDS A;  3WHC A;  2WV0 A;  3GVA A;  3LSJ A;  3ZMS A;  4ZYD A;  1TW3 A;  4CA0 A;  4A3D J;  5EJC A;  1TWC J;  2Q1Z B;  4A3F J;  5M5Y J;  2NOJ B;  2YS9 A;  2A69 F;  2EZK A;  2WY7 Q;  5D5U B;  4BL0 B;  5J47 A;  5TRD A;  5LHI A;  3DV8 A;  3REO A;  1AU7 A;  2W00 A;  3DU5 A;  1ETW A;  3WTZ A;  2F4O B;  3PFY A;  1BOB A;  2VJ4 A;  2DFH A;  2X85 A;  3CCV I;  4OMY A;  1LVA A;  2H6C A;  1ORK A;  4UY8 I;  2NYX A;  3HRT A;  2I5U A;  1Y39 A;  4HW0 A;  3GTP J;  3EUA A;  4XBF A;  4L9N A;  3I4P A;  3S17 J;  1IW7 F;  2ICW G;  3W3C A;  3K4K A;  3GZ6 A;  2EFO A;  1TNT A;  2DA4 A;  2QQ8 A;  2F5C A;  4IPA A;  1BW6 A;  2H27 A;  1OQY A;  3JRH A;  4L9J A;  3SEQ A;  3KEQ A;  3HOZ J;  3HL2 A;  2L7Z A;  3K4M A;  3ZXS A;  1HQC A;  4PJ0 C;  2DYS H;  3CUQ C;  3SZP A;  4A3I J;  2UZK A;  5JFR A;  5GTH C;  4KIC A;  3HGG A;  3UKG A;  4DBR A;  2L7M P;  5F1R A;  2FMY A;  3F0C A;  3M1E A;  4RB3 C;  1SD6 A;  4CXF A;  3JRI A;  4NBQ A;  5EG0 A;  3U9G A;  2QM3 A;  3GXO A;  1YW9 A;  3WGG A;  1QBJ A;  4LB6 B;  1VQ5 I;  4M3G A;  3AG1 H;  1R1U A;  1JGG A;  2KIU A;  4U88 A;  4BHP A;  3PQK A;  2FE3 A;  2IS4 A;  1T95 A;  1PUF B;  2JSP A;  2QBY A;  3OYN A;  2A6E F;  2CW0 F;  3S8P A;  4FAS D;  3HPG A;  1ETQ A;  2A68 F;  2XC7 A;  2QUF A;  5IT9 K;  2CSO A;  2Z3Y A;  1X2N A;  4M71 A;  3BTI A;  2N8G A;  3HYI A;  4E7S A;  1VND A;  2ZME A;  4OIO F;  3RJP A;  4XLP F;  1OLT A;  4BBS J;  3H9G A;  2RNJ A;  1RKT A;  5FD5 A;  2V9K A;  1ETK A;  4P5O A;  1SFE A;  3LA7 A;  1J7K A;  1XSD A;  4XKC A;  4I76 A;  3HOT A;  3ZQI A;  2XIG A;  1ENH A;  3NQO A;  5JI6 A;  3CP2 A;  3DCF A;  2STW A;  1GXP A;  2JA2 A;  2R5Y B;  3HUG B;  4FX0 A;  3ZMU A;  3GYH X;  4BEH A;  2AQF A;  2F48 A;  2OA4 A;  4HPQ A;  3V8L A;  3VSK A;  4AYB A;  4BHC A;  2VKD A;  5E3L A;  1ZKG A;  2HNH A;  3V8J A;  2VL8 A;  4EVI A;  2FML A;  1A36 A;  1UMQ A;  1W1W E;  2GM4 A;  3WTU C;  2HVR A;  1LEA A;  3OIP A;  3R6S A;  2JRM A;  3BG6 A;  4EJW A;  4YFX F;  3RI4 A;  4LG0 A;  2F4I A;  1N77 A;  1JUS A;  1SD7 A;  2CJJ A;  3TDZ C;  5DD8 A;  4X1E A;  1FJL A;  4RB0 A;  3RQ4 A;  4BH9 A;  3HJE A;  1YE9 A;  2IJL A;  1XS9 A;  1DPU A;  1T0F C;  1VQK I;  2E2I J;  1SAX A;  1V3F A;  3CCQ I;  1G3W A;  2R7T A;  1T98 A;  5K7F A;  2ZXI A;  3MZH A;  3D5R C;  1OCO H;  2NXN B;  3TBI A;  3L7W A;  5IOY A;  3ZOB A;  4OIP F;  1U8R A;  3GTG J;  