5GAHI

Rnc in complex with srp with detached ng domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
b'ALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYVTEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQIDRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SRP 4.5S RNA
publication title Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00466 Ribosomal_L10 Ribosomal protein L10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5gahI00
1ZAXA 5D6GA 5GAGI 3A1YG 5GAEI 2QA4G 5GAHI 1ZAVA 3J7Z5 3J7YI 4UY85 4NWBA 1ZAWA 3JSYA 5D8HB 5GADI 4V19J
chains in the Genus database with same CATH superfamily
1VRTB 3S6EA 4I6AA 1YVFA 2RUSA 3BGUA 2EG2A 2UUAJ 3M2UA 3IRXA 1SB6A 1NKBA 3BKFA 4P7TA 2BE2B 6FD1A 2EFPA 2RB7A 4QIGA 4RW7A 5KAKA 2VFTA 3RAXA 4DL7A 4JBCA 4YR2A 2BXJA 3Q2SC 1S48A 1VR6A 4JI8J 1KTQA 1QTNB 4EK2A 1U1QA 4ZCKA 1VIOA 4USTA 2AX1A 2Q6CA 1HNWJ 3TARA 4PXEA 4P72A 5BYRA 1M1GA 1VRQC 1HNZJ 1HKAA 1NZAA 3GQCA 2YNFA 3D4JA 4ZN1A 1NU4A 2HK3A 2EBGA 1P1LA 4TN2A 2YQ1A 4DPWA 2PSZA 4ENOA 1Y5NB 3QIDA 2EK6A 2YNGA 4CM0A 5K8PA 4OLPA 2ALZA 5FJ4A 1KNZA 3SDEA 2OIHA 1W2IA 1K73T 4QJVA 4KR0B 2BACA 1CULA 2BW2A 3J81U 2Z2MA 2IYIA 1F5CA 3GLJA 3D6FB 1AA1B 4IG3B 3UDEA 1T9WA 4M63A 4R0EA 5K5MA 3CB4A 2MQ8A 3IGVA 2EFGA 3KK3A 2M9KA 3T1AA 2CWXA 5DQHA 1KC8T 2V67A 3BGLA 3KHHA 3Q8SB 2GMLA 2DHAA 2DNGA 4DF8A 4I2PB 1FCAA 4DFJA 2DNYA 2I6WA 1WG5A 1SL0A 4JI1J 2HVDA 1NMEB 5IT4A 1QAXA 2ROGA 4LJMA 1TQLA 2FHJD 4A47A 2LXIA 1SQFA 3QJPA 2RNEA 1TP7A 3MM8B 2MKKA 4Y28C 3PKYA 3R9LA 1Q78A 2HNYB 1DARA 3T5HA 2UVUA 4DPXA 1SQEA 4XTTA 2BZ2A 1FKAF 1S59A 2JLEA 3BM7A 4FF2A 1VRUA 1SKRA 2AWZA 4X4OA 2FJAB 4P2FA 1NK6A 4PKDB 1RT3A 2DNMA 2C28A 4ED2A 4LF8J 3BKUA 4WYWA 4WF9Q 2ZC4A 4F4XA 2YX4A 5DM6Q 3BV8A 2UXBF 4USIA 3H90A 2F8HA 5KOWA 3D66A 1N5YB 3HO1A 1RK8A 1ICEB 2GGPA 2H1YA 1TL4A 3IGNA 2R2UA 1DBDA 5FDLA 2W7OA 2UU9J 5J2QB 1ZZFA 5KT4A 4BDPA 2DXDA 5EWEA 3AJ1A 4DR6F 3UCUP 3K2YA 3UR0A 1TZ0A 5AXMA 2BJ3A 3ENVA 4UOCA 5KFCA 2DR5A 1NDLA 2QLBB 3FGVA 3MMAA 3NGTA 4C9DA 1C0TA 2KO1A 3MEGB 1FVQA 2FUG9 2YY3A 4DR1J 3HMJG 2WK4A 3T1HJ 2OMOA 3OXLA 3C6TA 4I68A 2AKWB 3AA8A 3DCAA 1IUJA 2BVZA 3IAM9 1RTJA 4NXNJ 1Y5IB 2FB0A 4CLTA 1I6JA 3S1TA 2OP5A 1XERA 1KQGB 3PVXA 2BE2A 3TAMB 3M1VB 3I6PA 2FC9A 2XULA 2GS8A 2C2NA 2Y3YA 1YG0A 2FGCA 3ZZ0A 3T3FA 3N6NA 5ETMA 2OKQA 1OO0B 4DPYA 4OI3A 4YHHF 2J6SA 2R8JA 3FSXA 3VAFA 1VQSA 4V1Ak 2ZH7A 4J9MA 5DQIA 2KI2A 2VOOA 3GWCA 5JJBA 3PJWA 4YQWA 4TU9A 3TQEA 4LQ9A 3O6QA 2MQPA 3QLHB 1LNQA 2HFOA 1RJJA 2E1RA 3MUMP 3ITHB 2BA9A 3FMWA 4OHWA 4DSKA 2F40A 3W62A 1PYSB 3M8QB 2YKAA 3GJQB 3EGNA 4ETZA 5IWAF 2CADA 4IG3A 3H5XA 1Y4ZB 4JV1A 1GMWD 3G4SS 1PC5A 2C2RA 5L39A 4OI1A 4ZPAA 2XSJB 2BRKA 2R7UA 1RQ0A 4P71A 3J7ZT 1D0EA 3UN3A 2HGMA 3D28A 2CUYA 4CLKA 5BXIA 3KTQA 3TYTA 2AU0A 2UXDJ 1NH8A 5H9FJ 2M52A 4O4GA 4K5SA 1MMNA 3HDSA 3RAQA 5B0CA 2J7UA 3HVTA 1NK7A 4QR0A 2V68A 2HNYA 5C5JA 1FRJA 2DNNA 1FNOA 4CLZA 4KGKA 3DRXA 4KPYA 2QT7A 4PWDB 3OFFA 3NNHA 3L7UA 3MMBB 4DV2F 1L3TA 1R0AB 4DSFA 2XMWA 4WPAA 2Y1JA 4NLRA 3H25A 1Q8IA 4M5HA 1RXOB 1XNRF 1N5YA 3MCMA 3MXHP 3UNGC 1TTHB 3PX6A 3FZ2A 4G1IA 3J7YI 4A8SA 3C15B 2YH0A 2KXFA 1A7GE 4YB7A 4FXWA 4RNNA 3F56A 1SJFA 2UXBJ 1LXNA 5HQ8A 2GNKA 2BKOA 2R7SA 1GTEA 2XB2D 2KFYA 4OFZA 4CP5A 3M2RA 1H72C 4QQBA 3PR4A 2GHPA 5DGAA 2CVIA 2AGQA 1ZM4A 3QNWB 4X4PA 4DV6F 2KZMA 3BDEA 3QO9B 4DR6J 4PZVA 3L4BC 3I9V9 3CJ0A 1BC6A 5EWGA 2RQCA 5KFNA 2RQMA 2JC0A 2MLXA 2YWWA 1MROB 2HW3A 2BANB 3BZQA 1O0PA 3A8IA 2BE9B 4HACB 4WCEQ 1U1PA 3PM9A 4MKBA 4M94A 3TAMA 3M1VA 4NMLA 4AT1B 1EKRA 3M2VB 4B9UA 2BJ7A 4WKYA 2D9PA 1KS2A 2QEXS 2W4PA 4I56A 4FXDA 1XMBA 1T3NA 2J7KA 2X7IA 2HRTA 3MDFA 1F9FA 2FLPA 3KK1B 2MJUA 2R2RA 4M5DA 3EXCX 2YQ0A 2XZWA 3RGIA 1R7IA 4ANEA 2VG7B 1HBMA 2Y8WA 4CZCA 2NQPA 3M8SA 4A8WA 4RW9A 1ZAWA 2FHMA 3SCLE 1U49A 1OSDA 3FFIB 3LANA 4YHHJ 3QLHA 4X4SA 2KXHA 3ITHA 2MQMA 1S1WB 1KLMB 2OPQB 2W9AA 2CAJA 2UP1A 5D4PA 3M8QA 2C2EA 2B0GA 1R8CA 1EB0A 1C4AA 1YJUA 1RT5A 3LOUA 2CXEA 2XSJA 4JV0A 4PAAA 2HMIB 2DITA 1PYOB 1SVDA 1TL7A 4MIWA 3GFYA 2HVEA 3PHEA 2FZCB 1B7YB 1XJWB 2K1RA 3PO4A 3ZO7A 1NSQA 5L1JA 1FRXA 3OR2B 4LFAF 5LT5A 1Q16B 4ICLB 2MJNA 5CH7B 3VAGA 4ECRA 2ZBCA 2ZNZA 4J9QA 1N6QB 1S5ZA 4B3SJ 2ATLA 4ER8A 4B17A 4KB7A 1FT8A 5KFQA 4UY85 5ETRA 4ZP8A 4CLYA 4ZK7M 5KFXA 3FEZA 1WKJA 2Z30B 1UCNA 4CO3A 4ED5A 1RHMB 4B3MF 4KGXB 3MMBA 1CBKA 2M0GB 2QLFB 4KHMA 4FXVA 1FFSB 2DNPA 2ZM6F 3RBEA 3PDNA 1IJEB 4P73A 3I0RB 4C98A 3J7A1 4DDFA 2EVZA 5E0OA 5H9FK 1TVRB 3ISZA 5AJ3F 1JXEA 2MQOA 2L9DA 1QM9A 4KPCA 3SCIE 4DX5A 5JUMA 4DV2J 1M5PC 1G4CA 3C8YA 3W61A 1QAYA 4A4JA 3PXGa 2CYYA 4C8LA 3RR7A 1YJ9S 3HSJA 2JEFA 4W98A 1R0CB 1NH7A 4JI0F 2DGWA 1R8BA 3ZZYA 2VZ9A 1JLQA 1W7WA 4IFYB 2FJEB 4GO7X 4J9LA 3HSZA 1NKCA 1IR1A 2CVEA 3AD7C 1FKOA 4NEZA 3D3BJ 3RYLA 1S1TB 4DR4J 2J0XA 4YDXA 3H42A 4K2XA 2M4MA 1MROA 1YRUA 4TY8A 3MEDB 5DO2A 4TU8A 1CJKB 2VA2A 3S8SA 1JB0C 2XWYA 2W7AA 4YMEA 3W63A 2XCPA 4LF4F 1TAQA 3PFEA 3KUHA 3M2VA 3CTRA 2NCKL 4YEAA 4X4QA 4USMA 1H73A 1U8SA 1SI9A 1U6FA 4C11A 4ZLJA 3AQPA 4PCQA 5HI7A 1HNXF 3DDIA 4O0NA 3VZIA 4AL7A 2ZWOA 4DUZJ 5DS7A 1RA7A 3KK1A 2P9CA 4IR1A 