5GAHI

Rnc in complex with srp with detached ng domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
ALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYVTEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQIDRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords SRP 4.5S RNA
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00466 Ribosomal_L10 Ribosomal protein L10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5gahI00
3JSYA 5GAGI 3J7YI 5GAEI 5D6GA 4V19J 1ZAXA 3A1YG 1ZAWA 4NWBA 1ZAVA 2QA4G 4UY85 5D8HB 3J7Z5 5GADI 5GAHI
chains in the Genus database with same CATH superfamily
1HL6A 1PYOB 2LQ8A 2VG7B 3CD7A 3T6JA 1SJ4P 3VQTA 1WF0A 3NMAA 1DQAA 4KJIA 1S6QA 2ZE2B 3M2RA 3QPIA 1FNXH 2QEXS 3DM2A 2DGWA 3CCES 3TO8A 4N77A 1HD0A 2QYCA 1MN7A 3SI8A 2BMBA 4JV5F 3C66A 3PYGA 3BR8A 1UAWA 2LXIA 2F8EX 4ZHRA 3UFCX 3GG1A 5L9NA 3R2DJ 3NNCA 1C1CB 7FDRA 5B0DA 2FZCB 3ENWA 3FBBA 3KUHA 3NXZA 4MIWA 4P73A 5KG5A 3R7BB 4R0EA 4OYXA 3CCLS 4ED2A 1H0HB 3LP2A 3L7PA 4L3KA 4K5RA 1Q82T 4DR2F 3OJSA 1UVMA 3MR7A 3BQ2A 3OTBA 4FXDA 1VYAA 2ACYA 1F9EB 3GJTB 3IN5A 2OO4A 1U1LA 1S1UA 1ZM9A 2E5LJ 1OPIA 4XPEA 4FVMA 2HBYB 2QT7A 1UEVA 4IRCA 5BYQA 4UUXA 4CLFA 3KYLA 4L74A 3A8JA 1OYDA 1RJJA 3P45B 1PC5A 2CPIA 2VC0A 3DLEB 1VJQA 1TUGB 5KG1A 5IM0A 4QPXA 1RT1A 2DNLA 3F56A 4KHMA 1RWPB 2VBZA 2WSFC 3MMJA 2JEJA 5KFWA 1UJ6A 1RHKB 3I5BA 3LUYA 2W4DA 4J91A 5CCMA 2IM3A 2IRYA 1CJUB 4NI2A 4DLEA 4LSLB 1UZDA 1X8DA 4FBUA 1RYRA 4WP9A 3VGUA 5SUHA 1IQTA 2X1FA 5CYQB 2BJDA 3V4IB 4B3RF 4QWCA 2J76E 4NZ7A 2I6WA 1PYTA 3WIUA 2F63A 1JXVA 2QV6A 3EE3A 3QAEA 4UT4A 2W8KA 4A8YA 4DL2A 2F4FA 4DUTA 1NK8A 3J7A1 1X0PA 3T5HA 3KLHA 2IDLA 3VGTA 2QMXA 2M8HA 2ASDA 5LMNJ 3R6LB 3KLGB 1U6ZA 2YKOA 3ISZA 4GO7X 2RQCA 2FVPA 1VHIA 3D68A 1S9EB 5B0CA 4A47A 2Q79A 5KFHA 2KJWA 4ZA1A 4B3SJ 4ED5A 1T03B 1C0UA 3D3CJ 1FWLA 3K5PA 4CP5A 4Y0FA 4JP8A 3CC7S 1OSDA 1SC6A 2J7KA 2V4RA 4DV4J 5D3GB 3UN3A 2HHHJ 1AROP 1HNZJ 2N82B 1S76D 1RHQB 4U6PA 4AQYF 3G9CA 4J9QA 2V0NA 2KO1A 4F4XA 4V19J 2R3VA 3FUYA 5K14A 3RBDA 1X9MA 5KFOA 1RT7B 1EB0A 1RGVA 4OI2A 2HFUA 3QFWA 1RHMB 3LTOA 5CYQA 2PMHA 3W9JA 2LECA 2HS3A 2KHDA 3I5AA 1IKYB 4DV6F 3QATA 2NXCA 4MTPA 2MQMA 4WKYA 1JLQB 4LF5F 2GS8A 2LVWA 2LLZA 4ID5B 4ZVHA 4HACA 5FDLA 1SL0A 5K20B 5J1PA 3R1LA 3HO1A 3DU6A 4KKOB 3ILJA 4C7QA 4TKTA 3H2VE 3ULHA 1CLFA 4NLYA 5CAAA 4HKQA 2ASLA 2BQ3A 3FCHA 3GB0A 4URGA 5K8PA 4DFKA 3I9V9 4CWBA 4Z7CA 4C4WA 2IRUA 1RABB 4W4MA 4LVNP 1KNZA 3AOAA 4NI2B 4QQBA 1KTVA 1OY6A 3MPYA 3US5A 3O6QA 2JLEA 6FD1A 4I68A 5F9LA 5KFZA 2DHHA 5AJ3F 2QA4G 3PW0A 4UOGA 4JYAF 3DM2B 1IWAA 4G1QB 2HFSA 1QVFR 4LVOP 3B54A 2X1BA 3IS9A 2W4CA 4DX7A 3W5ZA 4YHHF 2MZJA 3MTKA 3P6YC 4PWDB 2DHAA 1T9TA 5F0UA 5IC6B 5A2QY 2HNDA 1LQ9A 1WHYA 1TV6B 1S5ZA 2HS4A 4J9VA 1N52B 4U8VA 1LV5A 2M8DB 1KSPA 1NUEA 4Q8EA 3UD3P 1A7GE 2I5JB 3M30A 2WVDA 2XM3A 4DV1F 3C46A 3CCSS 2AEJA 1S0OA 3L95X 2HAIA 1HBNA 5AXNA 2KRRA 3CE8A 1N36F 2CAJA 3HVRA 1XC9A 2N4DA 2AZ1A 3GCWP 2RKIA 4DG1B 5LJ5Y 3OTDA 2ZNZA 1RAJA 4IO9Q 3DLKA 1FRLA 3KUEA 3OTOF 3P3DA 2BACA 4MAKA 2WVEA 2V34A 1SJ3P 1QVGR 1FJGF 1TKTA 3MFHA 1TL5A 4O4GB 2JEFA 2CQ0A 2QO3A 1NMEB 1IVZA 3TW0A 3DRYA 2J6UA 1I51B 4WK3A 2OAUA 4ZPTR 5EGYA 2UUTA 3KLIB 4GVBA 3HP6A 1U1KA 1AFIA 4DR1J 2FJAB 4NLPA 1BQMA 2H5JB 3HHLD 1SC1B 1ZZFA 2LEPA 2YNHB 4IG0A 3S1TA 3IRXB 4DPOA 3VAHA 2EK6A 2JJ4D 3R3TA 2DXDA 2I9SA 4OI6A 1K73T 1XJWB 1C0TB 2RUSA 1DFDA 4IH6A 3NS5A 1IM4A 3GIRA 5KFKA 4EMDA 3P5BP 4CO3A 1N5VA 3JXOA 4DR6F 1V9OA 2DEJA 1HNXF 4DV7F 2CUYA 2VG5A 4OYWA 1GMWA 2Z58B 3D9BA 2XZDB 3R5AA 3S01A 4RW7B 5GAEI 1NKEA 1FRJA 2V4JA 1KHVA 1RI7A 5DDRC 1T3OA 1J27A 1MWYA 4PABA 1EP4A 1H6KX 3BKFA 3L4BC 4LSLA 4WJBA 4P2XA 1J5OA 3LPEA 3L09A 3F44A 4MKAA 1JKHA 1HI8A 3K5MA 1NK0A 3V6JA 5C25A 3K17A 3IRWP 1N8RT 4K2XA 4P7TA 4IQXA 1KVIA 2QE5A 2XTJP 1TL3B 2ASJA 4K50A 2DRBA 1ZM3A 4ZN1A 1H38A 3FQLA 1WORA 3N6LA 5M2RA 3RAMA 1Q53A 5D8HB 2VV5A 4HTIA 4NA1A 5J2QB 2UV8G 3G6XA 4LFAF 1VRTA 4OJGA 3OLAA 2L48A 3SDEB 2AGQA 1S97A 4B3TF 3GIKA 2VC1A 4KPYA 1FX2A 4MJKA 2NYIA 5GAGU 3BO3A 4DR1F 2XYGB 2EWHA 3J7YI 3PW7A 3KMSA 2D7SA 4C3KA 4ILMA 3W60A 2B5JA 2D9OA 2CA9A 1NK4A 4ZJLA 1HI0P 2OI2A 4ZPVR 4A48A 2E5LF 2XO6A 2WHOA 3QGIA 2F4VF 5LMUJ 4B3OB 1S0NA 1BQXA 2EEYA 3R7SB 4KO0B 1HNXJ 2DIVA 2DIUA 4Y2AA 2OTLS 3K0JA 2K3KA 2UUCF 1X60A 2IA0A 2XLIA 5DQHA 2AGOA 1IJFB 4Y2KA 4ED3A 2QLWA 2X3GA 1T9UA 1LW0A 4FZVA 3ISNC 4ZP9A 2E9RX 1IJEB 4KHPF 2H9ZA 3IBFB 1RWNB 1H72C 4NLDA 2FJDB 1NAQA 1HNZF 1VQ5S 1EZZB 2QMUB 2C3MA 2DPIA 4DCPB 2UUWA 3NAIA 2MB0B 2F1FA 2E7VA 1AYEA 5CA5A 3O1LA 3QJJA 1FNMA 1JNZB 2BV3A 1WEZA 4L72B 1U1NA 3FSXA 1R8CA 1VOMA 2JX2A 4OHXA 3NGSA 3DDIA 3F41A 4HTJA 4C8MA 2C3PA 4AXIA 3RAQA 2E9ZA 2VJUA 1R8BA 4AE5A 3BV8A 2DEIA 1ZA2B 1WTFA 1JLGB 2V2ZA 3VVUA 1DY3A 3W2VB 3SCLE 4NOHA 3M4XA 2WONA 2AJ2A 2MLXA 2EBEA 3I0RB 5J2NA 2Y0BB 1VQOS 3C19A 3C6TB 1XWLA 2BE7D 2AP6A 2MZQA 4OZ2A 4RO0A 3CB4A 2GMJA 4USHA 5ETTA 2R2TA 1YRTA 1LFPA 1S9GB 1U2FA 4B17A 3T5JA 2H4YB 3OR1A 3QGHA 4P52A 2AKWB 1VGYA 4HHHA 3IXQA 3IR6B 3NNHA 1DQ8A 5KOXA 2AU0A 4OX7A 4X4RA 1UWBB 3QMQA 4KPCA 5ETPA 4ZS6A 3UQSA 1B70B 1YJ7A 1YJNS 1H2TZ 1N4LA 