5GAHI

Rnc in complex with srp with detached ng domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
ALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYVTEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQIDRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SRP 4.5S RNA
publication title Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00466 Ribosomal_L10 Ribosomal protein L10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5gahI00
4NWBA 5GAEI 4UY85 5GAGI 4V19J 3JSYA 1ZAWA 1ZAXA 5GAHI 3J7YI 2QA4G 3A1YG 5D8HB 1ZAVA 5GADI 5D6GA 3J7Z5
chains in the Genus database with same CATH superfamily
3MECA 3NAHA 2J0SD 2BQUA 4CO1A 3O5TB 1TKXB 3EZ5A 2VONA 4MKVA 3GSDA 4MYUA 1WI6A 3Q24A 3DLKA 1EX8A 1XEZA 2C22A 4HH1A 2CNLB 1GMUA 3HZEA 4JI2J 4RNFA 2EWHA 4OLOA 4RUHA 4FP9A 1VQPS 1YJRA 1N54B 2WBRA 2FLNA 3TJ8A 1XTZA 1O6XA 2A6OA 5H9FJ 1EQMA 1FHTA 3EGZA 4U67Q 2XNQA 1LFWA 3ZNUA 1OPZA 4NYOA 1JXEA 3BGOP 4LQ9A 3QIDA 4M5LA 4Z2XA 4KHMA 2HBYB 3D1OA 3TUIC 4DV3F 2E5GA 1HBNB 5HMYA 2W24A 3BGRB 4C6AA 1S1VA 1OYDA 4Y28C 3JAMY 4TN2A 2RKIB 3A12A 2KH9A 2RQKA 1DQ8A 3KK1A 4N41A 3G87A 4MK7A 1XNQF 2UV8A 3FCHA 2AZ3A 3CXCR 2ZNZA 3I4PA 2UV8G 2W7OA 2VFTA 2UVUA 4KGKA 2VG6A 4MIBA 2KXHA 2I5JA 1TFWA 3QLHB 5LJ5Y 4WBFA 3VAMA 1PIEA 2IAJB 3M6VA 3A3OB 3SI8A 3KUGA 2GIFA 2W2MP 3KTQA 4PG4A 1JLCA 4OYXA 4QQBA 2O66A 4JV2A 2E7XA 2K06A 4PG5A 2QLXA 1K44A 4JI1F 1XMQF 4Q8EA 1I94J 4IDKB 3DRSB 2Z2YB 5B0EA 2B43A 2XNRA 4EWTA 4DV3J 3M8QA 2PO4A 2CJXB 3CUNA 1L3VA 1ZM3A 2WZ1A 4ZVQB 2HFUA 1IM4A 3B78A 3ELHA 2R7TA 4RW4A 4RNNA 1CVJA 3QSYB 2RE1A 2Y1RI 1XNQJ 3V5RA 2DNLA 3GIMA 3SZ2A 1HWJA 4A8OA 2ALZA 4EBCA 1WI8A 3IC1A 3W5YA 2M0GB 4GVLA 1TVRB 2XSFA 3MXHP 2FDNA 3CCMS 1OQ6A 2XS5A 2FUG9 5HBMB 1AFJA 4DF8A 5KFQA 5T7LB 1WG5A 3UDCA 2UU9F 4HYKA 1LQ9A 1AROP 5KFIA 1S1XB 3BGLA 3DXSX 4PZVA 5IT9Y 3V6DA 3HVWA 2GHWA 4M5MA 4JI1J 1BE4A 1R3NA 1XMQJ 3D3BJ 1UZDA 2JJ4D 2OSQA 2N3LA 1C4AA 4HT5A 1SIZA 1D9DA 3BN4A 3R1LA 1P1TA 3OJSA 1LWEB 2RQ4A 1ZTWA 1T3NA 2QJ3A 3F73A 1BD6A 1Q78A 1X4EA 2M9KA 3RAXA 1X9WA 4HTJA 4O3OA 2YNHB 1U1RA 2V68A 2AZ1A 3MR2A 4L6V3 3R5AA 3AFGA 5KG6A 4DPUA 4X64F 3HKWA 3K5MA 3K58A 3PYDA 1REGX 2HRTA 3M1VB 1XBWA 2BJ9A 4QU6A 1RDRA 5AE2A 3AA8A 3BB5A 4LF5F 4QOTA 1FKOB 4IRCA 4L3NA 5I42B 3PXGa 3I31A 4KHPF 4LRBA 3I56S 3L7UA 2UU9J 2XG8A 3BZQA 1MN9A 1N5VA 1YVFA 2DR6A 3A8IA 2HQFA 3SSRA 1F3VA 1WC5A 1VBZA 5F9NA 4LUBA 2LXIA 1IQTA 4LBIA 4MTPA 1L3TA 2PFFB 3UCUP 3J81j 1UKUA 1F5BA 4I4BA 3H20A 1ZA2B 1T9UA 5F0WA 1XK8A 4G65A 2OPPA 3GFZA 3OTCA 2I38A 2WONA 3PRDA 3SDEB 4F67A 5CYQA 2R4FA 4WKRA 3BQ2A 3C6UB 1CQMA 4DSKA 4KRWA 3Q86A 3CO9A 2HLUA 1HI1A 5A8WB 4DSEA 1PGZA 2OPQB 4CO4A 4X64J 3SV3A 1EKRA 1U8WA 4EEYA 5K8MA 2KDOA 4LF5J 3M2VB 5HAOA 2QLFB 1RBOB 1SJ3P 1ZBTA 1AZSA 1SJQA 4P75A 4RWXA 5L1KA 2A3JA 4KHPJ 3CCUS 4DUZF 1WTFA 4WFYA 3VZIA 4NEYA 2E1RA 3NGUA 2NLWA 4DSJA 1RBAA 2DR9A 1B64A 1SVDA 1JLBB 4OZ1A 2HQDA 1VRQC 1TKTA 2CVEA 2KHDA 2HQ3A 2VBWA 1XMBA 2IJNA 1UP1A 1RU2A 2CPFA 2OTLS 1LWXA 1VK8A 4JI3F 4EK2A 5CH7B 3TZZA 1K73T 2ZZTA 4ZCKA 3SQOP 3LPYA 4MMOA 3PY8A 2DBBA 1ICEB 1IJFB 2WOMA 4EBEA 1R8BA 2OPRA 1F3FA 3IG1A 4KV8B 1XERA 3J80Y 4Q43A 1T05B 2UUTA 1S0VA 4HVZA 4F4XA 4M5HA 2QA4G 3H5XA 3MCSA 1WOPA 1QAYA 2YWFA 2HAIA 5D0GA 3J7AN 3TUPA 3QWUA 4CLLA 3KHLA 2W9BA 4PPDA 2DY9A 2YNGB 1K9MT 2YQ0A 2B7CB 1M5OC 1VRUB 2CQ3A 2Y0SD 1O8BA 1B0PA 5KFKA 3HSZA 2XLIA 3HDSA 1NDPA 2WVDA 2EKYA 2DKOB 5L46A 6AT1B 2ZOMA 2KFNA 3ITHB 2HHXA 4FNIA 2FLPA 2XI3A 3MAQA 4IH6A 4N77A 3VF0B 1CSJA 4JI3J 1SIWB 4W4MA 2MXYA 3W9JA 4CO5A 3Q0AA 3NMRA 1FJEB 3I5AA 3SIPB 5IV3A 4YY3J 4A8MP 4ECYA 1U1OA 4P2FA 3QATA 1MWZA 3ILOA 3S8SA 4CM0A 4ED0A 4P52A 1O51A 4UUWA 1MNEA 4ICLA 4TXSA 2NXNA 2M4MA 4ZCLA 4F3OA 3G8QA 4X2BA 3BH6B 1M0SA 4ILLA 2BOPA 1FEEA 1V9OA 2NXJA 3I87A 4DV6F 1M5VC 4ZKAA 1S6PA 3I9ZA 2DGTA 4LF6F 1JLAB 1VJWA 4OJ1A 5F8HA 3PIOQ 4LFCJ 3Q8RB 4ANCA 2RAQA 2ZD1A 3LWLA 2ZZNA 1N5TA 2GS8A 1VMBA 4LRAA 4JUZA 4ENOA 1WHYA 3EPIA 3CWJA 4CYUB 1RTDB 1WSVA 2DNNA 1EIYB 5K9FA 2KJWA 1ITPA 1X4GA 1R7IA 2GIRA 2Y1JA 1HWLA 3CD6S 1I3OB 1H7XA 2EPIA 4USUA 3WQPA 1WOOA 3FBFA 2BKNA 3QZ7A 2HEKA 2V4JA 1HWUA 2E7WA 3NBPA 3QGGA 4P72A 2ZHOA 1ROFA 4FF4A 2YNFB 4UY85 4O44B 4PAAA 4HR2A 3TP2A 4YEAA 3MEEB 2HNZB 2HNYA 3KUHA 2W01A 4C7QA 3M30B 2Z58B 1BQNA 5K8OA 2B6AB 4FF2A 4P73A 3K7RA 1HMVA 2QRRA 2XY5A 1K8AT 4DV6J 1N6QB 1RJJA 1PC4A 1P1LA 4LF6J 1N48A 2FC8A 2LU2A 1U0HA 4DQIA 2ZBCA 3N0VA 2E1PA 3KLHA 3AJDA 2DGXA 3DU5A 4TNOA 2JEIA 3H0PA 5LL6d 3DI6B 2ASLA 1VYAA 1HQEB 4LFBF 4DXLA 5AXLA 4MKBA 1LFPA 3ULHA 2CZ9A 1A9NB 4DEZA 1FWPA 3AB4B 1AFIA 1HHSA 5L1JA 1N4LA 3AT1B 3KKFA 2DRDA 2B8PA 2W7AA 2M5YA 2BVZA 2HGNA 4RW9A 1JB0C 3WHIA 2E5IA 4LSZB 4DPWA 3FEXB 2PA8D 3OJUA 3BGRA 4WFZA 2GMHA 1RWXB 4U7UK 1EQ0A 2L08A 1RKJA 2RKIA 2BDPA 1FJGF 1WC4A 1K0VA 1S1TA 1HIYA 2XULA 5CZXA 2IY5B 1G3OA 3CJKB 2VA3A 4DR1F 1FDAA 3ZZTA 4DV0F 1DLOA 2LEBA 1NB7A 1FD2A 2MLYA 1IBCB 1EP4A 2R2RA 4QIWD 2QYCA 3AY0A 4Q5VA 3GONA 4LFBJ 4K59A 5DETA 1MN7A 3TANA 2F3JA 4KPCA 5CHCB 2IAJA 2FHJD 1YK9A 5B08A 1FRKA 4A4JA 3DU6A 2AHOB 2BE2A 3W9IA 4CNZA 5D15A 5B0DA 4OZNA 2BW2A 4FVCA 3UD3P 2RMLA 4XK8C 