4TY9A 2VDIA 4ILRA 4OYMA 3GFZA 4ZVQB 2MY8A 2KT3A 1UEKA 4NYPA 1XR6A 4YR3A 2VJUA 1X4BA 4C97A 3CCTA 1N48A 5ETPA 4UQGA 2FHJA 4KFBB 3G96A 4OYIA 3FFIA 1RWVB 1RBOB 2Y0SD 3IS9A 2J6TA 2DGXA 1B70B 3O3LA 3I87A 4TYBA 1KLMA 3DU6A 1EQ0A 4ED4A 2MQLA 4N8OA 1UJ5A 2PA8D 4Q8FA 2KHDA 3AAWB 3EJMA 4IOAQ 2JJ4D 1LQ9A 1YJRA 2KKHA 2IDEA 5LJ5Y 3PTWA 1X60A 1RWWB 2B51A 2AHOB 4CIOA 3DHWC 1YJ7A 2RE1A 3G9CA 3SV3A 4A8YA 2V6AA 3P5TL 4LR8A 5HAOA 3OR2A 5KG3A 1U02A 1VQ4S 1RE1B 5D77A 4CO4A 1SUQB 3LP0B 4ICLA 4WYLA 4EYIB 2CQ4A 3R1LA 4PRFA 3TUZC 1GQEA 8ATCB 6AT1B 2HHTA 2DGTA 1RB0A 3OTBA 3I0SB 4LMZA 1RA6A 3G8QA 1AROP 5BYQA 1NB2A 5M2UA 3MUVP 2A3JA 4IOBA 2QIFA 2XYGB 4YS2A 2XMMA 3QGGA 4L6V3 2XMVA 2KM8C 4JI6F 3I0RA 4NMXA 3OVSA 1IWAA 1WOOA 2JEIA 2ACMA 4X65F 4KYZA 4OLOA 3C2PA 4IQXA 4B3MJ 3JAMY 2VHGA 4HI1A 2EKNA 2O66A 2EC2A 2NSBA 1HBNB 1SL1A 2G4BA 1JXVA 2G0IA 1EQMA 3A13A 2DD8S 1VISA 4LR7A 5AJ3J 2DGOA 2AF6A 3SFGA 2CPIA 3DLLQ 4OYZA 2LQ5A 3C66A 3WX8A 4DEZA 4Z2XA 3ZXWA 4EBEA 4IFYA 1AW0A 1TR0A 5JMNA 1VLYA 2HQ3A 2HS4A 1FWPA 5HQMA 5E3RA 1F2HA 1XBWA 1MMLA 2FY1A 2XLKA 4KRWA 1S1TA 1SV5B 4UF4A 4I0WA 1L3KA 4JI0J 4LSNA 3HSDA 1PSDA 2YNIB 3DLKB 4PQAA 4ERDA 3V2UC 4NA1A 5GVQA 5D6GA 1CJKA 2VL1A 1MSWD 1ZOTA 5KFDA 2HHXA 3CJ8A 2KRRA 3DNCA 2Q6BA 4X84A 3BGRB 2XM3A 1RYSA 3SMZA 2MDAA 4QWDA 3AB2B 1LFPA 1UW4A 4KH1B 4CDIA 1UA0A 1GMWA 5KT2A 3GIIA 2E5LF 2IY5B 2RDJA 4LF4J 2GMJA 1REGX 1UAWA 1YWXA 3LP1A 3BREA 1NSAA 4HHUA 5B0AA 3SQOP 1HNXJ 3CJ2A 3TQ1A 4DQRA 1JLGA 1X4AA 1B0VA 4G1QB 5CD4A 2EKYA 4U7UK 3OFEA 1WC6A 1VHFA 3HM9A 2HVHA 1HMVA 2BOPA 4W92B 5KFSA 2COLA 2F5GA 1Q7LB 2D1CA 2ZBIA 2DNZA 2XG8A 3VTIA 2UUCF 4RBTA 5LXYA 1V3ZA 3NCRA 2N4CA 1QLNA 3LGNA 5KG0A 2VQFF 4QU6A 4OX8A 1VK8A 2RUGA 1KVIA 1AZSB 5FD1A 5HP1B 4ZVOB 2AJ4A 2M8DB 4IG0A 1K9MT 5IQQA 3LP0A 1JNZB 4GMKA 1IWGA 3HP6A 1N5QA 4DI6A 5FIIA 2K2PA 3JYTB 1DHMA 3DLBA 4YB5A 3D7SB 3FCWA 1SPBP 4FN5A 2KH9A 2YX1A 2K06A 3GCXP 3FC9A 5F8HA 4FF3A 2Z2LA 3N6LA 3L9ZA 1V6HA 4FBTA 2HZCA 1J2VA 1S97A 4HDGA 2ZE2B 3HHLB 1XR7A 3D0IE 4EO8A 3IXQA 1FRLA 4USJC 4XK8C 4F26A 4AQYF 3DLGA 3NWRA 2QYCA 1F5AA 4IRKA 1I3OB 1JKHA 3A8JA 2L08A 1HBNA 3LQVA 2IC3A 3UDCA 3H20A 3G6YA 3GG0A 2ALYB 4WP9A 2MKJA 2V2QA 4X65J 5KFOA 2W7PA 2HYIB 5DETA 4RUHA 1D3WA 1PBAA 1HHSA 2YNHA 5F8MA 2CQGA 3OVBA 2ASLA 1H38A 3J81Y 2HS0A 5GADU 3PW0A 1C1CA 2HHVA 3HHNB 1SV5A 3KDOA 3BQ0A 4XPEA 1EAYC 3DLKA 1H6KX 3R5JB 3PIPQ 4U8YA 3OL8A 3BR8A 4C0OC 1EP4B 4UUWA 4HT7A 1Q0NA 4LF5F 3BGRA 2HNDB 2VFRA 4HTIA 5H1SV 1S6OA 4NEYA 1QVFR 2H5EA 4EWTA 5IM0B 2VQEF 2HRYA 5A0YA 2W24A 2BDPA 4YUDA 5GAGU 4K4UA 4L76A 1HR0F 1J5OA 1S7IA 3T1YF 4NLXA 3CGIA 5KG4A 4OHZA 2VF3A 1NK9A 3GSDA 4L73A 2DO0A 4OV1A 2HFZA 2J7WA 4OJ3A 5T41A 5L1KA 2X51A 2E5LJ 2AT1B 3PR5B 5J1EB 4ZITA 3IFEA 2OJ3A 2FVQA 1M0SA 1SJ4P 1IKXB 3M30B 2E9RX 3ZNUA 1NDPA 1M90T 1ZYQA 1U0HB 4G1QA 3I4HX 2WAQD 3G87A 2VG5B 3IWLA 1IBCB 1BD6A 2V8DA 1FJGF 3QWPA 1LXJA 4ECYA 5D0GA 3DLEB 4PWUA 1Y00A 3MM9B 8RUCA 4ZP7A 3FKBA 4DPTA 2O1PA 1U2FA 3VWSA 3RW6A 3TUPA 2UUCJ 2EFOA 2PI4A 1UZDA 4HHHA 4DFMA 2LQJA 3MPYA 5E2QA 5J1PA 1Q8KA 2VQFJ 1HI0P 3R5GA 2R3VA 4LF9F 3NGUA 3T6BA 1TKXA 4ECXA 3PW7A 2F4FA 2GVDA 1IM4A 1SJ3P 4LF6F 3POTB 2CQCA 4Y2MA 1IM6A 2OEMA 1F3VA 3BQ1A 4MT1A 2O67A 2ZE2A 1LW2A 1U7LA 3QGIA 3AQOA 4U7CA 1P1TA 4LF2A 4IRDA 1L3VA 3UW1A 1BLUA 1DTQB 2DXEA 1TV6B 3UD3P 4ECWA 4CO2A 1LWFB 2NZ4A 1F60B 2RMLA 4A8FA 1HD1A 3EVMA 2BJEA 5HVHA 4BLGA 4AQYJ 4DL6A 4PABA 4MMOA 3PFOA 4P52A 2H65B 2W8KA 2P8IA 4NZ0A 2XMKA 5CCLA 3LP2B 4K5RA 1N36F 3FQLA 2L41A 4FF1A 2XMTA 1PILA 4IH6A 2VPXB 3H40A 5F3ZA 4PG7A 2OI2A 3AJDA 2PC6A 1UEUA 2W2PP 1QAIA 2F1FA 3NMAA 1RT2A 2QRRA 1EP4A 5THWA 3GMGA 1HQUA 3DRSB 3FSIA 1JLFA 5D4LA 3MM5B 2HNDA 3OVAA 4ZIVA 1X4DA 2HWHA 4Y65A 2JSXA 5I42B 5HSPA 1MWQA 1UWBB 2BE7D 3Q22A 3CVKA 4DV5F 3HT0A 4QR2A 5DG8A 1AB8A 3G8SA 5J1NA 4LVOP 4OHYA 2QMUB 4LF5J 2BQUA 3O5TB 4OZNA 3NBPB 4WKRA 2ACYA 5EX3A 3QT7A 1K0VA 4BCAA 5CYJA 4URQU 3DOLB 3BDPA 3V4IB 3F0NA 2H48B 4AUKA 5J1EA 3T1YJ 4PWWA 2HNZB 1IKXA 3M30A 4KY3A 4AXIA 4DZDA 3HCXA 4QW9A 4FF4A 4O3NA 1U0HA 4NASA 1I94F 2BQ3A 1KTVA 3PCOB 3FK4A 2VG5A 3BO4A 1UVNA 5EHHA 1DY3A 1KKHA 4KHRA 3IRWP 3EYZA 4C8YA 2R7RA 3DLEA 4F4WA 3EWGA 3NCPA 4ZIWA 1NO8A 2NXNA 3PKMA 3WX4A 4QYZK 5E3AA 3KK2B 4P10A 3G82B 3IBFB 1U1OA 4EO6A 2DNRA 1YZ6A 2KDOA 2VBZA 3V6KA 4A8KA 1QJHA 4XO0A 3I9ZA 4ZS6A 3QJLA 2WB4A 1SC4B 1VOMA 2GQCA 4D3GA 1JIHA 1BQMB 2M7SA 4OI6A 3GYNA 4M95A 3POTA 2C2MB 3UDVA 3D68A 2GFFA 4WTOB 5CD4H 1TKTA 3BSOA 5C2GA 3TA2A 3CD5A 4KC5A 2IRUA 5LSRA 1K8AT 1O6XA 2GVZA 1DTQA 5H9EJ 4LF6J 2P5VA 4KV8B 3QGHA 3PW2A 1TV6A 1GXLA 3Q86A 2OFHX 1FERA 1FRIA 2Z2ZA 2IJFA 2NZCA 1RHJB 4N56A 3RUBL 4EGLA 5KFFA 1CJUB 1X9SA 2ASJA 1SJ1A 3ZC4A 5DDRC 2YWKA 4LBHA 3Q2TC 3L95X 1RTZA 4RNHA 4DUYF 1VC0A 3SV4A 3I32A 5M2RA 2Y0BB 1X31C 4JYAF 2HAIA 4OYAA 1SC6A 2BOAA 3EDRB 2IDLA 4HR2A 4LRAA 5JVGQ 4OX9F 1UJ6A 2MQNA 2FTRA 2JEGA 5HANA 3CSKA 4F4KA 4W90B 1XMOF 2CIMA 2KVIA 3BSNA 2FHKA 4HVZA 4G6VB 4UZCA 1Q8LA 2XI3A 1N36J 1JNRB 1R31A 3A8EA 1UJ4A 4E8UA 4KBIA 5F8JA 4ZHRB 3DRSA 4FVCA 3MM5A 5B7WA 2BJ8A 3PRBA 5I42A 1X8DA 2MKYA 3QSIA 3KLIB 3RG6A 1D9DA 3CDUA 2B6AB 3I5CA 4URSA 