3OMY A;  1ZK8 A;  2KIQ A;  2YR2 A;  2VB6 A;  5F04 A;  1LPQ A;  4IF4 A;  1S3J A;  4ABZ A;  4RGX A;  3ISP A;  2DT5 A;  4AIJ A;  3D5L A;  5D5V B;  1J59 A;  2HEO A;  3BC8 A;  3NAU A;  1FWZ A;  3CCR I;  2OZU A;  2CUJ A;  3TO9 A;  4LB5 A;  2L02 A;  1FBU A;  5DV5 A;  3WHB A;  1FOK A;  5DUI A;  3S3N A;  3RKX A;  1YJW I;  4KN4 X;  3CUQ A;  2VXZ A;  3IKT A;  4XRS G;  2LY9 A;  1B9M A;  3IV5 A;  1VQP I;  4NNJ A;  1HOM A;  5LD2 C;  3HXL A;  2LBF B;  2R7F A;  3HPH A;  4DW6 A;  3MKW B;  1LUJ B;  2QGU A;  4AD9 A;  1I6H J;  2LY2 A;  5B1B H;  4KT5 C;  3OYH A;  1TT0 A;  5BOX A;  1LEB A;  1EH6 A;  3X2Q H;  3QU3 A;  2W25 A;  3GLX A;  3S16 J;  2CMP A;  2ZJ2 A;  2L3D A;  4JK1 X;  2ELK A;  4CHU A;  4GDF A;  2JT1 A;  2M2E A;  3I9V 2;  3L2C A;  2EWN A;  4NB5 A;  2M0M A;  1YYV A;  3C2H A;  1N75 A;  1Z1D A;  5CJ9 A;  2RV8 A;  3ONQ A;  3QPS A;  4RA2 A;  3R61 A;  1U0J A;  4B8X A;  4IOC F;  3OR2 C;  3TL4 X;  1K6Y A;  3H92 A;  2OBP A;  3ZQH A;  4Y33 A;  5HNH A;  1HDD C;  1UFM A;  2EFN A;  2ME0 A;  2BOL A;  2G0E A;  4I0B A;  3LSP A;  5FRN A;  3M7G A;  3OYL A;  2F5V A;  3P7N A;  5M3M J;  2XSJ C;  2LP0 A;  2K9M A;  3TO6 A;  3IRR A;  2DOF A;  4Q4Z F;  1WJE A;  2DFF A;  1HF0 A;  4OAZ A;  4C3I J;  5FJ8 J;  2GA1 A;  2UXN A;  2DXI A;  4XSZ F;  5J8C A;  2FXA A;  3L00 A;  1FMW A;  3LST A;  4LIU A;  1MKM A;  4RGR A;  2AXT C;  1O57 A;  2E71 A;  2OZ6 A;  3UNG C;  1WJF A;  3BG7 A;  5LRS A;  4HF1 A;  1WGX A;  3GTQ J;  3B6C A;  1T0F A;  3OYB A;  1RI7 A;  3ABT A;  5IY5 H;  1UHW A;  1JHH A;  2FF4 A;  4HG2 A;  2G9W A;  2VI6 A;  3F8F A;  5E3N A;  4IEJ A;  3HRS A;  2NVT J;  2D2W A;  2HVQ A;  4BJT A;  2EK5 A;  3CF5 F;  4Y7N J;  4LD5 A;  3KE2 A;  4JYK A;  2HR3 A;  3AG2 H;  1V54 H;  4Y17 A;  3JRC A;  1D5V A;  2VBX A;  2WB1 A;  2VJ5 A;  4UB8 C;  2GXG A;  5FGM A;  1ETO A;  3H5A A;  3S32 A;  3PO3 J;  2HZD A;  3CLQ A;  1E2X A;  3QAH A;  1JT0 A;  1BL0 A;  1MSF C;  2M1B A;  1KGS A;  2KPM A;  4JX5 A;  4DOZ A;  4E6K G;  4KN7 X;  2EIL H;  5D6E A;  3DPU A;  2E19 A;  2YSR A;  1G6N A;  1UCR A;  4MTD A;  1MBJ A;  2MA3 A;  3FXK A;  4F93 B;  5H6R A;  2FSW A;  1KQ9 A;  2TRT A;  1SAU A;  1Z77 A;  2BV6 A;  2HWV A;  2KT0 A;  4BY7 J;  5EEG A;  1YS7 A;  1OPC A;  2ZB9 A;  3CJN A;  1YJN I;  2XHK A;  3V8K A;  2LH9 A;  1T39 A;  3ABK H;  2E1O A;  2IGO A;  3LL7 A;  2R7U A;  2P7V B;  4ENN A;  