5GAMe

Foot region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
83
structure length
75
Chain Sequence
MVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSKGTPLGKILLKGDNITLITS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 Angstrom resolution
pubmed doi rcsb
molecule tags Transcription
total genus 8
structure length 75
sequence length 83
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
e PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5game00
4JLIA 4XTZA 4M7DG 4JRKA 4C92G 3JB9H 4C8QD 4M77E 4C8QB 1JBMA 4F7UE 3BY7A 4M7AC 3QHSA 1WQWA 2YLCA 4M75E 4M77A 4EMKB 5GAN8 2EJGA 1MGQA 4F7UA 4XTVA 3SWNB 3RKXA 4M75A 3PGGA 1I5LA 4M7DE 5GANg 4C92E 2DXTA 5GAMf 2E1HA 5LJ3h 4M75F 4M7DA 4N0AA 4C92A 1I8FA 5GANe 5LJ5g 3GIBA 1I4K1 3JCMg 3JCMP 2EJFA 1U1TA 4M78C 2DZ9A 5LJ5e 4PNOA 3JCMQ 3RERA 1TH7A 5GMKi 2I2LA 5GAMd 5GMKm 1B34B 4Y91A 4J5YA 3V7SA 2DTHA 5GANh 4F7UG 4M7AE 4NL2A 1H641 1LNXA 3JCMd 4MMLA 3JCMJ 4JUVA 4M7AA 1LJOA 3FIFA 5LJ5h 4XU2A 3AHUA 1M5Q1 5GAOm 3EFRA 3M4GA 5GANj 2DJZA 3FB9A 2E41A 4C8QC 1JRIA 4WF2A 4M77D 3VU3C 4QVDA 4M77B 5DY9A 5GMKe 5GAN2 1LOJA 3JB9G 4V2SA 2EWNA 2DXUA 4M75D 4X9CA 4M75B 5LJ5j 3SWNC 4PJOC 1U1SA 4M77F 5GAMg 3HFNA 3JB9I 4F7UF 4M7DD 5GAOr 2RB6A 4C92D 4M7DB 3EFSA 4XU3A 4C92B 5GAMe 2DZCA 2E64A 2QTXA 2DKGA 3JB9D 5GAN4 5GAN5 4M7DF 5GMKh 5GAN3 4C92F 4J6WA 4M7AG 4J6XA 5I21A 3BFMA 4M78E 3V8JA 5GAOq 1KQ1A 4XTXA 3JB9F 2VXFA 3JCMe 2DEQA 4J6YA 4M78A 2RA2A 1Y96A 5LJ3f 3V8LA 2RD1A 1Y96B 3V7CA 4XQ3A 5GMKj 5GAMh 2Y90A 1BIBA 1HXDA 4M7AD 4M7AB 4PJOE 3V7RA 4A53A 5GAN6 1X01A 3QSUA 3RESA 3JCMh 4RCBA 4PJOA 5GAMj 4M7AF 5LJ3d 1N9RA 4HA8A 3SWNA 4M77C 2JN0A 3QO3A 4EMKC 4F7UB 5GMKl 3BW1A 4M75C 4NOYA 4RCCA 2DTIA 2DVEA 4M78G 5LJ5f 1I81A 5GAN7 1KQ2A 1D3BA 5CAIA 4M7DC 4N0AC 1WNLA 4C92C 4NL3A 2YLBA 4XTUA 1N9SA 4C8QG 4EMHA 5GAOl 3HSBA 2FYKA 4PJOG 3FJPA 3JCMV 4M78D 3L1AA 2RM4A 2FB7A 4M78B 2E10A 4OP0A 5LJ3g 4QVCA 3JCMb 4XU1A 1BIAA 3JCMc 3JCMW 2ZGWA 2K57A 2E65A 4M78F 4C8QE 5LJ3e 2EAYA 2VC8A 4EMGA 4C8QA 3JCMX 4XTYA 2DTOA 4PJOD 4MMKA 4EMKA 4PJOB 4C8QF 3V8KA 2EJ9A 3INZA 4PJOF 3HFOA 5GANf 4HT8A 3L2ZA 4JRIA 3RUXA 1WQ7A 4XTWA 1HK9A 1M8VA 3BDUA 1YCYA 3RIRA 1D3BB 3JCMf 2CGHA 5LJ3j 4HT9A 2VXEA 2YHTA 4XU0A 4A54A 5GANd 3JB9J 1B34A 3QUIA 4M77G 3RKYA 5GAOp 5GAOn 4X9DA 4DQ2A 5LJ5d 3RKWA 4M75G 2HNIA 1WPYA 3SB2A
chains in the Genus database with same CATH superfamily
1WJRA 1JJ2A 1KG1A 1K73U 1S72T 3LGFA 3VJPA 4HCKA 3ER0A 2IPOB 3HRSA 4M7DA 2DM1A 1PKTA 4J9BA 4C92A 1WIEA 2JM8A 4E6RA 4JZ3A 5LJ5g 4ESRA 4RMOA 2L3PA 4PNOA 3JCMQ 2KSSA 1ZA1B 4J5YA 4EIKA 2YUPA 1UGQB 4ZGJB 1OULA 5KH6A 3FIFA 5KYUB 2R5MA 2EKHA 5GANj 2CT4A 2DJZA 1PWTA 2K4YA 3FB9A 4UC4A 1UB4A 5GMKe 1M2VA 3VUZA 4DOVA 3JB9I 3EHQA 2GF7A 4HVWA 4J6WA 2EQJA 2HBPA 3V8JA 1KQ1A 3M56A 3V7CA 5GAMh 1YJWQ 1M1KC 1YCSB 1Q86U 1X01A 1Y71A 2EFIA 2F2WA 2CH4W 3CPFA 2EKOA 3BW1A 1WJSA 2C0IA 2E12A 2OX7A 4NOYA 1M1KR 2V8IA 2QQRA 3THKA 4N0AC 1TSFA 2DL3A 1K8AU 4C8QG 1JJ2P 5KYXA 5DLQE 4M78B 2FB7A 5I2MA 2OTLT 2JTEA 2K5IA 1WHKA 3SDZA 4J9HA 3SEMA 5HK0A 3M53A 1WXTA 2R57A 3QWXX 1YIJT 4CC3A 3R6NA 2DO3A 2DD5A 1KQSS 1WHLA 1Q7YC 1Y96B 2QQSA 3CMET 1IZ6A 2HL5C 4JRKA 2CZ6B 2H3EB 1JBMA 4F7UE 1IXDA 4MDWA 1FMVA 3OYGA 1VQ9T 4XTVA 3LWHA 3PGGA 3CCMA 3S3NA 1Q7YR 4KRTA 5IHKA 3CCJT 3M54A 3JCMP 2QGFB 2DZ9A 4Z88A 3EFOB 5GANh 2ZPIB 1ZSZB 1LJOA 2COWA 4C8QC 3F70A 3H41A 2FPDA 3UA7A 4M7DD 1PC0A 4C92D 1PM3A 3OYAA 1HD3A 2RO0A 3TU4K 3VS4A 4XQ3A 4P5NA 4LDWA 5GAN6 3E19A 4HA8A 1WA7A 2YUQA 4EMKC 1GRIA 3PVQA 1SRLA 2HDAA 1WNLA 2HCKA 1U06A 3RR6A 2L3RA 4FT2A 3QXEB 2LCLA 3L1AA 3OBWA 3JCMW 2QASA 4RTYA 2OI3A 1NJIC 1IGQA 3N5BB 1YN8A 1WI7A 1CSKA 2RK1A 1K9MC 3M0UA 2XMFA 2RH2A 2GQIA 2RHXA 1PG5B 2LT1A 4OB0B 4JS5A 1KC8C 1Y57A 1WHHA 3CMAQ 1K9AA 1NJIR 4PJJA 1BYMA 2RN8A 1K9MR 3EGXA 3HP9A 1ZBJA 2YRDA 4XTZA 4J9DA 4QQGA 3A8LB 4LUDA 1QCOA 2X3WD 1G3WA 1MNEA 4F04B 2I2LA 3MKDA 4ZGEB 2FG0A 3E9GA 2G3RA 3EG3A 3OSSC 4XU2A 2L5QA 3G71Q 1JQQA 1MUZA 2E41A 2YDLA 3VU3C 5C6SA 1VYTA 4E2FB 5LJ5j 1NEGA 5DM7R 3QIIA 4LDYA 4J9FA 1CKBA 1OOTA 3CCMT 5GAN4 3E1SA 3OBYA 4J6XA 2PNIA 2RA2A 1QP3A 3OYHA 4CC2A 2Z0WA 5KCOA 2LC4A 4J9GA 1GCQC 2A28A 3QO3A 4F7UB 5A2QE 2P84A 1KQ2A 2O4XA 4J9IA 4PJMA 1PRMC 3M0TA 3OSVA 2FYKA 2KI7A 2O01E 1OQKA 4M78F 4QVZA 4EMGA 4EMKA 2E4HA 1R0CB 3GNFB 4AMCA 1MMNA 1VQ8A 2EGCA 1M8VA 1N27A 1YITA 3QUIA 2ZCFB 3GOXA 3OYLA 2DVJA 3P8HA 3FC3A 3MEUA 1YI2A 2NWMA 2GTJA 2P0KA 1Y07A 3UT1A 2K3YA 3QHSA 2MWOA 1IGUA 3ME9A 1U3OA 1JXOA 2YT6A 2DERA 3JCMg 4XK8E 3NGPA 3G7ZA 1TH7A 2ED1A 4X1VA 3OB9A 2DXCA 4IKFA 3JCMJ 2LQKA 5LJ5h 1NBEB 1K73C 2CP6A 1JRIA 3JB9G 1V76A 2X4YA 1LCKA 1LOJA 3J80E 5DLOA 2DF6A 4M7DB 2J6OA 2CZ7B 4C92B 5KYWA 2DKGA 2OAWA 4N4IA 1K73R 1PRLC 2RI2A 4M7AG 2K7AA 4HVVA 2L8DA 3CMAT 2K3BA 1JB0E 5FWCA 3IQLA 5GMKj 2QEXQ 1XJWB 1YJ9A 4YTLA 1OX9A 4OGCA 4KH0B 4QW2A 2XDPA 1ZSGA 2X51A 3VRYA 3VS1A 2MIOA 1QCFA 3I55Q 4OMLA 1M2VB 1YJNQ 2KBTA 1Q81U 3T9NA 1MMDA 2CSQA 1D3BA 4RTVA 1QWFA 4HKEA 4XTUA 2LT4A 4ATOA 2E6ZA 2HL3A 3RNJA 2RQUA 1M1FA 2ZGWA 2K57A 2E65A 4DBRA 3WXMB 1AOJA 3VS6A 3NTIA 2DTOA 1AWWA 1TG0A 2V1QA 4HT8A 2M1HA 1GCPA 2V8KA 4JRIA 3G71T 1KC8U 3OYNA 3CC4A 3A98A 4FM4B 3JCMf 1Q86R 1RLPC 4A4FA 4BACA 1K8AC 2JVVA 2QA4Q 2WSFE 1FX7A 4D8KA 2MWPA 1QWEA 2JZ2A 3OW2A 3X25B 1VQLQ 2RI5A 3ZL7C 1E6GA 1T0HA 4J8OA 2M51A 2QTVA 2W0ZA 3BY7A 1K8AR 4M7AC 3H0FA 2P0PA 2DD4A 1MGQA 5I11A 2CZ0B 2KR3A 3EG9B 1GFCA 2E3HA 2NUZA 2ZPGB 3PMTA 1W70A 1WHGA 1VQ8T 3GIBA 1XOVA 2JW4A 1X2KA 1YITT 1BCOA 5GMKm 1D1BA 4RG8A 1FMKA 4JUVA 5D6XA 2ECZA 1VQLA 1VQPQ 1QVFA 2FZKB 2YWWA 4WF2A 5CCAA 4PLIA 2RMOA 4X9CA 1OZ3A 3GBQA 1G3YA 3M5AA 2LMJA 2V1RA 5FU6C 3CCVQ 3I35A 4F14A 2X9HA 5GMKh 2SEMA 4M78E 1ABQA 