1WACA 2XY7A 3BYRA 4C48A 4IO1A 4DV0F 2CKWA 4WP8A 3NBPA 1UVIA 4JV5F 4YY3F 1CJVA 3ZZRA 4B02A 4K50A 3DOLA 4DV5J 5ETQA 3V4IA 4I7FB 3CCQS 3OTEA 3BN4A 3K89A 2L9WA 3IC1A 2P6TA 3LGHA 4RKUC 3DRYA 5DDQC 2J9CA 4DF4A 3GZ7A 1QSSA 2H4WB 4ALZA 4DV3F 1JJCB 3IP0A 4N8NA 3NOGA 2E66A 3JSMA 1NUEA 3CXCR 2KZZA 1I94J 3CCMS 2LLZA 2ILYA 5E33A 1WC1A 4X66F 1N32J 1FX4A 4ZP6A 2W8LA 1FESA 3M05A 4DPOA 3KK2A 5C25A 3I55S 4FPIA 1CJTB 2LDYA 1F5BA 3TEHB 3GV5B 4OYBA 5ETOA 1X5PA 3MECB 5BYSA 4P7VA 2Y9HA 4TVAB 4BS2A 3CNQP 2HG4A 1BQMA 3ZFVA 2LXFA 1WG1A 3DOKB 5KFKA 4DL4A 1RWXB 4DLEA 4E0DA 2CQ3A 4QWCA 2QLWA 3PEHA 2PMHA 3AXKA 4OQJA 4IH7A 4H4OA 4RBUA 2AYMA 3DKDA 3EVWA 2VOPA 1YJTA 2IBKA 2UUTA 3P5BP 2RVJA 3CC7S 1N34F 1YBTA 1XC9A 1MNEA 1VYAA 2J8AA 2GIFA 3ZTOA 1A0OB 1U45A 2LEPA 3K5OA 2WW8A 1FKPB 4TKTA 3MFIA 2BW7A 4GRSA 3RB4A 2P9GA 2QJ3A 2H54B 4LRCA 5A6WA 2RRAA 3NNCA 4GC7A 1CJUA 3EM1A 2XZDB 1M1KT 2RF2B 3X1LB 1SC1B 1A9NB 1Z2LA 2V0NA 2A6MA 2WW4A 1NB7A 2LDIA 4ZVGA 3CCES 3M8PA 1X4EA 2MKIA 5B0DA 3KG4A 5IT9U 3SCKE 2AQ4A 1RTIB 2MYFA 1VQ9S 5DM7Q 5H9EK 1NJYA 5GAEU 2I8EA 5KFAA 4KO0B 5JVHQ 4DUYJ 2OD4A 1UZHA 4JYAJ 2DEIA 3WC0A 1KLNA 3A3PB 1FWKA 3WZ0A 3GP9A 3NGSA 4DG1A 3UNYA 4C0HA 2Q1LA 2AW0A 3CJ4A 3KKFA 1XMOJ 2O3DA 4Y2KA 5ETNA 3N4WA 2J8SA 1JLEB 2GV1A 1RAEB 2XY5A 3IG1B 2I5JB 2B6AA 3KJFB 1LKZA 3DN9A 3FRZA 2OHDA 2ZOGA 4ID5B 5KFHA 4DQQA 4RW8B 3O8WA 4J5OA 4LSLB 4RUBA 5CZVA 1RISA 2WVDA 1WSVA 3IR7B 2AD9A 2MZSA 2V5HG 1RWNB 1S6UA 3J80U 2XBPA 3MMCB 3CCRS 4JI7J 1G6BA 3I96A 2YWHA 4U96A 4I7FA 2GQQA 3PACA 4P2MA 4USVA 2ZH1A 4ILLA 1A6LA 4LFCF 2JFDA 4DV0J 4GVLA 1DRZA 3ZTQA 1N4LA 2XGPA 3ADAC 2V50A 4ZDNA 4JV5J 4YY3J 3KHGA 3CULA 4IH5A 3AOBA 1X5SA 1RAJA 2BEFA 1OPZA 3E51A 2V69A 1SKSA 1Q7YT 3R2CJ 3RBDA 2B4VA 2VBXA 3CT9A 4HHJA 5EGYA 2NUUG 1F9EB 1FFWB 2XQCA 4NCBA 5L1LA 1H7XA 1S1UB 4YB6A 3LF0A 2X1FA 4DV3J 4F3OA 1WHVA 2MB0B 1S9EA 2VH7A 3QATA 2PT0A 3RU0A 3FQKA 4QPXA 1CJTA 3UN5A 2AGPA 2YKMA 2YWEA 1FI4A 3MECA 3HHDA 4WXOA 2ZBQA 3NRBA 3DOMB 4WFBQ 2KN4A 3PYDA 4X66J 2GIRA 2HQIA 3ETOA 4M5IA 3HD2A 2PGCA 4DJBA 1DURA 4IKAA 2EXUA 1FD2A 5KTQA 2P9EA 3U1NA 4USUA 4NLGA 2Q3PA 1WI8A 4B3OA 1O5JA 2V8HA 1EETA 3BBFA 3KJQB 1BE4A 3MGJA 4QR1A 2KJWA 1V3RA 1HQ2A 5RUBA 3T6JA 1G3OA 3HVRA 2OGUA 1I1GA 4ZOSA 1YRXA 2RSQA 1Q5VA 1HNVA 3KLFB 3HKWA 3OPKA 3HFKA 1FKPA 1REVA 2HZAA 3X3UA 1P27B 1PC4A 2QX0A 2HEKA 1NHUA 3GV8B 2DO4A 4IDKB 2RF2A 1VQPS 4PG4A 1ELOA 3MAAA 1BQXA 2J0WA 4AYBD 3PJ9A 1BQNA 1YZ7A 5DLGA 4ZN3A 3J7Z5 2CJBA 4H54A 1X0FA 1GTHA 1NK4A 4CYUB 4OI4A 1GX5A 3T5KA 3R6LB 1HARA 1VBXA 1XTZA 3QIPB 4ZA1A 1VHIA 2CJAA 2XY6A 1H74A 4URGA 2HRUA 1XIQA 2CNKB 2C2KB 3GTYX 3W60A 1EX8A 2D3ZA 4NLTA 2CG8A 1IVZA 3BSAA 3IG1A 2FYXA 4JI8F 1N0UA 1N88A 4ID5A 2DYAA 3HHKA 4QOTA 3IRXB 5K8NA 4DS4A 1Q5YA 4F50A 1PAUB 4TQSA 2IJRA 1U6BA 2DGQA 2LEAA 4LF7F 4YOEA 4RW7B 2X3GA 4ELTA 2YKPA 5B09A 2FLNA 1HBOA 3QT6A 2VICA 2R8GA 2CFXA 4WIIA 3VZHA 5LL6d 3KFWX 5GADI 1WC5A 3K59A 3OSNA 3SFUA 2Y1IA 1P6TA 1VQNS 3R5CA 2YNFB 3W1YC 3K58A 3W2VA 2OTLS 2RT3A 2EWHA 1GNKA 4PXCA 5KG5A 4UQTA 4GKJF 4LFCJ 2ZDOA 2WHOA 1B0TA 3AD8C 2YNGB 3AY0A 2WRMA 4CCHA 3HVAA 4EUVA 1S1UA 1T7PA 1CULB 2UV8A 3KG1A 2NUHA 3MPDA 2IRXA 3OTCA 1NBEB 1S9GB 5L9NA 1OYEA 4DSLA 1E6VA 2R4FA 2HKEA 1ULRA 4ZLLA 3OL7A 4RWWA 1ZM9A 1IKYA 1MU2A 1F2GA 1WOSA 4LUBA 3OTOJ 3L09A 2NLWA 3MWBA 5IC6B 2XS7A 2UV8G 3M7VA 4A8OA 3MHYA 1C4CA 3KXDA 1IKWA 3CD0A 3KG0A 4NLYA 4LF8F 4RUAA 1V5IB 3TANA 2WCXA 2N4DA 3S7RA 3RR8A 4ELUA 5J2NA 2DR9A 3TW0A 1VRUB 3NS7B 4OX6A 3IM9A 4IRCA 4K4SA 4Q44A 3D1QA 3KLFA 2XSFA 1ZTWA 4DL2A 3W9JA 4QU7A 1NXIA 4IDKA 3HXMA 3KHRA 3SBMA 1H0HB 1DTTA 3KUGA 3QZ7A 2BQRA 2GGPB 3D2WA 4U9RA 1OMSA 1UEVA 2CDRB 2B4OA 2J9DA 5FDLB 5AE1A 3T1HF 2ZH4A 4J9RA 4CYUA 3M9NB 3DGVA 2XCAA 4OZ1A 1RHRB 3QIPA 3MMAB 4YFUA 3ZTPA 3NS5A 2HFNA 3EXYA 3PG9A 1C0TB 5A8RB 2QGFB 2C3PA 3IN5A 4PQUA 1JLAA 3W5YA 1AXQA 2C2DA 2VD3A 2R7WA 4B3TF 4B9SA 4Z7YA 3HHLC 2DNLA 4O23A 3JQJA 1U48A 1RTJB 3G6VA 4N41A 2R9LA 5KG6A 4JUZA 3FBEA 2M2BA 3RRGA 4EMDA 1ZPWX 4C0BA 2RS2A 4NE9C 1LFWA 5KFUA 2WBRA 2D74B 3DDNA 2DNOA 1FO1A 3GIMA 3CCVS 1N5VA 2GJIA 5BR8F 2VG6A 5IFMA 2XHWA 2HFSA 1B7FA 2V34A 2D41A 5E5NA 3Q8UA 1AFJA 3MUTP 1U47A 4LF7J 3JSYA 2FGOA 3ZZUA 3BPDA 3QPIA 4MYTA 2D69A 2QZ8A 4WU2A 1WKLA 1KN6A 4ZJQA 2CWKA 4M5KA 2M88A 4WFYA 3O1LA 2J0SD 3PHTA 2A0FB 4X4VA 4PYAA 3VAKA 1SJRA 5F8NA 4IQMA 2UVVA 2CQ2A 5BJRA 1RAHB 4ZVUB 3PY8A 4UUXA 3CJRA 2UXDF 1HLWA 3H8YA 1S9GA 4QIEA 5F8IA 4GKJJ 4L72B 1TUVA 3THPA 1C1BA 5IXUA 3EUNA 1CS4B 1HNIB 1NAQA 4OJ1A 2O5DA 3CJ5A 1PKUA 1S1VA 4CH1A 1Z4UA 3FEYB 4X2BA 5L46A 1SCJB 2OSQA 4ES3A 4O4GB 2WOMB 5SZTA 3VGSA 4TU7A 2RQ4A 3GSIA 4OX7A 3QRQA 3CC4S 5D15A 1HL6A 3A3NB 4L75A 3HVTB 2P2CB 1RT6B 1LW0A 2ZBRA 2DNHA 5A8WB 2C2OB 2E5JA 7FDRA 3H98A 1RT4A 3VHQA 2B8QA 4N47A 3T5JA 3RW7A 4LREA 3E3XA 3WDOA 1JQGA 2DKOB 3CF5Q 3RB6A 2G2ZA 4P9SA 4PG5A 1TELA 2RQKA 2R8IA 1KFDA 1OWXA 4NA2A 3UFCX 3PX4A 4ED1A 2XWXA 3M9MB 1GAOA 1G7CB 2C3UA 4NRTA 1CC7A 4RW6B 4HYKA 3UDLA 4DN9A 3VAIA 3C6UB 3A8KA 2SXLA 1B99A 3IMQJ 3M2RB 3GB0A 5A8RA 2W1BA 3N6MA 1KOHA 3MZIA 5LJ3Y 1WTFA 3CJQA 4DL3A 3FBCA 2N7YA 3EVOA 2LA4A 3A4TA 3GJTB 3H2UB 5B0GA 