3DTI A;  4XNF A;  5F6F A;  1T08 B;  2AQE A;  3EDP A;  4U0V A;  4Z6Y A;  2W82 A;  3IAS 2;  1H88 C;  2PMZ A;  3VDX A;  1WHU A;  2FBI A;  2VQH A;  2QYO A;  1HXD A;  3HG9 A;  3IHU A;  3P9K A;  4MQ9 F;  2JA5 J;  1B72 A;  1FYM A;  3DPL C;  2OU2 A;  4XON A;  4KIF A;  3BT9 A;  1SFK A;  2K3F A;  5F0H A;  3KFW X;  4JX6 A;  4G7O F;  1PDN C;  2ZSH B;  5BPI A;  1T8I A;  1BI2 A;  1WH7 A;  3IUO A;  3IL2 A;  3E1S A;  2EIK H;  4BHB A;  2E5Z A;  2DTZ A;  1R6R A;  3A03 A;  3ABU A;  2CQQ A;  4V2G A;  3JTG A;  2DFI A;  1FYK A;  3N4M A;  4CGZ A;  1X3Z B;  4LLG F;  2DQL A;  1RUO A;  3EUH C;  5J6X A;  1JTX A;  2JTV A;  3BDD A;  4HQM A;  1YJ9 I;  3S14 J;  2RQQ A;  2Y0S A;  2L54 A;  4MGR A;  4HLY A;  4HF2 A;  1G3S A;  3ZN0 A;  5M5W J;  4JX4 A;  5EZH A;  4UV8 A;  2GQQ A;  2MH9 A;  4B1R A;  3DU6 A;  1N78 A;  5GAH J;  2DA5 A;  2IAI A;  3FXL A;  2E35 A;  1S7A A;  2XAQ A;  3K7A J;  4KIS A;  4Y13 A;  3SFI A;  1FIA A;  3FX3 A;  5ED4 A;  4BE0 A;  2PJR A;  5ILV A;  4X6A J;  3DWL E;  3GFI A;  2WC2 A;  4I7H A;  5L3B A;  3C2B A;  3SYT A;  2F5E A;  3K1P A;  2LF8 A;  2M7A A;  3NWS A;  1DUX C;  2KQR A;  1IN7 A;  1LDJ A;  3MAJ A;  1MDM A;  1JJ6 C;  1OCC H;  2ZKZ A;  2GAU A;  4V2F A;  1TQP A;  4HNU A;  2QQA A;  1F9N A;  2LOO A;  1A35 A;  1D3Y A;  3GLL A;  1U6G A;  2HI3 A;  2DLL A;  5IP9 J;  4CCJ A;  4XN0 A;  1LFP A;  2VIX A;  2A07 F;  5DM6 F;  1HSJ A;  3K0L A;  1WJA A;  4XLF A;  5DS9 A;  3CF2 A;  4KIB A;  1FOX A;  2RNG A;  2O8K A;  1CF7 B;  1F5T A;  4XQF A;  2KIF A;  2TCT A;  3V42 A;  3VYS B;  4KMU X;  2XAJ A;  1FEX A;  3JCU C;  2FRH A;  3T8T A;  5FLV A;  3BG5 A;  3ZQQ A;  1UB9 A;  2YX4 A;  2DOD A;  1I3A A;  4HLX A;  5CKT A;  4OIR F;  1P7J A;  4CIC A;  3HB9 A;  1OCZ H;  4HDU A;  4CYC B;  1I5Z A;  3O8G A;  1WVR A;  2DI3 A;  2VBZ A;  2MH2 A;  4C2U A;  4Q5S F;  3M8J A;  4CUG A;  4FE4 A;  1MMA A;  5EEH A;  1Z3X A;  1OFC X;  4WX9 A;  1MBG A;  3JR9 A;  5M3F J;  4E7H A;  3ZMD A;  3CDL A;  2LMD A;  4QIW N;  2JJ7 A;  2VBY A;  2QSH X;  3S2H J;  4PJL A;  3BWG A;  4RLQ A;  2WWY A;  1Y0U A;  3SJM A;  1VQ4 I;  2E36 A;  4YEL A;  5HLI A;  1IXS B;  4HA8 A;  4HYE A;  2RN7 A;  1QPI A;  4I6Z A;  1VQ7 I;  3FMQ A;  4A5M A;  5K5O A;  3IAM 2;  1K6O A;  2W4S A;  3BQZ A;  4KT6 A;  2ME6 A;  1O7F A;  3KP7 A;  2XF6 A;  2HOT A;  3MZ8 A;  3L2Q A;  2OTL I;  2M8E A;  1MMS A;  1JI8 A;  