3M0RA 1RAEB 4HVUA 4J83A 2X4XA 3I56A 2YRVA 1RACB 3DB4A 1GXIE 2GFUA 2CH4A 2LQWA 1VQPA 1AZGB 3VUBA 1I81A 3OW2P 1UGRB 2LJ1A 2H3JA 2LNHB 5AT1B 3CCVA 3OS1A 1OI1A 3VRZA 4PJOG 5CKFA 2RM4A 2Y4YA 1MV0B 4QVCA 4XU1A 3META 3QJYA 4B9WA 3OY9A 1YJ9T 2PUOB 3FLGA 3GF5A 3L2QA 4Z8AA 2HSPA 2RNAA 4PJLA 2FL7A 4ZN3A 1YIJA 3DB3A 3QYHB 5ECAA 1Z9QA 2DMOA 1DJ7B 1WXBA 5GAOp 1QVFP 4DQ2A 2DIGA 3REBB 1PD1A 3QZ9B 2M02A 1QKXA 5KYYB 3CCRQ 3G6EA 3SWNB 2COYA 2NLUA 1QLYA 2WSCE 5LJ3h 2AT1B 4MZPA 3I55T 3CC4T 1YJNT 1UUEA 3RERA 3EGXB 1VQ4A 1YBYA 2BIVA 2ED0A 3S6WA 1SPKA 2KXDA 4M7AA 4OMPA 4BE0A 3C4SA 2XIDA 4C0FA 5D7UA 2DL5A 2EPDA 5DY9A 4PJOC 4KULA 3VYGA 2LX9A 2PQWA 5GAOr 5I22A 2JXBA 1OEBA 4M7DF 4C92F 3QDRB 1VQ6A 2LQNA 2JNGA 3CQTA 2ZPEB 3V8LA 4IURA 1I1JA 1HXDA 1OV3A 1PKSA 2AIRB 3MP8A 5CQXA 3LW5E 1N6AA 1VQLT 4LUEA 5IHNA 3OYJA 2BKDN 2KMTA 2RPNA 4IUTA 1SEMA 3VS2A 4NL3A 2VYTA 3CPWS 4A4GA 1MNDA 2ZPFB 2BE7D 1SRMA 1TUCA 2EAYA 2XDDA 3JCMX 5IHIA 4E7LA 5HKCA 3I56T 4FIBA 2CZ1B 4BB7A 2PVOB 3PTAA 1VQPT 2RK2A 3QKJA 4XTWA 1HK9A 3BDUA 3RMQA 2O4XB 1N8RU 5CKDA 2H8HA 4AG2C 1LPLA 1U5SA 2CP2A 2I0NA 2YHTA 4A4HA 1VIFA 4J9EA 1B34A 2K5LA 3CCVT 3GLXA 2EVRA 2HNIA 3A8GB 1OU9A 2E6NA 3OYMA 4KGXB 2ZPBB 1YJWA 1YFNA 4EMKB 4M77A 4E7HA 4M75A 2K5FA 1SF9A 4AFZC 4LNPA 4M75F 2CT3A 2J05A 3HRUA 3HHTB 4LD6A 2RQTA 3EGUA 3HL8A 1NZ9A 4OMMA 2VGMA 2MCNA 4JPBW 2EYQA 1KD1U 4DBQA 1NEBA 1AWXA 1U1SA 2RHYA 3G6ET 4PFPA 4Q5WA 3REAB 3JB9D 2BZ8A 2LCSA 1G83A 1VQ7Q 2G6FX 2KQWA 2O31A 1QKWA 4KH1B 1VQ4T 2Y90A 2HZYA 4JDSA 1BIBA 4QQ6A 2M9UA 3MO8A 4FU6A 4M7AD 4OMNA 1Z9ZA 1QQJA 2EQUA 4PJOA 3TCJA 2DYBA 1VQMQ 1H3HA 1T3SA 2J6KA 2WACA 3S3MA 2IIMA 3GNGA 2JN0A 5LL6S 2CSIA 3E2UA 2M0YA 2GTOA 3CCRT 5FU7B 5KYWB 1BCMA 1T0JA 2RJCA 4FL6A 1W6XA 1TOVA 1TWBA 3HSBA 4JZ4A 5CK9A 1X69A 4JJDA 1VQ6T 2DK3A 3RDVA 3JCMc 4IUVA 1R8OB 4HCCA 1VQ7A 3CCQQ 1I5OB 2RI3A 3A8HB 1BU1A 1XTDA 2SRCA 2GBQA 1B7TA 2CDTA 1VQMA 1Q81C 3OS0A 2DL8A 5IXFA 4QQDA 1D3BB 2DEUA 4BUGA 3EG1A 1AWJA 1W2BS 2FPFA 1G8XA 2PZ1A 4O6JA 3UATA 1NLOC 1TS9A 2X35A 4M78C 1Q81R 4JLIA 2ZZDA 2A37A 1F1BB 3CC2Q 5KCHA 3TQ7P 2NUPB 5CR2A 3RKXA 4M7DE 2AZSA 4C92E 2CREA 4N0AA 2JOYA 3QG1A 3P8DA 1D1AA 4Y91A 2HKQB 2AK5A 1KC8R 2L89A 3CC7Q 1KHCA 4KGVB 4RUGA 4WCIA 4KUDK 3OMGA 1G5VA 5CKHA 4M77D 1NPPA 5L8RE 1YJWT 4M75D 2NUTA 3KXTA 2LJ3A 2RB6A 3TSZA 4JJNK 1VQKQ 2E3IA 3CMAA 1VIEA 3JCMe 1TUGB 3JV3A 4C5IA 4OMQA 1D1CA 1UE9A 2XI9A 3E9FA 3SHWA 1UGVA 1ZSZC 5FLXE 1IHVA 2JTMA 5GJVB 1UG1A 4FW1A 4PKCC 2RHIA 2VGNA 3MCAB 4WTOB 1YP5A 2KYMA 4C0DB 2AZVA 1HYOA 1VUBA 4ORZA 3SD4A 3CCUQ 1SKUB 1BIAA 1OU8A 2YUOA 1ZUUA 2DRMA 3TVTA 2LJ0A 4C8QA 3ASKA 3CCSQ 1KQSA 4PJOD 4C8QF 1QVGS 3L42A 3MEWA 3G71A 3M55A 4B6MA 4RTZA 8AT1B 4O5VA 3DLMA 1AHJB 3JB9J 3CCUA 2M0OA 4J7FA 1XNIA 1VQ7T 5IT9E 3WVDB 3UDCA 2VVKA 2DILA 2XKOC 3JSCA 2AKKA 4PFOA 1ZHIA 1VQMT 5A0DA 4L5GA 1WHMA 2BZYA 4N4GA 2JMAA 4RTUA 1I07A 1X75C 1W1FA 3EG0A 5CIUA 1WX6A 3OYEA 3GP8A 4ME7A 4F7UG 1RAAB 3JCMd 3EGDB 2KT1A 3M4GA 1AVZC 4QKUA 4J9CA 2OTJQ 1AEYA 2KK4A 1H3ZA 3FDRA 3CCQT 2DXUA 2C0TA 3LGLA 4FYYB 2EW3A 2DXBA 1I0CA 3R6OA 4F16A 2VWFA 3I5RA 2DEQA 4KT0E 1Y96A 1KQSP 2EQMA 2D9TA 2QXFA 3MPUB 4OMFB 4M7AB 1R0BG 2RF0A 2W10A 1KHIA 1WYXA 3CC2T 4RCCA 3QWYA 1H92A 2CKKA 3O5ZA 2JS2A 3G4SQ 1BKBA 4JRQA 2FPEA 5GAOl 4EDUA 1ZSZA 2D0QB 4JJCA 4OP0A 1VQ5Q 2X4WA 4E7JA 1KIKA 3PMIA 4RKUE 1UEBA 4BY6B 1EX4A 4JRPA 4D8DA 1OPKA 4BE1A 3H9NA 2IG0A 1VYVA 3NMZC 1K76A 2HSEB 5CQYA 1VQKT 3LWIA 1WPYA 4FYWB 2HQXA 2DIQA 4M7DG 1VQ5A 4C92G 2FZGB 4C8QD 1D0YA 1H8KA 2QEXA 4LE9A 1GCQA 3CCEQ 2DE0X 1D0XA 3I55A 3M0SA 1YJNA 1ZUYA 2BUDA 1N8RC 1I4K1 3RBBB 3MEVA 4KGZB 1WJQA 1BI3A 3ZFJA 1WGSA 1B34B 2YUNA 5KYXB 2J06A 3CXCS 3C94A 2F69A 3PNWC 1N8RR 3CCUT 3HKSA 4M77B 4M75B 1QMCA 2O9VA 4ELZC 1QVGA 4LDVA 3LYIA 3TEEA 5C0MA 3UA6A 2XICA 5HK3A 4OB3B 1IB8A 3BFMA 2GCXA 9ATCB 2QG9B 2QA4A 1NM7A 2RQVA 4KUIA 1ACMB 2WSEE 3V7RA 2EYZA 1RAFB 3RESA 2K2MA 2BZXA 3VS5A 1KD1C 1M8MA 1G3TA 1NG2A 4FW2A 4OVAA 2RQWA 4L59A 4MZMA 3S3OA 5J39A 5CAIA 4M7DC 4C92C 1X27A 3M9QA 4EMHA 3LX7A 1KD1R 1RL2A 2LNVA 1QW1A 1VQNQ 3L2RA 4XTYA 4PJOB 2QDLA 2KYBA 2RJFA 2EGAA 2ROTA 1AT1B 2DBMA 3H0IA 3RIRA 2OTJT 2EBPA 2CGHA 1M3AA 3EAEA 4Y28E 1VOMA 3RKWA 1YWPA 4B9XA 1O75A 1V1CA 4VUBA 4DBFA 3C0CA 3JB9H 2LRQA 4IIOA 1QVGP 5GAN8 1VQNA 4F7UA 1VA7A 1RI0A 3M59A 2JUFA 1UFFA 5D6YA 3PIOA 2D8JA 4LDUA 3MHXA 1ZUKA 2J7IA 5GMKi 2XD0A 2VKNA 2DX1A 1SG5A 3CEYA 1BB9A 3VS0A 1X2QA 4NL2A 3G4ST 1A0NB 5CKBA 4BDZA 3VKIA 5KYNA 2LQ8A 3CCJQ 1M90C 2COZA 1VQ5T 5GAN2 2HD0A 2VV5A 4BI3A 2CYZB 3PFSA 2QEXT 4OMOA 3OS5A 2MYSA 2E64A 5EG2A 3L2WA 2OJ2A 2AKLA 4D6WA 2MMPA 1M90R 1Y0MA 4XTXA 3JB9F 2VXFA 2ZPHB 4II1A 2LX7A 4HCZA 1XQHA 4E7ZA 1QCNA 4RCBA 2NYSA 3FJ5A 4M7AF 4ELYC 4ZGDB 3M0QA 4E7IA 2DL4A 3CCRA 4OB2B 4RTWA 3A5ZB 3OQ5A 2B8AA 4LN2A 3OYBA 3CCLQ 2KDSA 4OB1B 1SHFA 3QJ6A 3ZBDA 1M9SA 2F2XA 2QA4T 2VC8A 2KNBB 2DYIA 3QPHA 3EH1A 5A0GA 3CXCA 2KT8A 2LCCA 3MP6A 4C0GA 1UHCA 4Y92A 4EPCA 3X20B 1YCYA 2JM9A 2DJQA 2RHZA 2VXEA 2HKNA 2QQAA 3TREA 1NYFA 3CCLA 1LVKA 1OX8A 2L3QA 4AFQC 4C8QB 1VYUA 1T3LA 4DOWA 1WQWA 1I5LA 2DXTA 4MZTA 4PJNA 5KE2A 3WVEB 5GJWB 1X6OA 4RG2A 1X6GA 5CO7A 1M5Q1 4JS4A 1ZQ1A 2HBWA 3H8ZA 1EFNA 2LVMA 4Z02A 3SWNC 1VQNT 4M77F 4C0ZA 2DETA 3RMSA 2L0AA 2P0QA 1NE8A 3ZEHA 2YSQA 1SSFA 3M58A 4DEYA 4BDYA 2F5KA 2FVUA 4HXJA 2E5KA 1PNJA 2X4JA 2HMAA 3CXCP 3QDFA 4A53A 1FMWA 1WLPB 3JCMh 3CCMQ 3EHRA 1VQOQ 1UHFA 3J7AF 3BE3A 2FRYA 3QBYA 3QZ5B 2QI2A 2HEQA 3EG9A 1BK2A 4M78G 5LJ5f 1RI9A 2ABLA 1X6BA 1HJDA 3LH5A 1O9SA 3FJPA 2XK0A 5LJ3e 4C5HA 2QGGA 2O88A 3M57A 3EG2A 3V8KA 4PJOF 3HFOA 1VQOA 3OMCA 1WFWA 1WQ7A 3JAME 4DBHA 1UGSB 1IREB 5CVIA 3A1PA 2E70A 4E7KA 1Q82U 1M27C 2P4RA 4CI0C 3G1JA 4X9DA 5KE3A 3KUFA 3SB2A 4ZTFA 4V2SA 