1LWCB 4HH0A 2ZJRQ 3VALA 2RDIA 3VGUA 3LALA 4B9LA 3MURP 4F7VA 4C8ZA 4B3TJ 5LSLA 3ZZOA 2D9OA 2ILZA 2IVFB 5DRKA 4F0HA 1OPIA 3D9BA 1VJQA 2ZOFA 3DLHA 3R27A 4XIUA 5E3QA 3IO1A 3AFGA 4ECSA 3OTDA 2R7VA 4FP9A 1B4SA 4M5DB 3R2DJ 3TVYA 1R27B 1HBMB 3UR3C 2XEXA 2RJZA 3LPEA 5BR8J 1OY6A 1RWPB 4RW9B 4U67Q 2IFXA 1U0SA 1EARA 4RW4B 3W3SA 2MZ1A 3CCZA 3OR1A 1U09A 4MFBB 4HL9A 2ZZMA 1NCLA 1TUGB 2E7WA 3NAIA 1HWIA 1KQFB 4D3HA 1RT5B 1H2UX 3R7NB 4ZPCA 3I4PA 2QL5B 1CS4A 1HNIA 1TL7B 4DOZA 3VR1A 4OYXA 4B3SF 3KJVA 4FVMA 5EX0A 2K1RB 4F2RA 2IM1A 1TUWA 2WOMA 2KYXA 2E9ZA 2CZ4A 1MWYA 3HI9A 3QT8A 3M6XA 1M1HA 5ETKA 5HMXA 4K4XA 3IM8A 2FJWA 1RAOA 1I5OB 2P6SA 1EHWA 2EFQA 1RT6A 1UPMB 5KFRA 1ROFA 1WHXA 1CPZA 5A8WA 3CW2C 2IM0A 2Y1LB 3BEGB 4CLUA 4AXJA 3F44A 1RLCL 1FXRA 4FPRA 3CMQA 3M6WA 4C4WA 4IUFA 3E8OA 2DCLA 3QWUA 3TA1A 4OJHA 2QN6B 1CG2A 4DPUA 3ELHA 4H4MA 2DEJA 2O01C 3HLUA 2N3OA 3HK2A 2KG0A 2LMIA 3LPYA 4FKXA 2F4VF 2MKCA 1WJ9A 4DXLA 2AEMA 1RU2A 2FVCA 3VVTA 4N77A 1Q82T 3GIRA 2DTJA 5KOXA 2QA4G 4RW6A 1SIWB 4EFAC 1NLKL 1VQ8S 3QBCA 2WSFC 3AT1B 4IR9A 3D1OA 3C6UA 2DHSA 4DR4F 3TEGA 3MAQA 2CZVC 3PZPA 2WVCA 2GA7A 1JLQB 2EK1A 3K5NA 3TJ8A 2YWGA 3HFZB 2IHR1 1BWVA 2JX2A 2DIUA 3GFHA 1FKOB 2WTFA 2QA2A 1YSJA 4NA3A 4F4YA 3DC2A 3VAJA 3IBCB 4RX6A 1GT8A 3OHAA 1FHTA 4TY8B 2LQBA 1LWCA 2MHNA 2DIVA 2VPWB 2C22A 1FK9A 4M8LA 2V94A 4DZ6A 2LVWA 1QUPA 4DUZF 3OFHA 4KGMA 2OSRA 4WBFA 1WNEA 1T03A 4Y3CA 5A8KA 4YDDB 1KQKA 2VPZB 1F9HA 4C11B 4OYOA 1KQSR 4ECQA 4ZVFA 2IMWP 1F1BB 4NCGB 2HS3A 2BM1A 2ZKTA 5DG7A 3LAKA 5EN1A 2QTWA 2DISA 1FFGB 1TFYA 4ZPTR 1FXDA 4I67A 5GAEI 3MR5A 2XO6A 1YGYA 1VQOS 3L7OA 4X64F 7AT1B 3OHBA 4U7UD 1HWLA 1VS3A 2KM8B 5J2PB 3EX7B 3NGDA 2VUGA 3TX0A 1WOPA 4HT5A 3CPWR 3ET6B 4FYDA 2GJFA 4RW4A 5F0UA 3IS9B 5D8HB 4MFBA 4B9VA 1FDNA 1T9XA 3VAMA 2HPUA 3F73A 3HZEA 3CE8A 3DGPA 5MAOA 1RYRA 1RLDA 5B0BA 4X4TA 3CIMA 2G0CA 2UVWA 1UPPA 1Z1ZA 2PN6A 3V81B 1RBAA 5C24B 1RSCA 3LWMA 3AXMA 1UMJA 3NWGA 2HFUA 1JLCB 5B0FA 2W2MP 4YR0A 4WTYA 8AT1B 4F3MA 1VIXA 3G71S 4X4UA 3H5YA 3GIJA 5HROB 2NR0A 1N54B 2JFKA 3MCOA 4KAIA 2E5IA 1HA1A 3OJSA 4FS2A 5T7LB 4PG8A 3PRVA 1IR2A 4F4ZA 2BJDA 2FJXA 4J9UE 2B43A 2NXJA 4Q0BB 2G2YA 3LW5C 1WHWA 5GAHI 4MK9A 5CYQB 3KLEB 2EW9A 2J9DE 5CYMA 4ECUA 1ZM3A 4HTJA 4DWIA 2Z4PA 5C7PA 2POKA 5L8RC 2VFUA 2XS5A 2EEYA 4MK7A 4LQ3A 3P96A 2WSEC 2DJWA 1LWEA 2MSSA 2MY7A 4B08A 3PYFA 2VJVA 2J0QD 5K8OA 3QQCD 1PO6A 4PEOA 3MPVA 1OQ3A 1KVKA 2NSCA 1S57A 4J9PA 4CT8A 2F4VJ 4LF1A 1DLOB 3CIZA 3DFEA 3NMRA 2CJQA 2B5JB 3Q8PB 1UL3A 3KDNA 1HPZA 4H4KC 4F2SA 3T19A 2RKIA 4UOFA 2HBZB 1ITPA 3W66A 1RWKB 1SKWA 3CJKA 2AGOA 3Q89A 4KHPF 3W9HA 4LSNB 2G2OA 1AYEA 4K8RA 4F3QA 4DQPA 1UA1A 1Q81T 1S9FA 4FS1A 3NLCA 5AXKA 2PEHA 2ZUGA 1KP6A 3KOAA 2DR8A 1UTAA 1SQGA 4NLSA 4F0MA 4R8UB 1ZH5A 4KQZA 1N8RT 2ZH9A 3JAMU 3FDSA 4NCGA 4P2SA 3OW2R 3BKTA 1O8BA 2MLZA 4QPTA 1K1SA 3DHXA 1TMJA 2F8MA 3LP1B 5LM7E 5G4DA 3CCUS 1HBUA 1PBUA 2IPOB 1VJWA 4DR3F 3P45B 2NXUA 5J2PA 4O3PA 4XPCA 4WJBA 1P8GA 5KT7A 5AT1B 1DQ8A 3J81j 2FVRA 3ET6A 2BJ1A 5LMUF 3QFHA 3GV7B 2XS2A 1JLGB 4J9NA 1T9VA 1CC8A 2NREA 4NLVA 2HFVA 4X64J 3CUNA 2WONB 2B3TB 2G9OA 5HK4A 3ONQA 4ZPVR 5ETVA 1HMVB 1QE1B 3JQMA 1JJHA 3N0VA 3TI0A 3V81A 4EEYA 2B8PA 5C24A 1KRPA 1WC4A 1R6YA 3QZ8A 3K8WA 3L7PA 4OZ0A 1JLCA 2AX0A 3LO3A 4PXDA 1R43A 5SUHA 2JL9A 1Q95G 2QA4S 4IG0B 5I3PA 3R5AA 5HROA 3W9IA 5U47A 4KE5A 4O3SA 1NM2A 2CPZA 5HLFB 3MTKA 4B9MA 5T7LA 4I6WA 3GE9A 2OMLA 1NK5A 1ZBTA 5I3UB 1S12A 3G86A 5D4NA 3Q23A 2DB1A 3AJ2A 3KUEA 2MPUA 4Q0BA 2LQ8A 4GVBB 4ECZA 2R8HA 4GC6A 3LH2S 4JI3F 5CYQA 3KLEA 4TXSA 1N52B 5K9FA 2DBBA 3C14A 3QJJA 2VB6A 3L3CA 1IXKA 2F63A 4RZRA 2HBQB 4HEA9 1LOUA 2LEBA 3DLGB 5FLXU 4DV1J 4O44B 2JRSA 1S10A 3IA0A 3WIUA 1JKHB 1RTHB 2E5GA 2AYGA 1HHQA 3U02A 2Z8QA 4B9NA 2H3EB 4WFZA 2GO8A 3GIKA 2IC3B 1R8AA 3BN7A 3OXFA 2B4PA 3R7BB 4Y6IA 3THVA 4ZJOA 4AFFA 2B4UA 1HFEL 2F3JA 3G6XA 1W25A 4ZVRB 2R7OA 1DLOA 5GMKa 4EZ6A 1RUSA 3TZZA 2B5JA 2YNHB 1R3NA 1UFLA 2PMWA 2QC3A 3TVZA 4WFAQ 3CDWA 2FZGB 4OMFG 3IR6B 3N79A 1BY9A 2XC9A 1S6QB 1C1CB 4RPFA 5CABA 2OAUA 2R7XA 2WVBA 2CA9A 3PYEA 3RRHA 1J5EF 2OPSB 2IM3A 2LU1A 2CNNB 4XDCA 3VVUA 2HAFA 1QUVA 2GIQA 4BHQA 2DR7A 2WBMA 4KHPJ 2CQ0A 4J9KA 4R8UA 1TL3B 5A0YB 1VBKA 1LEOA 4CRJA 1J5OB 3HD1A 2ZFHA 4NPOA 4Q2LA 1FDDA 1T05A 4ELVA 1S6PA 2VDHA 1CLFA 1MN7A 4YP3A 1KD1T 2IAJA 2MEWA 2XHCA 4DX7A 5DZ7A 3R7SB 1IKVB 1V3SA 4V19X 2K8GA 3UD4P 1UVMA 1D8ZA 2UXCF 3FVYA 2E44A 2XYHB 1X4FA 1YJWS 3M8RA 2VFSA 2WONA 4DR3J 5HMYA 5EDWA 3VGVA 2WVEA 3MEEB 4PYDA 1FWLA 4DU8A 1KSPA 4DCPB 2BMBA 4DU7A 4QIFA 1QE1A 4TNOA 3DLJA 5LMUJ 3M9OB 3VAHA 3VGTA 4HH1A 3KNAA 3SYZA 4NCAA 1VBYA 3MR7A 3H2LA 2V4JB 4K4WA 5C42A 2G1DA 2J6UA 2W25A 2WSCC 2W9CA 4DSIA 1IBLF 3C16B 2UUBF 1D9FA 3KWMA 3BGFA 3MR2A 1S49A 5HLFA 2QO3A 2W2QP 1K0TA 2DH7A 2W01A 4V19J 5DGBA 1YBUA 2BYCA 4R25A 5I3UA 1ZA1B 5HO4A 1TKXB 1WC3A 2NXCA 2GVDB 3U27A 2YWFA 5LSOA 4GVBA 1K44A 4RUCA 1YI2S 4DR2F 5A76A 3UE2A 2V2KA 1ZZNA 1EKSA 3ZTRA 1LW2B 2AYEA 1RTDB 2WVFA 1GFWB 4O44A 4EBCA 3T41A 2B9XA 2F65A 3DDKA 4LSZB 1C0UA 4JI3J 4ZCLA 1RTHA 5KFPA 3I82A 3W5ZA 1X9MA 4G65A 3ISND 1PIEA 4WFXA 4WU3A 4NL5A 4Y34A 2K3KA 