1HQ2A 2YWWA 2QFIA 5LMNF 3BR9A 2OUGA 3R5DA 5ADZA 2ZH6A 1DBDA 3V6KA 2AIRB 2V9KA 4IDKA 4WE1A 3DRSA 3FBCA 3TAMA 3R9LA 1Z1ZA 4OLPA 1R43A 4Q2MA 2WAQD 1YZ7A 3RJMB 2QA1A 3D9BA 3W62A 1HPZB 4NLVA 3T1HF 4N8OA 4QR2A 2BJEA 3V4IB 1FJGJ 1HARA 2HHUA 3UNYA 2L41A 1VQSA 1FDNA 4HHJA 2IC3A 2G1DA 2WVCA 3M32A 3CJQA 4DR1J 4HI1A 4DX6A 4DV0J 1BQMB 2J6UA 2SXLA 4PG8A 2CQCA 3SV4A 4CLUA 3HHEA 3VGTA 1HW9A 3H5SA 3MCNA 1TU0B 1KQSR 1YG0A 4JV0A 4ED6A 3ENVA 3NMAA 4I0WA 3DOKA 2VOPA 2XMTA 5HBMA 2IM1A 1E6VB 2UUBF 1C4CA 2D9OA 3QAEA 1NJZA 4F2RA 2XGPA 2XI2A 4FYXB 1U02A 3B4DA 2ACMA 2P9EA 4IR9A 1S1XA 3IR5B 3N5BA 2X3GA 1JXVA 3CNQP 5G4DA 2XMMA 1T9XA 4XAKA 5LMNJ 2Y1LB 1N88A 3FRYA 1HI0P 5EDWA 1LW0A 3GJQB 3IS9B 5KOWA 2CNNB 2MMYA 5HQ8A 3UO0A 2DXEA 4FZVA 4G3IA 8RUCA 5E3AA 2EFQA 2WBMA 1LWEA 2NSBA 3PYEA 2FD2A 3OL8A 4Y3CA 3QMQA 4F25A 2D3UA 3T1HJ 2WVFA 1T94A 3FSXA 3QT7A 2YNHA 2FJAB 4WZQA 2M70A 3R7BB 2W8KA 2L48A 3W3SA 1U24A 1XN9A 4AL7A 3R5GA 4RPFA 2ZJQQ 1YJ7A 4AXJA 5D4OA 3B54A 5THWA 3VHQA 1FKOA 2GW8A 3Q8YA 3VAGA 5HROB 5I42A 2HWHA 3IAM9 2NPFA 2UUBJ 1TQLA 3OXFA 1NSPA 2CWXA 2CUYA 5DJBA 2XGQA 2JC1A 2DY1A 1KR4A 2DPJA 4DFPA 2CQBA 1KS2A 1AA1B 3NS6A 3I0SB 1HQUB 2HVEA 2G1HA 4B9NA 5ETRA 1IUJA 1SJ1A 4DR2F 1ZM2A 3Q2TC 2CG4A 3O2IA 2HRYA 2HZCA 2J8AA 2XTJP 1P6TA 4FBUA 5HK4A 2VKZG 1FRMA 1WF1A 3SDEA 4QYZJ 3AOBA 3RB3A 5CAAA 1P27B 4F8RA 1UCNA 4NLGA 3NCRA 1RLCL 3M2UA 2XZTB 1UZHA 2JZ5A 1RHKB 5A8WA 3GMGA 2OPQA 4XPCA 4OYMA 4RBTA 2DR7A 3VR1A 3MD1A 3U1MA 5AE1A 2JH3A 1UWAA 2PI5A 3C3LA 3M2VA 2M8HA 2B9EA 2ZOGA 2ILYA 4LF8F 2W7PA 1PAEX 4EBDA 2Z2LA 2ILZA 3BBBA 1BXNA 1UJ5A 3MR5A 3B8HA 2CJYB 2QX0A 3FQKA 1VS3A 7FDRA 4DCOB 4NLYA 4NLXA 3PX0A 2FLLA 3HD1A 3I96A 1T9WA 3RRGA 2F63A 2PN6A 1TMJA 4ID5A 3ZZRA 4ALZA 3NCPA 2HHPA 2HHQA 3QRRA 1OYEA 1TK5A 1OIAA 1RT2B 3EE3A 2OSRA 4O3RA 3HJFA 1P8GA 4UT4A 4K2XA 3PFOA 1TK0A 2XYPB 2D69A 4KV8A 2COLA 3M7VA 2PMZD 1T05A 4C8ZA 4FS2A 3EPGA 1UJ4A 5HL7Q 4DSFA 1HYSB 2RHQB 3SCKE 2VFUA 3NGTA 4A8FA 5D3GB 1SI9A 3LF0A 5A8RB 4V19X 2CNKB 2VQEF 3V81B 3VALA 2AEMA 2V63A 4LF8J 2BX6A 2BM1A 3IGNA 5IWAF 1R0AA 4DV4F 5ETMA 1N33J 1FJ7A 4PEOA 4ZVGA 1N34F 2G2OA 2Z2MA 4KKOB 2NXCA 2YNGA 4HT7A 2YXLA 2YWHA 3MCMA 2B0GA 1NDKA 3PHEA 2CKWA 2ZUAA 1MWQA 3T6BA 1Y10A 1VRUA 1IKXA 2HS0A 5GAGI 2F7VA 5DZ7A 5BXIA 2CDQA 1SV5B 1RAFB 3E2EA 4J9UE 4X4OA 4DHVA 1RE1B 4P10A 3ITHA 4LBHA 4CLZA 3LOUA 2CJQA 3HFVA 2CQ1A 2KG1A 3ISNC 2HWIA 2KT2A 2MHNA 4ED1A 4NX9A 4ANEA 3OUYA 2WK4A 2BJ1A 1CG2A 3QO9B 5GVQA 2IHR1 3E01B 3EVOA 2IBOA 2HK2A 2RS8A 5K20B 1LWFB 1FK9A 2J76E 4CZCA 2RB7A 1QLNA 4CDIA 5KG7A 3MAAB 3GV5B 1NJWA 5KFCA 2EFPA 3HHLB 2Z8QA 4URSA 4H4MB 1HNZF 4ECWA 3DRRB 3MZIA 1FFSB 2VQEJ 3M8YA 1OY9A 1V6HA 1T8EA 4ZPWR 5IWAJ 4R0EA 2AJ0A 4DV4J 1H72C 1N34J 2HNDA 2C42A 3P4UB 1NPRA 3W7BA 2E9TA 2EBEA 3IR7B 5BYRA 2OD6A 3R2CJ 4YQWA 3ZTPA 3ETMA 3VAIA 3TOQA 1SH2A 2QFJA 5IC4B 3TAPA 1VIOA 1GX5A 4ECZA 4CYUA 1RTDA 2XYGB 2CPJA 5KT3A 5BJRA 2KT5A 3N6NA 5IXUA 3CDUA 4WFAQ 1R89A 1YIJS 2KI2A 2MZRA 1OQ3A 2E5LF 2P6SA 4ZA1A 1GTHA 4LF9F 4X4UA 2YNFA 2HYIB 5I3QA 1T0TV 4O44A 1XR6A 1HNVB 2XB2D 1C2PA 2VDHA 4DL0C 3T5HA 3MEEA 3I5CA 3LPEA 1U49A 1ZOTA 1KP6A 2XBPA 1AB8A 4DV5F 3T1AA 1IQZA 3M30A 4LF7F 1NHVA 2IYIA 1TV6A 4MIAA 1YRUA 1HNZJ 2H3EB 2B6AA 1Q7LB 2VF3A 3BKFA 4ZLPA 2RRBA 3M2RB 2QMWA 2AGPA 5T14A 4OI4A 4R8UB 2KRRA 4R5PB 1LK7A 4CP5A 4I7FB 4RW8A 1YJTA 1N6QA 2ZDOA 3C14B 2N3OA 3BN7A 1F6TA 1JJCB 4Q0BA 2QA4S 1PCAA 4IH7A 4TQSA 3GIRA 3PRVA 1SUQB 1X4AA 3IA0A 3QFWA 4NZ0A 3DI6A 4CLFA 4KAIA 3OT9A 1ZPVA 1K1SA 2VOOA 4QWBA 3IRXA 2GNKA 3I4HX 1OY6A 2E5LJ 2J9EA 3HHLC 3PDNA 2JVRA 1CULB 2ADBA 4DQPA 4LF9J 4CNYA 2OH2A 2QYGA 2QL9B 4IQXA 3OR1B 3ISZA 1V3SA 1SQFA 4IG3A 8ATCB 2IPOB 4DV5J 3UR0A 1HWIA 1BC6A 1KDNA 2LXUA 3G71S 4LF7J 4C98A 2J7WA 4CO0A 4B3SF 3NGDA 2LA6A 2KXNB 2XM3A 4ZVRB 3IXQA 2B5JB 4ES3A 3HSDA 4ERDA 1HNIB 4EI2A 4B9TA 2Z4PA 2YPYA 4O4GB 1N36F 1NJIT 4NE9C 2DXDA 3LTOA 4I56A 1AT1B 3OR2B 5F8GA 4UZBA 1F9EB 3KJVB 2NUHA 3B4MA 3BQ1A 1IR1A 3KDNA 5EX0A 3OHBA 4CM2A 3NP5A 2ABYA 2B9XA 2LU1A 3VGUA 2XC9A 1B0TA 1IVZA 3EYZA 1V5IB 1VRTB 3D0IE 2BQ3A 2LECA 5HANA 4JYAF 2ZVIA 2GAHC 1DAXA 4NLRA 5AXMA 1V5VA 4F4AA 4DQRA 3OL6A 4WF9Q 2AD9A 1GXLA 1KC8T 2FGOA 3R6LB 4NI2B 2V2VA 1E6YB 3EMTA 2I2YA 3H2VE 3H5UA 2MHEA 4NLWA 7FD1A 2UVWA 1VQMS 2CPDA 1VHFA 3PEHA 4IFVB 4B3SJ 1A0OB 2KFZA 3H4BA 2FJBB 2H4YB 4C8LA 2E1CA 2M88A 1RT6A 2IA6A 3GFXA 4G1QB 2XMAA 1EETB 1HPZA 4R25A 4DCPB 1NRKA 3GG1A 3J7YI 2DIUA 1DY3A 1OO0B 1CEZA 3L3CA 4ZOSA 3KYLA 5EHHA 1X7VA 4DV2F 2LCWA 5LOQA 1HHTP 1RBLA 3NS7B 2FZKB 1Y3KA 1BQMA 3W64A 1U1KA 1T3OA 4HACB 2AKWB 3MUMP 4DR5F 1TELA 4YN3B 2ALYB 3RRKA 4MKYA 5CABA 5CYJA 4UY8T 2LFVA 3T41A 3TUZC 2W25A 2D74B 1LOUA 1E6VA 3SEOA 4O3SA 4X84A 2HZVA 4JYAJ 1BWVA 3A3NB 3KWMA 2BJ8A 2JFKA 2DXFA 2PMHA 3IBFB 2Z30B 2ZWOA 5B7WA 3IS9A 4IG0B 5LJ3Y 1L3UA 3VAHA 1AYEA 1XR7A 5A0YB 2Y8YA 2BA9A 2ZC3A 1G6BA 3OVAA 4Y00A 2WW4A 1Y4ZB 2FIUA 2C2KB 2JOQA 3BQ0A 2DR8A 3N28A 5M2PA 4WK3A 1H6KX 4DV2J 3TI0A 1PJ5A 1KSPA 5KTQA 1D9AA 2W2OP 4C4WA 1MU2B 2KYZA 2E9ZA 3CULA 2CIMA 1NH7A 3D1HA 4DR5J 1HLWA 2HVZA 3CCZA 1T03A 1PYTA 3CCSS 4DMZA 3R8YA 1OY8A 2C3OA 2MZTA 3M9OB 4JV5F 