1JEGA 4JLGA 3PE0A 2GQVA 2RQRA 2XHCA 2EJGA 2XDBA 2CUDA 2D8HA 2KRMA 1I8FA 4A4KA 1UTIA 1IHWA 8ATCB 4C5GA 3OYCA 1YHQQ 4M7AE 1H641 4RTTA 3CCLT 1IRXA 1M4ZA 4MDXA 2A0FB 4ZTJA 3CCQA 3O8VA 1M90U 4QVDA 1E7OA 1KJWA 4N4HA 3TSWA 2EYWA 5IH2A 2A08A 4GLMA 5FW9A 1YNZA 3HFNA 3H0HA 5AYFA 3EFSA 2O2OA 5GAMe 2DZCA 1K0SA 1E6HA 2JT4A 2K2VA 5GAOq 1JU5C 3OYIA 3FRNA 2DBKA 2MI6A 2F1LA 4E7SA 3NTKA 2ROLA 4GBQA 1YHQA 3QSUA 2LDMA 3CPWA 5KYYA 2DL7A 4FYVB 5LJ3d 3SWNA 1D0ZA 1GBRA 3CC2A 1SHGA 3OA6A 5FWBA 1NLPC 2L2PA 2B86A 2V26A 3X28B 6AT1B 3M4YA 2A3LA 2MPXC 5LJ3g 3JRZA 1B3QA 3JCMb 2LP5A 2R58A 3HTRA 1JXMA 2PUKB 3NHNA 1UJ0A 4MMKA 3CC7A 1M3BA 3HPWA 1BI2A 3INZA 1OZ2A 2HQHA 2KRNA 2LZ6B 1UDLA 1GL5A 4BI4A 3QYGB 1TU0B 4RTXA 5FU7C 4HT9A 4R0KA 3PVLA 1GFDA 1VQKA 4QT7A 3RKYA 3P8BB 1RABB 1UGPB 4ANJA 4A4EA 5KYUA 2FRWA 2EQIA 4M77E 4FYXB 4FCYA 2VB6A 4M75E 4J7IA 1PSFA 2E1HA 2ESWA 3CBOA 2DRKA 1PCXA 4LXCA 5GANe 1VQOT 5D6WA 3OW2S 3UWNA 2EJFA 4XAXB 2QYZA 4IIMA 3AT1B 2DNUA 7AT1B 5GAMd 2CUBA 4ZN1A 1ABOA 2L3SA 3CPWP 1OPLA 1M1KU 2PU9B 4MMLA 1X43A 1KFZA 2EQKA 2BTTA 2DA9A 5HCKA 2KGTA 2KROA 1UJYA 4TVRA 1VQ8Q 2CP7A 4LD9K 2EWNA 1P92A 3CCSA 1YITQ 5GAMg 2HAXA 2P4TA 2IVWA 2LTOA 2QDYB 4M4ZA 5GAN5 4F17A 5I21A 3BDLA 3A8MB 1YI2Q 2DLPA 4M78A 5LJ3f 1QVFS 2RD1A 2VASA 4CRIA 1TTHB 2FEIA 1KK7A 3VYHB 4PJOE 3I5SA 1PSEA 2CP0A 1GBQA 3OYYA 1SSHA 4E47A 2EGEA 2JS0A 4PL6A 3X24B 5GMKl 4HCBA 5GAN7 2PTKA 1MHNA 3A8OB 1Q95G 2ATCB 1MV3A 2YLBA 1N9SA 1FWZA 1Q7YU 1B07A 1JO8A 1PD0A 4KBMB 1FXXA 4L6V5 4C5EA 1W2BA 3CBPA 5J3BA 2PVDB 1YHQT 2D6FA 2DPPB 2JMCA 3DKMA 1QP2A 2CS7A 3L2ZA 4BI8B 3RUXA 1RAGB 2OTJA 2KY9A 4LDXA 1BI0A 2EYYA 2MOXA 5IXBA 2ENMA 3EFOA 2KXCA 4C0DC 5GANd 4JJBA 3MJXA 1YJ9Q 2EYXA 1M2OA 1CKAA 1S1NA 2FO0A 3KBGA 4R55A 3CD6Q 2YLCA 1MMAA 3Q1JA 5M9OA 1KSWA 1NYGA 2JJ9A 2RHUA 2X3XD 3MEAA 5A0LA 5GANg 5GAMf 1NPRA 3CC7T 2K3XA 5FU6B 4BE2A 1IO6A 1TUDA 3J81E 1BBZA 5CKEA 2QAZA 2GFAA 1EIFA 5EC7A 3G4SA 4CC7A 4ZNXA 3VV0A 2C06A 4FSXA 1WHJA 1BI1A 1PHTA 4PFZA 3AHUA 3HRTA 3OS2A 3C12A 1M30A 2V8JA 4A63B 3UF4A 3CC4Q 1M1GA 1RADB 2R5AA 3CD6A 1C0MA 1V29B 4XU3A 5IAYA 2F2VA 3M0PA 4NS5A 3NPFA 2K6DA 5GAN3 4FSSA 1HSQA 5J26A 1W2BP 5FRNA 4R56A 1S72Q 1JJ2S 2FZCB 1MMGA 1NJIU 2KEAA 1Q86C 2RJDA 2E5QA 2DAQA 3LH0A 3L2VA 1K9MU 2NUPA 1Y7XA 2XU8A 5FRMA 4OGEA 2DTIA 3CCST 1OYXA 3CCEA 1RAIB 4IUUA 1K0XA 2CP3A 3U23A 2M16A 4M78D 1C1AA 3PT9A 2C0OA 1S72A 4K11A 4C8QE 3LLRA 3NFCA 4X34A 1RAHB 3C95A 2QQBA 2ZAEA 2K9GA 2EJ9A 5GANf 2BE9B 1G2BA 4IUQA 3NTHA 1K1ZA 2D0NA 5LJ3j 1AZEA 3VS3A 1QVPA 2KVQG 2FHDA 4M77G 2D1XA 4PLLA 3VS7A 5GAOn 3I56Q 2MAMA 4M75G 1EZZB 2F5TX 3OYFA 3PIPA 1YI2T 2AHJB 1U8RA 4BY6C 3UPUA 1ZLMA 4FT4A 2OTLQ 1ZA2B 1AWOA 3ULRB 1U1TA 4PK4A 2A7YA 5LJ5e 2K79A 2QQ9A 3OYDA 1Q82C 5HY6A 3L2UA 1R77A 4BD3A 3V7SA 2DTHA 2HQEA 1LNXA 5L23A 4GY5A 1W4SA 3GPLA 5GAOm 4DA4A 3EFRA 2EIFA 4GLKA 2KE9A 1Q82R 1YIJQ 2OAUA 2QK0A 4F7UF 2RJEA 4IUPA 1RUWA 2DFUA 2QTXA 3CMEQ 1ZX6A 3DLLA 2OTLA 2GNCA 2XG8D 3I9QA 1J3TA 3X26B 4J6YA 1M3CA 5FROA 1ARKA 3SFMA 1TXQA 1D09B 1VQ9Q 2GGRA 3D7SB 2PVGB 1UECA 3G6EQ 1ZBXA 1AD5A 3OYKA 4OF1A 5GAMj 1N9RA 2J6FA 1WDXA 4M77C 2MF2A 4M75C 2KRSA 3URGA 2DVEA 5IN1A 3CD6T 4AFUC 4Z89A 1VQ4Q 1FYNA 5I2SA 2KAFA 3FEOA 1G3SA 2O9SA 2VUBA 3CBMA 2YRCA 4DEXA 2Y4XA 3JCMV 3CMEA 2E10A 1C6VX 3EH2A 3EGDA 3MP1A 1VQ9A 1WXUA 1K4US 2YXYA 3CCJA 2MK5A 2NUTB 4AG1C 2JTFA 1VQ6Q 1YWOA 4CC4B 2CP5A 3KFVA 1N5ZA 3H6ZA 2A36A 4AFSC 4XU0A 4A54A 4AT1B 1WZOA 1RLQC 3CCET 5LJ5d
chains in the Genus database with same CATH topology
4JLGA 1WJRA 1JJ2A 2M0OA 1KG1A 4J7FA 4J8OA 1K73U 1S72T 1XNIA 3LGFA 1VQ7T 3VJPA 3BY7A 4M7AC 5IT9E 2GQVA 2XHCA 2EJGA 2DD4A 2P0PA 1MGQA 3ER0A 3WVDB 3UDCA 3HRSA 2XDBA 2XKOC 3JSCA 2CZ0B 4M7DA 3PMTA 4C92A 1I8FA 2ZPGB 4A4KA 1ZHIA 5LJ5g 1VQMT 1VQ8T 3GIBA 1XOVA 5A0DA 4L5GA 4RMOA 4N4GA 4PNOA 3JCMQ 1X75C 4C5GA 1YITT 3OYCA 5CIUA 5GMKm 2KSSA 4J5YA 4RG8A 3OYEA 3GP8A 1UGQB 4ME7A 4F7UG 4ZGJB 4M7AE 1H641 5KH6A 3JCMd 4JUVA 5D6XA 3CCLT 3FIFA 1VQLA 1M4ZA 2R5MA 1QVFA 3M4GA 5GANj 2DJZA 3FB9A 2K4YA 4ZTJA 4MDXA 3CCQA 3O8VA 4WF2A 4QVDA 4UC4A 1UB4A 5GMKe 1M90U 4N4HA 2KK4A 4PLIA 5CCAA 3FDRA 3CCQT 1H3ZA 2DXUA 4X9CA 1OZ3A 3VUZA 4DOVA 3JB9I 1G3YA 3HFNA 5AYFA 3M5AA 2GF7A 3EFSA 5FU6C 3LGLA 5GAMe 2DZCA 2DXBA 5GMKh 4J6WA 2EQJA 3R6OA 2HBPA 2K2VA 4M78E 3V8JA 1KQ1A 5GAOq 2DEQA 4KT0E 1Y96A 3OYIA 3FRNA 4J83A 2EQMA 3M56A 2D9TA 2QXFA 2MI6A 3V7CA 5GAMh 1M1KC 3NTKA 2X4XA 4OMFB 1YHQA 3I56A 4M7AB 2YRVA 1Q86U 1X01A 2LDMA 3QSUA 3CPWA 1Y71A 3DB4A 1GXIE 2EFIA 2GFUA 5LJ3d 3SWNA 1VQPA 1KHIA 3CPFA 3CC2A 2EKOA 3OA6A 3CC2T 3BW1A 1WJSA 2E12A 4NOYA 4RCCA 3VUBA 2V8IA 1I81A 2QQRA 2CKKA 4N0AC 1UGRB 3X28B 2H3JA 3M4YA 1K8AU 1BKBA 4C8QG 4JRQA 3CCVA 5GAOl 2A3LA 3OS1A 1OI1A 4PJOG 5DLQE 5CKFA 4EDUA 2RM4A 2FB7A 2D0QB 2Y4YA 4M78B 3JRZA 4OP0A 5I2MA 4QVCA 5LJ3g 4XU1A 3JCMb 3META 2X4WA 2R58A 2K5IA 4E7JA 3QJYA 4B9WA 3OY9A 1YJ9T 3PMIA 2PUKB 2PUOB 4MMKA 4RKUE 1UEBA 4BY6B 3SDZA 3CC7A 4JRPA 3HPWA 1BI2A 3INZA 3FLGA 3GF5A 4BE1A 1OZ2A 3L2QA 2IG0A 5HK0A 3M53A 1YIJA 2FL7A 2R57A 4ZN3A 3DB3A 4BI4A 3QYGB 1YIJT 3QYHB 5FU7C 4HT9A 1DJ7B 2DO3A 1VQKA 2DD5A 3RKYA 5GAOp 1KQSS 3P8BB 4DQ2A 5CQYA 1Q7YC 1VQKT 1Y96B 1UGPB 1WPYA 2QQSA 3LWIA 2DIGA 4A4EA 2HQXA 2DIQA 3CMET 1IZ6A 4M7DG 4JRKA 1VQ5A 4C92G 2CZ6B 3QZ9B 4C8QD 4M77E 2QEXA 1JBMA 4F7UE 4MDWA 4M75E 3OYGA 1VQ9T 4J7IA 3G6EA 4XTVA 3SWNB 3LWHA 3PGGA 2NLUA 3CCMA 1PSFA 2E1HA 3S3NA 2WSCE 3CBOA 5LJ3h 3I55A 5GANe 4MZPA 1VQOT 5D6WA 1YJNA 2BUDA 3CCJT 3OW2S 1N8RC 1I4K1 3I55T 3M54A 3UWNA 2EJFA 3MEVA 4XAXB 3JCMP 2OTLT 3CC4T 1WJQA 1YJNT 2DZ9A 3RERA 1BI3A 3ZFJA 1VQ4A 5GAMd 1WGSA 1YBYA 1B34B 4ZN1A 2BIVA 5GANh 2ZPIB 1M1KU 3CXCS 2PU9B 3S6WA 4MMLA 3C94A 4M7AA 1LJOA 2EQKA 2F69A 3PNWC 3CCUT 