4BC7A 5L1IA 4NLQA 1NSKL 3SEOA 4A46A 2CPDA 2XNRA 2HHQA 1RT7A 5DQGA 2AJFE 1WHYA 1M5SA 3H4DA 2GW8A 1LWXA 2MGZA 4OI2A 4R0JA 1FTCA 1TMMA 1PYTA 4P74A 2RRBA 1B3TA 1DFDA 3A12A 3M6UA 1S6QA 4KIAA 4WE1B 1T11A 4ATNA 2W2NP 1VRTA 1P9QC 4FDFA 4MH8A 5B0EA 2OPSA 3JTOA 1ZAVA 5K8MA 3ZZZA 2VBYA 1R8PA 1U26A 2CG4A 3CO0P 2H4YB 1RT2B 4UZBA 4JP8A 1HQUB 3HZGA 3HJVA 2IBOA 1JLFB 1FJ7A 2V4RA 2QMWA 1J5EJ 2NYIA 1BWEA 3CJ3A 2LA6A 1TL3A 1IR0A 2CPHA 2CQ1A 4ZVPB 3QT5A 3P49B 2JVRA 2M3DA 2ZDPA 1W2BR 2FVSA 3EPIA 4QBUA 2W4CA 4QIWD 2MSTA 1N33F 5DZ6A 1FXLA 1WF0A 1WG4A 1NJZA 4ZPDA 3FBBA 5KFEA 4C3KA 1Y11A 3HHEA 4O3QA 1DQAA 1DAXA 1T9TA 2HQCA 3KMSA 4G1PA 1RHKB 3RBXA 1IKVA 3QYYA 1YBAA 4QYZJ 2APOA 4DCOB 4WXWA 4RLEA 3U1LA 3H5UA 1U25A 2B7BB 3OL9A 2K7JA 4NWBA 4FBUA 3MEEA 3LA0A 3EZ5A 1TFWA 4NLDA 4ZPBA 3JSRA 1WTBA 3DMJB 1U24A 3P4UB 2HBRB 2CZ9A 4LIRA 2JC1A 4I2PA 2UXCJ 4DMZA 9ATCB 1WEXA 2DGUA 1GEHA 3ILOA 4WIQA 2V4JA 2ZJQQ 3R6GB 2FD2A 2KYZA 3QAEA 4I6YA 3MM8A 1T9YA 2FHOB 3C16A 1WD6A 2QG9B 1L3SA 4ITSA 1FEHA 2QSFA 1WKKA 2E7XA 2W9BB 2QFIA 1UW9A 1ACMB 1NHVA 3MCNA 5ETLA 4TLQA 1AUSL 1IBLJ 2UUBJ 3FUYA 2D3OR 3LAMA 5IC4B 1VFJA 1PJ5A 3TUIC 3TVKA 1NZ8A 2CJKA 2BKPA 5CCMA 2MMYA 4K59A 1TKTB 1VDHA 5HMWA 1RTDA 2BKNA 1S76D 1EIYB 2GVZB 3MCSA 2HQFA 2NPIA 4DV7F 4DR2J 1HIYA 1QDUB 3BH7B 3NGKA 5J2QA 3UI3A 4F4AA 2DPJA 4NLWA 4ZLPA 1NPKA 5KFBA 1IBMF 1QSLA 2QE5A 3NNAA 4M5NA 2KHCA 2LCWA 1HWUA 3MEGA 2ZH5A 3BSCA 4IO9Q 3EICA 3TZYA 1WUUA 5C2CA 1H2VZ 4U95A 4WE1A 1ZPVA 2ZZNA 2C42A 1XWLA 1T94A 4XDDA 4C6AA 1RACB 3JQKA 1XMQF 3UPFA 4FYVB 3WIVA 2MLYA 3RBZA 4J37A 1P9YA 4DCJB 1FNMA 1OY8A 2OFGX 2EPIA 1XN9A 5HATA 2M8HA 3CCWA 3RB0A 2DK2A 4LBPA 3KLHB 2LYVA 3V6HA 2QL9B 1VGYA 5KT3A 2VASA 3T5LA 4ED6A 5AE3A 3P3DA 5F41A 2RD5C 3D5MA 1CQMA 4DN0A 1RBLA 1OIAA 1CJVB 2JNJA 2ZITA 2FJDB 1AUDA 5I4MA 3K5LA 2N82B 3Q8RB 2JLFA 1VBZA 1N33J 2HHPA 1ZTTA 4OZLA 2GX8A 1F3FA 4QYRA 4ED3A 2PDAA 3KLVA 1PCAA 1X4GA 4ZVEA 5ITHA 4J9VA 1N32F 3JSMB 3OQ2A 3DMJA 3HT3A 2GMHA 1RI7A 4NRUA 4KSEB 1KHVA 5ETSA 4KGZB 1JJ2R 5IWAJ 1UKUA 1WORA 4TYAA 2HK2A 2OPRB 1R8HA 1AFIA 3DRRB 2C3YA 4AL5A 4Q2MA 1RABB 5C25B 4EU0A 3IWNC 2X1GA 3G8TA 1S1XB 4K4VA 4CNYA 4KJIA 2W9BA 5EUHA 4RNOA 4PWDA 4FZVA 3DRPB 1IJFB 3BO3A 3WC2A 3TX8A 4J7CA 2BUNA 4ED0A 1R0AA 4DSJA 2FY8A 3GFXA 1RKJA 3FCVA 4H4OB 3W8GA 5A2QU 2FVPA 2KTQA 1MLAA 1VK3A 4M5MA 2ZH6A 3Q8QB 4RL1A 4C8OA 5GMEA 5D0RA 2H5IB 3CCJS 4A48A 1VCTA 2PFFB 2DNKA 3C15A 1YRTA 2B9EA 4RO0A 1BUXA 1OQ6A 1GXUA 4U8VA 4OZ2A 1S99A 4K0KF 3W5XA 3ENAA 1XNRJ 2JDJA 1SIZA 4NYZA 4DV7J 2IVMA 3HHLD 2I38A 1QD1A 3DXBA 3KMQA 1JJ4A 4N7TA 3W8PA 4Y2AA 3M8PB 2MKSA 3QO9A 3CDEA 2MZJA 4DQSA 4FYXB 1S7HA 5KG1A 1IBMJ 3OSPA 2FJBB 4LRBA 2QSWA 2CPEA 2QL7B 2BANA 1RKIA 3GILA 4MTPA 4DV6J 1U1MA 5KT6A 2HHUA 4HACA 4QWBA 2HIQA 4A8QA 3C3LA 2DPIA 4DG1B 2OUGA 2CPYA 1URRA 2BJ9A 3FCHA 4LVNP 1NDKA 1TK0A 1AT1B 1XMQJ 2R7TA 3KLHA 1YJVA 2RHQB 3IBWA 3H2VE 4JI7F 4B3RF 2KFNA 1FA0A 3P8BB 3K8VA 3CJTA 2V9WA 1IN0A 2VG7A 3IR5B 1RAAB 3SXLA 2AV5A 2QFJA 1GMVA 2ZVIA 2V8VA 1XK8A 3OXGA 3HX9A 3TR5A 1EZZB 3CEDA 5LXRA 1D8YA 2NS1B 2VBWA 2DHGA 3HVWA 1CEZA 1VQ7S 1S1WA 2CDQA 2OPQA 2J76E 4WFNQ 1WEZA 4B9TA 1FX2A 3U1MA 2YH1A 1U1KA 1VMBA 2WZ1A 1RZMA 3PO5A 1S0MA 2IM2A 2G1HA 2HMIA 2CNOB 4K4ZA 5MLCV 2AEFA 5KFVA 4C3MA 5D78A 2FLLA 3UWTA 2ZOMA 2OH2A 3OLAA 1MMDA 4PR6A 3UVJB 5HQLA 1UVLA 5CQGA 2VIHA 3I56S 1R0BG 2OPRA 4NYOA 1D1UA 4O3RA 3DRRA 1CQNA 4CLSA 2XI2A 1S9EB 3AOCA 3TP2A 2HQDA 2YKMB 1N6QA 2CJ9A 2ZH8A 3D3CJ 1S1XA 2LECA 2U1AA 1RT1B 1RCOB 4LFAJ 3DRPA 2VKRA 4I1TA 1WSRA 2KU7A 4F36A 2RRNA 4CO0A 3MMJA 3NAHA 3ILIA 4B3OB 3NS6A 1EETB 4TLRA 5CXTA 3K57A 2XMJA 1TVRA 1U1NA 1HWKA 1FVSA 2GHWA 3NY0A 1HW9A 3LWLA 3TAQA 2ZM6J 1WI6A 3H4BA 4ECTA 5D3GB 1HNVB 3KJNB 3I5AA 4MYUA 1NKEA 1REVB 4RBVA 3R97A 2YTCA 3BO2A 2PO4A 3FZBA 4C2MA 4QCLA 2R2TA 2W4DA 1FE4A 4R5PB 3E2EA 2NYHA 3TWZA 3MAAB 2LKZA 1BQNB 4OZ5A 2DRDA 4ZLNA 2HGLA 1TL5A 4F04B 3U7JA 4K0KJ 1NDCA 2OEKA 3RRKA 3R1HA 1M5KC 3N5FA 3UN2A 2GZOA 1RADB 3MEDA 1GH8A 4Q7AA 2ZH3A 3EGVA 1VI7A 5IS2A 3RAMA 4ZVSB 4CH7A 4OHXA 1KVJA 2Y8YA 2H9ZA 3MEKA 4RNFA 3DXSX 1NSPA 3LUYA 1DZ5A 1HYSB 2AIRB 1YJNS 4DFPA 2CQHA 1X5TA 5HBMB 1NEEA 4ZPWR 3GYXB 1WDDA 4USWA 3OUYB 4IFVB 2N7CA 3SSRA 2PA3A 2PFDA 1TKDA 4CLWA 3CC2S 3J7AN 4FYWB 4ETXA 2VPYB 4CI0B 3MPUB 3SSQA 2KL8A 4HLBA 1U8WA 4KFBA 1HBOB 1N5SA 2M5YA 4Z7CA 4B3RJ 2EI5A 4ZKAA 4DFKA 2RIJA 1UWAA 3N01A 2J5AA 2RHSB 1XEZA 2VU5A 2ABYA 4USHA 3QRPA 5FLXY 1JK9B 4DS5A 4CQ1A 4ED7A 4DX6A 3W2VB 2XNQA 4A8MP 2XLJA 4O0IA 3B82A 1VQKS 3C19A 1I51B 1FRMA 2CQIA 1H98A 3Q8YA 1MG7A 4Y2CA 3EGWB 5E41A 2ZWPA 5KFYA 3UVJA 1U1RA 3OTOF 3KYLA 4RJVA 4USKA 2ZHBA 1SUQA 1E6VB 1RAIB 1UVKA 2X3DA 4DUTA 2YKOA 4NLUA 2FQQB 3SIPB 1IKYB 1MU2B 2Q79A 1M5OC 1RT1A 3DM2B 4GKKF 3I0SA 3US5A 4N76A 1NJIT 2HSEB 2KT2A 4Z37A 5T14A 2BBEA 2MZRA 1Q86T 1Y3JA 5F3TA 1IKWB 3D0GE 4Q5VA 3FRYA 1FRKA 5J2NB 2HGNA 2D3UA 1SBRA 3ULHA 3TJ9A 4WP3A 3SZ2A 5D3GA 3RJMB 4JI6J 2ERRA 4WK3A 1E6YB 4OI0A 2HBYB 3QFWA 2JWNA 3PRDA 4CLPA 4S0MA 1F6TA 1U4BA 3D6MB 4DL5A 3N9UC 4R5PA 3CCSS 1KR4A 2K3IA 1DTTB 4LBIA 5GMDA 1Y3KA 4GO5X 2IRYA 1UVJA 1TAUA 2I1RA 2FC8A 1GX6A 3NCQA 2OO4A 