1TAQA 3LUYA 1ELOA 1HFEL 4LSLA 3W2WA 2IYGA 2DHHA 4WWSA 3G82A 1NB2A 4YR3A 1RP5A 5KFEA 1M1KT 2V0NA 3I0SA 4M8LA 3UN3A 3HVAA 2IIHA 3G6YA 2EFNA 2VC1A 1FF2A 2MKSA 1FXLA 4B9SA 3G8TA 3IP0A 1S76D 4Q7AA 4F26A 1VISA 4P2MA 3OFGA 4JBCA 3BSNA 1BGXT 3SYZA 1UETA 2XQCA 2FVRA 3GYXB 3KLFA 1S1VB 1H38A 1SL2A 3PV8A 4P6QA 4OHZA 1GK8A 4WFNQ 4U7CA 3M8SA 3FQLA 3AJ2A 3ZZUA 2IMOA 1WORA 3H25A 3NNHA 4JV5J 3KLEB 1T95A 1TP7A 4RO0A 3EX7B 2C3MA 1Q86T 1BHNA 2I5JB 1UEKA 1CBKA 3RBDA 4RUCA 3CCES 3VVTA 3AB2B 2RDJA 1UJ6A 3G6XA 5CA5A 1DHMA 4L72B 3H5YA 3O1LA 4DZDA 3CPWR 3L7PA 2ADCA 1Q5YA 1SBRA 3NKYA 5B0AA 1M5KC 1M1GA 1A6LA 3W5XA 2O3DA 3QJPA 2X7IA 3TJ9A 2FJDB 2MKYA 2BANB 3ZTQA 2V5HG 5KT6A 1TL5A 3M8QB 2EVZA 3GG0A 2F8HA 2MYFA 4A47A 1HYSA 2W2NP 4UQTA 5D3GA 4JI7F 5A8RA 1YJNS 1S9FA 1WSRA 1RT1A 2OJ3A 1RI7A 3PTWA 4N56A 2CAJA 4X4QA 1WELA 1Q0NA 4KKOA 2V67A 3EGVA 4IOCQ 1TR0A 3H40A 1RGVA 5ETVA 3DGPA 4Q8FA 4E8UA 1RT7B 2A2CA 2C3YA 2CJ9A 4X62F 3AOAA 1JMTA 2ZH5A 2W4PA 4CLWA 4L76A 3ETOA 5KFYA 4WP3A 3MM5B 4I1TA 1SCJB 5CD4H 1FVSA 1SC4B 4CIOA 1LWFA 3PKYA 1VK3A 3KG4A 1T7PA 5LXYA 3IN5A 5CQGA 2YNIB 4ZLLA 1S99A 2JLGA 3HHLA 3DKDA 4JI7J 8AT1B 2VB6A 3P8BB 4NA3A 1CJVA 1RABB 4DS5A 1FFWB 5KT5A 4HL9A 4RBUA 1GT8A 3DLBA 1ACMB 4KE5A 3BR8A 3HFKA 4MAKA 1FRJA 4KT0C 1Q81T 1WACA 3HI9A 3CCRS 3J7Z5 4LF2A 3M6UA 2K7KA 3HPOA 4N47A 2ZFHA 3Q89A 2FJWA 2UUCJ 3GIIA 1NHUA 2CYYA 1X4CA 3H8YA 4X62J 4F04B 1D0EA 2LYVA 4NLSA 2LQ9A 3QRPA 2DJWA 2VV5A 4J9QA 3GCWP 4IUFA 3FBEA 2J0QD 2MY7A 4RZRA 1Z2LA 2FB0A 5AJ3F 1PYOB 4S0MA 2BE7D 1RCXB 2EK1A 4RNOA 3ZZYA 2WONB 4KTQA 3KUEA 2VHGA 1YRXA 3KLIA 1WDDA 4W92B 2QEXS 4DV1F 3MOJB 2LQJA 3CTRA 3M2RA 1X4DA 5CXTA 3M9NB 4R8UA 4UQGA 1FRIA 4FKYA 2YTCA 4UOHA 2KB2A 2I6WA 2A1BA 4I7FA 2R2SA 1JQGA 3F44A 3N79A 4DN9A 5DRKA 3A8KA 2RU3A 1N0VC 1D3WA 3C46A 1RAHB 4DR4F 2DD8S 4ID8A 1RT4B 3LH2S 2VFSA 4NA2A 2LQ5A 1RT3B 1KKHA 4JB8B 1SUQA 2VG7B 2WVBA 4TY8B 3TVZA 5KFWA 4LIWA 1NKBA 2R8GA 2VASA 5JMNA 2ZM6F 2FY1A 1D8ZA 5L38A 5HVGA 4FXWA 4DCJB 1YJWS 2FLOA 4A8YA 4KGVB 4N5SA 5GAHU 1CULA 2IRYA 3JYTB 2AYMA 1TKTB 4OHXA 3EWGA 4ECTA 1N0UA 3OR1A 4TU7A 2ACYA 4FNHA 4LF4F 5AJ3J 2OEJA 1UVKA 3D4JA 1JWWA 4RR5A 1C1BA 3EDRB 4B3MF 3VAJA 2WOMB 4DV1J 1HW8A 1SB6A 2J8SA 5RUBA 3GIKA 3K59A 9ATCB 4RLEA 1RWNB 2BM0A 1NEEA 1RHQB 4FN5A 4JP8A 1XIQA 2ZKTA 4K4ZA 1UWBB 3H42A 3DDNA 1HNIA 1S48A 1XJWB 1ZS6A 1WHVA 1NHKL 4WXWA 3BSOA 2H54B 3T5KA 1H2VZ 4DR4J 1U1QA 3UW1A 4LR7A 4NLUA 1U25A 2BKOA 2HMIA 1RAOA 1R8PA 3KJVA 4MH8A 1VIXA 4DQSA 1HBOA 3UCGA 4NPOA 4J9LA 2E66A 2ZM6J 4DR6F 1KTQA 1Y5LB 3LP2B 4LRDA 4CLTA 4AL6A 3MUVP 3KNGA 5F3ZA 2DHAA 1VRTA 2EFOA 4X66F 4J91A 3F0NA 5IT0A 3H4DA 4LF4J 1RQ0A 1S79A 4L3KA 2H5JB 1WNEA 2J0XA 1XNRJ 4B3MJ 3MPUB 4NI2A 1E6YA 4IRDA 2E1AA 4RL1A 3CCVS 4UTGA 4J37A 4IFVA 2CZ4A 4ZVOB 4J9RA 2UP1A 3R5CA 1QTMA 4YHHF 4P7TA 1FO1A 1U2CA 1R0CB 2YQ3A 2F65A 1U8SA 2RDDA 1QD1A 2BJ3A 4CLYA 4ICLB 4PWDB 4A8SA 4PR6A 3OQ2A 4KJIA 2K2PA 2O5DA 1VQ6S 2DGWA 5FJ4A 4W98A 1WKKA 2YKQA 1KFSA 4RUBA 2KYXA 3LGMA 4HACA 2HBZB 5HATA 3POTA 4PG6A 3MTKA 4FKXA 4DR6J 3H90A 3HJVA 4QZVB 4ZJLA 4X66J 4ZP6A 1WD6A 4RX6A 2IVYA 1UEVA 3JAMU 4BWMA 1NXIA 3PW4A 3PRBA 2U2FA 3H2LA 1IKYA 2QV6A 1WF2A 1ZAVA 2V4JB 3I55S 1UL3A 4WIQA 1YTYA 3NBPB 5A0YA 3C15A 4YHHJ 1UVNA 5C25A 2DH9A 3DRPA 4QWAA 4C97A 2KN4A 2O67A 4GVBB 2EXUA 2YBVA 1YGYA 4WKYA 2NZCA 2MQQA 1HMVB 5HLFB 3MCOA 3S7RA 3IWLA 2HRUA 3ZO7A 3HHDA 4EYHB 1AXQA 5M2RA 2GJIA 1MU2A 4YB6A 5FLXY 3J81Y 4OYAA 2CJAA 4ANDA 3CF5Q 1ZM9A 1X4HA 1TKZA 2HHWA 4MYTA 4LSNB 3BYPA 2PD1A 1D1UA 3QWPA 5DS7A 1W26A 2B3TB 1F5CA 1LXNA 3KLHB 2RU9A 2NYIA 3HVTA 3J7YU 1U26A 1QUPA 4CT8A 2WB1D 1RT5A 1M5SA 2MQ8A 1RISA 1T02A 3M8WA 1KQGB 1UPPA 4YB1P 3P6YC 4F4YA 5HVHA 4U96A 4JOUA 4XIUA 3P45B 3EXCX 1WDTA 3D1QA 2AW0A 3EZUA 4FYYB 3TX0A 3IFEA 1W2IA 2LEPA 4B9UA 4X4RA 2YKPA 3PKMA 5D78A 2OTJS 4TYAA 2AP6A 3DM2A 3TZYA 2LVWA 1IXKA 1I51B 4C11A 5KT7A 4DG1B 4NA1A 4PQUB 2B7BB 3MM7B 4RW9B 2YX7A 3OSNA 5IFMA 2CQIA 2GJFA 3K5PA 2HVDA 3KLVA 3H98A 1CC8A 2E5HA 3F56A 2VICA 1X60A 5IT9U 4I67A 5F8IA 1O0PA 2FHOB 2K7JA 4U6PA 3D2WA 3D7SB 1S1TB 2PFDA 5C42A 4KH1B 1EARA 4KIAA 4OI0A 1SQEA 5F9LA 3KLEA 5KFSA 2NSCA 1DLOB 1KWMA 3BGFA 5C24B 1YQHA 4AD6A 1EP4B 3DLEB 5D0HA 2V6AA 4K4VA 4WTYA 4DDFA 3BO3A 4E0DA 2R7OA 4AL5A 4M94A 1FNXH 2J6TA 5H9EJ 3ZZ0A 4ZVEA 4DOZA 2CPYA 2BE2B 3UCZP 4QWDA 4C3KA 1Q4RA 1TUVA 3N5FA 3R7NB 3DXBA 5KOXA 1JLQB 3AH6A 4DU7A 3PW5A 3MMBA 4M5IA 1NPPA 1RB0A 4WE1B 3TAMB 4OYIA 2UUAF 1QAJA 1TTHB 1Y7PA 3L95X 2BANA 3HLUA 2E44A 1WF0A 2XMJA 3JSRA 3JSBA 3AQPA 3V6HA 1RHUB 3PVXA 5I3PA 4WXOA 3CJ5A 1RADB 2A2DA 4GC6A 1C0TB 3DLJA 2A0FB 1RAIB 2IC3B 4KC5A 3OPKA 1OMSA 3M32B 3MUTP 4A48A 3OTBA 4ZHRB 2QLJB 4U8VA 3DYAA 3CIZA 3TX8A 1RCOB 4Q44A 4HKQA 3VV2B 3UDEA 1RTHA 1UVMA 1KOOA 1FFGB 1S12A 5D77A 4OI1A 3DOKB 1RT7A 4B3TF 1URNA 2ZH7A 4OZ5A 2XLKA 2CWKA 1YSJA 2PEHA 2N4DA 1U6ZA 4J7CA 3UR3C 5J2QB 1LW0B 3CB4A 3W65A 3MM5A 3BF4A 3GR1A 4CT9A 4KY3A 3L7OA 4OV1A 4I2QB 3THVA 2YNIA 1SPBP 4FYWB 2CVIA 5E7OB 5CCMA 1FX4A 3F41A 4P9SA 1KEKA 4AT1B 3FK4A 4DPOA 3C19A 3D6TB 5B0BA 3TO8A 4DLEA 5HQLA 1L5UA 1U1PA 4KFBA 1WC1A 5DGBA 2YH0A 2VZ9A 4NZ6A 2AEFA 2FHKA 