2ZOMA 4WFYA 5LJ3Y 2J5AA 3RB6A 2B43A 2P8IA 3W63A 4CZCA 2LQ5A 1X9SA 2NUUG 2ZZTA 1LFWA 3GFHA 4TY8B 3SQGB 3UCGA 1Y11A 3CJRA 3Q24A 2K2PA 3HFVA 2B4OA 4N47A 1NDKA 1TKXA 5JVGQ 4DR3J 4AL7A 4LF7J 4GKJJ 4DN9A 2RRNA 2J9DA 1WEYA 3CJTA 3Q8SB 4ELUA 1HR0J 3C2PA 3QJPA 1M5SA 3H90A 1S9FA 4KH0B 2PD1A 2DR8A 4GRSA 5A8WB 2JRSA 2XHCA 2QLFB 1VQKS 4DOZA 1WNEA 1QLNA 3M8SA 3QZ8A 1CULB 1KOOA 1Y5LB 2FHJA 3BS9A 2ZWOA 2J9EA 2P2CB 1WHVA 4RW6A 2EKNA 3HJVA 3ZTRA 2AYBA 1N5YB 3GIIA 4DV2F 2CFXA 2ZBCA 3W8GA 2KVQE 3UI3A 1C0TA 5HVHA 2ALZA 3W5YA 1MU2A 2DPJA 4RU9A 1UVJA 1AB8A 3ITHA 2ZWPA 3N01A 4TNOA 4B9NA 3CO9A 2AJFE 5T7LA 3QT6A 4O3PA 4NLSA 4HACB 3CIMA 2HWIA 5FDLB 4WFAQ 3OSPA 1TL7B 3M6XA 2B7CB 2HHSA 2ZC3A 1NH7A 2GIFA 3RU0A 3HCXA 4ZVEA 2Z0GA 4DL3A 3KMQA 1MSWD 1YJWS 5J1EA 2QN6B 4HVZA 2ZE2A 3CF5Q 4E0DA 2D69A 2E1PA 3MCNA 1HR0F 2YY3A 3DRRA 2ATLA 5T41A 3CCVS 1KBRA 2BJ7A 5K14B 4DR5J 4DSLA 1UJ4A 1NKBA 2ZBPA 3HSZA 1Q8KA 1DZ5A 2MMYA 2NPIA 2XHWA 3CJ5A 4X84A 5FIIA 4O3QA 3TZXA 5F9NA 2DR7A 3RGIA 4C8ZA 2AT1B 1UETA 2U1AA 5KFVA 2R7WA 3HVAA 4MK7A 3QLHB 4U7UK 4Y2IA 2W01A 1R89A 2RT3A 3MR5A 3Q86A 1SVDA 4PAAA 2GVZB 3BGLA 4PQAA 4W90B 4O4RA 5KT3A 4LT6A 2HBRB 2CNOB 4IG3A 1RT6A 1QM9A 3HM9A 2BR0A 4OJ3A 2CPJA 2NXJA 1PG5B 3QT5A 4X65J 1UVNA 1C1BA 1JLCB 4IKAA 2HLTA 2V8HA 2KJVA 3MMCA 1EKRA 2OPQA 5DETA 5HMYA 1GQEA 1NSPA 3EDQB 1VBZA 3H5XA 2VUGA 1UEKA 1FEHA 4I69A 1RACB 1JLFB 2E1RA 3MEKA 4JI5F 4LF1A 1S1VA 2EFGA 3I9ZA 4NRUA 3G96A 1GFWB 1R8HA 2RNEA 2HVDA 1FKOA 1HBMA 2ZBRA 4CIOA 4LFCF 2C2ZB 2PC6A 1KWMA 1C0UB 1RB0A 1YKWA 3HHLB 3KXDA 4YMEA 1HFEL 3UPFA 4ED8A 2GQ2A 5IOLA 2RAQA 4A8WA 3FEXB 3PX0A 2RF2A 2VIHA 1S1XA 3V81A 2WW4A 2A2DA 3AD7C 2IYGA 3ZZOA 3NY0A 4C3LA 2C1EB 4UOHA 4K4SA 4Y3CA 3W65A 1RBOB 2KT2A 1KQGB 1H74A 1NSKL 4P10A 5CD4A 4X4OA 3RG6A 4Q43A 5CQGA 3MMBB 1KDNA 4KYZA 4ELTA 4K0KJ 3DLKB 2OPPB 3FBCA 3P5TL 2V4QA 1N33F 1Q4RA 1RTHA 3KNGA 3ZNUA 1O0PA 4DUZJ 1VRUB 4BLGA 4O44B 1IBCB 5LOQA 1RT5B 3K57A 3AHPA 1VBYA 2FVCA 4F50A 4MFBB 2MSTA 3G82A 4NLXA 3SZ2A 2W9BA 5G0RA 2MZ1A 3GR0A 3GFYA 3KUGA 3UE2A 3HVTB 2JLGA 2HHQA 1GK8A 1SPBP 4CM0A 3W7BA 4RZRA 2PFDA 1DQ9A 3MEEB 3KDNA 2UXDJ 3D28A 4HEA9 1FK9B 2Z56B 3N5BA 3W62A 5A2QU 2ZC4A 3RR7A 5GVQA 4DPTA 2CXEA 2NR0A 1S57A 2YWKA 3M1VB 4O3RA 1SJRA 2DNMA 1SBRA 2WBMA 1BQMB 3GE9A 4FP9A 2M0GB 2QX0A 4LR8A 3MTJA 3BGFA 3PFOA 1FVSA 5IXUA 2XSJB 5RUBA 2YKMB 4ITSA 1IR1A 1NXIA 2IHR1 5G0RB 2H3EB 4RWXA 2MKKA 1BGXT 1Q81T 3Q8YA 4F4YA 2QA2A 3CJ2A 5LSRA 4YHHJ 1FT8A 3PIOQ 1U1OA 2A1BA 4JI1F 4WZQA 4KT0C 2HVEA 1QTMA 2E66A 2MLZA 3BH6B 4LR7A 4CLPA 3SQGA 4FXVA 1PJ5A 3DYAA 4QCLA 2PO4A 2OFHX 3V4MA 5HQLA 1NZ8A 5D4LA 2OEKA 1Z4UA 4KB7A 5CYMB 2A3JA 4WTOB 3OVSA 3Q2SC 2W2OP 2QA4S 1VQ4S 1WF2A 1H7XA 2WSCC 3RW7A 3D5MA 1F9FA 3EPIA 1GNKA 5HL7Q 2VH7A 3V81B 4X64F 1VQ9S 1N34J 4HT7A 5CABA 3BJYA 3U02A 3ZZUA 1SKWA 1S10A 4LF6J 3G8QA 4LQ3A 5D0GA 1HQUA 1KEKA 2W7OA 4B08A 2BKNA 2B7BB 3PTWA 3IGVA 3WQPA 2R2UA 3KJFB 4DV5F 2KT5A 1WOOA 2LYVA 4WKRA 2LU2A 2WVCA 2ADCA 1WC1A 3UVJB 1FRXA 2K06A 3CC2S 2E5IA 4EZ9A 1IKXA 1RAAB 4LIWA 2DNGA 3AT1B 1VIOA 2AV5A 3W2VA 3FFIB 5E33A 1IBLJ 2DGUA 1B4SA 1OQ6A 2ZJRQ 3IWNC 2JVRA 3AXMA 4I2QB 5F8IA 2V2KA 1YVFA 3KLGA 2D3UA 2UVRA 2DRAA 3NWRA 3ZZYA 2E44A 2IJRA 1I5OB 4O23A 5FJ4A 2EFNA 4M1KA 5D0EA 5L1LA 5CYMA 4LQ9A 3VVTA 3GV7B 1I94F 1PAEX 4B3TJ 3RW6A 2BUNA 2VFRA 3GSDA 3F73A 4USTA 2GW8A 3BGUA 2ZHBA 1RWWB 1ZM4A 4J7CA 2CQ3A 1CC7A 5GAGI 1SUQB 4WE1A 4P71A 1YZ7A 3VF0B 2C2RA 5A8RB 4YY3F 3MPUB 3TVZA 5H1SV 2CQPA 3H2LA 4ZCKA 1YBAA 1B0TA 2O67A 2W8LA 1MWQA 3BKTA 3C16B 4KQZA 2WZ1A 2N3LA 4FYVB 4DL6A 2KFNA 3IM8A 5HMXA 3C15B 5E3PA 2DK2A 2C2OB 3OVAA 2VJVA 4NYPA 4NLQA 3EVWA 2DNYA 2G2YA 5ITHA 1VRTB 1WSRA 3CWJA 3SSRA 2R7VA 1T03A 2MZSA 2FJXA 4DDFA 2DJWA 3MCSA 3W5XA 1R6VA 5IWAJ 1S1WA 5LSLA 5F8JA 4NASA 1S1VB 4DR7J 2NLWA 2PFFB 3MWBA 3CCJS 3DRSA 2DCLA 3RBXA 4CH0S 1VS3A 3G82B 5F0WA 3GV8B 1X5OA 4Q2MA 1JWWA 5AE3A 3T41A 2C2NA 1W26A 4EBEA 1J5OB 1Y3KA 5DO2A 2C2MB 2BJ1A 2D9PA 1YI2S 1T9VA 2G1DA 4OZJA 2YXLA 3H25A 2C3UA 1RT3B 2LXUA 2DHSA 5K5MA 4NPOA 5KFSA 4QW9A 2MQOA 5FLXU 4OV1A 5JJBA 2FD2A 4LFCJ 2IMOA 1EAYC 3HK2A 1FFGB 2PN6A 2F9DA 1EP4B 1W2IA 3DXBA 3EVOA 3DMJA 5KFXA 4RUHA 5J2PB 3CCRS 3BKUA 5L38A 5KFMA 2R7TA 4OJ1A 1PJ7A 1RCXB 1SIWB 2LMIA 1WSVA 2DGOA 2MKHA 3QT7A 5JVHQ 1G2EA 1BLUA 1UW9A 5BJRA 2EBGA 3C6UB 1U4BA 3PRBA 4EK2A 3HSJA 2HURA 1UFLA 3CDUA 1G1XA 1K47A 1VFJA 3MEDB 4H4MB 1LK5A 4K2JA 1U1RA 3CMES 4DQPA 4BCAA 4DSIA 5AXLA 4QWAA 3CW2C 4G3IA 4USKA 4WYLA 1NM2A 4KFBA 4OHZA 4M95A 2J8SA 4ZCLA 4HR2A 5ETRA 3NGRA 5KFIA 1TK0A 1KC8T 4ZLLA 5L46A 2BJEA 1AZSA 4LF9F 4KGXB 4WE1B 3MM9B 3CSKA 1FKAF 3DLJA 3M8QB 2CQ2A 3R6GB 4WXOA 2BJ8A 3I6PA 4JI8F 2AD9A 1U6FA 4NLOA 1HD1A 5HVGA 4I6AA 4BWMA 4DU8A 1RT3A 3M6VA 4TYBA 1HPZA 4DUYF 2JHEA 2XY5A 1YLXA 1P6TA 2ZKTA 3DDKA 2GVDA 2VZ9A 1PKUA 3OFGA 3QLHA 2H48B 1RT2A 4IRKA 2CRLA 4PCQA 5IQQA 1Q8LA 5D4OA 4NXMJ 3HXMA 2KZZA 1RWKB 5ETQA 3OR2B 1L3UA 3MURP 1EKSA 4OI1A 1Q0NA 3M8QA 2J8AA 2MDAA 3QRRA 4CLLA 3EMTA 2DHXA 1T9XA 4DV7J 1SC4B 4LRCA 3KLEB 2ZH6A 2EFVA 1AUDA 3MCMA 3GPAA 2HBZB 4FVCA 4M5JA 3U7JA 1RWXB 3W2WA 3POTB 3MM7B 3ZTOA 4KSEB 4O4GA 4IOCQ 3EZUA 