4LFBF 4QZVB 1G2EA 5AXNA 2QLJB 3OT9A 2ROEA 4U6PA 2DY9A 2YNIA 4X62F 4F0KA 4WZMA 2E7VA 2EC0A 1RWMB 2HLUA 3KNGA 4PQUB 3TO8A 1JLAB 1URNA 1VQYA 4M1KA 2GHVC 1BMQB 2KRBA 4DX8H 3ZTSA 1X0PA 4ANDA 1H3DA 4DBQA 3DYAB 1HYSA 4WZQA 3FBFA 5HBMA 1K1QA 1LK7A 2PMZD 3OUYA 4IFVA 4PG6A 4RR5A 3RZAA 1Q4RA 4UY8T 3R5BA 3PJXA 1YK9A 2AP6A 1NHKL 3EZOA 2LP4A 2DY1A 4M5LA 1FRHA 2V4QA 4CM2A 3WQPA 1FTRA 1T02A 4AL6A 3M6VA 5DDOC 2VODA 3V5RA 2VG6B 4WK1A 4PXBA 3JB9k 4QWAA 1FEEA 2FZKB 2V2VA 1Y0HA 4CLLA 3K7RA 2HIYA 2V8PA 1VC6A 5LOQA 4NZ6A 2AEJA 1Y5LB 4Y2IA 3B78A 1KHWA 1FJCA 4OZJA 2IYGA 3F41A 4Y0FA 5EWFA 1CSJA 3HKZD 4NXMF 2KXNB 4N5SA 1XNQF 3JXOA 1AZSA 4KTQA 2MZQA 5HP1A 2XTJP 1YHQS 4FKYA 5GAGI 1YLXA 2C2ZB 4MIAA 3GONA 4A8XA 3R3TA 4UT4A 5LMNF 2QLXA 3B54A 1W26A 3AHPA 4UOGA 1C1BB 5IOLA 3JYTA 4RNMA 2DRAA 3CD6S 1S79A 5KT5A 2A2DA 1M5VC 3DM2A 2JHEA 3AODA 1S1VB 3EMTA 3ENQA 2MZTA 2K7KA 3BS9A 3PIOQ 4Q8EA 2ASYA 3AOAA 1KWMA 3HPOA 3A3OB 3HHLA 1BHNA 3WHIA 1LW0B 5K14B 4CNZA 4GKKJ 3IWXA 2A10A 3ZNJ1 2ADBA 4DHVA 4OYWA 1B64A 3BYPA 3VV2B 1RT4B 3BPSP 5L38A 3QAUA 4AE5A 1NNDA 1ZA2B 3SSSA 2XMAA 3OD2A 2CPXA 1HHTP 2KB2A 1RU1A 2ZBPA 1E6YA 1NK8A 5E7OB 2HHHF 5K20B 2QV6A 4I4BA 4ZCIA 4X4RA 4K7QA 2JEJA 4LRFA 2F9JA 5CA5A 2FJVA 4Y00A 4P2XA 1KEKA 4E2FB 1Q79A 2BABA 3B4MA 1YDLA 4ANCA 1D9AA 3OBIA 3M4XA 1U6ZA 1YIJS 5ETTA 3G6ES 3D0HE 3VCDA 2ZKUA 4QW8A 3Q0AA 2HZVA 1ZETA 1RAGB 3MM7B 4BWMA 1OY9A 3FEXB 4EYHB 3D54A 2H51B 2YVSA 2GC8A 2ATCB 4LFBJ 5J2MB 3V6DB 2UZAA 2AMCB 1NRKA 2F7VA 4KGVB 5KFLA 2MKHA 3ILJA 3MR6A 1QAJA 4DR7F 4C8MA 3PV8A 2V63A 4X62J 1S4EA 3DYAA 1RHUB 3IAS9 5IM0A 4BWJA 3UCGA 1FNXH 2JH3A 3C46A 4EI2A 1QVGR 2A6OA 2FPHX 2PE8A 3FNNA 3W65A 4L74A 4FNIA 1WC0A 3MTJA 1Q53A 1Q1KA 3D6HB 5JXSA 2VQEJ 3AA9A 3B6BA 2ROPA 1RAFB 1HR0J 4DL0C 4CWBA 2VC0A 4L3KA 4CLFA 4PUOB 3Q8VA 1EJ7L 3TRGA 4MKVA 3PYGA 3TOQA 5F0WA 2D3O1 1HD0A 2JLGA 2I2YA 3JSBA 4C7QA 5G0RB 2OEJA 3SI8A 1B0PA 1BXNA 2DGSA 5HN0A 2M70A 2HURA 1NJWA 5F9NA 1KDNA 2OPPB 2JVOA 3OR1B 3MM9A 1VC5A 5KFZA 2ZNYA 2E1MC 1HW8A 1FJGJ 2RILA 2G13A 2XZTB 2GAGC 3M32B 4NXMJ 2DCUB 3NEKA 2E1AA 1XNQJ 4P75A 5KFIA 1F0XA 2CPJA 1TK8A 1T3OA 3KJVB 1RP5A 2E29A 3R5DA 6FDRA 1VQLS 4O4RA 2AJQA 5LMNJ 2OELA 3NP5A 2RDDA 1RWOB 2G0JA 4LF9J 2OD6A 3KLGB 3FMBA 2ZVSA 1APSA 2RH3A 1SKUB 5K14A 3MOZA 1HI8A 3H0PA 1T8EA 1GK8A 3FJ2A 2V9KA 5AXLA 1LWFA 1LK5A 2AJ0A 4F25A 3BQ2A 1OJ4A 2B56A 3I5BA 3W64A 3GG1A 4H4MB 3RB3A 4EBDA 2PI5A 4I2QB 2L3MA 2XYPB 3LP2A 3ZZPA 3T9NA 5CHCB 3N28A 2HHHJ 4Q45A 5F8GA 3MR3A 3MM7A 2XO7A 2Z58B 2LQ9A 3A1YG 4I64A 3NGRA 3PNIA 2QA1A 1S0NA 2R42A 4BC9A 5J2MA 3V6DA 1SJQA 4ZVHA 1RCXB 4L3NA 3SCJE 1SH0A 3UD5A 1CVJA 1Y9OA 4DV4F 3DU5A 2EFVA 4WWSA 2IIHA 2FDNA 1UWBA 4ES2A 3OV7A 1VQMS 1FJEB 1FK9B 2VA3A 2A18A 1U2RA 1NJXA 2UVRA 3K5MA 4ZCMA 4O3OA 3H59A 2F8EX 2XMUA 4DR7J 3TNVA 2PIIA 3JTNA 1LV5A 3QMQA 2LU2A 1T03B 5A8KB 3OFGA 4JI4F 4ES1A 3SQGB 5D0EA 2YXLA 2MXYA 2CQDA 4C8NA 3GR0A 3PW4A 1TU0B 2DVIA 1SXLA 4RU2A 1SH3A 4OIXA 2HNZA 4PUOA 5A2QY 4W4MA 3EPGA 3HULA 4RU9A 2Z57B 3R8YA 2DRBA 3O44A 1V9OA 2ADCA 1N56A 2C3OA 1H2TZ 5G0RA 3GJSB 4NLPA 2DXFA 1WF1A 5HL7Q 4MAKA 4HDHA 3S01A 2ZEJA 1X4HA 2LFVA 2Q66A 4PPZA 2V2ZA 3D1HA 5E3PA 1Y10A 1FE0A 2CQPA 2B7CB 1FD8A 2RAQA 3QSYB 2OPPA 1ZM2A 2IA6A 2IA0A 5CZXA 4J9OA 1G1XA 2IMOA 2HHSA 4CTAB 3MM6B 5IZHA 3DGPB 3EE3A 1MN9A 4BBYA 5KFJA 3G82A 2YBVA 3NOCA 2ZHOA 1IBKF 1QTMA 1FDAA 3M32A 3E01B 5DLFA 3J7YU 1KOOA 1O51A 5KFWA 1YKWA 2YPZA 3Q83A 2AZ1A 1Q8BA 3MOJB 2NPFA 4QWEA 2VV5A 1BGXT 4LR9A 2DGVA 2DHXA 1S4FA 1JXLA 1L3UA 2FLOA 1K47A 4M5JA 3KLGA 1R6VA 4J90A 1WWHA 3MF5A 4LIWA 3HFVA 3AH6A 2FIUA 2JOQA 5IT0A 3LTOA 3GYGA 4KV8A 2KJVA 3GCWP 4JI2F 1X4CA 4LRDA 1TL1B 1HI1A 4DLGA 4M5GA 3OLBA 2CQBA 4NI2B 3FSYA 5CYMB 7FD1A 3QRRA 4C3LA 5HVGA 1S0VA 1QY7A 3CD7A 5AE2A 2KVQE 2W2OP 3AD9C 1DJ0A 4I2QA 2HWIA 3UO0A 1PAEX 4ECVA 1LWEB 1OS5A 2RU9A 1UETA 1JLBB 2L48A 2YX7A 3VQSA 2NXEA 4E98A 1UFWA 1JX4A 1YQHA 1S0OA 3ISNC 4J9SA 1FDBA 2R2SA 2DR6A 4J91A 5M2PA 4IYQA 2HWTA 4OX9J 1HPZB 1S72S 4AD6A 4ZHRA 2U2FA 1JMTA 2RKIB 1T95A 4MIBA 3CWJA 1PG5B 5IV4A 3MAHA 4C8KA 3CJKB 3B8HA 4JOUA 2X1BA 3KLIA 2GCFA 4JB8B 4KH0B 2GQ2A 4JV2A 3P6YC 1X9WA 1RWUA 1M5HA 2YKNB 4DV4J 4F67A 5DJBA 2AJ2A 4DR5F 3SQGA 2GJ2A 2E1CA 4HI2A 2KT5A 3EDQB 3W7BA 2QYGA 3WBZA 2MHEA 2YQ3A 2H5JB 2J9EA 4HKQA 5DG9A 3D67A 4QIVA 3RTVA 2QMXA 2BV3A 2HHWA 4JI4J 1VLOA 2Z56B 1JWWA 2XGQA 1HBUB 1FF2A 5HVFA 1DQ9A 3PEJA 3MD3A 1KBRA 1SL2A 2OLWA 1TKZB 4DQIA 3CCLS 5GAHU 1Y7PA 5F8LA 4K4YA 2CJYB 4CTAA 1T9UA 2CNLB 3TZWA 3MM6A 1IQTA 3PX0A 2EBEA 1PJ7A 2ZZTA 4MKAA 5CAAA 4ZVTB 5IT9Y 5HMZA 3BJYA 2A2CA 3E01A 3GPAA 2BR0A 3I31A 3HF5A 4I69A 3JS9A 1ZS6A 4P6QA 3H7HB 3DOKA 4KKOB 4H4KA 3W2WB 2CRLA 1IBKJ 1SC3B 1V5VA 3DI6B 3JTPA 1YITS 2ZUAA 2Q43A 4IOCQ 4UW2A 3H5SA 4OYPA 3T9ZA 1XQIA 4ILMA 5ADZA 1UFKA 1SH2A 4CO1A 4OV6A 4ED8A 4KT0C 3BF4A 4PPDA 2L9NA 3HJFA 9RUBA 2B9WA 5KFMA 4DV1F 5DDPC 4XAKA 5IQ6A 2VONA 4FNHA 5KFGA 1GMUA 3ICLA 2R8KA 1TL1A 3M8ZA 2AYBA 4FYYB 3VQTA 2X1AA 1HQEB 4NLOA 4NI2A 3M8YA 3C14B 2AZ3A 1WELA 1N34J 3LGMA 4OZ3A 3M8WA 3D6TB 1VQ5S 4DSEA 3CO9A 4X4NA 2IVYA 2ZJPQ 2E5HA 3J80Y 3CMES 3NG8A 4JI2J 3GR1A 3MPWA 1XR5A 