2GA7A 3ENQA 2V94A 1IKWA 2C2MB 2HHVA 1YI2S 2AT1B 4YS2A 5IT4A 2GIQA 5A2QU 5ETOA 4OYOA 4F2SA 2R42A 4B3TJ 1N32F 3DCAA 4CO2A 4ELTA 3DNCA 3J80U 4DPYA 1OSDA 1OJ4A 4HEA9 2UXCF 1KLNA 3MF5A 3M6WA 1CJKA 4DUTA 2X3DA 4OJGA 3B6BA 4ZCIA 2EBGA 3W9HA 4DJBA 5EWFA 4OX7A 1LEOA 4IO9Q 1VR6A 3B82A 3DRXA 3PFEA 3QPIA 1VI7A 3Q8VA 1JX4A 5SZTA 5DLGA 5L8RC 2ZH9A 4IFYB 3HF5A 3M2UB 2MQNA 3PO5A 5D0RA 2C2EA 4J5OA 3ICLA 4ZVPB 3MGJA 2VODA 2XMWA 2VIHA 5A6PA 2DGVA 3WX8A 2VBZA 4J9MA 2MGZB 1B3TA 4KB7A 3KK3B 3CVKA 1DURA 4KR0B 2LEAA 3OTOF 1RT4A 2XEXA 3KOAA 2FVPA 1FXRA 3SSSA 1T9VA 1RT3A 4WZMA 1N32J 2VG7A 3MPVA 4TY8A 1DRZA 3OW2R 4P2XA 4EZ9A 1I1GA 4FBTA 2UXCJ 1Q8KA 2X1AA 4ZP8A 5D4NA 1NNDA 5DZ6A 1W25A 3C66A 4LRFA 1LWCB 1GEHA 2F5GA 1IBMF 5K14B 1SH0A 1IKVB 3JYTA 3EVMA 2ZBPA 4CLPA 2ROPA 4ID5B 2DNPA 4QYRA 5DG7A 3BREA 1UAWA 2Y9HA 3SQGB 4HHHA 2MSTA 5KG1A 2PC6A 1KN6A 1RWKB 4ZIVA 5A2QY 4DWIA 1FRXA 5IZHA 2FZCB 2QA2A 2EG2A 1WTBA 3VGVA 2H48B 2DT9A 1M90T 2ZZMA 1TAUA 1UWBA 1OPIA 4UUXA 1NSKL 3W63A 2DNRA 1VQKS 2GJ2A 5ETTA 2XMVA 2AJ4A 4PQAA 4MK9A 4WYWA 1R0AB 3MEKA 5FD1A 1NUEA 3S1TA 1SC1B 2YWEA 3C16B 2QSFA 4DUZJ 5E3QA 3MMAB 3JQMA 1KTVA 2CPHA 1RZMA 2R2TA 1VQ7S 2KVIA 1IKXB 1PC5A 3RTVA 1IBMJ 3LP2A 1TUGB 1WG4A 3W66A 3L09A 3NGKA 2DHXA 4USTA 4H4OA 4ES1A 5FIIA 3K57A 1GMWD 3FMWA 1SKRA 1T9TA 2B4UA 4BS2A 4P2SA 4OYPA 4TLQA 1R6YA 5I3UA 1X9SA 3OUYB 1SJFA 4QIFA 4NASA 4TY9A 3QQCD 2HQGA 1S72S 4ZPDA 3Q8QB 1NLKL 2GX8A 2IMWP 1FK9B 2M2BA 3KFWX 1U47A 3JSMB 4ZVUB 1MROA 3HK2A 3J7ZT 2UXBF 4X4NA 3ZTSA 1J5OB 4PWDA 5KFTA 4ZDNA 2L9WA 2KKHA 5AE3A 1VGYA 2PGCA 3IRWP 5L1LA 3ET6B 3HM9A 2DRBA 1HBMB 2PI4A 2HNDB 2V2QA 3GFYA 2B56A 2XSJB 5J1NA 1HR0F 2D1CA 4ZJQA 5LSRA 2DB1A 4XPEA 2ASDA 5KFXA 3SXLA 2MQOA 5KG4A 4FVMA 3CJ2A 4QU7A 1UVLA 4PUOA 3BPDA 4WK1A 1L3KA 4I69A 1JLEB 3O44A 4DL7A 3GB0A 4TU8A 4P71A 1JJHA 3KXDA 4EFAC 3I9V9 3PW0A 4RW6B 3OXGA 4WJBA 2W8LA 1RU1A 3HZGA 2NR0A 3CJTA 2Q79A 2VDIA 2NREA 2VU5A 4P74A 3JQJA 2UXBJ 5E3RA 4LRCA 4GVBA 1PILA 1TV6B 3GU0A 5JVGQ 2MKKA 1JXLA 3PR4A 5DDQC 5HLFA 1QVFR 3R1HA 3H7HB 5ETQA 3QNWB 3VWSA 2HFOA 3TA2A 2QTWA 2E1MC 4DR3F 2R7QA 4RW8B 2W2PP 2UZAA 1S1WA 3FVYA 1WEYA 1Q82T 1NK6A 4PABA 4ZVSB 1HR0J 4LSNA 1KHWA 2OIHA 1SL1A 4Q0BB 3OVSA 5KFVA 4XDDA 1FI4A 5DM7Q 5GADU 1RAJA 2B9WA 3UD4P 3RUBL 4USHA 5K8NA 3DOMB 2MZ1A 3I5BA 1FJCA 1NH8A 4XTTA 3IRXB 4FXVA 2DNYA 1NCLA 3MAHA 2XWYA 3GSIA 2NYHA 5B09A 4XO0A 4YR2A 4GKJF 5J1EB 2YVSA 3Q2SC 1SJ4P 4IG3B 2X1BA 4C8YA 4KGXB 4DG1A 2DGUA 4PQUA 1EKSA 3MM7A 4OX8A 3S6EA 1GXUA 3P5BP 2F4VF 2G0IA 3LP1B 4NLPA 4KBIA 3UVJA 4NCAA 2GHPA 5C2GA 2NPIA 4PWWA 3DLHA 4IOAQ 5AXKA 4NWBA 2ROEA 1KLMA 4EMDA 4DR3J 2GVZA 1PSDA 1WG1A 2IVFB 1QJHA 4URGA 2FGCA 4LR9A 1S6OA 4MKAA 1QAXA 3T6JA 2DNHA 2DEJA 3BM7A 4C48A 4CCHA 1TL1B 4ZLNA 5D0EA 5C24A 2V8GA 4Y65A 3DLEA 1YJUA 3UI3A 1TFYA 3PM9A 3KK2A 2J9DA 2ZBQA 2B4OA 3FSIA 3DOLB 3NWGA 2YPZA 2FQQB 2J9CA 2HKEA 3CIMA 4TVAB 1FKPB 1HBUB 1VC5A 1JLQA 1Y3JA 1YBTA 4ILMA 4HTIA 3HKZD 3HHKA 3AXKA 3GYGA 2RNEA 3O3LA 5KFOA 5K8PA 3THPA 3RR8A 5A6WA 2F4VJ 3CDBA 1XWLA 5H9EK 1G1XA 4BBYA 1H73A 1RT6B 1U1MA 2YKNA 1NKEA 1HHQA 3VCDA 2C2DA 4WP9A 2KG0A 5GMKa 2HGLA 2C2OB 1G4CA 3KHGA 3U02A 2MKJA 1VQNS 5LM7E 4ITSA 2MZSA 1C0TA 3O8WA 1IR0A 3TRGA 2D3ZA 2XS2A 2R8JA 1VLYA 2H51B 1AUDA 2R8KA 4WIIA 4ZHRA 2HVHA 4J90A 1HD0A 3DC2A 3IM9A 3ENWA 1F0XA 1X5TA 2P9CA 1X5SA 2PIIA 3JXOA 4TQRA 1YLXA 4LR8A 5KG3A 3D6FB 2ZOFA 1FTCA 3HHNB 1QTNB 3MM6B 2VFVA 1DTTB 3GQCA 2CRLA 2IJRA 4ELVA 1VBYA 4CH7A 3IO1A 4KGMA 3PX6A 5J2QA 3EVWA 4DV7F 3CCLS 2A18A 3HMJG 1U1NA 2POKA 3MM9A 4Y2AA 3OSPA 4A8XA 3E8OA 4I2QA 1CJTA 4JI8F 2M7SA 2KM8B 3D6MB 3OFFA 3UNGC 3KLGA 2C2ZB 3BSCA 1YZ6A 1QDUB 5K5MA 2W9CB 1FA0A 4M5KA 1QSYA 4A8KA 1A7GE 1T03B 3QAUA 2V8HA 1FERA 5KG2A 3NL0A 3IGVA 1I94F 2V8VA 1AW0A 1BWEA 1YJVA 3HFZB 2QL5B 3QSIA 4JI5F 4LSLB 3W2WB 3EZOA 3OHAA 1NPKA 4C0HA 1C1CB 3HVRA 3G82B 4K4TA 4IOBA 4K4XA 4RW7B 2C1EB 4QR0A 2NXEA 1X8DA 4DV7J 1HWKA 5J2MB 4K50A 3TUJC 2Q66A 4OZ2A 2P9GA 1TL7A 4OHVA 4E2FB 2CPXA 3W8PA 1KVIA 4JI8J 1KONA 3EM1A 2XMKA 2ZJPQ 2FVCA 5E41A 4M1KA 4D3GA 1U6BA 5IQ6A 3LALA 2FHJA 4MFBB 4NXMF 1TL3B 1U48A 4U7UD 3R5JB 5FDLA 4IFYA 1EZZB 2HG4A 1IN0A 2MZQA 1WC6A 3HXMA 2MGZA 3KLFB 1HNWF 1S6UA 4WYLA 3KK3A 4OYWA 3CMQA 2Q43A 1B70B 2ZH2A 3ILJA 4G1IA 5E33A 5LXRA 4B9VA 3ZC4A 1RYRA 3AD8C 3PZPA 1C0UA 3FJ2A 2IBKA 4B08A 4JI5J 4FPIA 4X4PA 3K89A 2GGPA 3U27A 1MG7A 1DQAA 2BUNA 5EN1A 1LWCA 4R0JA 5K14A 3BO2A 4C0OC 4C3LA 2KM8C 1IKVA 3BO4A 4GKKF 3PYGA 3DLLQ 4DR2J 1Z2ZA 1OSCA 4X4VA 4GMKA 4G6VB 3SQGA 2FYXA 2HW3A 3ZZZA 4CI0B 2GQ2A 1U4BA 2EC2A 3SBMA 4NXMJ 2LQBA 4X4SA 2Z57B 2RJZA 3U1NA 3UDLA 4EU0A 4ED7A 4ZJOA 4M5DA 2VPWB 1HNWJ 4ATNA 4K5RA 3N6LA 2V2ZA 3MDFA 2YH1A 1LXJA 4KH0B 4ZN1A 6FD1A 4NCGA 2XO7A 1TK8A 3GPAA 5KFHA 2CQGA 3CJ0A 4RU2A 1RT1B 3A13A 2Q6BA 1VOMA 2GO9A 5DGAA 3A8EA 1GAOA 4JI4F 2AEJA 2CFXA 2VL1A 3C16A 1VQ5S 2IM2A 3GIJA 1N56A 3MMAA 3VGSA 3GTYX 2XMUA 3LP0B 1RWOB 2CQ2A 2FJEB 2G9OA 4DX7A 3DGPB 4Z7YA 4KPYA 1GMVA 4C0BA 2DPIA 3QRQA 1BY9A 5J2NB 3U1LA 2HAFA 4GKKJ 2HHHF 4DFKA 3NS5A 1CLFA 2DH7A 4CH1A 2C28A 2YY3A 2I1RA 4WU3A 1QUVA 2W1BA 2RF2B 1S4EA 3OFHA 3PX4A 1S9GB 2IVMA 