1FRMA 1HIYA 3NBPA 3WC0A 1N54B 1HNWF 1S12A 1REVB 1ZS6A 1NB2A 2R2SA 1RE1B 2ROGA 4UOFA 1AA1B 3HX9A 5HJXA 5M2UA 3BBCA 1RBAA 4ECQA 1Y5IB 1XMOJ 3TJ8A 3IM9A 2GV1A 4WYWA 1XN9A 3DFEA 2RQMA 5HMZA 2B8PA 2CIMA 4GKKF 1TL3A 4IQMA 1RA6A 3L9ZA 5F3ZA 1GXTA 4CNYA 4DZ6A 5KFQA 2BE2A 4RBUA 5EHHA 2JDJA 1VDHA 3UN2A 2V8DA 2EFQA 3C6TA 5U47A 3RBEA 1JMTA 1X4HA 3WX8A 3GTYX 1E6YA 4NYZA 2DVIA 2VG7A 4TU8A 4P2MA 4TLRA 3C14A 4MT1A 1WC5A 2D3OR 4WXWA 1U49A 1VQSA 4KIAA 1NJZA 2J7UA 3PW4A 3D1OA 3GSIA 1VRQC 5C25B 2MGZB 1RWMB 4QR1A 3BH7B 4K4ZA 4I2QA 1TTHB 3OSNA 1YJUA 5SZTA 2HNYB 1WG1A 1SH2A 5DQGA 2B51A 3H7HB 1VMBA 3HKZD 3W8PA 3P49B 1RHRB 2BZ2A 2XMJA 3HHKA 2ZD1B 3UDCA 3DNCA 2KM8C 3EM1A 1U1PA 1HBOB 2XYHB 2DGVA 3CCZA 3L3CA 3HDSA 4ED1A 3ADAC 1F5CA 1PBUA 2HGNA 1A9NB 1VQ8S 3H2UB 5HBMA 2B6AA 1FI4A 1IKVA 5G4DA 4O3NA 2OFGX 3A8KA 5KFTA 4CYUB 3V5RA 2QFJA 2XY7A 4IUFA 3NCQA 5HVFA 1XTZA 2O66A 2BOPA 3A1YG 1M5OC 4IR1A 1N5QA 3R1HA 2KZMA 1KVJA 2NUHA 2B56A 2EG2A 2P9GA 3AH6A 3UCZP 2FLPA 3D7SB 4IH5A 3UDVA 1T3NA 4TVAB 4B3OA 1HLWA 3PVXA 1BC6A 2GHWA 1RADB 1HKAA 4JI3F 3DCAA 3OBIA 1OS5A 3K5NA 3DRRB 4CLSA 4DR3F 2HMIB 4NLRA 1V3RA 2YWEA 1R27B 3UVJA 4CO2A 4QWEA 4H4OB 3TRGA 5I42B 1Y7PA 1QE1A 4DV6J 3QSYB 2G13A 3ZXWA 4ATNA 1F5BA 2FDNA 2ZZNA 3PKMA 4OX9F 4Z37A 3HHLA 3BZQA 1UCNA 3Q8VA 5IWAF 4I67A 2HW3A 4CT8A 1XNRJ 1SJ1A 3T19A 1NLKL 2Y3YA 2YKNA 4PYAA 2XC9A 2OKQA 2WB4A 4OYZA 2EVZA 3Q22A 1H7WA 3D67A 3DLGB 3LAMA 4PXDA 2H51B 1O51A 4NCBA 2L9NA 1X4DA 1D0EA 5I3QA 4DV4F 4AD6A 4N8OA 5CZXA 3VR1A 4AL6A 2G4BA 2QMWA 3TWZA 1URRA 2AJ1A 1N5TA 1WKLA 4ID5A 4X4TA 1K9MT 2YQ3A 1ICEB 3UR3C 2H65B 2UU9F 3H42A 3UDLA 2IRXA 4MMOA 1KS2A 2AEMA 5DG8A 3GR1A 4OYBA 4ZPWR 4K4TA 4BBYA 3H4BA 1OMSA 2ZHAA 4RW8A 2MXYA 1RAHB 1WOPA 1S1TB 3MDFA 4HYKA 2OEMA 2YTCA 2HHVA 3RZAA 2W9BB 2DNOA 2C3OA 4F3OA 3R97A 4K5SA 2VKZG 3R5CA 5E3AA 3POTA 3D54A 3D1QA 4P9SA 1KP6A 2D41A 3BEGB 3D6MB 1JK9B 1IKWB 3JSRA 3IC1A 4FS1A 4F4ZA 1RYSA 1M1KT 2SXLA 1ITPA 5DG9A 2XCPA 1RAEB 2QGFB 3MM6A 5DG7A 1YDLA 4RUBA 4ZMMA 2QLXA 5KAKA 4DV3J 2RHSB 3NOCA 4DN0A 3X3UA 2GC8A 3BPDA 4CQ1A 2W2NP 5GMKa 1CVJA 4NE9C 4ECUA 4P6QA 4DWIA 1JJHA 3FZ2A 3EXCX 3OXGA 1XNRF 2Q43A 3HD2A 3KK3B 1S1XB 4KY3A 1TVRB 1KFSA 3AA9A 2AGPA 4K4YA 1SUQA 4KGKA 4I2PA 2RDIA 3KJNB 3AA8A 3JSBA 1JLAA 1B64A 2O01C 2ZH2A 1RTJB 2MHEA 1T02A 4I7FA 3IAM9 1Q8IA 2BQRA 1FTCA 3GJSB 3QJLA 4FYYB 1FERA 1NKCA 4JB8B 4TYAA 1X31C 3HHDA 4QOTA 1W7WA 3CMAS 1N56A 5D6GA 3T1HJ 5HANA 3EZOA 4DEZA 1LW2A 2XWYA 4DR2J 4DCJB 1FNOA 3THVA 4DPXA 2QFIA 2WONB 3EX7B 2K1RA 4PG5A 5EUHA 2FVRA 2UVUA 1TMMA 1TKZA 3M8RA 1ZBTA 3MAQA 3M8ZA 2GCFA 5A6WA 2Z2ZA 4OX6A 3MR2A 2W9AA 1FRIA 2I8EA 3G6VA 1XR5A 2DNHA 3CCTA 2QIFA 2DCUB 2MY8A 2CQDA 2Y9HA 1ROFA 3WC2A 4A8MP 2F65A 2D74B 1FESA 3RB4A 3B6BA 2XLKA 2DITA 5C24B 4GC7A 3MD1A 3PR5B 2QC3A 2B3TB 1NB7A 3OQ2A 4CO5A 3ONQA 4USMA 3PFEA 1PGZA 1DLOB 4OJHA 4Q0BA 2NZCA 1RTJA 3TA0A 5IZHA 1L3VA 5CXTA 2MGZA 4TU9A 3KOAA 4Q8FA 4DMZA 5FLXY 4F7VA 2HZAA 3CUNA 5ETVA 4F26A 1YIJS 1TL4A 1SKRA 1ZM2A 5KT4A 1NDPA 2AMCB 2ZH3A 4AFFA 4OZ3A 4GVLA 4RBVA 3RRKA 5KG2A 3C14B 3CC4S 4ECVA 3BSAA 4B3MF 4W92B 1Q5YA 3THPA 3RTVA 4LRDA 3W1YC 5LSOA 2J6TA 1E6VA 1FXRA 3BQ1A 4Y65A 3RRGA 2JEGA 4JI6F 4B9UA 4LFBF 1NK5A 1M90T 3LQVA 2M3DA 4X66F 4I64A 2KFZA 1FJCA 5HK4A 1TVRA 1S6PA 4ZOSA 3E51A 2YKQA 2R9LA 4C11A 1R0AA 4Y00A 5J2MB 3H40A 3PKYA 3PRVA 1RP5A 2L08A 2YX4A 3DLGA 1U47A 3K8VA 1TMJA 1XMQJ 4X65F 1SQEA 2E5GA 2YNGA 1UL3A 2VG6A 1FWKA 1U7LA 3A3PB 3QO9B 5GAEU 3OXLA 2HMIA 2GMLA 1OWXA 2W1BA 3WHIA 1APSA 2Z2YB 1OYEA 4ECXA 1KQFB 1GTHA 4ICLB 1U6BA 2RS2A 1QE1B 3MM7A 4KKOA 4Y6IA 2BE2B 3D66A 3AQOA 1YITS 2P5VA 2MSSA 1RT5A 2R8HA 4B3SF 2PT0A 3W3SA 4KGMA 1AFJA 5E3RA 3CXCR 3Q0AA 2DXEA 2HWTA 4LBPA 3BO2A 2LEAA 4L3NA 1RTHB 2AJ0A 2HRTA 4EGLA 3OR2A 3D6HB 3KK1A 2P9CA 4K0KF 1OQ3A 3OL6A 3SCJE 3PRDA 3TEGA 1SJFA 2EW9A 1N0UA 5A8WA 4B9SA 3D6TB 2K3IA 5DJBA 5KFLA 2IC3B 1FWPA 4QZVB 4ZVFA 4RNMA 4XAKA 2UVVA 4X62F 1P9YA 2J0SD 2JSXA 1FE4A 3IFEA 4RJVA 1F3VA 3H5SA 2LU1A 3I96A 4JV0A 3QZ7A 4JV1A 1RU2A 4OHYA 4LUBA 3AD9C 3HVWA 2I0XA 4NA2A 2HIQA 4OIXA 3I87A 4A8KA 4P75A 3A8EA 5KFRA 4DZDA 1TR0A 2AW0A 4XDCA 4USVA 2XB2D 4X4NA 2IJFA 2GIRA 3E01A 2EC0A 3J81U 4OZ1A 2VODA 1R0BG 2NREA 9RUBA 3TJAA 1I6JA 1QAIA 4C0HA 5ADZA 2GHVC 2CPDA 4XIUA 1S99A 1SXLA 3OW2R 4DL5A 1SV5A 3TAPA 1N6QA 2GVZA 3OR1B 3Q2TC 4AQYJ 1D9DA 4J9RA 2MQ8A 1LWEA 2J0QD 8RUCA 4F02A 1FD2A 4M5DA 1JLEA 1AT1B 1IKVB 1T94A 2DGTA 3MCOA 1KLNA 1RTDB 3JAMU 1WEXA 3KLVA 4LF4J 5CZVA 4LFAJ 5DM6Q 4PG8A 4DS5A 1BY9A 1QD1A 4WIIA 5AXMA 3W64A 1NHUA 1RUSA 3KG4A 3TQ1A 3BDEA 2HZVA 3HT0A 1R0CB 2CNKB 2NYHA 4ICLA 5HN0A 3IRXA 1BQNB 1G6BA 2IVYA 1P1TA 2VPWB 3LGHA 4X2BA 3N9UC 1B0VA 3UD5A 5H9EK 2OPSA 1PAUB 1XMBA 2OP5A 2IAJB 3SSSA 5K8MA 2QLBB 2E1AA 2W25A 2ZBIA 5I42A 3GYNA 3KNAA 4WU3A 2PGCA 2R7QA 4M8LA 3A3NB 2RH3A 5B0AA 2LFVA 4BC7A 4Q45A 4OYPA 3Q8RB 1UWBA 5E3QA 4ZK7M 4ECSA 1S0VA 1BQNA 3VGSA 2RDJA 4M5IA 3U1NA 7AT1B 2B9XA 3Q8UA 3RAXA 1XMQF 4F3MA 1X9WA 1S49A 2CDRB 4NMXA 4OZLA 4YQWA 3TI0A 4FYDA 1XERA 2F4VJ 2CPFA 1TKXB 2DNZA 4NX9A 3HF5A 4ZLPA 3I56S 2CJBA 2YNIB 3NL0A 2CPHA 1YHQS 3D0IE 4M5KA 2CZ4A 2QJ3A 