4K2JA 3TZXA 2EG1A 1RTIA 1JLBA 2ZD1B 2HVIA 2UUWA 1KFSA 4JI5F 3EZUA 1T0TV 2CPFA 4OL8A 3TAPA 4KO0A 1NPRA 3N5BA 1J27A 3TJAA 3NKYA 4F02A 2F9DA 3ILLA 2UUAF 1MWZA 1KONA 3KHLA 3UCZP 3AB4B 1WF2A 1D09B 2HLTA 3BR9A 3GJRB 2R7QA 1X5OA 4EZ9A 4TQRA 2C3MA 1WDTA 1JLEA 3BGOP 2DHHA 5L9XA 2MQQA 2RU3A 4ZP9A 2I5JA 2B9YA 4CH0S 3MD1A 1GXTA 3M2UB 5B08A 2CJXB 1YTYA 4RW8A 1HNWF 1QSYA 2BM0A 4LSLA 1U2CA 5KG7A 2YKNA 2BRLA 1HNZF 5D4OA 1X7VA 2I0XA 2EFNA 3MMCA 2HQGA 1NPPA 1OSCA 3BB5A 3VF0B 1ZAXA 4ZJLA 2N3LA 4OHVA 2A1BA 3BBBA 3HSGA 1YX2A 2GAHC 2AJ1A 3BBCA 2Z2YB 1T05B 2KFZA 3B4DA 1S6PB 4OJGA 4DR5J 2I9SA 1N0VC 4ID8A 3NXZA 3NL0A 2DNQA 2IAJB 3EGZA 2ZHAA 1L5UA 2WB1D 4F8RA 2PD1A 2Y1RI 1TKZA 3SDEB 2D7SA 5E3CA 3PW5A 2DH9A 1S77D 2XLIA 1H7WA 4JI1F 3CJSA 5A6PA 2V8GA 1PJ6A 2Z0GA 4YB1P 3KK3B 3O2IA 3MFHA 1PGZA 4MK8A 4UOHA 3OJUA 1TK5A 3K0JA 3V4MA 1U1LA 2VFVA 2YKQA 3DOMA 1RGVA 3Q24A 5C42B 4NZ7A 4KKOA 2C1EB 3W2WA 2W9CB 3TUJC 3G2XA 3DI6A 3ZZTA 1R89A 2ZC3A 4LT6A 4G3IA 1RDRA 3K5PA 2VC1A 1UP1A 4UTGA 1C2PA 4K4TA 2DH8A 3K17A 1RT3B 3QGPA 4CT9A 2RS8A 5I3QA 1HQEA 2HVZA 2MTLA 4RWXA 2UU9F 1NK0A 1Z2ZA 1HWJA 2PEBA 3TA0A 1RHQB 5HJYA 2E1PA 5KFTA 2E9TA 5KG2A 1C0UB 5F9LA 2YPYA 4NOHA 4Q43A 5D0HA 2VKZG 1MW7A 2BX6A 4ZMMA 3THTA 3CDBA 2GO9A 1VQ6S 2DT9A 2ZD1A 4DR1F 2IJNA 3V6JA 2ZH2A 1WEYA 3BH6B 3CDAA 2KG1A 1N5TA 2OTJS 1RT7B 3UQSA 2JZ5A 1OYDA 3ENWA 2LXUA 4MKYA 4NXNF 1IQZA 3ETMA 3CMAS 2MGZB 3GU0A 4MJKA 4NX9A 5HJXA 5IV3A 3C6TB 4YN3B 4JI5J 3OL6A 4CO5A 2ASDA 3MI7X
chains in the Genus database with same CATH topology
3NMAA 3VAJA 1VRTB 1RT2A 3S6EA 2QRRA 1EP4A 5THWA 4I6AA 3GMGA 1HQUA 1YVFA 3DRSB 4RX6A 1GT8A 4CH7A 4OHXA 3FSIA 1JLFA 3OHAA 1FHTA 3BGUA 1KVJA 4TY8B 5D4LA 3MM5B 2LQBA 2EG2A 1LWCA 2MHNA 2DIVA 2VPWB 2C22A 2HNDA 1FK9A 4M8LA 3OVAA 2V94A 1X4DA 2H9ZA 2HWHA 3M2UA 4Y65A 3MEKA 4RNFA 2JSXA 2LVWA 1QUPA 3IRXA 1SB6A 1NKBA 3DXSX 3LUYA 5I42B 1DZ5A 4DUZF 3OFHA 1HYSB 1UWBB 4KGMA 4P7TA 2BE2B 2OSRA 6FD1A 1YJNS 3Q22A 3CVKA 4DV5F 4DFPA 1WNEA 2CQHA 2EFPA 1X5TA 4QR2A 4Y3CA 5DG8A 5HBMB 1T03A 1NEEA 4ZPWR 5A8KA 3GYXB 4YDDB 3G8SA 2RB7A 1KQKA 2VPZB 4QIGA 4RW7A 5KAKA 2VFTA 3OUYB 3RAXA 5J1NA 4LVOP 4OHYA 2BQUA 4IFVB 4C11B 2N7CA 4DL7A 1KQSR 4JBCA 4YR2A 4ECQA 3O5TB 4ZVFA 2BXJA 4OZNA 3SSRA 2PA3A 1TKDA 2IMWP 3Q2SC 1S48A 4NCGB 2HS3A 3CC2S 1KTQA 3NBPB 4WKRA 2BM1A 2ZKTA 2ACYA 5DG7A 5EX3A 3LAKA 1U1QA 4BCAA 5EN1A 1K0VA 5CYJA 4ZCKA 4URQU 4ETXA 1VIOA 2VPYB 2AX1A 4CI0B 2DISA 2Q6CA 3SSQA 1TFYA 4ZPTR 3TARA 3DOLB 4PXEA 1FXDA 4HLBA 5BYRA 4KFBA 4I67A 1HBOB 5GAEI 3BDPA 3MR5A 1N5SA 3V4IB 2M5YA 1NZAA 2EI5A 4AUKA 1YGYA 4ZKAA 5J1EA 4DFKA 2RIJA 3GQCA 3L7OA 1VQOS 2YNFA 3N01A 4X64F 2J5AA 2HNZB 3OHBA 1HWLA 1NU4A 2EBGA 1IKXA 1P1LA 1VS3A 3M30A 4TN2A 1XEZA 2KM8B 4AXIA 5J2PB 2PSZA 4QW9A 4FF4A 3EX7B 3NGDA 2VUGA 4O3NA 2ABYA 4HT5A 4USHA 1Y5NB 1I94F 2BQ3A 1KTVA 5FLXY 3CPWR 2VG5A 3BO4A 1JK9B 3QIDA 2EK6A 4FYDA 2YNGA 4RW4A 5K8PA 1UVNA 5F0UA 3IS9B 5EHHA 4DS5A 4OLPA 5D8HB 4CQ1A 4ED7A 2ALZA 5FJ4A 3W2VB 1KNZA 3SDEA 2XNQA 2OIHA 4MFBA 1W2IA 1K73T 4B9VA 4QJVA 1FDNA 4KHRA 2BACA 4KR0B 2XLJA 4A8MP 4O0IA 3IRWP 3B82A 1VQKS 2BW2A 3EYZA 3VAMA 2Z2MA 2IYIA 2HPUA 1F5CA 1FRMA 3F73A 2CQIA 3HZEA 3CE8A 1H98A 3DGPA 4IG3B 4C8YA 4M63A 4Y2CA 5MAOA 4R0EA 1RYRA 5K5MA 2R7RA 3CB4A 3IGVA 5B0BA 3EGWB 2EFGA 3DLEA 3KK3A 5E41A 4X4TA 2M9KA 3CIMA 3T1AA 5DQHA 2G0CA 4F4WA 1KC8T 2UVWA 3BGLA 5KFYA 3NCPA 1U1RA 3OTOF 3KHHA 1Z1ZA 2PN6A 3Q8SB 3V81B 1NO8A 2DHAA 2GMLA 3KYLA 3PKMA 2DNGA 5C24B 4DF8A 4I2PB 1FCAA 3WX4A 4DFJA 2ZHBA 1SUQA 3LWMA 5E3AA 3KK2B 1UMJA 2DNYA 1TK8A 1E6VB 3NWGA 1WG5A 1UVKA 1SL0A 1U1OA 1JLCB 4EO6A 5B0FA 2DNRA 5IT4A 1QAXA 2ROGA 2KDOA 4LJMA 1TQLA 2FHJD 4YR0A 4WTYA 2VBZA 2YKOA 4A47A 4NLUA 4F3MA 3V6KA 4A8KA 1QJHA 2LXIA 1VIXA 4XO0A 3I9ZA 3QJPA 1IKYB 1MU2B 3G71S 3H5YA 4ZS6A 4X4UA 2RNEA 3GIJA 1TP7A 3MM8B 2Q79A 2MKKA 1M5OC 3QJLA 1RT1A 2WB4A 5HROB 2NR0A 3DM2B 1N54B 4Y28C 1VOMA 2JFKA 2GQCA 3I0SA 3US5A 4N76A 4GKKF 1NJIT 4D3GA 4KAIA 3PKYA 1JIHA 1BQMB 2E5IA 1HA1A 2M7SA 3OJSA 4FS2A 2KT2A 4Z37A 1Q78A 4OI6A 5T7LB 2HNYB 1DARA 3GYNA 3T5HA 4PG8A 5T14A 2UVUA 4M95A 3POTA 2BBEA 2MZRA 1Q86T 1SQEA 4F4ZA 1Y3JA 5F3TA 1IKWB 2BJDA 2BZ2A 1FKAF 2FJXA 2JLEA 3BM7A 2B43A 4FF2A 2GFFA 1VRUA 1SKRA 5CD4H 2AWZA 4X4OA 1TKTA 3BSOA 4Q0BB 2FJAB 3TA2A 1NK6A 4PKDB 3CD5A 4KC5A 1RT3A 2IRUA 3LW5C 1WHWA 3D0GE 5GAHI 2DNMA 2C28A 4ED2A 4Q5VA 4MK9A 5CYQB 3KLEB 4WYWA 5LSRA 1K8AT 4WF9Q 2ZC4A 1DTQA 2EW9A 2J9DE 1FRKA 3FRYA 5CYMA 5J2NB 5H9EJ 4ECUA 2P5VA 1ZM3A 2HGNA 3QGHA 4HTJA 4KV8B 2D3UA 4F4XA 1SBRA 2YX4A 1TV6A 5DM6Q 3PW2A 2Z4PA 3ULHA 1GXLA 2UXBF 4USIA 2F8HA 2POKA 3SZ2A 5KOWA 5D3GA 2ERRA 1N5YB 5L8RC 2OFHX 3HO1A 1RK8A 2VFUA 1FERA 1FRIA 4WK3A 2XS5A 2IJFA 2GGPA 4MK7A 1E6YB 4N56A 1TL4A 4OI0A 4LQ3A 3IGNA 2R2UA 1DBDA 4EGLA 5KFFA 2JWNA 3PRDA 3P96A 1U4BA 1X9SA 2WSEC 2DJWA 1LWEA 2MSSA 2MY7A 5FDLA 4B08A 1SJ1A 3N9UC 3ZC4A 5DDRC 4DL5A 2ASJA 2YWKA 4R5PA 3CCSS 2W7OA 1KR4A 2K3IA 5J2QB 3Q2TC 3L95X 1DTTB 1ZZFA 5KT4A 4BDPA 2J0QD 1Y3KA 4GO5X 2IRYA 5EWEA 4RNHA 3AJ1A 5K8OA 4DUYF 3UCUP 1VC0A 1PO6A 4DR6F 3K2YA 3SV4A 3I32A 3UR0A 1UVJA 5M2RA 1TZ0A 2I1RA 2FC8A 5AXMA 1TAUA 