2CZVC 1YBUA 1Q79A 3KG0A 1RWPB 2QL7B 3CCJS 2P5VA 1WOSA 1VC6A 1YDLA 2AYGA 3Q8PB 3JSMA 5CD4A 2HHTA 1EAYC 1VLOA 3GE9A 1IWAA 1J5OA 4PPZA 3QGHA 3TWZA 1P9YA 3DFEA 4UW2A 3DLGA 3RYLA 2ZC4A 3T5LA 1KVKA 2Y0BB 5J2PA 4QIGA 3ET6A 4FXDA 2GC8A 4O0IA 1DTQB 1CJVB 3W5ZA 1HBMA 1CPZA 4JI4J 2GQQA 2XWXA 4USVA 1S4FA 5F8MA 2AWZA 5GAHI 2XSJA 9RUBA 3FCVA 2FC9A 3AODA 3QIPA 2AX1A 2RRAA 3LW5C 4PXDA 4KO0A 2KO1A 2HHHJ 1PAUB 4TYBA 3HO1A 1JLEA 2XZWA 4NYZA 2WSCC 4K0KF 1EB0A 4M5NA 3OFEA 3FC9A 2FJXA 1HNXF 1TKDA 4WFXA 4RW6A 1Q8LA 1S0OA 1IBLF 1FD8A 4DFJA 4ZIWA 2IRXA 4QW9A 2CQ0A 2YWKA 5HMWA 1Q16B 2WW8A 4ZVTB 1VBKA 4LF1A 1NZ8A 3KLIB 5KFBA 3JB9k 2V8DA 3HSGA 2LP4A 4OX6A 1H2UX 4ED5A 1VC0A 3W2VB 3OV7A 3HSJA 4BWJA 2H9ZA 2RHSB 4UF4A 1F9HA 3RW7A 1HA1A 2RD5C 4PG7A 1S5ZA 2G2ZA 3ZZOA 1QM9A 4YY3F 3BV8A 3G96A 5KFZA 1FESA 3DOMA 4GO7X 4X4TA 2HIYA 3LQVA 4MK8A 5J1PA 4K0KJ 5LT5A 2I9SA 2MQLA 1HNXJ 2VD3A 4PCQA 3RBZA 5JJBA 2DGSA 1UVJA 5D6GA 1IBLJ 1N5QA 4NCBA 5J1EA 3X1LB 2GVDB 3QZ8A 1K0TA 1C1BB 1RLDA 3GV7B 2JLEA 4RU9A 1ZH5A 3LP1A 4LFCF 1G7CB 2WSEC 4P7VA 3GR0A 5KT2A 2QLWA 4QR1A 2J0WA 3AOCA 4QIEA 1Q95G 2HFVA 4PWUA 1XR5A 2EK6A 3A4TA 2MQMA 2L9NA 4CLSA 3GP9A 3BJYA 2VG5A 2ZKUA 2IDLA 4DBQA 1UPMB 1S49A 1NAQA 4V19J 3BH7B 1ZAXA 4OJHA 4Y2CA 2B9YA 2HMIB 4B9LA 1TL1A 4MJKA 1HBOB 2BRLA 5CYMA 4YDDB 1ZETA 1KRPA 4O3PA 3DN9A 4DX5A 5B0FA 2M3DA 1S6QA 1S1UA 4UZCA 3Q8UA 5KG5A 2FJVA 3DOLA 3N9UC 3MR6A 2Q3PA 3EJMA 3I6PA 3JTOA 1FKPA 2DCUB 4K7QA 3PO4A 2H5IB 1K47A 1HBUA 3CDEA 2OD4A 3RU0A 1U6FA 2GQCA 2ZBRA 3BYRA 3DMJB 2DHSA 4ZVFA 5IM0A 4HDGA 2BQRA 3G6ES 2DNOA 2VJUA 5KFJA 3BSAA 2PMWA 2DO4A 2DHGA 4ZPCA 2VC0A 1N36J 3FEZA 1ZZNA 2X1FA 4NRUA 2V2KA 2ZUGA 2MTLA 2CNOB 3PR5B 5GMDA 2AV5A 2QN6B 3MMCB 5E5NA 3TA1A 3TJAA 5HI7A 5F3TA 3Q8SB 3POTB 1CS4A 4OI6A 3E3XA 2G0CA 1KVJA 1B4SA 3MM6A 1RTJB 1DTTA 1FX2A 3AD7C 1JKHA 5E0OA 4CWBA 3GJTB 4OHYA 2OFGX 1S0MA 1PYSB 1K1QA 4F0MA 1IKYB 1EJ7L 2AYBA 4DPTA 2RILA 3TZWA 3C6TB 5E3CA 4PXCA 3C15B 2HPUA 1X4FA 1TKXA 2HURA 5C25B 3MEDB 3SCIE 2ATLA 3DRPB 2WSFC 2BABA 1VJQA 2QE5A 2LKZA 2U1AA 2KRBA 4N76A 5JVHQ 2H65B 3JTNA 2MPUA 1S9EB 2GHVC 2EC0A 2M52A 1V3ZA 2BACA 2W9CA 2LDIA 5BR8F 1GXTA 5D8HB 3I0RB 4BDPA 3JQKA 2MKIA 3Q22A 1Q7YT 5KG0A 2FVQA 1S0NA 3R27A 3LO3A 2QG9B 1TKZB 2V69A 1JNRB 2HHSA 4JI0F 2XHWA 4IYQA 3TVYA 1VBXA 3KHRA 3HVTB 5DDPC 2V4RA 4RJVA 1RT5B 1JJ4A 1HBNA 4AXIA 1C1CA 2CJBA 1RHMB 2DNZA 5GMEA 3J7A1 3CDWA 5H9FK 5U47A 5MLCV 1RACB 5HSPA 3M4XA 3CJSA 4L74A 4RW7A 4U9RA 2WHOA 3KJNB 2GV1A 2Z56B 4CH0S 1H0HB 5J2MA 3H59A 1HD1A 3W1YC 1VCTA 2CADA 4J9SA 5AT1B 5SUHA 5F8NA 5HQMA 4OMFG 1YRTA 1T11A 3DM2B 1NK0A 1MMDA 4HH0A 2GO8A 5A8KB 4C11B 2XY6A 3VQSA 3CO0P 2EG1A 4MFBA 3QLHA 1TL3A 1X31C 4ZN3A 2D41A 4X65F 4IH5A 2E5JA 5JUMA 4PXBA 2ATCB 3NY0A 5DM6Q 5IV4A 2KXFA 5BR8J 3PW2A 3G6VA 2LMIA 3NEKA 2DITA 1YITS 3T9ZA 1MMNA 2K1RB 5C42B 2OHDA 1TUWA 4JI0J 1UFLA 2PDAA 1VQLS 3KMSA 3OLAA 3GFHA 4QWCA 1NO8A 4DL3A 2WRMA 2V4QA 2ZDPA 4E98A 3OXLA 4ZVHA 4BC9A 1P9QC 5IQQA 2ZJRQ 2BV3A 1XMOF 2YKMB 1I5OB 2GAGC 2GMJA 3RBXA 4ED3A 5LSLA 3PJWA 4YDXA 1F2GA 2JEGA 4F0HA 1M5PC 2H4WB 5KFLA 4ZMMA 3W61A 3RAMA 2R8IA 2FZGB 3NCQA 1LW2B 3MMBB 4F4WA 1TVRA 2AQ4A 3CEDA 4EO8A 4X65J 4LREA 2DIVA 4J9PA 4FDFA 3KJQB 5KFAA 5B0CA 3MPDA 2ERRA 5T7LA 2DNMA 4Q45A 2KJVA 4OV6A 3I32A 2R9LA 2V50A 1WKLA 2OELA 3HT0A 1N5YB 3OTDA 2L3MA 3R2DJ 4A46A 2W9AA 3FEYB 3BPSP 3SCLE 1N8RT 5M2UA 1R27B 4K4YA 4H54A 1H2TZ 3DYAB 3M8PB 3QJJA 3LP0A 1JK9B 2Y1IA 4ZLJA 4NL5A 1RTHB 1ZA1B 4CLKA 2G0JA 4DF4A 4BLGA 4NYPA 4BC7A 5J2NA 1XMOJ 3KMQA 1X4BA 1ZTTA 3D0GE 2CQHA 2MZJA 4MT1A 3KG1A 3OVBA 3W60A 4F36A 5EX3A 3M1VA 2RF2A 2F4FA 1WWHA 3UE2A 1S9GA 4A8QA 2BMBA 3NNCA 2N7YA 2HFNA 2KL8A 1S97A 3EICA 5KFMA 2ZHBA 1RTIB 4I6WA 4OIXA 1KOHA 4AE5A 5HJYA 3ZFVA 3RR7A 3X3UA 1VQYA 4Y2KA 4F7VA 2AMCB 2DNQA 1CC7A 3AJ1A 5HP1B 2AYEA 1H3DA 2MKCA 4GC7A 3GILA 4KFBB 3EGNA 1MMLA 1DTQA 4BCAA 1WEXA 4ZP7A 1DZ5A 3CGIA 4USIA 3GJSB 1FWLA 3PW7A 2BXJA 3FGVA 4LMZA 2QMUB 1ULRA 4F4ZA 4CTAB 1SKUB 2QLBB 4ZPTR 4K2JA 1IKWB 2DGQA 3CW2C 1IM6A 3C6UA 5EUHA 3K2YA 2X51A 1H7WA 4NLTA 3MPWA 4HI2A 1R8AA 4WFBQ 3C2PA 2YX4A 3QJLA 4Y0FA 4N7TA 3K5OA 1CJKB 1ZM4A 5BYQA 4L73A 2BE9B 1GX6A 1WC3A 1WEZA 5L9NA 1KNZA 1EHWA 2KZMA 4ZS6A 3PIPQ 1SKWA 1YHQS 4I2PB 2NCKL 1N33F 2MQPA 4YR0A 2C3UA 2O1PA 1LKZA 4D3HA 4Y2MA 4ZITA 1SKSA 1CJUB 5KFDA 2QC3A 3NAIA 4URQU 2ZHAA 1PBUA 2DNGA 3IBCB 3IAS9 2VUGA 3RBEA 2QIFA 2W4CA 2RVJA 2JEFA 2MJUA 3AXMA 4ELUA 1JLBA 1MSWD 2CA9A 5GAEI 2G13A 4ECSA 4QJVA 4ES2A 4WPAA 5HJXA 4AFFA 3K5LA 2K3IA 3W2VA 2Z0GA 2RT3A 1Y00A 3RB4A 3TVKA 4YOEA 3TW0A 2VKRA 4RNHA 4QW8A 3RAQA 2LA4A 3U7JA 1T9YA 2KVQE 3NGSA 4C8MA 2R8HA 2R7XA 2XCAA 3S01A 3FUYA 4OHWA 3CC7S 4CO3A 3D28A 2ZH8A 1YJ9S 5E3PA 1UEUA 2Z2ZA 2EFVA 1KHVA 4KHRA 3L9ZA 2VPZB 2EW9A 3O6QA 4NMXA 3CCTA 4W90B 3ILLA 3TZXA 2MB0B 4NXNF 5CCLA 2GVDA 1PO6A 1NDCA 2DO0A 2YKAA 2OEKA 5KAKA 1WJ9A 1IJEB 1PJ6A 1QY7A 2OMOA 4O4RA 4J9KA 1S10A 3FCWA 2CQPA 5ETKA 2ZEJA 2MKHA 5ETLA 3HULA 2JRSA 2RS2A 3D67A 2VFRA 2K8GA 3LAKA 1QSSA 4LBPA 3SCJE 3WC2A 4QCLA 4B3RF 4KYZA 3R97A 4AQYF 3OD2A 1HKAA 4DFMA 2BRKA 2F1FA 4OZ0A 3GV8B 5LMUF 2A6MA 2R3VA 3VAKA 3BDEA 1FNOA 