2HNDB 3IG1B 3M9NB 1T7PA 5H9FK 1LXNA 2GJ2A 2F3JA 3CCMS 4A8FA 4M5HA 3NGDA 3R7NB 1O6XA 2R42A 3Q8QB 2VA3A 2LCWA 2UV8A 3OV7A 5DRKA 5F3TA 2MJNA 3R5DA 4A46A 1CC8A 4RKUC 3HT3A 1Q5VA 3SFUA 5D15A 2P6TA 2P6SA 2LDYA 4CRJA 2CVEA 4ZVSB 3MUMP 4A8XA 2W9CA 1UA1A 5AE1A 4NXNF 4EYIB 5EDWA 2JC0A 1YX2A 3HLUA 3MM5A 1DLOA 3UN5A 2G0CA 4D3GA 5KG6A 3ZTQA 2UUCJ 3DLLQ 1UFWA 4CO1A 2VFSA 1C4AA 1HQUB 2M88A 4ZVQB 3ZZZA 3T5LA 1M5KC 2AYMA 3M2VA 2RU3A 4PQUA 3HZEA 1YRXA 2AF6A 2MEWA 5C2GA 4C48A 2CVIA 1RT4B 2YWFA 1HWIA 1LOUA 1XR7A 1U25A 3ICLA 3KG1A 5KG0A 3TUJC 3WBZA 2RD5C 2MKSA 4FPRA 5J1NA 1PSDA 5DM7Q 3QRQA 3GQCA 5KT2A 5E5NA 4ETXA 2WVBA 3KHHA 1BMQB 3KHLA 1DTTB 1PJ6A 2QZ8A 2E7XA 5HP1B 1K44A 1RISA 2GJIA 5B08A 3PJWA 3M9OB 2KVIA 2A2CA 3AOCA 4KGVB 4MK8A 4ED7A 2B4VA 3AD8C 2HNYA 2ERRA 1UVIA 1FF2A 1BWVA 3ILLA 4NEZA 2VOPA 2ILZA 3EWGA 2YNGB 3CD5A 5EWGA 1URNA 1A0OB 3BREA 4RNFA 4EUVA 2ZH5A 1S4EA 2LA6A 4YB6A 1BE4A 1HHQA 2A6MA 4I1TA 3PO4A 2DO0A 4F3QA 5EN1A 1SL2A 1JJ2R 1O5JA 4H4KC 3GONA 5GADI 4YB7A 4IRDA 3G6YA 2QL9B 1LWFA 4R8UB 2IC3A 4WFBQ 2ZH9A 2YPZA 1MW7A 3BGRB 1VJWA 4ZDNA 5BYRA 5E0OA 2YQ1A 2GX8A 1TU0B 1S7IA 1WJ9A 3FNNA 1VK8A 4HHJA 4UW2A 1J5EF 1RTDA 2OGUA 3JQJA 2PMZD 3SCIE 2C22A 4HL9A 2DYAA 4KHRA 4JI0F 2UP1A 1IN0A 2Q6BA 1NU4A 3NLCA 4O0IA 4O3SA 1REVA 1BXNA 2C3YA 3CJ0A 2CPZA 1V5IB 3A12A 3MECA 4IH7A 1NPPA 3BGRA 2N3OA 3H59A 1XMOF 2MQPA 4QYZK 3C16A 4F2RA 4EU0A 4NZ6A 3LWLA 3KLEA 1ZZNA 1S77D 3M9MB 3R27A 4DR4F 5D78A 3N79A 1PYSB 3M2UA 4M5DB 2QRRA 2HFVA 1NRKA 5BXIA 2DNRA 1YBUA 2GJFA 2FLOA 4J9SA 4DL4A 1U0HA 4XTTA 2XY6A 4LR9A 3PV8A 5LL6d 4JOUA 3DC2A 3HVTA 2MKIA 4DSKA 4QIVA 2B0GA 1FKPA 1CS4A 3ET6B 1S1TA 2XNQA 1C1BB 1JLCA 4G65A 4RUAA 2OH2A 2N4CA 2QLJB 3ZC4A 5B0EA 1YTYA 3BQ0A 3O44A 4DFPA 4NCGA 1Q1KA 4RW7A 4OLOA 4GO5X 4X4QA 3VAJA 4LRBA 1RSCA 1DTQA 2KRBA 2MTLA 3QNWB 4OYIA 1REGX 3E3XA 2NXEA 2R7XA 3QRPA 2JFDA 3ZTSA 2XMAA 3LH2S 1UTAA 4Z2XA 2YWGA 1GTEA 4KRWA 4UTGA 5HMWA 3K8WA 2IM0A 3CPWR 2UUAJ 2I38A 2GMHA 4F8RA 1GMVA 1VQ7S 5K8OA 1TK8A 4ALZA 3D0GE 2QL5B 1Y10A 3O2IA 2R7UA 2ZFHA 1UZHA 2G2ZA 5BYSA 4QWBA 3VGVA 4ED6A 1B99A 2CQ4A 3CCUS 4NWBA 3FGVA 5M2PA 1K1QA 2WW8A 2HFZA 2KDOA 3I0SA 4MYUA 2LKZA 5KFJA 3TZWA 4HT5A 2Y1IA 5HSPA 4QBUA 1IBMF 2LDIA 4YP3A 2RKIB 4DG1A 1GXUA 5IQ6A 2CJYB 3FVYA 3GMGA 3OUYB 4D3HA 1FFSB 5DZ7A 1RWUA 5ETKA 5L1IA 1JLBB 2KM8B 2APOA 3CJKB 4C0OC 2JVOA 2DKOB 2AZ3A 2ZHOA 3B78A 4RW4A 1UA0A 1LK7A 2V8GA 1S6OA 3NKYA 1CJUA 5EWEA 4U67Q 4DSEA 3V6KA 4MK9A 1S0MA 3MMBA 1D9FA 2A6OA 4DUZF 1NPKA 2C2EA 1R7IA 1JLQA 3LOUA 4H4KA 4TQRA 4PXBA 4YB1P 3PXGa 3VZHA 4PG7A 1EARA 2Z2LA 1HARA 1SCJB 1WC4A 1BUXA 2KYXA 2W2QP 4NXNJ 4JYAJ 2V5HG 3QGGA 5ETLA 4DFJA 1SQGA 4BS2A 2ZEJA 3TANA 1D8ZA 4C8NA 4I0WA 4F67A 1RKIA 2VQEF 3SYZA 1YQHA 2UU9J 5KFFA 2PE8A 4CO0A 1R6YA 2HVIA 1EQ0A 2Q3PA 4JI7F 1PO6A 2YKNB 2OHDA 1R8PA 4JI4F 4YUDA 3X1LB 3FDSA 4WWSA 2Z8QA 3SEOA 3O8WA 1G3OA 5KOWA 4DSJA 2R7SA 2VQEJ 1F9HA 2F5GA 4C8LA 2RDDA 3MOJB 4UZBA 1PC4A 3Q8PB 3LWMA 4ECZA 2HVHA 4KHPJ 1WF1A 2VPYB 3TAMB 1HNWJ 1MMNA 5IT0A 3GIJA 2UXDF 2ZVSA 1QSYA 4DX8H 3R5BA 3AFGA 4RNHA 1NK9A 5HQMA 2IYIA 4P7VA 1FDNA 1FX4A 2BM1A 1YRUA 4DV3F 2R8KA 3JAMY 4LREA 3FC9A 3VAIA 3DRXA 2VFTA 3NOGA 4PG6A 3TZYA 1LWFB 1PIEA 2VBXA 2AJQA 1JX4A 2HNZA 2HQDA 4ZJOA 1L3KA 1ZAWA 3GIMA 4F0KA 1EETA 1T05A 3NRBA 4KTQA 2VBWA 3T9ZA 4FDFA 1RAGB 4K4XA 2Y1JA 1U48A 3EDRB 2UXCF 2EXUA 3TUPA 4TU7A 5CHCB 3DLBA 3KJVA 1KN6A 5IFMA 1NJWA 2IFXA 3M8YA 5GAHU 3N5FA 3CCWA 3NCRA 1ULRA 2CWXA 2X1AA 3EYZA 4DUYJ 4ECWA 4FN5A 5CD4H 1F2GA 3KLHB 5DLFA 3H5YA 1S4FA 2UXCJ 4R0JA 3CO0P 3VQSA 1U09A 2Y1RI 2JOQA 4N7TA 4I4BA 3T1HF 2FY8A 3C6UA 1O8BA 3KLIA 2B9YA 4GVBB 3TEHB 3MUVP 3KTQA 5A0YB 5HROB 4H4OA 2XMMA 2B8QA 4NLVA 5HJYA 1RHUB 3PYEA 4F4WA 3DMJB 4LF6F 1LW0B 2JL9A 2B6AB 3CJSA 2DGXA 1HI1A 1JJCB 2ROEA 1RZMA 1RT6B 4J9MA 1T9YA 2MY7A 1YZ6A 2WCXA 4K59A 2J0XA 2YBVA 4NLWA 2PA8D 1U24A 4USWA 1KFDA 2BANB 1UVLA 1C1CA 1X4EA 4UQGA 3ET6A 1RK8A 4LF2A 4OZNA 2MLYA 2IIHA 4YFUA 1UPMB 3MFIA 1FRHA 1VISA 2NPFA 3W9IA 1M0SA 3FMBA 1UJ5A 2FZKB 2QG9B 3DGPA 3ENQA 1S1WB 3M2VB 3PCOB 4PWWA 4ZPDA 3W2WB 4PQUB 3PW5A 1CSJA 2NXNA 4BDPA 4UUWA 5C42B 4A8SA 2D1CA 1VC5A 2YVSA 4NLTA 4JV2A 4FF1A 1IR2A 3BSOA 3GFZA 4L6V3 4AYBD 1TQLA 2FHJD 3EGNA 4B02A 1U8WA 4C9DA 2BKPA 4PWDA 4ZP7A 2CYYA 4GMKA 5HI7A 4B3MJ 2ACMA 1G7CB 1X7VA 2NXUA 3HMJG 5F8LA 4FF2A 3NWGA 3NCPA 2AEFA 1UEUA 2HFNA 2LQ9A 1RU1A 2VPXB 4ZVRB 3V6DA 3AAWB 1JXEA 3PACA 3TX8A 4MKVA 4F36A 2DY1A 1YSJA 1YBTA 1HNIA 3R8YA 4QIWD 1UKUA 1TUWA 3MPVA 1NJXA 1TUVA 4XDDA 2L9WA 3N28A 2HWHA 2ZZMA 1FJ7A 2X7IA 2YPYA 2Y0SD 2XG8A 2GA7A 2OSQA 4U9RA 3DHWC 3TVKA 3T6BA 3ZZTA 6FDRA 1KRPA 2AX1A 2DR9A 2DTJA 2Q1LA 2NS1B 1ZA1B 4CM2A 2BYCA 3OL7A 3QAUA 4QIFA 3J80U 4TY8A 4YDDB 4IDKA 3DOMB 2BOAA 2GQCA 5KFAA 3IGNA 4K4VA 2OSRA 1HWKA 4FS2A 2DD8S 4DX6A 1HYSB 1N88A 4DSFA 3SSQA 4WCEQ 3HKWA 4NA3A 5KFUA 4DQIA 1PCAA 2BEFA 2F7VA 1S9EA 1SIZA 1XR6A 5KFCA 4ZVGA 4CT9A 4ZKAA 4AL5A 3PHEA 1TAQA 1GX5A 1T0TV 1YGYA 2C2KB 1P9QC 1QJHA 2VPZB 5E7OB 1R3NA 1SQFA 2ZUGA 1VQMS 4LFBJ 1OIAA 5THWA 5IT9U 4EBCA 2CNLB 2YWHA 1HMVB 3MXHP 1TKTB 3PJ9A 4YN3B 2GVDB 3DI6B 4J9PA 1WI8A 3RRHA 3L7UA 1K0TA 