3MPVA 1OQ3A 1GX6A 4JYAF 3ENVA 2NSCA 4J9PA 3NCQA 4CT8A 2HAIA 2OO4A 4UOCA 4LFBF 1SC6A 5KFCA 2DR5A 3FGVA 5JVGQ 3MMAA 1UJ6A 4OX9F 2MQNA 4QZVB 1DLOB 3CIZA 4C9DA 1C0TA 1G2EA 3DFEA 3NMRA 2CJQA 2FTRA 5AXNA 2JEGA 2KO1A 2B5JB 2ROEA 3Q8PB 3CSKA 3MEGB 1UL3A 1FVQA 2FUG9 4U6PA 4F4KA 1HPZA 2YY3A 4W90B 4H4KC 4F2SA 1XMOF 2CIMA 2YNIA 2KVIA 3HMJG 3BSNA 2FHKA 4HVZA 3T19A 4G6VB 4X62F 2RKIA 2WK4A 4WZMA 2OMOA 3OXLA 2EC0A 3C6TA 1Q8LA 4I68A 2XI3A 2HLUA 1JNRB 1R31A 3A8EA 3KNGA 3AA8A 1JLAB 3CJKA 3DCAA 3TO8A 2AGOA 1SKWA 4KHPF 4PQUB 1UJ4A 1URNA 1IUJA 2BVZA 1VQYA 3IAM9 4E8UA 4KBIA 4LSNB 4M1KA 2GHVC 2KRBA 4ZHRB 5F8JA 1RTJA 3DRSA 4FVCA 3MM5A 4F3QA 4DQPA 1UA1A 4DX8H 1Q81T 1S9FA 4FS1A 1X0PA 3NLCA 5B7WA 1Y5IB 2FB0A 5AXKA 2PEHA 1I6JA 3S1TA 1H3DA 4DBQA 2OP5A 3PRBA 1XERA 3DYAB 5I42A 1HYSA 1KQGB 1X8DA 2ZUGA 3PVXA 2BE2A 3KLIB 4WZQA 3TAMB 3M1VB 1D9DA 3CDUA 3KOAA 2B6AB 3I6PA 2FC9A 3I5CA 5HBMA 4URSA 1WACA 2DR8A 1K1QA 2XY7A 2XULA 1LK7A 2PMZD 3OUYA 4NLSA 4R8UB 1ZH5A 4IFVA 1YG0A 4IO1A 2FGCA 4KQZA 4PG6A 3RZAA 3ZZ0A 3FDSA 1Q4RA 3N6NA 2ZH9A 3T3FA 2CKWA 2OKQA 4NCGA 4UY8T 3NBPA 3R5BA 3PJXA 4P2SA 2AP6A 3OW2R 1UVIA 1OO0B 4YY3F 4JV5F 4OI3A 3ZZRA 1FRHA 4YHHF 2J6SA 4B02A 2V4QA 4K50A 2R8JA 1FTRA 3DOLA 3FSXA 1O8BA 1T02A 4QPTA 3V4IA 1K1SA 4I7FB 4AL6A 3CCQS 3M6VA 3BN4A 3DHXA 1VQSA 3OTEA 5DDOC 3VAFA 2VODA 3V5RA 2VG6B 4WK1A 4PXBA 2L9WA 2F8MA 3LP1B 2ZH7A 5G4DA 3IC1A 4QWAA 3JB9k 2P6TA 3CCUS 4J9MA 1FEEA 4RKUC 1HBUA 5DQIA 2KI2A 2VOOA 3DRYA 1VJWA 3GWCA 1Y0HA 5DDQC 4DR3F 2J9CA 5J2PA 2NXUA 5JJBA 4O3PA 4XPCA 4WJBA 3PJWA 4YQWA 1P8GA 4TU9A 5KT7A 3K7RA 4DF4A 1VC6A 1DQ8A 3GZ7A 1QSSA 2FVRA 4LQ9A 4ALZA 3O6QA 5LMUF 2MQPA 3QLHB 4DV3F 4NZ6A 4N8NA 3GV7B 2HFOA 1Y5LB 4Y2IA 2XS2A 1RJJA 2E1RA 3B78A 3MUMP 1JLGB 3ITHB 2E66A 4J9NA 1KHWA 3JSMA 1CC8A 2NREA 4NLVA 2BA9A 3FMWA 4OHWA 3CUNA 4DSKA 2F40A 3M8QB 2YKAA 2WONB 4OZJA 2B3TB 3EGNA 4ETZA 2IYGA 4IG3A 5IWAF 3CXCR 3F41A 4Y0FA 2G9OA 5EWFA 3H5XA 1Y4ZB 4JV1A 1CSJA 3HKZD 3ONQA 4ZPVR 3G4SS 4NXMF 2KXNB 2KZZA 4N5SA 1PC5A 1XNQF 2C2RA 5L39A 1HMVB 4OI1A 4ZPAA 4KTQA 2XSJB 3CCMS 1QE1B 3N0VA 1JJHA 2BRKA 2MZQA 2LLZA 5HP1A 4DV0F 3TI0A 2ILYA 5E33A 3V81A 4EEYA 2R7UA 4X66F 1YHQS 1RQ0A 5C24A 5GAGI 3J7ZT 1D0EA 4MIAA 4ZP6A 1KRPA 4A8XA 2HGMA 3D28A 2W8LA 1FESA 3M05A 4DPOA 1R6YA 3R3TA 5C25A 3QZ8A 3I55S 3KK2A 2LDYA 1F5BA 3K8WA 3KTQA 5LMNF 2QLXA 3L7PA 3TYTA 2AU0A 4OZ0A 1JLCA 3GV5B 3AHPA 2AX0A 1NH8A 5H9FJ 1C1BB 3LO3A 4PXDA 2M52A 1R43A 5SUHA 2JL9A 4O4GA 3JYTA 4RNMA 2QA4S 2DRAA 3CD6S 1S79A 1X5PA 3MECB 4IG0B 4K5SA 5KT5A 5I3PA 5BYSA 3R5AA 1MMNA 2A2DA 1M5VC 3HDSA 5HROA 4P7VA 3DM2A 2JHEA 1S1VB 5U47A 3RAQA 4KE5A 5B0CA 3ENQA 4BS2A 2HG4A 1BQMA 2J7UA 2MZTA 3ZFVA 3HVTA 2K7KA 2LXFA 1NK7A 1WG1A 4QR0A 4O3SA 3DOKB 5KFKA 4DL4A 2CPZA 3BS9A 4DLEA 5HLFB 4E0DA 3MTKA 4B9MA 5T7LA 3PIOQ 4Q8EA 4I6WA 2CQ3A 2HNYA 3GE9A 2OMLA 5C5JA 4QWCA 1FRJA 2DNNA 1NK5A 1FNOA 2QLWA 2ASYA 3PEHA 1ZBTA 3HPOA 4KGKA 3DRXA 2PMHA 5I3UB 4KPYA 2QT7A 3G86A 4OQJA 5D4NA 3HHLA 4IH7A 4H4OA 4RBUA 3Q23A 3OFFA 4PWDB 2AYMA 2DB1A 3AJ2A 2MPUA 4Q0BA 3NNHA 1LW0B 3MMBB 2VOPA 1YJTA 5K14B 2IBKA 4CNZA 2UUTA 2RVJA 3IWXA 2A10A 2R8HA 3LH2S 4DV2F 4GC6A 4ECZA 1N34F 1L3TA 3CC7S 4JI3F 1XC9A 5CYQA 3KLEA 2XMWA 4DHVA 4DSFA 2ADBA 4TXSA 1R0AB 1B64A 1N52B 1MNEA 5K9FA 2Y1JA 2DBBA 3QJJA 2VB6A 4NLRA 1RT4B 5L38A 2J8AA 3L3CA 1IXKA 3QAUA 4AE5A 3H25A 1Q8IA 4RZRA 1NNDA 1U45A 4HEA9 2LEPA 3K5OA 1LOUA 2WW8A 2LEBA 1FKPB 1XNRF 3DLGB 1N5YA 3SSSA 4O44B 4TKTA 3MFIA 3RB4A 2CPXA 3MXHP 1HHTP 2P9GA 3UNGC 2JRSA 2KB2A 3PX6A 1E6YA 1S10A 3FZ2A 3IA0A 4G1IA 1NK8A 2RRAA 5A6WA 1JKHB 5E7OB 3J7YI 3NNCA 2HHHF 1RTHB 2E5GA 2AYGA 2QV6A 4I4BA 4GC7A 4A8SA 2YH0A 2KXFA 3U02A 1A7GE 4YB7A 2Z8QA 4B9NA 4ZCIA 4WFZA 1M1KT 2GO8A 3GIKA 2IC3B 1R8AA 4X4RA 4FXWA 2RF2B 3BN7A 3OXFA 2JEJA 3X1LB 1A9NB 2F9JA 2B4PA 4RNNA 1Z2LA 2V0NA 3F56A 1SJFA 5CA5A 4Y6IA 1LXNA 1NB7A 4Y00A 1KEKA 2FJVA 5HQ8A 3THVA 2GNKA 4AFFA 2R7SA 2B4UA 2LDIA 1HFEL 4ZVGA 1Q79A 3CCES 3M8PA 1X4EA 2MKIA 5B0DA 3KG4A 1GTEA 2BABA 3SCKE 2XB2D 3B4MA 2KFYA 1D9AA 2F3JA 4OFZA 3OBIA 3G6XA 3M4XA 2AQ4A 1RTIB 3M2RA 1W25A 4QQBA 3PR4A 2MYFA 2R7OA 1DLOA 1U6ZA 2GHPA 5DGAA 1VQ9S 5DM7Q 2CVIA 5GMKa 1YIJS 4EZ6A 3G6ES 3D0HE 3VCDA 2AGQA 2ZKUA 1ZM4A 2B5JA 4QW8A 2YNHB 3Q0AA 1ZETA 4X4PA 1R3NA 1UFLA 4WFAQ 4DV6F 3TVZA 3MM7B 2KZMA 4BWMA 3BDEA 3CDWA 1NJYA 5GAEU 3FEXB 3QO9B 2I8EA 5KFAA 4KO0B 5JVHQ 4EYHB 3D54A 2OD4A 4OMFG 2YVSA 2GC8A 3IR6B 3N79A 1BY9A 2XC9A 1S6QB 1C1CB 3I9V9 3CJ0A 1BC6A 2OAUA 2R7XA 3WC0A 1KLNA 5J2MB 3V6DB 5EWGA 2RQCA 5KFNA 2UZAA 3RRHA 1J5EF 2RQMA 2JC0A 3WZ0A 2OPSB 1NRKA 4DG1A 4C0HA 2F7VA 4DWIA 1MROB 2IM3A 2Q1LA 2LU1A 2HW3A 5KFLA 2AW0A 2MKHA 2BANB 3BZQA 3MR6A 4XDCA 1QAJA 4DR7F 3CJ4A 3KKFA 4C8MA 3PV8A 1O0PA 2O3DA 4Y2KA 1QUVA 2GIQA 3N4WA 1JLEB 4BHQA 3DYAA 2GV1A 3IAS9 4WCEQ 5IM0A 1U1PA 3PM9A 4BWJA 4MKBA 4M94A 3UCGA 2XY5A 2DR7A 3TAMA 3IG1B 3M1VA 4NMLA 2I5JB 2WBMA 2B6AA 3M2VB 1FNXH 2JH3A 1LKZA 4ELUA 3DN9A 4B9UA 3FRZA 2CQ0A 4WKYA 4J9KA 3C46A 2ZOGA 1QVGR 4ID5B 2D9PA 2FPHX 5KFHA 4DQQA 1KS2A 4R8UA 2PE8A 3FNNA 4RW8B 2QEXS 2W4PA 4I56A 1TL3B 4FXDA 3O8WA 4FNIA 1XMBA 5A0YB 4J5OA 4LSLB 5CZVA