3KDOA 4M5JA 4PKDB 3NNAA 2JC0A 1IBKF 3VTIA 3WBZA 3LGNA 1R8CA 5G0RB 3FKBA 3G86A 2D3O1 3N4WA 1TL4A 2V8PA 4I64A 2GZOA 5B0GA 1VFJA 4H4OB 5ITHA 2B4PA 4NRTA 4DLGA 4ED4A 2LDYA 3ADAC 4O3NA 4MIWA 1QVGR 3GZ7A 1NMEB 5DG9A 4HHUA 2EFGA 3IR6B 4NXNJ 2MEWA 3NG8A 5FLXU 3J81U 3FRZA 5I3UB 3SFUA 4PYAA 2MDAA 3ONQA 4OZ3A 3GYNA 1OWXA 1JLAA 1REVB 5ETSA 3DMJA 3NLCA 2YX1A 4EZ6A 2R7VA 1JLGB 2QMXA 2CPEA 2FTRA 4O3QA 1RA7A 2IJFA 1LK5A 1MROB 4YFUA 3TAQA 1FNMA 3E51A 4M5GA 2FHMA 1RWMB 2IA0A 3V4MA 3NWRA 5GADI 2JHEA 4B3RJ 1UMJA 3Q23A 1Y5NB 4AQYJ 5DO2A 3D0HE 4LJMA 1RUSA 4NMLA 2K3KA 1X0FA 3HD2A 3RZAA 5LMUJ 2ZE2B 2N82B 2WCXA 3G4SS 3MMCA 2WB4A 1URRA 1IBKJ 1FVQA 2Q1LA 2HNZA 4QPXA 2GCFA 1LNQA 1N5SA 1HL6A 4G1PA 5EWEA 3FBBA 2NQPA 1Q53A 5T41A 3JTPA 4OZJA 3NOGA 1MLAA 3LGHA 4O23A 7AT1B 1JJ2R 4PUOB 1RTJA 1S59A 1F9FA 2KZZA 1NSQA 2O01C 2LXFA 1N52B 4B3OB 1B0VA 3PCOB 3UQSA 4EYIB 1HI8A 1RSCA 2DRAA 4GO5X 3GCXP 3C6TA 2RUGA 4O0NA 2JNJA 3CJ8A 3THTA 5DQHA 2HGMA 4QWEA 3BS9A 4DZ6A 3EXYA 3UWTA 4F0KA 4FS1A 3MEDA 4TLRA 2HS3A 5DDRC 3CD0A 3MEGB 3OBIA 4DU8A 2BOAA 3CC4S 1ZAWA 2JX2A 1HQEA 4USMA 2R7SA 2OFHX 3MURP 3D5MA 1FKAF 2I8EA 4M63A 3AD9C 1PBAA 1S9EA 2BEFA 2HQCA 3NOCA 1DJ0A 3I0RA 1S57A 1SC6A 5DDOC 2W4DA 3SSQA 2CXEA 1S1WB 1NK4A 4LVOP 3BKUA 3N6MA 4WCEQ 4EO6A 1UW4A 2EEYA 3DDKA 3PJ9A 6FDRA 2AGOA 2XS7A 2OPSB 2Q6CA 1JNZB 2MLZA 2KFYA 2OLWA 2JDJA 3RB0A 3DHWC 2VA2A 3AA9A 5IOLA 4FPRA 3FNNA 4J9NA 4OL8A 2Y3YA 3UN5A 1X5PA 4ZPAA 3FFIB 2HBQB 3CCWA 1RAAB 4LQ3A 2VBXA 2YWGA 1W7WA 2DR5A 5KT4A 3WX4A 1FRHA 3CJKA 5F0UA 3DDIA 2ZWPA 3SMZA 3ILIA 1BLUA 2RDIA 4YB5A 3UN2A 5A8KA 3MD3A 3VVUA 4NOHA 3LANA 3CMAS 4YUDA 2IM3A 3EDQB 1RWVB 1I6JA 4I6AA 2HBRB 3UVJB 1JLFB 1MW7A 4NEZA 2DYAA 1TZ0A 2VH7A 3WDOA 2GFFA 4IO1A 2F9DA 5KFGA 4JV1A 1KLMB 2CQ4A 2GVZB 3ISND 4M95A 1B99A 2HZAA 4ED8A 2HQIA 1Z4UA 1X5OA 2VBYA 2CG8A 1F5AA 4B02A 1UTAA 3FZBA 2K1RA 3BBCA 1XC9A 2NUUG 4OQJA 1L3SA 4HDHA 1GTEA 3MM8B 4USWA 2AGQA 2LQ8A 3MMJA 3A3PB 1TMMA 3ZTOA 5MAOA 2ZNYA 2CJKA 2DK2A 3CMES 4B17A 1J5EF 2PT0A 2HWTA 3KK2B 3V4IA 2YKMA 3T19A 3CE8A 4PYDA 4PXEA 3FZ2A 1GFWB 2ZBIA 1SH3A 1UA1A 1GQEA 3TEHB 3G9CA 3KJFB 2A10A 4H4KC 1RTZA 1LV5A 2IDEA 1X9MA 3KNAA 2IFXA 4DN0A 4CQ1A 4DL4A 3PJXA 4FF3A 4QIVA 2OP5A 1LW2A 1CQNA 1RAEB 2RIJA 3HCXA 4I68A 1GNKA 5DLFA 2HVIA 3H2UB 2YKNB 1SC3B 2BJ7A 1FRLA 3V2UC 2VJVA 4PRFA 2PE8A 1R31A 2APOA 4OI2A 1SXLA 5HN0A 1N5YA 2AU0A 3PG9A 2JSXA 2HLTA 2QGFB 4DSLA 3M8PA 3MWBA 2VQFF 1J5EJ 2JVOA 1OS5A 4USKA 3P5TL 4Z37A 4ZK7M 2ZH1A 2R7RA 1H98A 4YB7A 3D6HB 5JXSA 1PJ7A 4UOGA 4DI6A 3JSYA 4C8KA 4RBVA 4ETZA 2RRNA 1KQFB 5HMZA 3TARA 1RKIA 1UFKA 2OEMA 3TEGA 2AJ1A 3TYTA 5HROA 4IKAA 1RTIA 2WVEA 1QE1B 5IS2A 5LSOA 1F60B 3MM9B 2DISA 1VDHA 2J7UA 2UUAJ 1NM2A 2BZ2A 3BEGB 3MECB 2VPYB 1CJTB 1AUSL 4IR1A 1WC0A 1UW9A 2BJDA 4DL5A 2GMLA 2E29A 3DLKB 4GRSA 3KLGB 5C7PA 4LFAF 5HP1A 3HHLD 4DS4A 3MPYA 1XQIA 3OTEA 1HQUA 1Q8BA 4F3QA 2H1YA 3A1YG 2DGOA 2J7KA 2AF6A 4ECUA 4JI6F 3ZNJ1 2JL9A 2XY7A 1B7FA 4RUAA 1VQ9S 2NS1B 1YKWA 4CTAA 2UXDF 5DQGA 2CQDA 3OL9A 1SQGA 1Y5IB 4K4SA 3ENAA 2AX0A 2JLFA 2WTFA 2VQFJ 1Y0HA 1UFWA 4DUYF 3M8RA 3HX9A 2QT7A 4BHQA 1FE4A 1D09B 5H1SV 1D9FA 4ED2A 5E2QA 4K4UA 2I0XA 3IBWA 4QYZK 3QGIA 2OO4A 5BYSA 1S7HA 2ZVSA 1VQ8S 3NGRA 3G2XA 3KK1B 4NLQA 5KFNA 3K8WA 1TL7B 1U7LA 1J27A 4ILRA 4I2PA 3CJ4A 5F41A 3D54A 3BGUA 2KTQA 1GH8A 4F50A 2HSEB 5A76A 2VG6B 1CJUA 2RUSA 3BDPA 2NXUA 4ZP9A 4LFAJ 5FDLB 1BQXA 3HT3A 4C2MA 5L9XA 3ZTRA 1J2VA 1KFDA 4FYDA 2FPHX 5D4PA 4C3MA 1VQ4S 1JLCB 3R7SB 4JI6J 3OL7A 4FYVB 3IMQJ 1NU4A 1Q5VA 3DRYA 1NK5A 2UXDJ 1F1BB 4OJ3A 1FT8A 1RT2A 5KFUA 1JIHA 1PKUA 2RQCA 4OYZA 4ZCMA 5KFPA 1DARA 3UPFA 4DUYJ 2OI2A 1C0UB 1YBAA 4DQQA 3PACA 5C2CA 3MFIA 2GGPB 3WIVA 4DPXA 5DQIA 3TA0A 2QSWA 3LAMA 1NK8A 2OMLA 2W2QP 3P3DA 1R0BG 2H5EA 3D3CJ 3K17A 3QT6A 1RWUA 2JFDA 4RW4B 1PG5B 4UOFA 3V81A 3RW6A 2XYHB 1O5JA 4U8YA 2ZITA 3NXZA 4ECXA 1DQ9A 2F8EX 1D8YA 2DVIA 3CD7A 2BKPA 1FCAA 1R6VA 3CSKA 4NLDA 3JS9A 4KGZB 3MOZA 1G2EA 2EKNA 2P2CB 1BUXA 1SV5A 1FEHA 3M6XA 3R6GB 4DSIA 4DL6A 1NBEB 1U09A 3R3TA 4M5DB 2C2NA 2UUCF 2KU7A 4KSEB 2CDRB 2HFSA 2F9JA 3V6DB 2MJNA 1NJYA 4NCGB 2OGUA 4LVNP 5DG8A 3LA0A 1FE0A 3OTOJ 4XDCA 3QO9A 2G4BA 3E01A 2BBEA 5EGYA 2RSQA 2E7VA 1M1HA 4V1Ak 2XCPA 3IWNC 3A8JA 3AQOA 3MR7A 3W8GA 2UVRA 5G0RA 5GAEU 1NJXA 3MAAA 3EUNA 5EWGA 4H4MA 3PHTA 4F02A 3DRRA 1RXOB 3CC2S 3CCQS 2R2UA 4I6YA 3QT5A 5ETPA 1U0SA 3QYYA 2YQ1A 2NZ4A 3VAFA 2HFZA 3LWMA 2HK3A 3NRBA 2M8DB 4TKTA 4ECQA 1REVA 3L4BC 3G8SA 4ECVA 1JLGA 1QAIA 1RAGB 3AHPA 1SL0A 1BMQB 3T1YF 3VQTA 2G2YA 2RQMA 3CD5A 3DLGB 1RYSA 4DR7F 5AXNA 2DCLA 5J2PB 3TNVA 2OAUA 2BYCA 4F3MA 2ZE2A 1HNVA 5GAGU 2XO6A 4K4WA 2OPPB 4RWWA 3K0JA 4HLBA 4ZPBA 5CYQB 4C8OA 4WTOB 3MFHA 3QIPB 4KQZA 1U1LA 1SJRA 1YWXA 2QO3A 3T5JA 4K5SA 4QBUA 2C3PA 4KO0B 5F8JA 1IR2A 3MTJA 3RB6A 4R5PA 3QGPA 2AJ2A 1MWYA 3VZHA 5D4LA 1NDLA 2CPIA 3FDSA 4WP8A 3C14A 4B3OA 2ROGA 1FDBA 1Y11A 3UFCX 1RHRB 2N4CA 1NZAA 1FDDA 5F8LA 4FF1A 2MSSA 3WZ0A 3GWCA 1NSAA 1AZSB 2MY8A 1RA6A 1WHXA 3ZZPA 1B7YB 3GJRB 2UUWA 4YMEA 2J5AA 3MEGA 3T1YJ 1VQOS 2B8QA 1U2FA 2D3OR 2BW7A 2R7UA 4DR7J 4H4KA 4L75A 2KT3A 3EGWB 1UA0A 2UVVA 4TU9A 1KQKA 