4OV6A 1FJGJ 1ZYQA 3FCVA 5J2NB 1VQLS 1ZPWX 3R5GA 3UD4P 5E3CA 2IVFB 3BO4A 4Q2LA 4CH1A 2HNZB 1FO1A 2P9EA 4OQJA 1FRKA 2MJUA 4TXSA 3AQPA 2VDHA 3IR7B 2BQUA 2PIIA 3P96A 1IUJA 1CS4B 4PXCA 3VTIA 3J7AN 4QYRA 2EKYA 3BM7A 4A4JA 3G87A 5AE2A 3D3BJ 4QPTA 4NCGB 2O5DA 2RU9A 2HFOA 2CQCA 3WZ0A 2KFYA 1JLAB 2QYGA 2RRBA 3SBMA 3S6EA 4JI7J 3GP9A 5B0BA 4JV5J 1XK8A 2BRKA 1Z2LA 2IM1A 1IKXB 1NHKL 2H54B 4IYQA 1RQ0A 1U45A 1I1GA 1IBMJ 4B9TA 2GNKA 3ZTPA 2CPYA 3U1LA 2NQPA 1C2PA 1RWOB 2VB6A 3I4HX 3I32A 4MIAA 1S72S 3DRPB 3TP2A 4AUKA 1JKHB 2R2RA 2IBKA 1HBUA 2KI2A 1WI6A 4ANCA 1S6PB 4ZVOB 4EFAC 1RTIA 5A76A 3NMRA 2K1RB 1Q95G 5IM0B 2VHGA 4ECRA 1RCOB 1VC0A 5HLFB 4IDKB 2WOMA 4MH8A 4YR3A 2XMKA 1DRZA 4LF7F 4GKJF 4JI0J 3LP1A 3HHNB 1UMJA 1NO8A 2JFKA 3MF5A 1S1UB 2HZCA 3UNYA 4EO6A 2CWKA 2DNNA 1HW8A 2HRUA 3NS6A 4DV0F 5C2CA 1T95A 2L3MA 4FKYA 2AWZA 3QFHA 3IO1A 4G1IA 1N6QB 1FCAA 1RTIB 1N5YA 1SL1A 2DH8A 3OL9A 2FHMA 2W7AA 1WG4A 2MZTA 4L75A 3EJMA 1D09B 2CQBA 3JQKA 3DI6A 1SH3A 4R5PB 3EUNA 2YNFA 4USJC 2RHQB 1T9WA 3CMQA 3ENAA 1V3ZA 4XPCA 5L1JA 5LMUF 3MR6A 4C11B 1R0AB 3D1HA 5I3PA 4EO8A 2XSFA 2OPSB 1GT8A 4F0MA 2CADA 2XBPA 3HZGA 4I6YA 5KT7A 2XGQA 3GJRB 3HD1A 1F1BB 5HAOA 1NBEB 3OUYA 1NJYA 1M5VC 2HHHF 4WIQA 5DDOC 4N5SA 2VG6B 4WU2A 1FFWB 1R43A 2I2YA 4OYOA 1HWLA 3FFIA 4ZCIA 4QYZJ 2FTRA 2FJEB 2V8VA 3Q89A 1NK6A 4FF4A 1VQNS 3A3OB 2F8MA 3P8BB 3QIPB 3K58A 4DR4J 2W2PP 2XWXA 3OLBA 1Y0HA 5D0RA 4DPWA 4ED4A 2BJ9A 4MKYA 2J6SA 1QY7A 3FK4A 3MMAB 3PNIA 4IR9A 3CVKA 4BHQA 4NZ0A 4IFYA 4J9UE 2BANA 4XK8C 3M6UA 4Y2CA 3CDWA 2Q6CA 2ILYA 5I4MA 4P2FA 3KHGA 3PEJA 4W98A 4UY85 2LQBA 5LMNF 3JS9A 5L8RC 4JI5J 1SKSA 2AIRB 4WP3A 3MOZA 2BE9B 2RILA 1IBKF 2HHXA 1HNIB 1PBAA 1OPZA 3JTOA 2OD6A 5DQIA 2XMUA 1RTZA 3N6NA 2FLLA 1F5AA 3NGTA 2G9OA 1U8SA 2N7YA 2YKMA 2VICA 1NZAA 2G1HA 4KE5A 2B4PA 5KFBA 2J9DE 3TAMA 3LW5C 3KLFB 2OMLA 5CCLA 3AOBA 4QIGA 1SJQA 3G2XA 4FYXB 5C24A 1S6UA 2CQHA 3QIDA 2OUGA 3KK1B 2XGPA 4ZLJA 1D3WA 3BGOP 1SKUB 2AYEA 4P2SA 2A0FB 2UUAF 2NCKL 8ATCB 2VF3A 4Y34A 1KKHA 2RMLA 5KG3A 4J90A 4CLUA 2GGPB 1X4GA 3TX0A 3HI9A 1HA1A 2AX0A 1TKZB 1FHTA 5B7WA 1KQKA 4PUOA 4LBIA 3MD3A 4C97A 2O3DA 2WB1D 3DKDA 4KAIA 3VAGA 5GMDA 4LF8J 1HQ2A 1TP7A 2EG1A 4JBCA 5JMNA 3Q23A 4EYHB 1N0VC 1X4AA 4AXJA 4X4UA 4ZHRB 4RNOA 4OI4A 3FEZA 3PEHA 3CULA 4TY9A 1I3OB 3K89A 5F8MA 3FRYA 1QAJA 2EC2A 3LP2B 3PY8A 1IKYA 2AYGA 3A4TA 4C3MA 2MYFA 4FKXA 4PR6A 4HHUA 2W24A 4C8OA 5HROA 4ELVA 2VASA 4Q0BB 2KTQA 1QTNB 2YWWA 4CTAB 1Q7YT 2MZRA 1GAOA 1VCTA 2F8HA 4HDHA 1FK9A 3TJ9A 3M6WA 3MHYA 2ZH4A 4UY8T 2RQKA 1G4CA 2OEJA 1VBKA 3TUZC 3MAAA 2HGLA 3NGUA 1P8GA 1Z1ZA 4ZVUB 4DV2J 3VZIA 5DDQC 4DF4A 2Y8YA 1LKZA 1JLFA 2WRMA 2OD4A 1Q79A 3FQKA 4R8UA 1X4CA 1X5TA 2MKYA 1MMLA 1RAIB 2M2BA 3G8SA 4RLEA 4MIBA 4JUZA 2DBBA 2Z57B 4HLBA 1WUUA 3O5TB 1KD1T 1WDTA 2CZ9A 4ENOA 3H8YA 3QSIA 1BWEA 3IMQJ 2CDQA 2BM0A 5MAOA 4WTYA 4OX8A 3QQCD 2IM2A 3IR5B 2CG4A 5KFNA 1XBWA 5H9FJ 2IVMA 1Y3JA 1JLBA 1OJ4A 2H4WB 4DR5F 1X5PA 2KYZA 4QWDA 2BW7A 4DPYA 4FF3A 2M7SA 1GEHA 1H98A 3EGVA 3ISND 4I7FB 3B4MA 4KR0B 3O3LA 4DHVA 2N7CA 4PPZA 1H3DA 1RXOB 2YNHA 4TN2A 5ETNA 4U7CA 4DL7A 4DV0J 1BHNA 3E8OA 2GGPA 4WBFA 3WIVA 4ES1A 2XMWA 4DLGA 1N36J 1QUVA 3CCQS 3JQMA 3PDNA 2FJBB 5HBMB 1GH8A 3KK3A 2JC1A 1FEEA 3I82A 2C2DA 2C28A 2DH9A 4V1Ak 1ZH5A 1P1LA 2CPXA 2RF2B 3PIPQ 4QU6A 3G8TA 2XZTB 1U0HB 2ZD1A 3CJQA 4JI3J 4H4MA 1U2CA 1HNVA 1KTQA 3DHXA 4RL1A 3UR0A 1MG7A 3MUTP 4ILLA 2KU7A 3M2UB 1R31A 3D0HE 2FHKA 3HFZB 4QW8A 1WOSA 3AB4B 2CJ9A 2YX1A 2HHUA 2JLFA 3GU0A 3VCDA 3KHRA 3EICA 3MM8B 1GMWD 4OZ0A 2W2MP 4ANEA 9ATCB 1D8YA 2XNRA 3DOMA 3H0PA 3WX4A 1N48A 1FVQA 1R8AA 4LJMA 5GAHI 4P72A 4OMFG 2EK1A 3KK2B 2KL8A 3I4PA 3M32B 2FPHX 2R7OA 2GAGC 3IBWA 5KG7A 2D3ZA 1W2BR 2IMWP 2XEXA 2DGQA 4G6VB 5EX0A 2RS8A 1FJEB 3MMAA 1EIYB 1ZAXA 1T11A 4X64J 4CCHA 4URQU 1VQYA 2HQIA 1S7HA 3QGPA 4EBDA 2FY1A 2MPUA 2FB0A 3OHBA 1UFKA 4U96A 3G6ES 3BN4A 4S0MA 1FD8A 1WKKA 2ROPA 2VFUA 3FRZA 3NGKA 2K7JA 4K4WA 3T1AA 3K5LA 1TV6A 2EI5A 1OSCA 4K7QA 3PJXA 1SI9A 3R2CJ 2GAHC 1C4CA 2V69A 3MEEA 1ACMB 4J37A 3MR3A 3GV5B 3QBCA 4OYMA 1WHXA 3AY0A 4WF9Q 4NYOA 1QSSA 5J2MA 3TA1A 1X0FA 2PEHA 5MLCV 1CQMA 3H4DA 2QSFA 4X66J 1CJKB 1LXJA 1WD6A 2FZGB 4YOEA 2DISA 3GILA 2H5IB 3E2EA 5D0HA 1CJVA 4F25A 2W7PA 1VRUA 1X4BA 2FVQA 2V94A 2BA9A 1X5SA 2VKRA 3A8IA 3BB5A 4CLTA 4EWTA 3J7Z5 1IWGA 2ZH7A 4B9MA 2HG4A 2QA1A 3QWUA 1JIHA 5A8KB 4RW9A 5KTQA 5IT9Y 2BW2A 2OJ3A 3D4JA 3KLFA 5CH7B 3HHEA 2ZUAA 4F0HA 2VDIA 2XMTA 3LANA 4YDXA 4KV8A 1XEZA 3GG0A 1TFYA 3NEKA 1N32F 2YKAA 3MMCB 2G0IA 1HW9A 1PILA 2RB7A 2W4PA 4LRFA 2DRDA 2CG8A 4FYWB 1OY9A 4J9OA 1Q16B 1S48A 4NCAA 4B9LA 2FHOB 4IG3B 4LSZB 5B09A 2HQFA 4DR6J 2HHWA 4C8YA 1M1HA 1IR0A 2ALYB 5IT4A 1KONA 2R4FA 1FDDA 4J9KA 2LXFA 2OPQB 2YNIA 3BPSP 3I55S 5L1KA 1U26A 1YJVA 2KT3A 5IS2A 1BD6A 3DXSX 2FJVA 2WVFA 4M5GA 3PYDA 4F4AA 3PO5A 2DGSA 3N6MA 5DZ6A 4JI4J 1DTTA 3AJ2A 3K2YA 4WP8A 5GMEA 2ZVIA 5FD1A 2XI3A 4CYUA 4E8UA 3L7OA 4LSNB 1NPRA 1ZOTA 1Q78A 1QDUB 3E01B 2ZDPA 2GHPA 3K5OA 3MM5B 4EEYA 2ZKUA 1XNQF 1WACA 4L73A 2B5JB 4P74A 5I3UB 2FC8A 1RKJA 1QAYA 4DXLA 1NK7A 1NEEA 4RBTA 1RA7A 2IDEA 2E9TA 3BF4A 3RB3A 4DV5J 1HQEB 