3CC2 I;  4FTH A;  3DFG A;  2FOW A;  2MBF A;  2OUM A;  1IXC A;  3BRO A;  4F52 A;  4PZJ A;  1NK3 P;  2XDV A;  2Z2S B;  3QPH A;  1VQL I;  1XDU A;  5E1Z B;  3BR0 A;  4Y3O A;  2ELH A;  3BR1 A;  1XCB A;  3EUH A;  3IWF A;  5H20 A;  4MNU A;  1YO5 C;  4L9V A;  1TBX A;  4A0Y A;  1A6Q A;  4MEY F;  4RS8 A;  2B7E A;  3KP6 A;  3CCM I;  5CVR A;  3J80 K;  2AS5 F;  3DKW A;  3AAF A;  4LLN A;  1V4R A;  3BPV A;  5JLX A;  1U5T A;  4LLL A;  3CJQ B;  1VTN C;  2F4M B;  1RKW A;  1P4A A;  1UJ8 A;  3BQY A;  4JBA A;  3RKW A;  5K1Y A;  2FX0 A;  2P7C B;  1XMK A;  2E1N A;  2E1M C;  3QYF A;  5FFX A;  4MHG A;  4X0G A;  3ZQ7 A;  3HRM A;  3EYY A;  5EZG A;  1HW2 A;  2Z33 A;  5KCM A;  1O7L A;  3QPL A;  2IGK A;  4PK4 A;  5L3C A;  3F22 A;  5CVI A;  3S1N J;  3K9T A;  2L4M A;  3LFK A;  3N97 A;  1CGP A;  2EV6 A;  1HST A;  1XGS A;  3MCZ A;  2O5R A;  1R4N B;  3F9K A;  3A4C A;  1FP1 D;  2M30 A;  2MGQ A;  1ETV A;  4KDP A;  2RC4 A;  4EEF G;  5LGU A;  2UUZ A;  5HDK A;  1G3T A;  3CCJ I;  4IHT A;  3JAM K;  1DU6 A;  4E4H A;  2YPR A;  4U0W A;  1EKE A;  5BMZ A;  3HKZ A;  4BJ6 C;  1FY7 A;  2GIZ A;  3H3U A;  4O3M A;  2DJN A;  3UR3 C;  1K7A A;  4BXF A;  2BGC A;  3RPU A;  2D1H A;  1BM9 A;  2KMU A;  3BTL A;  5GP9 A;  3CMM A;  3F8N A;  3G2B A;  3GF2 A;  5F1J A;  2VPL A;  1IV6 A;  3AFH A;  1K4S A;  5LEK A;  3AG3 H;  5AIQ A;  4ESJ A;  2L7K A;  2CU7 A;  2IGM A;  4I02 A;  3HSF A;  1POG A;  4RAG A; 
#chains in the Genus database with same CATH homology
 1YIJ I;  1VQP I;  1VQ6 I;  3DLL F;  3I56 I;  3J7Y J;  3CME I;  3EGV B;  1YJN I;  1FOY A;  1VQ5 I;  3CC7 I;  3I55 I;  5GAG J;  1VQ4 I;  3G6E I;  2E36 A;  3CCL I;  2OTJ I;  1VQ7 I;  3G71 I;  2K3F A;  2ZJQ F;  1VQN I;  1MMS A;  2OTL I;  1YIT I;  4IOC F;  3CC2 I;  2FOW A;  1VQO I;  3CCE I;  4IO9 F;  1YHQ I;  1VQL I;  2H8W A;  1VQM I;  5JVG F;  2ZJP F;  1YJ9 I;  5DM7 F;  3J7Z I;  1WIB A;  2QA4 I;  5GAH J;  3CCM I;  1HC8 A;  3CCU I;  2E35 A;  2QEX I;  1VQ9 I;  3CJQ B;  1S72 I;  4V19 K;  3CCS I;  3PIO F;  2JQ7 A;  5GAD J;  2E34 A;  3CD6 I;  1FOW A;  3CJR B;  2ZJR F;  1VQK I;  4IOA F;  5GAE J;  3CJT B;  3CCJ I;  3CCQ I;  1VQ8 I;  2NXN B;  1QA6 A;  3CF5 F;  3CCV I;  5DM6 F;  4UY8 I;  3CJS B;  1Y39 A;  1FOX A;  3G4S I;  3CCR I;  1YI2 I;  3PIP F;  1ACI A;  3CC4 I;  3CMA I;  1YJW I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...