3TR5A 2E9RX 2ZH4A 1XNRF 1FWKA 3UD5A 4LT6A 4AYBD 4C9DA 2N7CA 4Z7CA 3US5A 2B51A 4ETXA 2V9WA 2OPSA 2OPRB 3IG1B 1X0PA 4QPTA 3HP6A 1UVIA 4ER8A 2ASJA 2B5JA 1S77D 1ZZFA 2QZ8A 4B9MA 1ZYQA 1NK7A 3RG6A 2HS4A 4O4GA 2L9DA 4DL2A 3FFIA 3IM8A 4OI3A 4USJC 3T3FA 2BR0A 2F8MA 2ZH3A 3CT9A 3M05A 4K8RA 1APSA 3OR2A 3UDVA 3IWXA 2KHCA 2W9BB 2D9PA 5L39A 2ASYA 1KD1T 3Q83A 4Y6IA 4EUVA 2IM0A 2EI5A 3RRHA 2FY8A 4YP3A 2IRUA 1GMWA 3M9MB 1Q8IA 3WC0A 1JLFA 3I82A 3BBFA 3PNIA 1H74A 2PSZA 4WU2A 4RKUC 3DHXA 1FXDA 3N01A 4AUKA 4OX9F 3D68A 4RNMA 2VG5B 4IRKA 3FMBA 2OKQA 3TQ1A 3QFHA 2J9DE 4CRJA 5HO4A 3T9NA 2XLJA 2V34A 2XHCA 3MM8A 2JWNA 2LLZA 2JEJA 3P96A 1WUUA 4NZ7A 1RWWB 2RH3A 3QT8A 2DNKA 4U95A 2CPZA 4G1QA 5CYMB 5KFRA 1EETA 3SFGA 1NKCA 1IWGA 4EGLA 2DH8A 5KFFA 1DFDA 4UOCA 1M5HA 3MI7X 1S6QB 3GLJA 4LIRA 1S1UB 1VHIA 2DEIA 2VPXB 4ZPVR 1U45A 2F40A 1YX2A 4GKJJ 4C8NA 4IQMA 1U2RA 3PYFA 4ECRA 3P49B 2MLXA 4DX8H 3OLBA 1S6PB 5HVFA 4F4KA 5IC6B 5IM0B 4OZLA 2ZD1B 1R8HA 3R5BA 4Y2IA 3DGVA 2PEBA 4NLOA 2XZDB 1QSLA 4Y34A 4J9OA 3ZXWA 3M8ZA 1ZPWX 3CDAA 4OX9J 4A8WA 4N8NA 2DTJA 1S7IA 2P8IA 3WIUA 1WHWA 1RHJB 5HMXA 1F2HA 3MHYA 4JI2F 2Y8WA 4IG0A 3RGIA 2R7WA 3PEJA 3V6JA 2FVSA 3K5NA 3CJRA 2B4VA 1NK9A 1KBRA 1Q1KA 2PA3A 4OYBA 2HNYB 5L1IA 2YKOA 3D66A 1CS4B 3C8YA 1BQNB 1Y9OA 5C5JA 2P6TA 3K8VA 2AJQA 2D7SA 4OFZA 2J6SA 1W2BR 1RK8A 4Q2LA 3QBCA 1FTRA 3CJ3A 2HIQA 3FSYA 1JKHB 2AJFE 5I4MA 3KHHA 5ETNA 3MR3A 3AAWB 2C2RA 1WKJA 4J9VA 1V3RA 3BKTA 3TQEA 1QE1A 1U0HB 5CZVA 2X1GA
chains in the Genus database with same CATH topology
3MECA 3NAHA 5J2NA 2J0SD 4IG3A 2BQUA 4CO1A 3O5TB 2DNRA 1VQKS 2GJ2A 1TKXB 3KMQA 2XMVA 1X4BA 2AJ4A 4PQAA 1ZTTA 3EZ5A 4MK9A 2VONA 3D0GE 3UR0A 1HWIA 1BC6A 2LXUA 2CQHA 3GSDA 4WYWA 3G71S 1R0AB 4MYUA 2MZJA 3KG1A 1WI6A 3OVBA 3MEKA 5FD1A 3DLKA 4C98A 3Q24A 5EX3A 2J7WA 3S1TA 4CO0A 1XEZA 3M1VA 4B3SF 2C22A 3NGDA 2YWEA 4HH1A 2QSFA 2LA6A 2RF2A 2KXNB 3HZEA 1WWHA 3UE2A 1S9GA 5E3QA 3MMAB 4A8QA 1KTVA 3IXQA 4RNFA 2B5JB 3NNCA 2N7YA 2HFNA 1S97A 2CPHA 2EWHA 4OLOA 5KFMA 2ZHBA 4ES3A 4RUHA 4FP9A 1RTIB 2KVIA 4I6WA 4OIXA 2R2TA 1KOHA 1VQ7S 1VQPS 4ERDA 1IKXB 1PC5A 3RTVA 3LP2A 1HNIB 4B9TA 1WG4A 1YJRA 2Z4PA 3L09A 3NGKA 1N54B 2DHXA 2WBRA 2FLNA 4AE5A 1XTZA 4O4GB 4H4OA 3ZFVA 4ES1A 1N36F 3RR7A 5FIIA 5H9FJ 1NJIT 3K57A 1FHTA 3X3UA 3EGZA 4U67Q 2XNQA 1LFWA 4I56A 1VQYA 1OPZA 3FMWA 4NYOA 4Y2KA 1SKRA 2B4UA 3OR2B 4BS2A 4P2SA 1JXEA 2DNQA 5F8GA 1CC7A 4LQ9A 4TLQA 1R6YA 3QIDA 3AJ1A 5HP1B 2AYEA 4Z2XA 3KJVB 5I3UA 2NUHA 4KHMA 1X9SA 3B4MA 3D1OA 1H3DA 3TUIC 3OUYB 4DV3F 1SJFA 2MKCA 2E5GA 4QIFA 4TY9A 4GC7A 1HBNB 3BQ1A 3GILA 5HMYA 1S72S 4KFBB 2W24A 3EGNA 3BGRB 1MMLA 1DTQA 1S1VA 4ZPDA 4BCAA 3Q8QB 1WEXA 4ZP7A 5EX0A 1DZ5A 2GX8A 3CGIA 4Y28C 3JAMY 4USIA 2IMWP 3OHBA 3NP5A 4TN2A 2RKIB 2ABYA 2B9XA 3PW7A 2BXJA 2LU1A 2XC9A 2KH9A 1FK9B 2M2BA 2RQKA 3KFWX 3FGVA 1B0TA 1U47A 1ULRA 4LMZA 4F4ZA 3JSMB 4CTAB 3EYZA 4ZPTR 1DQ8A 1VRTB 3D0IE 2BQ3A 3KK1A 1IKWB 4N41A 2LECA 1MROA 3HK2A 3J7ZT 2UXBF 2DGQA 4X4NA 4MK7A 1XNQF 2UV8A 4JYAF 3FCHA 3C6UA 5EUHA 1J5OB 1DAXA 3CXCR 2ZNZA 3K2YA 4NLRA 3I4PA 4PWDA 5AXMA 2X51A 1H7WA 2UV8G 4NLTA 4ZDNA 5KFTA 2VFTA 2L9WA 3MPWA 3OL6A 2W7OA 2KKHA 2UVUA 4HI2A 5AE3A 2AD9A 1GXLA 1KC8T 1R8AA 4KGKA 2FGOA 4WFBQ 3C2PA 1VGYA 2PGCA 2YX4A 3QJLA 2VG6A 4MIBA 3IRWP 1E6YB 2KXHA 2I2YA 4Y0FA 5L1LA 3H2VE 3H5UA 2I5JA 2MHEA 3HM9A 4NLWA 1TFWA 7FD1A 3QLHB 2UVWA 5LJ5Y 1VQMS 2DRBA 1HBMB 1VHFA 2CPDA 1ZM4A 3K5OA 3PEHA 4IFVB 2PI4A 3VAMA 2HNDB 5BYQA 2KFZA 5L9NA 1GX6A 1WEZA 3H4BA 3GFYA 2FJBB 2IAJB 4C8LA 2B56A 2E1CA 2M88A 2XSJB 1RT6A 3M6VA 1KNZA 2KZMA 2IA6A 3GFXA 4G1QB 3SI8A 4ZS6A 5J1NA 1HR0F 1EETB 3PIPQ 3KTQA 2D1CA 1SKWA 4PG4A 5LSRA 1JLCA 1HPZA 2DB1A 4R25A 1YHQS 4I2PB 4XPEA 1N33F 4QQBA 2ASDA 1NRKA 3GG1A 3SXLA 5KFXA 2O66A 2MQOA 5KG4A 4FVMA 3CJ2A 3J7YI 2MQPA 4JV2A 4YR0A 2DIUA 2C3UA 4QU7A 1UVLA 1OO0B 1CEZA 3L3CA 2O1PA 2E7XA 4ZOSA 1LKZA 4PG5A 4D3HA 3KYLA 5EHHA 4PUOA 2QLXA 1X7VA 4JI1F 4Y2MA 1SKSA 4DV2F 2LCWA 1XMQF 5KFDA 4WK1A 4Q8EA 3NAIA 4URQU 1L3KA 4I69A 2ZHAA 1HHTP 1JLEB 2DNGA 4IDKB 3DRSB 3IAS9 2VUGA 3O44A 3RBEA 1Y3KA 2QIFA 2B43A 2W4CA 5B0EA 2XNRA 2RVJA 1BQMA 2JEFA 4DL7A 2MJUA 3GB0A 4TU8A 4ELUA 1JLBA 1MSWD 1JJHA 1U1KA 4EWTA 1T3OA 5GAEI 2G13A 3M8QA 3MUMP 4ECSA 4DR5F 4QJVA 4ES2A 4EFAC 3I9V9 3RRKA 3PW0A 4RW6B 3OXGA 2PO4A 4WJBA 3CUNA 1L3VA 4MKYA 1ZM3A 2W8LA 5CYJA 4AFFA 4UY8T 3TUZC 1IM4A 3B78A 2W25A 3K5LA 2K3IA 2D74B 1LOUA 3W2VA 3HZGA 2NR0A 2R7TA 4RW4A 2Z0GA 1E6VA 2RT3A 4RNNA 1Y00A 2Q79A 3RB4A 2NREA 3SEOA 4O3SA 3TVKA 1CVJA 2RE1A 4YOEA 5E3RA 3TW0A 4X84A 2Y1RI 2VKRA 4RNHA 4QW8A 3RAQA 3KWMA 3V5RA 1PILA 1TV6B 2LA4A 2DNLA 3U7JA 2JFKA 5JVGQ 2MKKA 1JXLA 2PMHA 3GIMA 3PR4A 3SZ2A 4C8MA 1HWJA 4A8OA 2ALZA 4EBCA 2R8HA 1WI8A 2R7XA 5DDQC 5HLFA 1QVFR 3IC1A 2XCAA 5B7WA 3R1HA 2M0GB 3IS9A 4IG0B 3VWSA 2HFOA 3TA2A 5LJ3Y 3S01A 1L3UA 4OHWA 3VAHA 1XR7A 3CC7S 4CO3A 1TVRB 2E1MC 2XSFA 3MXHP 4DR3F 3D28A 5A0YB 2FDNA 2R7QA 4RW8B 2ZH8A 3CCMS 1OQ6A 1YJ9S 2UZAA 2XS5A 5E3PA 1UEUA 2FUG9 5HBMB 1AFJA 1S1WA 2BA9A 2ZC3A 3FVYA 1WEYA 4DF8A 1Q82T 1NK6A 2EFVA 5KFQA 1G6BA 1KHVA 4KHRA 2VPZB 3OVAA 5T7LB 1WG5A 2EW9A 4LSNA 3UDCA 