4BE0A 3HKSA 3C4SA 2XIDA 4TVRA 4C0FA 4C8QC 4M77B 5DY9A 4LD9K 3F70A 4V2SA 2EWNA 1P92A 3CCSA 4PJOC 4M75B 4KULA 4ELZC 3VYGA 5GAMg 2LX9A 2HAXA 1QVGA 2PQWA 4M7DD 5GAOr 4C92D 2P4TA 4LDVA 2IVWA 2LTOA 3LYIA 3TEEA 5C0MA 2QDYB 5HK3A 2XICA 5GAN5 4OB3B 4M7DF 4C92F 3OYAA 5I21A 2RO0A 3BFMA 3BDLA 3A8MB 3QDRB 1VQ6A 3TU4K 2JNGA 4M78A 2ZPEB 2GCXA 5LJ3f 3V8LA 1QVFS 2RD1A 2QA4A 4XQ3A 4CRIA 4IURA 4P5NA 4KUIA 1HXDA 4LDWA 3VYHB 2WSEE 4PJOE 3V7RA 5GAN6 3MP8A 5CQXA 3RESA 3LW5E 1N6AA 3E19A 1PSEA 4HA8A 1VQLT 3OYYA 1KD1C 3OYJA 2BKDN 2KMTA 4E47A 4EMKC 1G3TA 4IUTA 4PL6A 3X24B 5GMKl 5GAN7 4HCBA 4OVAA 4L59A 4MZMA 3S3OA 5J39A 1MHNA 5CAIA 4M7DC 1WNLA 4C92C 3A8OB 4NL3A 2YLBA 3M9QA 1N9SA 4EMHA 2L3RA 1FWZA 2VYTA 3LX7A 4FT2A 3QXEB 1RL2A 2LCLA 3CCUA 3L1AA 3OBWA 3CPWS 1Q7YU 4A4GA 4KBMB 2ZPFB 1FXXA 3JCMW 4L6V5 4C5EA 2LNVA 1W2BA 1NJIC 2EAYA 3N5BB 1QW1A 3CBPA 5J3BA 3L2RA 2XDDA 2PVDB 2RK1A 4XTYA 3JCMX 1K9MC 4E7LA 1YHQT 5HKCA 3I56T 2D6FA 4PJOB 2DPPB 4FIBA 2CZ1B 2RH2A 2RHXA 4BB7A 2RJFA 3DKMA 1QP2A 2CS7A 2LT1A 4OB0B 2PVOB 3L2ZA 4BI8B 3PTAA 3RUXA 4JS5A 1VQPT 1KC8C 2OTJA 2RK2A 3QKJA 2KY9A 1HK9A 4XTWA 3BDUA 1BI0A 3RMQA 4LDXA 2O4XB 1N8RU 3RIRA 2OTJT 5CKDA 2CGHA 1BYMA 2YHTA 4C0DC 4A4HA 3EAEA 1VIFA 3HP9A 5GANd 4Y28E 1B34A 2K5LA 3CCVT 3GLXA 3RKWA 3A8GB 2HNIA 4B9XA 1O75A 4VUBA 4XTZA 2E6NA 3OYMA 3JB9H 3KBGA 2LRQA 2ZPBB 4R55A 4QQGA 1YJWA 2YLCA 3A8LB 4EMKB 3Q1JA 4M77A 5M9OA 5GAN8 1VQNA 4F7UA 4E7HA 2RHUA 3MEAA 4M75A 5A0LA 2K5FA 5GANg 1RI0A 3M59A 2JUFA 5GAMf 1NPRA 3CC7T 2K3XA 4M75F 5FU6B 4BE2A 1G3WA 5D6YA 3J81E 3PIOA 3HRUA 3HHTB 4LDUA 5CKEA 3MHXA 2XD0A 5GMKi 2I2LA 4ZGEB 3E9GA 3CEYA 2GFAA 1EIFA 4LD6A 3G4SA 2G3RA 4NL2A 3VV0A 3G4ST 2C06A 4FSXA 3HL8A 1NZ9A 3OSSC 5CKBA 1BI1A 4BDZA 4XU2A 2L5QA 3AHUA 3HRTA 3OS2A 3C12A 3VKIA 2VGMA 2LQ8A 2V8JA 1M90C 2E41A 1VQ5T 2EYQA 3VU3C 5C6SA 2HD0A 2VV5A 4BI3A 5GAN2 2CYZB 1KD1U 3PFSA 2QEXT 1M1GA 4ZTFA 2R5AA 5LJ5j 3CD6A 1U1SA 2RHYA 3QIIA 4LDYA 3OS5A 5DM7R 3G6ET 1V29B 4XU3A 5IAYA 3CCMT 2E64A 5EG2A 4Q5WA 4NS5A 3L2WA 3JB9D 5GAN4 4D6WA 5GAN3 2MMPA 3E1SA 3OBYA 4J6XA 5J26A 4XTXA 5FRNA 2VXFA 3JB9F 4R56A 1JJ2S 2ZPHB 2RA2A 4II1A 2KQWA 1VQ4T 1QP3A 2Y90A 4HCZA 4JDSA 1BIBA 4QQ6A 2M9UA 3MO8A 1XQHA 4FU6A 3OYHA 1NJIU 4M7AD 1Q86C 5KCOA 2RJDA 2E5QA 2DAQA 3LH0A 3L2VA 4RCBA 2EQUA 2LC4A 1K9MU 3TCJA 4M7AF 1Y7XA 4ELYC 4ZGDB 4PJOA 2WACA 2XU8A 3S3MA 5FRMA 4E7IA 3GNGA 5LL6S 2JN0A 3QO3A 4OGEA 4F7UB 5A2QE 3CCRA 1KQ2A 2DTIA 4OB2B 2O4XA 3CCST 3CCRT 3A5ZB 1OYXA 5FU7B 3CCEA 4IUUA 3OQ5A 2RJCA 4FL6A 2B8AA 3OYBA 3HSBA 3OSVA 2KDSA 2FYKA 2M16A 4OB1B 5CK9A 4M78D 3PT9A 2O01E 3QJ6A 1VQ6T 2DK3A 1M9SA 3ZBDA 1S72A 3JCMc 4IUVA 1R8OB 4HCCA 1VQ7A 4M78F 4QVZA 4C8QE 3LLRA 2RI3A 3NFCA 2QA4T 2VC8A 4X34A 4EMGA 3A8HB 3C95A 3QPHA 4EMKA 5A0GA 2LCCA 3MP6A 3CXCA 1XTDA 2QQBA 2EJ9A 3GNFB 4C0GA 5GANf 1VQMA 1VQ8A 1Q81C 4EPCA 3X20B 3OS0A 1M8VA 4IUQA 1YCYA 4QQDA 1N27A 1D3BB 3NTHA 1YITA 4BUGA 5LJ3j 2RHZA 2VXEA 1QVPA 1W2BS 2QQAA 2KVQG 2FHDA 3QUIA 2ZCFB 4M77G 4O6JA 4PLLA 3TREA 5GAOn 3OYLA 3GOXA 3CCLA 2MAMA 4M75G 2X35A 3P8HA 4M78C 3FC3A 3MEUA 2F5TX 2ZZDA 4JLIA 1YI2A 2P0KA 3OYFA 1Y07A 3PIPA 1YI2T 4C8QB 3UT1A 2K3YA 5KCHA 2AHJB 3QHSA 1WQWA 4DOWA 1U8RA 2MWOA 3ME9A 5CR2A 4BY6C 3RKXA 3UPUA 1I5LA 4M7DE 4C92E 2DXTA 4N0AA 4FT4A 2JOYA 3JCMg 4XK8E 1U1TA 3QG1A 4MZTA 2A7YA 3G7ZA 5LJ5e 5KE2A 1TH7A 2QQ9A 3OYDA 3P8DA 1Q82C 5HY6A 3L2UA 3OB9A 4Y91A 4BD3A 3WVEB 3V7SA 2DTHA 2DXCA 2HQEA 1X6OA 1LNXA 4IKFA 4GY5A 4RG2A 2L89A 3JCMJ 2LQKA 1KHCA 1W4SA 5CO7A 1M5Q1 5LJ5h 3GPLA 1K73C 5GAOm 4DA4A 3EFRA 4JS4A 1ZQ1A 4KUDK 3OMGA 1G5VA 5CKHA 3H8ZA 1JRIA 2EIFA 4GLKA 4M77D 3JB9G 1NPPA 2X4YA 5L8RE 1LOJA 2LVMA 1YJWT 4Z02A 4M75D 5DLOA 2OAUA 3J80E 3SWNC 1VQNT 4M77F 4C0ZA 3KXTA 3RMSA 4F7UF 2RJEA 4IUPA 2RB6A 2P0QA 1NE8A 2CZ7B 3ZEHA 4C92B 1SSFA 4JJNK 4M7DB 2QTXA 2DKGA 4N4IA 3M58A 4BDYA 2F5KA 2RI2A 4M7AG 3CMAA 3DLLA 1VIEA 2OTLA 2FVUA 2XG8D 3JCMe 2L8DA 3CMAT 3X26B 4J6YA 5FROA 4C5IA 1JB0E 2X4JA 3SFMA 5GMKj 2XI9A 3E9FA 1YJ9A 4YTLA 2PVGB 5FLXE 2JTMA 4OGCA 4A53A 1ZBXA 4PKCC 2XDPA 4QW2A 3JCMh 3OYKA 4OF1A 5GAMj 3J7AF 1N9RA 3QBYA 3QZ5B 2RHIA 2QI2A 4M77C 2MF2A 1Q81U 2VGNA 3MCAB 4M75C 3T9NA 2DVEA 4M78G 5IN1A 3URGA 5LJ5f 3CD6T 1D3BA 5I2SA 2KAFA 3FEOA 4HKEA 1O9SA 4C0DB 1G3SA 2VUBA 2LT4A 3CBMA 4XTUA 4ATOA 2E6ZA 1VUBA 3SD4A 2Y4XA 3FJPA 3JCMV 3CMEA 2E10A 1M1FA 1BIAA 2ZGWA 2XK0A 2K57A 2E65A 5LJ3e 3MP1A 4C5HA 3WXMB 4C8QA 1VQ9A 1KQSA 3ASKA 3NTIA 2DTOA 4PJOD 3M57A 4C8QF 1QVGS 3V8KA 3L42A 3MEWA 3G71A 3M55A 3HFOA 4PJOF 1VQOA 4HT8A 3CCJA 2M1HA 2V8KA 3OMCA 4JRIA 3G71T 1KC8U 1WQ7A 3OYNA 3CC4A 2JTFA 4FM4B 3JCMf 3JAME 4O5VA 3DLMA 1UGSB 4A4FA 4BACA 1IREB 3H6ZA 1K8AC 2JVVA 4XU0A 1AHJB 2E70A 2WSFE 5CVIA 4A54A 4E7KA 1FX7A 1Q82U 3JB9J 3CCET 4CI0C 2MWPA 2JZ2A 3OW2A 4X9DA 3X25B 5KE3A 5LJ5d 3KUFA 3SB2A 2RI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JLI A;  4XTZ A;  4M7D G;  4JRK A;  4C92 G;  3JB9 H;  4C8Q D;  4M77 E;  4C8Q B;  1JBM A;  4F7U E;  3BY7 A;  4M7A C;  3QHS A;  1WQW A;  2YLC A;  4M75 E;  4M77 A;  4EMK B;  5GAN 8;  2EJG A;  1MGQ A;  4F7U A;  4XTV A;  3SWN B;  3RKX A;  4M75 A;  3PGG A;  1I5L A;  4M7D E;  5GAN g;  4C92 E;  2DXT A;  5GAM f;  2E1H A;  5LJ3 h;  4M75 F;  4M7D A;  4N0A A;  4C92 A;  1I8F A;  5GAN e;  5LJ5 g;  3GIB A;  1I4K 1;  3JCM g;  3JCM P;  2EJF A;  1U1T A;  4M78 C;  2DZ9 A;  5LJ5 e;  4PNO A;  3JCM Q;  3RER A;  1TH7 A;  5GMK i;  2I2L A;  5GAM d;  5GMK m;  1B34 B;  4Y91 A;  4J5Y A;  3V7S A;  2DTH A;  5GAN h;  4F7U G;  4M7A E;  4NL2 A;  1H64 1;  1LNX A;  3JCM d;  4MML A;  3JCM J;  4JUV A;  4M7A A;  1LJO A;  3FIF A;  5LJ5 h;  4XU2 A;  3AHU A;  1M5Q 1;  5GAO m;  3EFR A;  3M4G A;  5GAN j;  2DJZ A;  3FB9 A;  2E41 A;  