3AJDA 3MM6B 3JYTA 2ASYA 2NSBA 3J7ZT 3RR8A 3CEDA 2FIUA 2RQ4A 2V67A 5LXYA 1RAFB 2ATCB 4G1QA 4AT1B 4ZCMA 2J0WA 5J2PA 1JJ4A 1B3TA 1TL7A 2NZ4A 1CULA 4A8OA 4QR0A 1SH0A 2MQNA 3SDEA 4J9LA 2AJ4A 3ILIA 3EGZA 2IA6A 2QTWA 1LWEB 3DOLA 3RBZA 4DI6A 3JSMA 3BBFA 2BX6A 1X4FA 1VC6A 4OI3A 5D4NA 2HK3A 1VIXA 4N76A 2HQGA 2MQLA 2ZOFA 3FBFA 4ZP8A 3J81j 2GFFA 4I56A 5AT1B 2YKPA 3IWLA 3CD0A 1NDCA 5KFPA 3MM8A 2GO9A 3TUIC 4LF4F 2OLWA 1SC3B 1WC3A 2V2VA 1P27B 1TKDA 4NLGA 3FBEA 3BDPA 4ID8A 4RWWA 1JLGA 2OIHA 1HQEA 1H2VZ 2GO8A 3IBCB 3CT9A 3LP0B 1L3TA 1U0SA 4DQSA 2Y1LB 2HRYA 2VQFJ 4ES3A 3J80Y 4J9NA 3BSCA 3CJKA 4OI0A 4OX9J 2Q66A 2BXJA 1RLDA 2OELA 2ZNYA 4DJBA 2GQQA 2Z2MA 2E1CA 4YY3J 4R25A 5D3GA 2F9JA 2E29A 1FDAA 4LSNA 2VQFF 2PDAA 4M5NA 4U8YA 1LWCB 4RPFA 4LF5J 3I0RA 1YJRA 3VAFA 2CNNB 4ERDA 5JXSA 1XQIA 3OD2A 3CGIA 3TYTA 5HP1A 2OPRB 1DURA 1UW4A 4MYTA 4WFXA 3FJ2A 2IY5B 1H73A 2V50A 3IAS9 1EX8A 5E2QA 2XZWA 4C0BA 3S8SA 3F0NA 5E41A 3ENVA 3RYLA 2ZITA 5IV4A 5KFDA 1TELA 1ZTTA 3NS7B 4FPIA 3OHAA 2AQ4A 4JI6J 2FGCA 4UZCA 1L3SA 2G2OA 4YS2A 2CPEA 4ANDA 2KG0A 2HIYA 1VBXA 4HH0A 1F60B 1H2UX 1MROA 1IM6A 2MKCA 5A0YA 4YR2A 1N32J 4OFZA 5DS7A 1VLYA 2HBQB 1LWCA 1LNQA 2ZOGA 3QYYA 1NHVA 2X3DA 1HMVA 4LBHA 1ELOA 3VHQA 1U1QA 4DS4A 2M70A 2IBOA 2PSZA 3BYPA 3GJQB 3A13A 2V2QA 4FNHA 3FCWA 4UQTA 3OXFA 2XS7A 3CDEA 3JTNA 2JEIA 2IJNA 4G1PA 3MAAB 4R5PA 3LF0A 3HSDA 2HPUA 4FXWA 1B7YB 3KDOA 3SIPB 3T3FA 5DLGA 4RR5A 4C6AA 4I2PB 2LEBA 4CLWA 4QIEA 4KGZB 1HYSA 3OTCA 1JNRB 1J5EJ 4X4SA 4NXMF 2FUG9 3JSYA 2V63A 2XCAA 3MI7X 2XO7A 1A6LA 2RIJA 4PEOA 3DGPB 1M5HA 2VA2A 3PYFA 2CQGA 2J9CA 1U2RA 1F3FA 2VU5A 2BVZA 2HS0A 3G4SS 4ZPCA 4OHWA 3BBBA 2XMVA 4DX5A 4RW8B 4F4KA 3ITHB 4C98A 1CJTB 3JB9k 3DGVA 4HH1A 4B9VA 4U95A 4X4VA 4LF9J 4K8RA 3TA2A 4X62J 2OMOA 3EZ5A 2E1MC 5J2QA 4IO1A 4RW6B 3FSYA 5GADU 2OPPA 3DRPA 3M05A 3GLJA 4YR0A 3DYAB 4ECTA 2JWNA 4H54A 2D3O1 2PEBA 2B4UA 3OTOJ 3H5UA 2NSCA 2COLA 2J7WA 3CDAA 2ZJPQ 3GYXB 4O44A 2ZM6F 1NJIT 5HLFA 2PMWA 1DARA 1VK3A 3NAHA 5HATA 1DBDA 2V6AA 3AB2B 2R8IA 1MN9A 1U1MA 2R8GA 2PI4A 4CTAA 3SCKE 1RBLA 3C8YA 4E2FB 1TFWA 1D1UA 3QWPA 3D6FB 1HNVB 4CDIA 5HO4A 4V19X 5J1EB 5ETMA 4PZVA 3TZZA 4RUCA 3J7YU 2ZBQA 5D77A 1CG2A 4YEAA 3MECB 1VR6A 4IFVB 3KK2A 2ZH1A 2ZJQQ 5LM7E 4DFMA 1N34F 5DDPC 4B3RJ 2DO4A 4PXEA 3DOKB 2WBRA 4UF4A 3M8PB 3FEYB 2CZVC 3JYTB 1JXLA 4DQRA 2DNPA 1MLAA 1S59A 1YG0A 3KWMA 2BDPA 2VFVA 1HBMB 1FKOB 4ETZA 1CJTA 1Y4ZB 2BRLA 5CYJA 3SMZA 1N5SA 5L39A 4PUOB 2K7KA 5KG4A 1S79A 3GCXP 4HI1A 1LW2B 4IG0B 5L9XA 1F0XA 2DT9A 2DY9A 3GYGA 1GXLA 3BYRA 3LGMA 3LP1B 4KC5A 1KLMB 1JLEB 1FDBA 2E7WA 2HKEA 3SV3A 4KFBB 1HHTP 2FVSA 4C8KA 1UVKA 2VL1A 1IXKA 1FXDA 1HWJA 1K8AT 3DN9A 3FSIA 1Y9OA 3N4WA 3QIPA 4WK1A 4E98A 2BBEA 3LALA 5DGAA 5JUMA 2OTJS 1EETB 1EHWA 3LPYA 3NG8A 4OYAA 3UCUP 3KKFA 3D2WA 1IBLF 3IS9B 3KG0A 2ZDOA 3PW2A 2HVZA 3IA0A 5HQ8A 3KFWX 3MEGA 3TNVA 4IFVA 3TR5A 3HHLC 3W9HA 1NSAA 2DNQA 2HHPA 2QL7B 4NLUA 1KLMA 4ZP6A 2XQCA 2HLUA 2XULA 1DHMA 2HGMA 4QJVA 2XLJA 5IV3A 3OT9A 4C2MA 1XNQJ 2BJ3A 5BR8J 5DGBA 3Q83A 5F8NA 2CJXB 1Y5NB 4YB5A 3VAMA 1U02A 4KO0A 4HI2A 3BSNA 1OY8A 3DLEA 5K9FA 1WG5A 3BR9A 3UNGC 4USIA 5KT5A 4EI2A 3W66A 1KHWA 4KV8B 1HBNB 3T1YF 3OJUA 2KH9A 2RUGA 1WTBA 4DBQA 2B9EA 4MKBA 3CNQP 3SQOP 4CH7A 4M94A 3LAKA 1MMDA 4OL8A 4USUA 2L9DA 3M8WA 3CJ4A 3P4UB 4RW9B 2XSJA 3PM9A 4Y28C 3T5KA 4PRFA 1MU2B 4N56A 4RU2A 3VALA 2WOMB 4F04B 3C3LA 1TL1A 2FLNA 2RSQA 2DXFA 3OVBA 6AT1B 2VOOA 3ZZRA 2WTFA 1RT1B 3ILOA 2MHNA 3OFHA 4CLYA 2G0JA 4LIRA 2UZAA 3DOKA 1RHJB 5KFGA 3UW1A 4XO0A 3TAQA 4O0NA 1KVKA 3SXLA 2V8PA 2JZ5A 2GIQA 2X51A 3B82A 2M9KA 1AUSL 3I0SB 4KBIA 4OZ5A 4PWUA 4X4PA 4DL0C 1ZETA 4U7UD 4Q7AA 1WC6A 3AJ1A 3MEGB 4DPUA 4URSA 4ZJQA 4FNIA 1M5PC 1IBKJ 4CLZA 2M52A 2FJWA 1WWHA 3AXKA 3M1VA 2Y8WA 4Z7YA 5A8RA 4DU7A 1QSLA 1VQ6S 4OHVA 3H20A 2CJQA 4ZPAA 3SV4A 1RWVB 1HBUB 1WKJA 2CQIA 2DH7A 2RE1A 4M63A 4ZPBA 1TL1B 5EX3A 1IKWA 4ZIVA 5A6PA 5C42A 2R8JA 4RX6A 1DJ0A 3M32A 3C15A 2DNKA 2POKA 1FTRA 3RJMB 1HWUA 2IPOB 3CTRA 5C7PA 3PZPA 2XS2A 1RT7A 1S9GA 3CIZA 2XS5A 1M1GA 3KJQB 3OPKA 2PI5A 1CPZA 4WZMA 4I6WA 1ZPVA 3PG9A 4IOBA 3U27A 3RUBL 8AT1B 5AJ3J 3R5JB 1RLCL 3FZBA 3ZO7A 3NNAA 5F41A 3DOLB 2UXBJ 1D9AA 1CBKA 2KKHA 3ZZPA 5B0FA 4ZITA 5I3UA 2DB1A 3V4IA 4QU7A 4Q5VA 3THTA 1YJ9S 3OTEA 2M5YA 2U2FA 1CEZA 2Z4PA 2BKOA 4HDGA 2EFPA 4IFYB 5AXKA 2KG1A 2DHGA 1DAXA 5D4PA 3PX4A 1FKPB 3U1MA 3GFXA 1S6QB 3CJ8A 3IWXA 2XYPB 2CQ1A 2YH0A 2K8GA 3VV2B 1YK9A 4ZVTB 4GC6A 3FKBA 2UUBJ 4L76A 3EXYA 2V9KA 1VI7A 4UOCA 4Y2MA 4J5OA 2DR5A 1T05B 3LO3A 4F2SA 3LP0A 1LEOA 1ZTWA 1TAUA 5K8NA 1V6HA 2B9WA 1V3SA 1Y00A 2JNJA 3B4DA 3BN7A 4ZLNA 3AODA 2V9WA 4CLKA 2HK2A 2RJZA 2VONA 2V68A 2YNFB 4DQQA 4JI2F 1L5UA 4CO4A 4KH1B 4WFZA 4DV1J 1DTQB 1KOHA 3RB0A 3MGJA 1QAXA 1YJTA 2KXFA 3CJ3A 2I5JA 2MQQA 3TOQA 1UP1A 2MKJA 3IG1A 5KFEA 2UVWA 1CQNA 3VAKA 2ZH8A 4TQSA 4CNZA 2A10A 2EFOA 1HHSA 2ZM6J 1CJVB 1RAOA 3MZIA 1AZSB 3DU5A 1FE0A 3M8PA 4JI1J 4JI8J 4ES2A 2BABA 3OFFA 3HPOA 4DF8A 1EQMA 4N8NA 1NDLA 3I31A 1VQPS 2W9CB 3G86A 1TZ0A 3R9LA 3VWSA 3NBPB 1VHFA 2WAQD 3IP0A 2HSEB 4M5LA 3T1YJ 2RRAA 4GKKJ 3EPGA 3EVMA 3K59A 1EJ7L 2M4MA 4TLQA 