1KHWA 2OIHA 2UU9F 1SL1A 4Q0BB 3O6QA 4Y00A 4HYKA 1LQ9A 1AROP 3OVSA 5KFVA 5KFIA 1S1XB 3BGLA 3CCTA 1Y4ZB 2FIUA 4XDDA 4W90B 3DXSX 5IT9Y 5DM7Q 2JOQA 3V6DA 3BQ0A 2DR8A 5CCLA 2MB0B 5GADU 4NXNF 1PO6A 2DO0A 1RAJA 2B9WA 2YKAA 3N28A 5M2PA 3UD4P 3HVWA 2GHWA 4USHA 5K8NA 4WK3A 1H6KX 1R3NA 5KAKA 2MZ1A 3TI0A 2JJ4D 2OSQA 1KSPA 1IJEB 2N3LA 1C4AA 3I5BA 1QY7A 4HT5A 5KTQA 1SIZA 1NH8A 1D9AA 1FJCA 2OMOA 4O4RA 4C4WA 1D9DA 1MU2B 1N48A 2KYZA 3BN4A 3IRXB 4FXVA 2DNYA 4J9KA 3R1LA 1P1TA 1S10A 2E9ZA 3MAHA 2XWYA 3CULA 2CQPA 2CIMA 1NH7A 3D1HA 2MKHA 5B09A 2JRSA 3OJSA 2RS2A 2HVZA 3CCZA 1T03A 1LWEB 2RQ4A 4XO0A 2VFRA 4YR2A 3CCSS 1ZTWA 2K8GA 1T3NA 3LAKA 4DMZA 4GKJF 3F73A 1BD6A 2C3OA 1Q78A 2MZTA 5J1EB 1X4EA 2M9KA 3M9OB 3SCJE 3RAXA 2YVSA 1X9WA 3Q2SC 1QSSA 1TAQA 3WC2A 4HTJA 4JV5F 3LUYA 4QCLA 4B3RF 4O3OA 1SJ4P 4IG3B 2YNHB 1ELOA 1HFEL 1U1RA 4LSLA 2X1BA 3W2WA 4AQYF 4C8YA 2IYGA 4DG1A 2DGUA 3MR2A 4L6V3 3R5AA 4DFMA 4PQUA 2BRKA 3MM7A 2F1FA 5KG6A 4X64F 4OX8A 3HKWA 3S6EA 4YR3A 3K5MA 1GXUA 3K58A 4OZ0A 2F4VF 1RP5A 3LP1B 5KFEA 3GV8B 5LMUF 3M1VB 1M1KT 2V0NA 4NLPA 4KBIA 3VAKA 3BDEA 1XBWA 1FNOA 4QU6A 3I0SA 1RDRA 4NCAA 2GHPA 5AE2A 3AA8A 3BB5A 4PKDB 4LF5F 2JC0A 2NPIA 4M8LA 4QOTA 3VTIA 3WBZA 3LGNA 1R8CA 1FKOB 1IBKF 5AXKA 4NWBA 5G0RB 4IOAQ 4IRCA 3G86A 3HVAA 4L3NA 3G6YA 2ROEA 1KLMA 2EFNA 2VC1A 5I42B 3N4WA 3PXGa 1PSDA 1FF2A 1TL4A 4I64A 1WG1A 2MKSA 3I31A 2IVFB 1QJHA 5B0GA 1FXLA 4URGA 1VFJA 3G8TA 4B9SA 4KHPF 4H4OB 5ITHA 2B4PA 4NRTA 4DLGA 2LDYA 2FGCA 3I56S 4O3NA 4MIWA 1QVGR 1S76D 1S6OA 4MKAA 2XG8A 3BZQA 3GZ7A 4Q7AA 1N5VA 5DG9A 1YVFA 2EFGA 1QAXA 4F26A 3T6JA 2DNHA 3IR6B 3SSRA 3BM7A 3OFGA 3NG8A 4JBCA 4DR6F 1VBZA 4CCHA 1TL1B 5F9NA 3FRZA 4LUBA 5I3UB 3BSNA 2LXIA 1IQTA 1BGXT 4MTPA 3SFUA 1L3TA 3SYZA 5C24A 2MDAA 3ONQA 1UETA 2V8GA 3GYNA 4Y65A 2FVRA 1OWXA 2PFFB 3UCUP 3GYXB 3KLFA 1JLAA 1REVB 1F5BA 1UKUA 1YJUA 3DLEA 3DMJA 3NLCA 4I4BA 2YX1A 3UI3A 1S1VB 3H20A 1TFYA 3PM9A 1H38A 1SL2A 5F0WA 4EZ6A 2R7VA 1JLGB 1XK8A 2QMXA 3PV8A 4P6QA 4OHZA 3KK2A 2OPPA 2CPEA 2FTRA 3GFZA 4O3QA 2J9DA 3OTCA 2B4OA 2I38A 2WONA 3PRDA 4WFNQ 1RA7A 4U7CA 2IJFA 3SDEB 4F67A 3M8SA 1LK5A 5CYQA 3FQLA 3AJ2A 3ZZUA 1MROB 2IMOA 2R4FA 3DOLB 3NWGA 4YFUA 3FSIA 3TAQA 4WKRA 1FNMA 3E51A 2FHMA 3H25A 2IA0A 3NNHA 3BQ2A 2J9CA 3V4MA 3C6UB 3CIMA 3KLEB 1CQMA 5GADI 1T95A 2JHEA 4DSKA 1FKPB 1UMJA 1TP7A 4KRWA 3EX7B 1Y5NB 3Q23A 2C3MA 3CO9A 2HLUA 1HBUB 1HI1A 5DO2A 1VC5A 1Q86T 5A8WB 1JLQA 1Y3JA 4DSEA 1PGZA 4ILMA 2OPQB 4HTIA 3HKZD 3HHKA 4CO4A 3D0HE 2RNEA 3O3LA 2I5JB 4LJMA 5KFOA 5K8PA 4NMLA 3THPA 2K3KA 3RR8A 5A6WA 1X0FA 3RZAA 3SV3A 3CDBA 1XWLA 2ZE2B 2N82B 3RBDA 2WCXA 4EEYA 1G1XA 4RUCA 3G4SS 3CCES 4BBYA 3MMCA 3AB2B 2KDOA 2WB4A 5K8MA 1URRA 2RDJA 1UJ6A 3M2VB 1FVQA 2Q1LA 1RT6B 2HNZA 1U1MA 2YKNA 3G6XA 1NKEA 3VCDA 4QPXA 2C2DA 5CA5A 2GCFA 1N5SA 1HL6A 4G1PA 1SJ3P 1ZBTA 5EWEA 2KG0A 2NQPA 5GMKa 1SJQA 2HGLA 1DHMA 4L72B 4RWXA 1Q53A 5T41A 3JTPA 3KHGA 4OZJA 3H5YA 5L1KA 2A3JA 3U02A 2MKJA 3O1LA 1VQNS 3CCUS 4O23A 4ITSA 2MZSA 4DUZF 1C0TA 3O8WA 1IR0A 1WTFA 3TRGA 3CPWR 1JJ2R 4PUOB 3L7PA 1RTJA 2D3ZA 4WFYA 1F9FA 3VZIA 2ADCA 2XS2A 2R8JA 2KZZA 1SBRA 1VLYA 3NKYA 1AUDA 5B0AA 2R8KA 1M5KC 2E1RA 4WIIA 1A6LA 2O01C 2LXFA 1N52B 2O3DA 3QJPA 4ZHRA 4B3OB 1B0VA 3UQSA 2NLWA 4EYIB 4DSJA 2DR9A 1B64A 2HVHA 1HI8A 2FJDB 2DRAA 1JLBB 1HD0A 2BANB 4GO5X 2V5HG 3DC2A 4OZ1A 5KT6A 1TL5A 3M8QB 2EVZA 3C6TA 1TKTA 2RUGA 2CVEA 2KHDA 3ENWA 3GG0A 2HQ3A 2VBWA 1F0XA 1X5TA 2F8HA 1XMBA 2MYFA 2P9CA 3THTA 4A47A 1X5SA 1HYSA 2PIIA 2IJNA 1UP1A 2CPFA 5DQHA 4TQRA 2HGMA 4QWEA 3BS9A 4UQTA 2OTLS 5D3GA 5KG3A 4JI7F 5A8RA 3EXYA 1YJNS 1VK8A 2ZOFA 1S9FA 4JI3F 1FTCA 3UWTA 3HHNB 5CH7B 3MM6B 3MEDA 2VFVA 4TLRA 4FS1A 2HS3A 1DTTB 1K73T 4ZCKA 5DDRC 3CD0A 3MEGB 2CRLA 3OBIA 3LPYA 4MMOA 3GQCA 1RT1A 3PY8A 2OJ3A 2DBBA 1RI7A 3CC4S 4ELVA 4N56A 1IJFB 2WOMA 4X4QA 1VBYA 1WELA 4CH7A 3IO1A 1ZAWA 4EBEA 1R8BA 2JX2A 2OPRA 1HQEA 2R7SA 3IG1A 4KV8B 2OFHX 4KKOA 4KGMA 3MURP 3D5MA 1FKAF 2I8EA 4M63A 1XERA 3J80Y 4Q43A 4IOCQ 5J2QA 3PX6A 1TR0A 4DV7F 1T05B 1S9EA 3CCLS 2A18A 3HMJG 3H40A 1U1NA 2UUTA 2POKA 1DJ0A 1S0VA 3I0RA 3MM9A 4Y2AA 1RGVA 4HVZA 3OSPA 4A8XA 4F4XA 3DGPA 1SC6A 3E8OA 5DDOC 2W4DA 2QA4G 4Q8FA 3H5XA 3SSQA 3MCSA 4E8UA 1RT7B 2A2CA 4I2QA 2C3YA 1S1WB 1QAYA 2YWFA 4JI8F 1NK4A 4LVOP 2HAIA 2M7SA 3N6MA 4WCEQ 4EO6A 1UW4A 2KM8B 2CJ9A 3QWUA 3OFFA 3DDKA 4X62F 1JMTA 6FDRA 2ZH5A 3UNGC 2AGOA 3KHLA 2XS7A 3KLGA 2OPSB 2W9BA 2Q6CA 2W4PA 1JNZB 3BSCA 4PPDA 2KFYA 2OLWA 3ETOA 2YNGB 2JDJA 1K9MT 5KFYA 3RB0A 3DHWC 3MM5B 4I1TA 3AA9A 5K5MA 2B7CB 2W9CB 4FPRA 1M5OC 3FNNA 2VA2A 1VRUB 2CQ3A 4J9NA 2Y0SD 4OL8A 1FA0A 5CD4H 1O8BA 1FVSA 1QSYA 1B0PA 5KFKA 4CIOA 1LWFA 2XLIA 1X5PA 3HDSA 4ZPAA 3PKYA 3FFIB 1VK3A 3KG4A 4A8KA 3CCWA 1A7GE 1T7PA 4LQ3A 2EKYA 5LXYA 3IN5A 5CQGA 2ZOMA 1T03B 3QAUA 2VBXA 2YNIB 3ITHB 2KFNA 2YWGA 1S99A 2V8HA 1FERA 5KG2A 2JLGA 4FNIA 3HHLA 2DR5A 2FLPA 3NL0A 2HHXA 2XI3A 5KT4A 3IGVA 3WX4A 3MAQA 4IH6A 4N77A 1FRHA 1I94F 3CJKA 5F0UA 2V8VA 3VF0B 3SMZA 1AW0A 1BWEA 1YJVA 1CSJA 2VB6A 1SIWB 1BLUA 2RDIA 4JI5F 2MXYA 4LSLB 4YB5A 3W2WB 5A8KA 3MD3A 3OHAA 4NOHA 4CO5A 3Q0AA 4C0HA 4NA3A 3LANA 1C1CB 3NMRA