4C8Q C;  1JRI A;  4WF2 A;  4M77 D;  3VU3 C;  4QVD A;  4M77 B;  5DY9 A;  5GMK e;  5GAN 2;  1LOJ A;  3JB9 G;  4V2S A;  2EWN A;  2DXU A;  4M75 D;  4X9C A;  4M75 B;  5LJ5 j;  3SWN C;  4PJO C;  1U1S A;  4M77 F;  5GAM g;  3HFN A;  3JB9 I;  4F7U F;  4M7D D;  5GAO r;  2RB6 A;  4C92 D;  4M7D B;  3EFS A;  4XU3 A;  4C92 B;  5GAM e;  2DZC A;  2E64 A;  2QTX A;  2DKG A;  3JB9 D;  5GAN 4;  5GAN 5;  4M7D F;  5GMK h;  5GAN 3;  4C92 F;  4J6W A;  4M7A G;  4J6X A;  5I21 A;  3BFM A;  4M78 E;  3V8J A;  5GAO q;  1KQ1 A;  4XTX A;  3JB9 F;  2VXF A;  3JCM e;  2DEQ A;  4J6Y A;  4M78 A;  2RA2 A;  1Y96 A;  5LJ3 f;  3V8L A;  2RD1 A;  1Y96 B;  3V7C A;  4XQ3 A;  5GMK j;  5GAM h;  2Y90 A;  1BIB A;  1HXD A;  4M7A D;  4M7A B;  4PJO E;  3V7R A;  4A53 A;  5GAN 6;  1X01 A;  3QSU A;  3RES A;  3JCM h;  4RCB A;  4PJO A;  5GAM j;  4M7A F;  5LJ3 d;  1N9R A;  4HA8 A;  3SWN A;  4M77 C;  2JN0 A;  3QO3 A;  4EMK C;  4F7U B;  5GMK l;  3BW1 A;  4M75 C;  4NOY A;  4RCC A;  2DTI A;  2DVE A;  4M78 G;  5LJ5 f;  1I81 A;  5GAN 7;  1KQ2 A;  1D3B A;  5CAI A;  4M7D C;  4N0A C;  1WNL A;  4C92 C;  4NL3 A;  2YLB A;  4XTU A;  1N9S A;  4C8Q G;  4EMH A;  5GAO l;  3HSB A;  2FYK A;  4PJO G;  3FJP A;  3JCM V;  4M78 D;  3L1A A;  2RM4 A;  2FB7 A;  4M78 B;  2E10 A;  4OP0 A;  5LJ3 g;  4QVC A;  3JCM b;  4XU1 A;  1BIA A;  3JCM c;  3JCM W;  2ZGW A;  2K57 A;  2E65 A;  4M78 F;  4C8Q E;  5LJ3 e;  2EAY A;  2VC8 A;  4EMG A;  4C8Q A;  3JCM X;  4XTY A;  2DTO A;  4PJO D;  4MMK A;  4EMK A;  4PJO B;  4C8Q F;  3V8K A;  2EJ9 A;  3INZ A;  4PJO F;  3HFO A;  5GAN f;  4HT8 A;  3L2Z A;  4JRI A;  3RUX A;  1WQ7 A;  4XTW A;  1HK9 A;  1M8V A;  3BDU A;  1YCY A;  3RIR A;  1D3B B;  3JCM f;  2CGH A;  5LJ3 j;  4HT9 A;  2VXE A;  2YHT A;  4XU0 A;  4A54 A;  5GAN d;  3JB9 J;  1B34 A;  3QUI A;  4M77 G;  3RKY A;  5GAO p;  5GAO n;  4X9D A;  4DQ2 A;  5LJ5 d;  3RKW A;  4M75 G;  2HNI A;  1WPY A;  3SB2 A; 
#chains in the Genus database with same CATH topology
 1WJR A;  1JJ2 A;  1KG1 A;  1K73 U;  1S72 T;  3LGF A;  3VJP A;  4HCK A;  3ER0 A;  2IPO B;  3HRS A;  4M7D A;  2DM1 A;  1PKT A;  4J9B A;  4C92 A;  1WIE A;  2JM8 A;  4E6R A;  4JZ3 A;  5LJ5 g;  4ESR A;  4RMO A;  2L3P A;  4PNO A;  3JCM Q;  2KSS A;  1ZA1 B;  4J5Y A;  4EIK A;  2YUP A;  1UGQ B;  4ZGJ B;  1OUL A;  5KH6 A;  3FIF A;  5KYU B;  2R5M A;  2EKH A;  5GAN j;  2CT4 A;  2DJZ A;  1PWT A;  2K4Y A;  3FB9 A;  4UC4 A;  1UB4 A;  5GMK e;  1M2V A;  3VUZ A;  4DOV A;  3JB9 I;  3EHQ A;  2GF7 A;  4HVW A;  4J6W A;  2EQJ A;  2HBP A;  3V8J A;  1KQ1 A;  3M56 A;  3V7C A;  5GAM h;  1YJW Q;  1M1K C;  1YCS B;  1Q86 U;  1X01 A;  1Y71 A;  2EFI A;  2F2W A;  2CH4 W;  3CPF A;  2EKO A;  3BW1 A;  1WJS A;  2C0I A;  2E12 A;  2OX7 A;  4NOY A;  1M1K R;  2V8I A;  2QQR A;  3THK A;  4N0A C;  1TSF A;  2DL3 A;  1K8A U;  4C8Q G;  1JJ2 P;  5KYX A;  5DLQ E;  4M78 B;  2FB7 A;  5I2M A;  2OTL T;  2JTE A;  2K5I A;  1WHK A;  3SDZ A;  4J9H A;  3SEM A;  5HK0 A;  3M53 A;  1WXT A;  2R57 A;  3QWX X;  1YIJ T;  4CC3 A;  3R6N A;  2DO3 A;  2DD5 A;  1KQS S;  1WHL A;  1Q7Y C;  1Y96 B;  2QQS A;  3CME T;  1IZ6 A;  2HL5 C;  4JRK A;  2CZ6 B;  2H3E B;  1JBM A;  4F7U E;  1IXD A;  4MDW A;  1FMV A;  3OYG A;  1VQ9 T;  4XTV A;  3LWH A;  3PGG A;  3CCM A;  3S3N A;  1Q7Y R;  4KRT A;  5IHK A;  3CCJ T;  3M54 A;  3JCM P;  2QGF B;  2DZ9 A;  4Z88 A;  3EFO B;  5GAN h;  2ZPI B;  1ZSZ B;  1LJO A;  2COW A;  4C8Q C;  3F70 A;  3H41 A;  2FPD A;  3UA7 A;  4M7D D;  1PC0 A;  4C92 D;  1PM3 A;  3OYA A;  1HD3 A;  2RO0 A;  3TU4 K;  3VS4 A;  4XQ3 A;  4P5N A;  4LDW A;  5GAN 6;  3E19 A;  4HA8 A;  1WA7 A;  2YUQ A;  4EMK C;  1GRI A;  3PVQ A;  1SRL A;  2HDA A;  1WNL A;  2HCK A;  1U06 A;  3RR6 A;  2L3R A;  4FT2 A;  3QXE B;  2LCL A;  3L1A A;  3OBW A;  3JCM W;  2QAS A;  4RTY A;  2OI3 A;  1NJI C;  1IGQ A;  3N5B B;  1YN8 A;  1WI7 A;  1CSK A;  2RK1 A;  1K9M C;  3M0U A;  2XMF A;  2RH2 A;  2GQI A;  2RHX A;  1PG5 B;  2LT1 A;  4OB0 B;  4JS5 A;  1KC8 C;  1Y57 A;  1WHH A;  3CMA Q;  1K9A A;  1NJI R;  4PJJ A;  1BYM A;  2RN8 A;  1K9M R;  3EGX A;  3HP9 A;  1ZBJ A;  2YRD A;  4XTZ A;  4J9D A;  4QQG A;  3A8L B;  4LUD A;  1QCO A;  2X3W D;  1G3W A;  1MNE A;  4F04 B;  2I2L A;  3MKD A;  4ZGE B;  2FG0 A;  3E9G A;  2G3R A;  3EG3 A;  3OSS C;  4XU2 A;  2L5Q A;  3G71 Q;  1JQQ A;  1MUZ A;  2E41 A;  2YDL A;  3VU3 C;  5C6S A;  1VYT A;  4E2F B;  5LJ5 j;  1NEG A;  5DM7 R;  3QII A;  4LDY A;  4J9F A;  1CKB A;  1OOT A;  3CCM T;  5GAN 4;  3E1S A;  3OBY A;  4J6X A;  2PNI A;  2RA2 A;  1QP3 A;  3OYH A;  4CC2 A;  2Z0W A;  5KCO A;  2LC4 A;  4J9G A;  1GCQ C;  2A28 A;  3QO3 A;  4F7U B;  5A2Q E;  2P84 A;  1KQ2 A;  2O4X A;  4J9I A;  4PJM A;  1PRM C;  3M0T A;  3OSV A;  2FYK A;  2KI7 A;  2O01 E;  1OQK A;  4M78 F;  4QVZ A;  4EMG A;  4EMK A;  2E4H A;  1R0C B;  3GNF B;  4AMC A;  1MMN A;  1VQ8 A;  2EGC A;  1M8V A;  1N27 A;  1YIT A;  3QUI A;  2ZCF B;  3GOX A;  3OYL A;  2DVJ A;  3P8H A;  3FC3 A;  3MEU A;  1YI2 A;  2NWM A;  2GTJ A;  2P0K A;  1Y07 A;  3UT1 A;  2K3Y A;  3QHS A;  2MWO A;  1IGU A;  3ME9 A;  1U3O A;  1JXO A;  2YT6 A;  2DER A;  3JCM g;  4XK8 E;  3NGP A;  3G7Z A;  1TH7 A;  2ED1 A;  4X1V A;  3OB9 A;  2DXC A;  4IKF A;  3JCM J;  2LQK A;  5LJ5 h;  1NBE B;  1K73 C;  2CP6 A;  1JRI A;  3JB9 G;  1V76 A;  2X4Y A;  1LCK A;  1LOJ A;  3J80 E;  5DLO A;  2DF6 A;  4M7D B;  2J6O A;  2CZ7 B;  4C92 B;  5KYW A;  2DKG A;  2OAW A;  4N4I A;  1K73 R;  1PRL C;  2RI2 A;  4M7A G;  2K7A A;  4HVV A;  2L8D A;  3CMA T;  2K3B A;  1JB0 E;  5FWC A;  3IQL A;  5GMK j;  2QEX Q;  1XJW B;  1YJ9 A;  4YTL A;  1OX9 A;  4OGC A;  4KH0 B;  4QW2 A;  2XDP A;  1ZSG A;  2X51 A;  3VRY A;  3VS1 A;  2MIO A;  1QCF