3MAHA 4O3OA 4K4UA 4PG4A 2F40A 2FQQB 1AXQA 2PA3A 1NSQA 4ED0A 4ILRA 4ZIWA 5B0GA 2HHTA 3QO9A 4NRTA 2FGOA 2O1PA 2YX7A 2HEKA 3DRSB 1NNDA 1W25A 2C42A 1SB6A 2XI2A 3CD6S 2CJAA 2A18A 1T8EA 4PYDA 5BR8F 5IC4B 1WELA 2WK4A 2X1GA 1GMUA 3HFKA 3OFEA 3T9NA 3G71S 4LRAA 4MFBA 1OO0B 1UWAA 2LA4A 1B7FA 1E6YB 3HULA 4PPDA 3JSMB 4PKDB 4NL5A 3W61A 4JI2J 1I94J 5ETSA 3V6HA 1MROB 4OLPA 3N0VA 1Q7LB 1XIQA 3HJFA 2DR6A 4ZVPB 2YH1A 2CJKA 1N33J 1RDRA 3JTPA 3V6DB 7FD1A 5F8HA 4CI0B 2JH3A 1FXLA 1AW0A 2RVJA 3ZNJ1 3EGWB 2R7RA 5C5JA 2KN4A 3M2RB 1MNEA 4A8QA 1E6VB 1UPPA 2LP4A 4DR7F 1KR4A 1FA0A 1SV5B 1VLOA 2E5HA 5ETOA 1WDDA 3TVYA 1V5VA 4BWJA 2VG5B 2HQ3A 5T14A 1WHWA 2E5JA 4NMLA 3UO0A 4RNNA 2L41A 3TARA 2HQCA 3PR4A 1TK5A 2GZOA 2FYXA 1LWXA 2FC9A 3ELHA 2KHCA 3PX6A 2HYIB 3ZFVA 2LQJA 1K1SA 5LT5A 3ETOA 4Q44A 3OL8A 4EZ6A 3NP5A 1RT2B 5F8GA 4IOAQ 1IQZA 3TQEA 1YWXA 1QUPA 3MEDA 2KXNB 4N41A 1JB0C 2CKWA 3LA0A 3I5CA 2EPIA 1RT4A 4ER8A 1HPZB 3S7RA 3B8HA 5EWFA 4QR2A 2KB2A 2V4JB 3HSGA 3CDBA 4WFNQ 1Q86T 1K0VA 3MPWA 4FBTA 1F6TA 2KXHA 1MWZA 4ZN3A 1NH8A 2ABYA 2I1RA 3MM9A 4DCOB 3KJVB 3ZZ0A 3ETMA 4M5MA 3SFGA 2UUBF 5KT6A 4NEYA 2H5EA 4RW4B 5H9EJ 3DLHA 3GWCA 2HAFA 3K7RA 4LF8F 2H1YA 1CJKA 1F2HA 1JQGA 1ZAVA 5A8KA 3UWTA 3J81Y 4WPAA 1HBOA 3WDOA 2VD3A 4LMZA 1B0PA 2QSWA 1Q8BA 3FMWA 1WC0A 5LXRA 2AHOB 4ECYA 1Z2ZA 1KQSR 3V2UC 1J2VA 3PHTA 2UXBF 1GX6A 3DDNA 3UDEA 2ADBA 3GZ7A 3M30B 2VBYA 2OPRA 3MPDA 5KFYA 2Z30B 3LGNA 2IAJA 4BC9A 3QT8A 5T7LB 2WSEC 3M7VA 2YQ0A 1NCLA 3H98A
chains in the Genus database with same CATH topology
1HL6A 3T6JA 2VG7B 3CD7A 3VQTA 1WF0A 3NMAA 1DQAA 4KJIA 1S6QA 2ZE2B 3M2RA 3QPIA 1FNXH 2QEXS 3DM2A 2DGWA 3CCES 3TO8A 4N77A 1HD0A 2QYCA 3SI8A 4JV5F 3C66A 3BR8A 1UAWA 2LXIA 2F8EX 4ZHRA 3UFCX 3GG1A 5L9NA 3NNCA 1C1CB 7FDRA 5B0DA 5KG5A 3ENWA 4MIWA 4R0EA 3CCLS 4ED2A 1H0HB 3LP2A 3L7PA 1Q82T 4K5RA 4DR2F 3OJSA 3BQ2A 3OTBA 4FXDA 2ACYA 1U1LA 3IN5A 2OO4A 1S1UA 1ZM9A 1OPIA 4XPEA 4FVMA 4IRCA 2QT7A 1UEVA 5BYQA 4UUXA 3KYLA 1RJJA 1PC5A 2CPIA 2VC0A 3DLEB 5KG1A 5IM0A 4QPXA 1RT1A 2DNLA 3F56A 4KHMA 2VBZA 2WSFC 3MMJA 2JEJA 5KFWA 1UJ6A 3I5BA 3LUYA 2W4DA 5CCMA 2IM3A 2IRYA 4DLEA 4LSLB 1X8DA 4FBUA 1RYRA 5SUHA 1IQTA 2X1FA 5CYQB 2BJDA 3V4IB 4B3RF 4QWCA 2J76E 4NZ7A 2QV6A 2W8KA 4A8YA 3QAEA 4DL2A 1NK8A 3J7A1 1X0PA 3T5HA 3KLHA 2QMXA 2M8HA 2ASDA 3KLGB 1U6ZA 2YKOA 3ISZA 4GO7X 2RQCA 2FVPA 1S9EB 5B0CA 4A47A 2Q79A 5KFHA 2KJWA 4ZA1A 4ED5A 1T03B 1C0UA 3K5PA 4Y0FA 3CC7S 1OSDA 1SC6A 2J7KA 2V4RA 5D3GB 1AROP 2N82B 1S76D 4U6PA 4AQYF 3G9CA 4J9QA 2V0NA 2KO1A 4F4XA 4V19J 1X9MA 5K14A 5KFOA 1RT7B 1RGVA 4OI2A 5CYQA 2PMHA 2LECA 2HS3A 2KHDA 3I5AA 1IKYB 4DV6F 4MTPA 2MQMA 4WKYA 1JLQB 4LF5F 2LVWA 2LLZA 4ID5B 4ZVHA 5FDLA 1SL0A 5J1PA 3R1LA 3HO1A 3DU6A 4KKOB 4C7QA 4TKTA 3H2VE 3ULHA 1CLFA 4NLYA 4HKQA 2ASLA 2BQ3A 3FCHA 3GB0A 4URGA 5K8PA 4DFKA 3I9V9 4C4WA 2IRUA 4LVNP 1KNZA 4QQBA 1KTVA 3MPYA 3US5A 3O6QA 2JLEA 6FD1A 4I68A 5F9LA 5KFZA 5AJ3F 3PW0A 2QA4G 4JYAF 3DM2B 4G1QB 1QVFR 4LVOP 2X1BA 3IS9A 2W4CA 4PWDB 2MZJA 3MTKA 3P6YC 2DHAA 5F0UA 5A2QY 2HNDA 1LQ9A 1WHYA 1TV6B 2HS4A 1LV5A 1N52B 2M8DB 1KSPA 4Q8EA 3UD3P 1A7GE 2I5JB 3M30A 4DV1F 3C46A 3CCSS 1S0OA 3L95X 2HAIA 1HBNA 5AXNA 2KRRA 3CE8A 1N36F 3HVRA 1XC9A 2N4DA 2RKIA 4DG1B 5LJ5Y 3OTDA 2ZNZA 1RAJA 4IO9Q 3DLKA 1FRLA 3OTOF 3P3DA 2BACA 4MAKA 1SJ3P 1QVGR 1FJGF 1TKTA 3MFHA 1TL5A 4O4GB 2JEFA 2CQ0A 2QO3A 3TW0A 3DRYA 2J6UA 4WK3A 2OAUA 4ZPTR 5EGYA 2UUTA 3KLIB 1U1KA 3HP6A 1AFIA 2FJAB 4NLPA 1BQMA 3HHLD 5JJBA 1ZZFA 2LEPA 2YNHB 4IG0A 3S1TA 4DPOA 3IRXB 3VAHA 2EK6A 2JJ4D 3R3TA 2I9SA 4OI6A 1K73T 1C0TB 1DFDA 4IH6A 3NS5A 1IM4A 5KFKA 4CO3A 1N5VA 4DR6F 1V9OA 1HNXF 4DV7F 2VG5A 1NKEA 3R5AA 3S01A 4RW7B 5GAEI 1FRJA 2V4JA 1KHVA 1RI7A 5DDRC 1T3OA 1MWYA 1EP4A 1H6KX 4LSLA 4WJBA 1J5OA 3L09A 3F44A 4MKAA 1JKHA 1HI8A 3K5MA 1NK0A 3V6JA 5C25A 1N8RT 3IRWP 1KVIA 4K2XA 4P7TA 4IQXA 2QE5A 2ASJA 1TL3B 4K50A 2DRBA 1ZM3A 1H38A 3FQLA 3N6LA 5M2RA 3RAMA 1Q53A 5D8HB 2VV5A 4HTIA 4NA1A 5J2QB 2UV8G 3G6XA 4LFAF 1VRTA 4OJGA 3OLAA 2L48A 3SDEB 2AGQA 1S97A 4B3TF 3GIKA 2VC1A 4KPYA 4MJKA 5GAGU 2NYIA 3BO3A 4DR1F 2EWHA 3J7YI 3KMSA 2D7SA 4C3KA 4ILMA 2B5JA 2D9OA 1HI0P 1NK4A 4ZPVR 4A48A 2E5LF 2WHOA 3QGIA 2F4VF 4B3OB 1S0NA 1BQXA 4KO0B 2DIVA 2DIUA 4Y2AA 2OTLS 3K0JA 2K3KA 2UUCF 2XLIA 2IA0A 5DQHA 2AGOA 1IJFB 4Y2KA 4ED3A 2QLWA 2X3GA 1LW0A 4FZVA 3ISNC 4ZP9A 2E9RX 1IJEB 4KHPF 2H9ZA 4NLDA 2FJDB 1NAQA 1HNZF 1VQ5S 2C3MA 2DPIA 2UUWA 3NAIA 2MB0B 2F1FA 5CA5A 3O1LA 3QJJA 1FNMA 1JNZB 2BV3A 1WEZA 4L72B 1U1NA 3FSXA 1R8CA 1VOMA 2JX2A 4OHXA 4C8MA 4HTJA 3F41A 4AXIA 5IWAF 2C3PA 3RAQA 2E9ZA 1R8BA 4AE5A 3W2VB 1WTFA 1JLGB 3SCLE 4NOHA 3M4XA 2WONA 3I0RB 2EBEA 5J2NA 1VQOS 3C6TB 1XWLA 2MZQA 2AP6A 3CB4A 2GMJA 4USHA 2R2TA 1YRTA 1LFPA 1S9GB 1U2FA 4B17A 3T5JA 3OR1A 3QGHA 1VGYA 3IXQA 3IR6B 3NNHA 1DQ8A 5KOXA 2AU0A 4OX7A 4X4RA 1UWBB 3QMQA 3UQSA 4ZS6A 1N4LA 1YJNS 1H2TZ 4FF4A 2ZOMA 4WFYA 5LJ3Y 2J5AA 3RB6A 2B43A 1X9SA 4CZCA 2LQ5A 2NUUG 1LFWA 3GFHA 4TY8B 3SQGB 3UCGA 3Q24A 2K2PA 5JVGQ 2B4OA 4N47A 1TKXA 4AL7A 4DN9A 2RRNA 2J9DA 1WEYA 4ELUA 3Q8SB 3C2PA 3QJPA 1M5SA 1S9FA 2PD1A 2DR8A 5A8WB 2JRSA 1VQKS 4DOZA 1WNEA 1QLNA 3M8SA 3QZ8A 1VQNS 1KOOA 1Y5LB 2FHJA 3BS9A 2AYBA 2J9EA 4RW6A 1WHVA 1N5YB 3GIIA 4DV2F 2CFXA 2ZBCA 2ALZA 3UI3A 1C0TA 2DPJA 1UVJA 1MU2A 4RU9A 3ITHA 3N01A 4B9NA 4TNOA 3CO9A 2AJFE 5T7LA 4O3PA 4NLSA 5FDLB 3CIMA 2HWIA 4WFAQ 3OSPA 3M6XA 2B7CB 2HHSA 2ZC3A 1NH7A 3RU0A 3KMQA 4ZVEA 1MSWD 2Z0GA 4DL3A 1YJWS 5J1EA 3CF5Q 4HVZA 2ZE2A 4E0DA 2YY3A 3DRRA 5T41A 3CCVS 5K14B 4DSLA 1UJ4A 1NKBA 1DZ5A 2MMYA 2NPIA 2XHWA 3CJ5A 4X84A 5FIIA 4O3QA 5F9NA 2DR7A 4C8ZA 2U1AA 1UETA 2R7WA 5KFVA 3HVAA 4MK7A 3QLHB 4U7UK 4Y2IA 1R89A 2RT3A 3MR5A 3BGLA 4PQAA 4W90B 4O4RA 5KT3A 4LT6A 4IG3A 1RT6A 1QM9A 3HM9A 2BR0A 4OJ3A 2CPJA 1C1BA 1JLCB 4IKAA 2HLTA 2V8HA 2KJVA 3MMCA 2OPQA 5HMYA 5DETA 1VBZA 1GQEA 2HVIA 3H5XA 2VUGA 4I69A 1FEHA 2E1RA 1JLFB 3MEKA 4JI5F 1S1VA 2EFGA 3I9ZA 4NRUA 3G96A 1R8HA 2RNEA 1FKOA 1HBMA 4CIOA 4LFCF 2PC6A 1C0UB 4ED8A 3HHLB 4YMEA 1HFEL 3UPFA 2GQ2A 4A8WA 3FEXB 3PX0A 2RF2A 1S1XA 3V81A 2A2DA 2IYGA 3ZZOA 4C3LA 4K4SA 4Y3CA 2KT2A 1KQGB 4X4OA 4Q43A 5CQGA 3MMBB 4ELTA 3DLKB 2OPPB 3P5TL 2V4QA 1N33F 1Q4RA 1RTHA 3KNGA 1O0PA 1VRUB 4O44B 1RT5B 3K57A 3AHPA 1VBYA 2FVCA 4F50A 4MFBB 2MSTA 4NLXA 3SZ2A 2W9BA 5G0RA 2MZ1A 3GR0A 3GFYA 3UE2A 2JLGA 3HVTB 2HHQA 3W7BA 4RZRA 1DQ9A 3MEEB 3D28A 4HEA9 1FK9B 3N5BA 3RR7A 2ZC4A 5GVQA 2NR0A 2YWKA 3M1VB 4O3RA 1SJRA 2DNMA 1SBRA 2WBMA 1BQMB 3GE9A 4FP9A 2M0GB 3MTJA 3BGFA 3PFOA 1FVSA 5IXUA 2XSJB 2YKMB 4ITSA 2IHR1 5G0RB 4RWXA 2MKKA 1BGXT 1Q81T 4F4YA 2QA2A 3CJ2A 5LSRA 3PIOQ 1FT8A 1U1OA 2A1BA 4JI1F 4WZQA 4KT0C 1QTMA 2E66A 3SQGA 4FXVA 3DYAA 4QCLA 2PO4A 2OFHX 3V4MA 4AL5A 5D4LA 3Q22A 5CYMB 1Z4UA 4KB7A 3OVSA 2A3JA 2QA4S 3Q2SC 1VQ4S 1WF2A 1H7XA 2WSCC 3RW7A 3D5MA 1F9FA 3EPIA 1GNKA 5HL7Q 2VH7A 3V81B 4X64F 1VQ9S 4HT7A 3BJYA 3U02A 3ZZUA 1SKWA 1S10A 3G8QA 4LQ3A 1HQUA 1KEKA 2W7OA 4B08A 2B7BB 3IGVA 2R2UA 4DV5F 2KT5A 4WKRA 2LYVA 2LU2A 2ADCA 1FRXA 3CC2S 4EZ9A 2E5IA 1IKXA 4LIWA 2DNGA 1VIOA 2AV5A 3W2VA 3FFIB 5E33A 2DGUA 1OQ6A 2ZJRQ 2JVRA 4I2QB 5F8IA 2V2KA 1YVFA 3KLGA 2D3UA 2UVRA 2DRAA 3ZZYA 2E44A 4O23A 5FJ4A 2EFNA 4M1KA 5L1LA 5CYMA 4LQ9A 1I94F 3GV7B 3RW6A 2BUNA 2VFRA 3GSDA 3F73A 2ZHBA 2GW8A 3BGUA 1ZM4A 2CQ3A 1CC7A 5GAGI 1SUQB 4WE1A 3VF0B 2C2RA 5A8RB 4YY3F 3TVZA 5H1SV 2CQPA 3H2LA 4ZCKA 1YBAA 1B0TA 2O67A 2W8LA 4KQZA 4DL6A 2N3LA 5HMXA 5E3PA 2DK2A 3OVAA 4NYPA 4NLQA 2DNYA 5ITHA 1VRTB 3CWJA 3SSRA 2R7VA 1T03A 2MZSA 2FJXA 4DDFA 2DJWA 3MCSA 1S1WA 5LSLA 5F8JA 1S1VB 2NLWA 2PFFB 3MWBA 3CCJS 3DRSA 2DCLA 4CH0S 1VS3A 3GV8B 5F0WA 1X5OA 4Q2MA 1JWWA 5AE3A 1J5OB 4EBEA 1Y3KA 5DO2A 2D9PA 1YI2S 2G1DA 4OZJA 3H25A 2C3UA 1RT3B 2LXUA 2DHSA 5K5MA 4NPOA 5KFSA 4QW9A 2MQOA 4OV1A 2FD2A 2IMOA 3HK2A 2PN6A 2F9DA 1EP4B 1W2IA 3DXBA 5KFXA 3DMJA 4RUHA 5J2PB 3CCRS 5L38A 5KFMA 2R7TA 4OJ1A 2LMIA 1SIWB 2MKHA 5JVHQ 2DGOA 1G2EA 1BLUA 5BJRA 2EBGA 3C6UB 1U4BA 3PRBA 1UFLA 3CDUA 1G1XA 1VFJA 3MEDB 4H4MB 1LK5A 1U1RA 3CMES 4DQPA 4BCAA 4DSIA 5AXLA 4QWAA 4G3IA 4WYLA 4OHZA 4KFBA 4M95A 4ZCLA 5KFIA 1TK0A 1KC8T 2BJEA 4LF9F 4WE1B 3MM9B 3CSKA 1FKAF 3DLJA 3M8QB 2CQ2A 4WXOA 4JI8F 3I6PA 2AD9A 1U6FA 4NLOA 1HD1A 4I6AA 4BWMA 2ATLA 1RT3A 3M6VA 4TYBA 1HPZA 4DUYF 2JHEA 2XY5A 1P6TA 2ZKTA 3DDKA 2VZ9A 3OFGA 3QLHA 4IRKA 1RT2A 2CRLA 4PCQA 5IQQA 1Q8LA 5D4OA 3HXMA 2KZZA 1L3UA 3OR2B 3MURP 4OI1A 3M8QA 2J8AA 2MDAA 2DHXA 2ZH6A 3KLEB 2EFVA 1AUDA 4FVCA 3PW7A 3U7JA 3W2WA 4IOCQ 3POTB 3MM7B 4KSEB 4O4GA 3EZUA 1FRMA 3NBPA 3WC0A 1N54B 1HNWF 1REVB 2R2SA 2ROGA 3HX9A 5M2UA 4ECQA 1Y5IB 2GV1A 4WYWA 1XN9A 3DFEA 2RQMA 5HMZA 2CIMA 4GKKF 1TL3A 4IQMA 1RA6A 5F3ZA 1GXTA 4CNYA 5KFQA 2BE2A 4RBUA 5EHHA 2JDJA 2V8DA 2EFQA 3C6TA 5U47A 3RBEA 1JMTA 1X4HA 1E6YA 4NYZA 2DVIA 2VG7A 4TU8A 4TLRA 2D3OR 4WXWA 1VQSA 4KIAA 1NJZA 2J7UA 3PW4A 3D1OA 2MGZB 5C25B 4QR1A 4K4ZA 4I2QA 3OSNA 1YJUA 5SZTA 2HNYB 1WG1A 1SH2A 5DQGA 2B51A 1VMBA 3HKZD 3P49B 2BZ2A 2XMJA 3HHKA 2ZD1B 3UDCA 3DNCA 2KM8C 1U1PA 1HBOB 3L3CA 2DGVA 3CCZA 4ED1A 3HDSA 1F5CA 2HGNA 1A9NB 1VQ8S 3H2UB 5HBMA 2B6AA 4O3NA 1IKVA 5G4DA 2OFGX 2QFJA 5KFTA 2XY7A 3V5RA 4IUFA 3NCQA 4IR1A 1XTZA 2O66A 2BOPA 3A1YG 1M5OC 2KZMA 1N5QA 3R1HA 1KVJA 2NUHA 2B56A 2EG2A 2P9GA 3AH6A 2FLPA 4IH5A 1T3NA 4B3OA 3PVXA 1BC6A 2GHWA 4JI3F 3DCAA 3OBIA 1OS5A 3K5NA 3DRRB 4DR3F 2HMIB 4NLRA 1V3RA 2YWEA 1R27B 4CO2A 4QWEA 4H4OB 3TRGA 5I42B 1Y7PA 1QE1A 2G13A 4ATNA 1F5BA 2FDNA 2ZZNA 3PKMA 4OX9F 4Z37A 3HHLA 3BZQA 4I67A 2HW3A 4CT8A 1SJ1A 3T19A 2XC9A 2YKNA 2OKQA 2WB4A 2EVZA 1H7WA 3DLGB 3LAMA 4PXDA 1O51A 4NCBA 2L9NA 1X4DA 1D0EA 5I3QA 4DV4F 4N8OA 5CZXA 3VR1A 4AL6A 2G4BA 2QMWA 1K9MT 1URRA 2AJ1A 1N5TA 4ID5A 4X4TA 2YQ3A 3UR3C 2UU9F 3UDLA 2IRXA 4MMOA 1KS2A 5DG8A 3GR1A 4ZPWR 4BBYA 3H4BA 2ZHAA 4RW8A 2MXYA 4HYKA 1S1TB 3MDFA 2YTCA 2HHVA 3RZAA 2W9BB 2DNOA 2C3OA 4F3OA 4K5SA 2VKZG 3R5CA 5E3AA 3POTA 3D54A 3D1QA 2D41A 3JSRA 3BEGB 4FS1A 1JK9B 1IKWB 1RYSA 3IC1A 1M1KT 4F4ZA 2SXLA 5DG9A 2XCPA 3MM6A 5DG7A 4ZMMA 2QLXA 5KAKA 4DN0A 3X3UA 2GC8A 4CQ1A 5GMKa 1CVJA 4ECUA 4P6QA 4DWIA 1JJHA 3FZ2A 3EXCX 3OXGA 1XNRF 2Q43A 3KK3B 1S1XB 1TVRB 1KFSA 3AA9A 2AGPA 4K4YA 1SUQA 4KGKA 4I2PA 2RDIA 3AA8A 3JSBA 1JLAA 1B64A 2O01C 2ZH2A 1RTJB 2MHEA 1T02A 4I7FA 3IAM9 1Q8IA 2BQRA 1FTCA 3QJLA 1FERA 1NKCA 4TYAA 3HHDA 4QOTA