A;  3I55 Q;  4OML A;  1M2V B;  1YJN Q;  2KBT A;  1Q81 U;  3T9N A;  1MMD A;  2CSQ A;  1D3B A;  4RTV A;  1QWF A;  4HKE A;  4XTU A;  2LT4 A;  4ATO A;  2E6Z A;  2HL3 A;  3RNJ A;  2RQU A;  1M1F A;  2ZGW A;  2K57 A;  2E65 A;  4DBR A;  3WXM B;  1AOJ A;  3VS6 A;  3NTI A;  2DTO A;  1AWW A;  1TG0 A;  2V1Q A;  4HT8 A;  2M1H A;  1GCP A;  2V8K A;  4JRI A;  3G71 T;  1KC8 U;  3OYN A;  3CC4 A;  3A98 A;  4FM4 B;  3JCM f;  1Q86 R;  1RLP C;  4A4F A;  4BAC A;  1K8A C;  2JVV A;  2QA4 Q;  2WSF E;  1FX7 A;  4D8K A;  2MWP A;  1QWE A;  2JZ2 A;  3OW2 A;  3X25 B;  1VQL Q;  2RI5 A;  3ZL7 C;  1E6G A;  1T0H A;  4J8O A;  2M51 A;  2QTV A;  2W0Z A;  3BY7 A;  1K8A R;  4M7A C;  3H0F A;  2P0P A;  2DD4 A;  1MGQ A;  5I11 A;  2CZ0 B;  2KR3 A;  3EG9 B;  1GFC A;  2E3H A;  2NUZ A;  2ZPG B;  3PMT A;  1W70 A;  1WHG A;  1VQ8 T;  3GIB A;  1XOV A;  2JW4 A;  1X2K A;  1YIT T;  1BCO A;  5GMK m;  1D1B A;  4RG8 A;  1FMK A;  4JUV A;  5D6X A;  2ECZ A;  1VQL A;  1VQP Q;  1QVF A;  2FZK B;  2YWW A;  4WF2 A;  5CCA A;  4PLI A;  2RMO A;  4X9C A;  1OZ3 A;  3GBQ A;  1G3Y A;  3M5A A;  2LMJ A;  2V1R A;  5FU6 C;  3CCV Q;  3I35 A;  4F14 A;  2X9H A;  5GMK h;  2SEM A;  4M78 E;  1ABQ A;  3M0R A;  1RAE B;  4HVU A;  4J83 A;  2X4X A;  3I56 A;  2YRV A;  1RAC B;  3DB4 A;  1GXI E;  2GFU A;  2CH4 A;  2LQW A;  1VQP A;  1AZG B;  3VUB A;  1I81 A;  3OW2 P;  1UGR B;  2LJ1 A;  2H3J A;  2LNH B;  5AT1 B;  3CCV A;  3OS1 A;  1OI1 A;  3VRZ A;  4PJO G;  5CKF A;  2RM4 A;  2Y4Y A;  1MV0 B;  4QVC A;  4XU1 A;  3MET A;  3QJY A;  4B9W A;  3OY9 A;  1YJ9 T;  2PUO B;  3FLG A;  3GF5 A;  3L2Q A;  4Z8A A;  2HSP A;  2RNA A;  4PJL A;  2FL7 A;  4ZN3 A;  1YIJ A;  3DB3 A;  3QYH B;  5ECA A;  1Z9Q A;  2DMO A;  1DJ7 B;  1WXB A;  5GAO p;  1QVF P;  4DQ2 A;  2DIG A;  3REB B;  1PD1 A;  3QZ9 B;  2M02 A;  1QKX A;  5KYY B;  3CCR Q;  3G6E A;  3SWN B;  2COY A;  2NLU A;  1QLY A;  2WSC E;  5LJ3 h;  2AT1 B;  4MZP A;  3I55 T;  3CC4 T;  1YJN T;  1UUE A;  3RER A;  3EGX B;  1VQ4 A;  1YBY A;  2BIV A;  2ED0 A;  3S6W A;  1SPK A;  2KXD A;  4M7A A;  4OMP A;  4BE0 A;  3C4S A;  2XID A;  4C0F A;  5D7U A;  2DL5 A;  2EPD A;  5DY9 A;  4PJO C;  4KUL A;  3VYG A;  2LX9 A;  2PQW A;  5GAO r;  5I22 A;  2JXB A;  1OEB A;  4M7D F;  4C92 F;  3QDR B;  1VQ6 A;  2LQN A;  2JNG A;  3CQT A;  2ZPE B;  3V8L A;  4IUR A;  1I1J A;  1HXD A;  1OV3 A;  1PKS A;  2AIR B;  3MP8 A;  5CQX A;  3LW5 E;  1N6A A;  1VQL T;  4LUE A;  5IHN A;  3OYJ A;  2BKD N;  2KMT A;  2RPN A;  4IUT A;  1SEM A;  3VS2 A;  4NL3 A;  2VYT A;  3CPW S;  4A4G A;  1MND A;  2ZPF B;  2BE7 D;  1SRM A;  1TUC A;  2EAY A;  2XDD A;  3JCM X;  5IHI A;  4E7L A;  5HKC A;  3I56 T;  4FIB A;  2CZ1 B;  4BB7 A;  2PVO B;  3PTA A;  1VQP T;  2RK2 A;  3QKJ A;  4XTW A;  1HK9 A;  3BDU A;  3RMQ A;  2O4X B;  1N8R U;  5CKD A;  2H8H A;  4AG2 C;  1LPL A;  1U5S A;  2CP2 A;  2I0N A;  2YHT A;  4A4H A;  1VIF A;  4J9E A;  1B34 A;  2K5L A;  3CCV T;  3GLX A;  2EVR A;  2HNI A;  3A8G B;  1OU9 A;  2E6N A;  3OYM A;  4KGX B;  2ZPB B;  1YJW A;  1YFN A;  4EMK B;  4M77 A;  4E7H A;  4M75 A;  2K5F A;  1SF9 A;  4AFZ C;  4LNP A;  4M75 F;  2CT3 A;  2J05 A;  3HRU A;  3HHT B;  4LD6 A;  2RQT A;  3EGU A;  3HL8 A;  1NZ9 A;  4OMM A;  2VGM A;  2MCN A;  4JPB W;  2EYQ A;  1KD1 U;  4DBQ A;  1NEB A;  1AWX A;  1U1S A;  2RHY A;  3G6E T;  4PFP A;  4Q5W A;  3REA B;  3JB9 D;  2BZ8 A;  2LCS A;  1G83 A;  1VQ7 Q;  2G6F X;  2KQW A;  2O31 A;  1QKW A;  4KH1 B;  1VQ4 T;  2Y90 A;  2HZY A;  4JDS A;  1BIB A;  4QQ6 A;  2M9U A;  3MO8 A;  4FU6 A;  4M7A D;  4OMN A;  1Z9Z A;  1QQJ A;  2EQU A;  4PJO A;  3TCJ A;  2DYB A;  1VQM Q;  1H3H A;  1T3S A;  2J6K A;  2WAC A;  3S3M A;  2IIM A;  3GNG A;  2JN0 A;  5LL6 S;  2CSI A;  3E2U A;  2M0Y A;  2GTO A;  3CCR T;  5FU7 B;  5KYW B;  1BCM A;  1T0J A;  2RJC A;  4FL6 A;  1W6X A;  1TOV A;  1TWB A;  3HSB A;  4JZ4 A;  5CK9 A;  1X69 A;  4JJD A;  1VQ6 T;  2DK3 A;  3RDV A;  3JCM c;  4IUV A;  1R8O B;  4HCC A;  1VQ7 A;  3CCQ Q;  1I5O B;  2RI3 A;  3A8H B;  1BU1 A;  1XTD A;  2SRC A;  2GBQ A;  1B7T A;  2CDT A;  1VQM A;  1Q81 C;  3OS0 A;  2DL8 A;  5IXF A;  4QQD A;  1D3B B;  2DEU A;  4BUG A;  3EG1 A;  1AWJ A;  1W2B S;  2FPF A;  1G8X A;  2PZ1 A;  4O6J A;  3UAT A;  1NLO C;  1TS9 A;  2X35 A;  4M78 C;  1Q81 R;  4JLI A;  2ZZD A;  2A37 A;  1F1B B;  3CC2 Q;  5KCH A;  3TQ7 P;  2NUP B;  5CR2 A;  3RKX A;  4M7D E;  2AZS A;  4C92 E;  2CRE A;  4N0A A;  2JOY A;  3QG1 A;  3P8D A;  1D1A A;  4Y91 A;  2HKQ B;  2AK5 A;  1KC8 R;  2L89 A;  3CC7 Q;  1KHC A;  4KGV B;  4RUG A;  4WCI A;  4KUD K;  3OMG A;  1G5V A;  5CKH A;  4M77 D;  1NPP A;  5L8R E;  1YJW T;  4M75 D;  2NUT A;  3KXT A;  2LJ3 A;  2RB6 A;  3TSZ A;  4JJN K;  1VQK Q;  2E3I A;  3CMA A;  1VIE A;  3JCM e;  1TUG B;  3JV3 A;  4C5I A;  4OMQ A;  1D1C A;  1UE9 A;  2XI9 A;  3E9F A;  3SHW A;  1UGV A;  1ZSZ C;  5FLX E;  1IHV A;  2JTM A;  5GJV B;  1UG1 A;  4FW1 A;  4PKC C;  2RHI A;  2VGN A;  3MCA B;  4WTO B;  1YP5 A;  2KYM A;  4C0D B;  2AZV A;  1HYO A;  1VUB A;  4ORZ A;  3SD4 A;  3CCU Q;  1SKU B;  1BIA A;  1OU8 A;  2YUO A;  1ZUU A;  2DRM A;  3TVT A;  2LJ0 A;  4C8Q A;  3ASK A;  3CCS Q;  1KQS A;  4PJO D;  4C8Q F;  1QVG S;  3L42 A;  3MEW A;  3G71 A;  3M55 A;  4B6M A;  4RTZ A;  8AT1 B;  4O5V A;  3DLM A;  1AHJ B;  3JB9 J;  3CCU A;  2M0O A;  4J7F A;  1XNI A;  1VQ7 T;  5IT9 E;  3WVD B;  3UDC A;  2VVK A;  2DIL A;  2XKO C;  3JSC A;  2AKK A;  4PFO A;  1ZHI A;  1VQM T;  5A0D A;  4L5G A;  1WHM A;  2BZY A;  4N4G A;  2JMA A;  4RTU A;  1I07 A;  1X75 C;  1W1F A;  3EG0 A;  5CIU A;  1WX6 A;  3OYE A;  3GP8 A;  4ME7 A;  4F7U G;  1RAA B;  3JCM d;  3EGD B;  2KT1 A;  3M4G A;  1AVZ C;  4QKU A;  4J9C A;  2OTJ Q;  1AEY A;  2KK4 A;  1H3Z A;  3FDR A;  3CCQ T;  2DXU A;  2C0T A;  3LGL A;  4FYY B;  2EW3 A;  2DXB A;  1I0C A;  3R6O A;  4F16 A;  2VWF A;  3I5R A;  2DEQ A;  4KT0 E;  1Y96 A;  1KQS P;  2EQM A;  2D9T A;  2QXF A;  3MPU B;  4OMF B;  4M7A B;  1R0B G;  2RF0 A;  2W10 A;  1KHI A;  1WYX A;  3CC2 T;  4RCC A;  3QWY A;  1H92 A;  2CKK A;  3O5Z A;  2JS2 A;  3G4S Q;  1BKB A;  4JRQ A;  2FPE A;  5GAO l;  4EDU A;  1ZSZ A;  2D0Q B;  4JJC A;  4OP0 A;  1VQ5 Q;  2X4W A;  4E7J A;  1KIK A;  3PMI A;  4RKU E;  1UEB A;  4BY6 B;  1EX4 A;  4JRP A;  4D8D A;  1OPK A;  4BE1 A;  3H9N A;  2IG0 A;  1VYV A;  3NMZ C;  1K76 A;  2HSE B;  5CQY A;  1VQK T;  3LWI A;  1WPY A;  4FYW B;  2HQX A;  2DIQ A;  4M7D G;  1VQ5 A;  4C92 G;  2FZG B;  4C8Q D;  1D0Y A;  1H8K A;  2QEX A;  4LE9 A;  1GCQ A;  3CCE Q;  2DE0 X;  1D0X A;  3I55 A;  3M0S A;  1YJN A;  1ZUY A;  2BUD A;  1N8R C;  1I4K 1;  3RBB B;  3MEV A;  4KGZ B;  1WJQ A;  1BI3 A;  3ZFJ A;  1WGS A;  1B34 B;  2YUN A;  5KYX B;  2J06 A;  3CXC S;  3C94 A;  2F69 A;  3PNW C;  1N8R R;  3CCU T;  3HKS A;  4M77 B;  4M75 B;  1QMC A;  2O9V A;  4ELZ C;  1QVG A;  4LDV A;  3LYI A;  3TEE A;  5C0M A;  3UA6 A;  2XIC A;  5HK3 A;  4OB3 B;  1IB8 A;  3BFM A;  2GCX A;  9ATC B;  2QG9 B;  2QA4 A;  1NM7 A;  2RQV A;  4KUI A;  1ACM B;  2WSE E;  3V7R A;  2EYZ A;  1RAF B;  3RES A;  2K2M A;  2BZX A;  3VS5 A;  1KD1 C;  1M8M A;  1G3T A;  1NG2 A;  4FW2 A;  4OVA A;  2RQW A;  4L59 A;  4MZM A;  3S3O A;  5J39 A;  5CAI A;  4M7D C;  4C92 C;  1X27 A;  3M9Q A;  4EMH A;  3LX7 A;  1KD1 R;  1RL2 A;  2LNV A;  1QW1 A;  1VQN Q;  3L2R A;  4XTY A;  4PJO B;  2QDL A;  2KYB A;  2RJF A;  2EGA A;  2ROT A;  1AT1 B;  2DBM A;  3H0I A;  3RIR A;  2OTJ T;  2EBP A;  2CGH A;  1M3A A;  3EAE A;  4Y28 E;  1VOM A;  3RKW A;  1YWP A;  4B9X A;  1O75 A;  1V1C A;  4VUB A;  4DBF A;  3C0C A;  3JB9 H;  2LRQ A;  4IIO A;  1QVG P;  5GAN 8;  1VQN A;  4F7U A;  1VA7 A;  1RI0 A;  3M59 A;  2JUF A;  1UFF A;  5D6Y A;  3PIO A;  2D8J A;  4LDU A;  3MHX A;  1ZUK A;  2J7I A;  5GMK i;  2XD0 A;  2VKN A;  2DX1 A;  1SG5 A;  3CEY A;  1BB9 A;  3VS0 A;  1X2Q A;  4NL2 A;  3G4S T;  1A0N B;  5CKB A;  4BDZ A;  3VKI A;  5KYN A;  2LQ8 A;  3CCJ Q;  1M90 C;  2COZ A;  1VQ5 T;  5GAN 2;  2HD0 A;  2VV5 A;  4BI3 A;  2CYZ B;  3PFS A;  2QEX T;  4OMO A;  3OS5 A;  2MYS A;  2E64 A;  5EG2 A;  3L2W A;  2OJ2 A;  2AKL A;  4D6W A;  2MMP A;  1M90 R;  1Y0M A;  4XTX A;  3JB9 F;  2VXF A;  2ZPH B;  4II1 A;  2LX7 A;  4HCZ A;  1XQH A;  4E7Z A;  1QCN A;  4RCB A;  2NYS A;  3FJ5 A;  4M7A F;  4ELY C;  4ZGD B;  3M0Q A;  4E7I A;  2DL4 A;  3CCR A;  4OB2 B;  4RTW A;  3A5Z B;  3OQ5 A;  2B8A A;  4LN2 A;  3OYB A;  3CCL Q;  2KDS A;  4OB1 B;  1SHF A;  3QJ6 A;  3ZBD A;  1M9S A;  2F2X A;  2QA4 T;  2VC8 A;  2KNB B;  2DYI A;  3QPH A;  3EH1 A;  5A0G A;  3CXC A;  2KT8 A;  2LCC A;  3MP6 A;  4C0G A;  1UHC A;  4Y92 A;  4EPC A;  3X20 B;  1YCY A;  2JM9 A;  2DJQ A;  2RHZ A;  2VXE A;  2HKN A;  2QQA A;  3TRE A;  1NYF A;  3CCL A;  1LVK A;  1OX8 A;  2L3Q A;  4AFQ C;  4C8Q B;  1VYU A;  1T3L A;  4DOW A;  1WQW A;  1I5L A;  2DXT A;  4MZT A;  4PJN A;  5KE2 A;  3WVE B;  5GJW B;  1X6O A;  4RG2 A;  1X6G A;  5CO7 A;  1M5Q 1;  4JS4 A;  1ZQ1 A;  2HBW A;  3H8Z A;  1EFN A;  2LVM A;  4Z02 A;  3SWN C;  1VQN T;  4M77 F;  4C0Z A;  2DET A;  3RMS A;  2L0A A;  2P0Q A;  1NE8 A;  3ZEH A;  2YSQ A;  1SSF A;  3M58 A;  4DEY A;  4BDY A;  2F5K A;  2FVU A;  4HXJ A;  2E5K A;  1PNJ A;  2X4J A;  2HMA A;  3CXC P;  3QDF A;  4A53 A;  1FMW A;  1WLP B;  3JCM h;  3CCM Q;  3EHR A;  1VQO Q;  1UHF A;  3J7A F;  3BE3 A;  2FRY A;  3QBY A;  3QZ5 B;  2QI2 A;  2HEQ A;  3EG9 A;  1BK2 A;  4M78 G;  5LJ5 f;  1RI9 A;  2ABL A;  1X6B A;  1HJD A;  3LH5 A;  1O9S A;  3FJP A;  2XK0 A;  5LJ3 e;  4C5H A;  2QGG A;  2O88 A;  3M57 A;  3EG2 A;  3V8K A;  4PJO F;  3HFO A;  1VQO A;  3OMC A;  1WFW A;  1WQ7 A;  3JAM E;  4DBH A;  1UGS B;  1IRE B;  5CVI A;  3A1P A;  2E70 A;  4E7K A;  1Q82 U;  1M27 C;  2P4R A;  4CI0 C;  3G1J A;  4X9D A;  5KE3 A;  3KUF A;  3SB2 A;  4ZTF A;  4V2S A;  1JEG A;  4JLG A;  3PE0 A;  2GQV A;  2RQR A;  2XHC A;  2EJG A;  2XDB A;  2CUD A;  2D8H A;  2KRM A;  1I8F A;  4A4K A;  1UTI A;  1IHW A;  8ATC B;  4C5G A;  3OYC A;  1YHQ Q;  4M7A E;  1H64 1;  4RTT A;  3CCL T;  1IRX A;  1M4Z A;  4MDX A;  2A0F B;  4ZTJ A;  3CCQ A;  3O8V A;  1M90 U;  4QVD A;  1E7O A;  1KJW A;  4N4H A;  3TSW A;  2EYW A;  5IH2 A;  2A08 A;  4GLM A;  5FW9 A;  1YNZ A;  3HFN A;  3H0H A;  5AYF A;  3EFS A;  2O2O A;  5GAM e;  2DZC A;  1K0S A;  1E6H A;  2JT4 A;  2K2V A;  5GAO q;  1JU5 C;  3OYI A;  3FRN A;  2DBK A;  2MI6 A;  2F1L A;  4E7S A;  3NTK A;  2ROL A;  4GBQ A;  1YHQ A;  3QSU A;  2LDM A;  3CPW A;  5KYY A;  2DL7 A;  4FYV B;  5LJ3 d;  3SWN A;  1D0Z A;  1GBR A;  3CC2 A;  1SHG A;  3OA6 A;  5FWB A;  1NLP C;  2L2P A;  2B86 A;  2V26 A;  3X28 B;  6AT1 B;  3M4Y A;  2A3L A;  2MPX C;  5LJ3 g;  3JRZ A;  1B3Q A;  3JCM b;  2LP5 A;  2R58 A;  3HTR A;  1JXM A;  2PUK B;  3NHN A;  1UJ0 A;  4MMK A;  3CC7 A;  1M3B A;  3HPW A;  1BI2 A;  3INZ A;  1OZ2 A;  2HQH A;  2KRN A;  2LZ6 B;  1UDL A;  1GL5 A;  4BI4 A;  3QYG B;  1TU0 B;  4RTX A;  5FU7 C;  4HT9 A;  4R0K A;  3PVL A;  1GFD A;  1VQK A;  4QT7 A;  3RKY A;  3P8B B;  1RAB B;  1UGP B;  4ANJ A;  4A4E A;  5KYU A;  2FRW A;  2EQI A;  4M77 E;  4FYX B;  4FCY A;  2VB6 A;  4M75 E;  4J7I A;  1PSF A;  2E1H A;  2ESW A;  3CBO A;  2DRK A;  1PCX A;  4LXC A;  5GAN e;  1VQO T;  5D6W A;  3OW2 S;  3UWN A;  2EJF A;  4XAX B;  2QYZ A;  4IIM A;  3AT1 B;  2DNU A;  7AT1 B;  5GAM d;  2CUB A;  4ZN1 A;  1ABO A;  2L3S A;  3CPW P;  1OPL A;  1M1K U;  2PU9 B;  4MML A;  1X43 A;  1KFZ A;  2EQK A;  2BTT A;  2DA9 A;  5HCK A;  2KGT A;  2KRO A;  1UJY A;  4TVR A;  1VQ8 Q;  2CP7 A;  4LD9 K;  2EWN A;  1P92 A;  3CCS A;  1YIT Q;  5GAM g;  2HAX A;  2P4T A;  2IVW A;  2LTO A;  2QDY B;  4M4Z A;  5GAN 5;  4F17 A;  5I21 A;  3BDL A;  3A8M B;  1YI2 Q;  2DLP A;  4M78 A;  5LJ3 f;  1QVF S;  2RD1 A;  2VAS A;  4CRI A;  1TTH B;  2FEI A;  1KK7 A;  3VYH B;  4PJO E;  3I5S A;  1PSE A;  2CP0 A;  1GBQ A;  3OYY A;  1SSH A;  4E47 A;  2EGE A;  2JS0 A;  4PL6 A;  3X24 B;  5GMK l;  4HCB A;  5GAN 7;  2PTK A;  1MHN A;  3A8O B;  1Q95 G;  2ATC B;  1MV3 A;  2YLB A;  1N9S A;  1FWZ A;  1Q7Y U;  1B07 A;  1JO8 A;  1PD0 A;  4KBM B;  1FXX A;  4L6V 5;  4C5E A;  1W2B A;  3CBP A;  5J3B A;  2PVD B;  1YHQ T;  2D6F A;  2DPP B;  2JMC A;  3DKM A;  1QP2 A;  2CS7 A;  3L2Z A;  4BI8 B;  3RUX A;  1RAG B;  2OTJ A;  2KY9 A;  4LDX A;  1BI0 A;  2EYY A;  2MOX A;  5IXB A;  2ENM A;  3EFO A;  2KXC A;  4C0D C;  5GAN d;  4JJB A;  3MJX A;  1YJ9 Q;  2EYX A;  1M2O A;  1CKA A;  1S1N A;  2FO0 A;  3KBG A;  4R55 A;  3CD6 Q;  2YLC A;  1MMA A;  3Q1J A;  5M9O A;  1KSW A;  1NYG A;  2JJ9 A;  2RHU A;  2X3X D;  3MEA A;  5A0L A;  5GAN g;  5GAM f;  1NPR A;  3CC7 T;  2K3X A;  5FU6 B;  4BE2 A;  1IO6 A;  1TUD A;  3J81 E;  1BBZ A;  5CKE A;  2QAZ A;  2GFA A;  1EIF A;  5EC7 A;  3G4S A;  4CC7 A;  4ZNX A;  3VV0 A;  2C06 A;  4FSX A;  1WHJ A;  1BI1 A;  1PHT A;  4PFZ A;  3AHU A;  3HRT A;  3OS2 A;  3C12 A;  1M30 A;  2V8J A;  4A63 B;  3UF4 A;  3CC4 Q;  1M1G A;  1RAD B;  2R5A A;  3CD6 A;  1C0M A;  1V29 B;  4XU3 A;  5IAY A;  2F2V A;  3M0P A;  4NS5 A;  3NPF A;  2K6D A;  5GAN 3;  4FSS A;  1HSQ A;  5J26 A;  1W2B P;  5FRN A;  4R56 A;  1S72 Q;  1JJ2 S;  2FZC B;  1MMG A;  1NJI U;  2KEA A;  1Q86 C;  2RJD A;  2E5Q A;  2DAQ A;  3LH0 A;  3L2V A;  1K9M U;  2NUP A;  1Y7X A;  2XU8 A;  5FRM A;  4OGE A;  2DTI A;  3CCS T;  1OYX A;  3CCE A;  1RAI B;  4IUU A;  1K0X A;  2CP3 A;  3U23 A;  2M16 A;  4M78 D;  1C1A A;  3PT9 A;  2C0O A;  1S72 A;  4K11 A;  4C8Q E;  3LLR A;  3NFC A;  4X34 A;  1RAH B;  3C95 A;  2QQB A;  2ZAE A;  2K9G A;  2EJ9 A;  5GAN f;  2BE9 B;  1G2B A;  4IUQ A;  3NTH A;  1K1Z A;  2D0N A;  5LJ3 j;  1AZE A;  3VS3 A;  1QVP A;  2KVQ G;  2FHD A;  4M77 G;  2D1X A;  4PLL A;  3VS7 A;  5GAO n;  3I56 Q;  2MAM A;  4M75 G;  1EZZ B;  2F5T X;  3OYF A;  3PIP A;  1YI2 T;  2AHJ B;  1U8R A;  4BY6 C;  3UPU A;  1ZLM A;  4FT4 A;  2OTL Q;  1ZA2 B;  1AWO A;  3ULR B;  1U1T A;  4PK4 A;  2A7Y A;  5LJ5 e;  2K79 A;  2QQ9 A;  3OYD A;  1Q82 C;  5HY6 A;  3L2U A;  1R77 A;  4BD3 A;  3V7S A;  2DTH A;  2HQE A;  1LNX A;  5L23 A;  4GY5 A;  1W4S A;  3GPL A;  5GAO m;  4DA4 A;  3EFR A;  2EIF A;  4GLK A;  2KE9 A;  1Q82 R;  1YIJ Q;  2OAU A;  2QK0 A;  4F7U F;  2RJE A;  4IUP A;  1RUW A;  2DFU A;  2QTX A;  3CME Q;  1ZX6 A;  3DLL A;  2OTL A;  2GNC A;  2XG8 D;  3I9Q A;  1J3T A;  3X26 B;  4J6Y A;  1M3C A;  5FRO A;  1ARK A;  3SFM A;  1TXQ A;  1D09 B;  1VQ9 Q;  2GGR A;  3D7S B;  2PVG B;  1UEC A;  3G6E Q;  1ZBX A;  1AD5 A;  3OYK A;  4OF1 A;  5GAM j;  1N9R A;  2J6F A;  1WDX A;  4M77 C;  2MF2 A;  4M75 C;  2KRS A;  3URG A;  2DVE A;  5IN1 A;  3CD6 T;  4AFU C;  4Z89 A;  1VQ4 Q;  1FYN A;  5I2S A;  2KAF A;  3FEO A;  1G3S A;  2O9S A;  2VUB A;  3CBM A;  2YRC A;  4DEX A;  2Y4X A;  3JCM V;  3CME A;  2E10 A;  1C6V X;  3EH2 A;  3EGD A;  3MP1 A;  1VQ9 A;  1WXU A;  1K4U S;  2YXY A;  3CCJ A;  2MK5 A;  2NUT B;  4AG1 C;  2JTF A;  1VQ6 Q;  1YWO A;  4CC4 B;  2CP5 A;  3KFV A;  1N5Z A;  3H6Z A;  2A36 A;  4AFS C;  4XU0 A;  4A54 A;  4AT1 B;  1WZO A;  1RLQ C;  3CCE T;  5LJ5 d; 
#chains in the Genus database with same CATH homology
 4JLG A;  1WJR A;  1JJ2 A;  2M0O A;  1KG1 A;  4J7F A;  4J8O A;  1K73 U;  1S72 T;  1XNI A;  3LGF A;  1VQ7 T;  3VJP A;  3BY7 A;  4M7A C;  5IT9 E;  2GQV A;  2XHC A;  2EJG A;  2DD4 A;  2P0P A;  1MGQ A;  3ER0 A;  3WVD B;  3UDC A;  3HRS A;  2XDB A;  2XKO C;  3JSC A;  2CZ0 B;  4M7D A;  3PMT A;  4C92 A;  1I8F A;  2ZPG B;  4A4K A;  1ZHI A;  5LJ5 g;  1VQM T;  1VQ8 T;  3GIB A;  1XOV A;  5A0D A;  4L5G A;  4RMO A;  4N4G A;  4PNO A;  3JCM Q;  1X75 C;  4C5G A;  1YIT T;  3OYC A;  5CIU A;  5GMK m;  2KSS A;  4J5Y A;  4RG8 A;  3OYE A;  3GP8 A;  1UGQ B;  4ME7 A;  4F7U G;  4ZGJ B;  4M7A E;  1H64 1;  5KH6 A;  3JCM d;  4JUV A;  5D6X A;  3CCL T;  3FIF A;  1VQL A;  1M4Z A;  2R5M A;  1QVF A;  3M4G A;  5GAN j;  2DJZ A;  3FB9 A;  2K4Y A;  4ZTJ A;  4MDX A;  3CCQ A;  3O8V A;  4WF2 A;  4QVD A;  4UC4 A;  1UB4 A;  5GMK e;  1M90 U;  4N4H A;  2KK4 A;  4PLI A;  5CCA A;  3FDR A;  3CCQ T;  1H3Z A;  2DXU A;  4X9C A;  1OZ3 A;  3VUZ A;  4DOV A;  3JB9 I;  1G3Y A;  3HFN A;  5AYF A;  3M5A A;  2GF7 A;  3EFS A;  5FU6 C;  3LGL A;  5GAM e;  2DZC A;  2DXB A;  5GMK h;  4J6W A;  2EQJ A;  3R6O A;  2HBP A;  2K2V A;  4M78 E;  3V8J A;  1KQ1 A;  5GAO q;  2DEQ A;  4KT0 E;  1Y96 A;  3OYI A;  3FRN A;  4J83 A;  2EQM A;  3M56 A;  2D9T A;  2QXF A;  2MI6 A;  3V7C A;  5GAM h;  1M1K C;  3NTK A;  2X4X A;  4OMF B;  1YHQ A;  3I56 A;  4M7A B;  2YRV A;  1Q86 U;  1X01 A;  2LDM A;  3QSU A;  3CPW A;  1Y71 A;  3DB4 A;  1GXI E;  2EFI A;  2GFU A;  5LJ3 d;  3SWN A;  1VQP A;  1KHI A;  3CPF A;  3CC2 A;  2EKO A;  3OA6 A;  3CC2 T;  3BW1 A;  1WJS A;  2E12 A;  4NOY A;  4RCC A;  3VUB A;  2V8I A;  1I81 A;  2QQR A;  2CKK A;  4N0A C;  1UGR B;  3X28 B;  2H3J A;  3M4Y A;  1K8A U;  1BKB A;  4C8Q G;  4JRQ A;  3CCV A;  5GAO l;  2A3L A;  3OS1 A;  1OI1 A;  4PJO G;  5DLQ E;  5CKF A;  4EDU A;  2RM4 A;  2FB7 A;  2D0Q B;  2Y4Y A;  4M78 B;  3JRZ A;  4OP0 A;  5I2M A;  4QVC A;  5LJ3 g;  4XU1 A;  3JCM b;  3MET A;  2X4W A;  2R58 A;  2K5I A;  4E7J A;  3QJY A;  4B9W A;  3OY9 A;  1YJ9 T;  3PMI A;  2PUK B;  2PUO B;  4MMK A;  4RKU E;  1UEB A;  4BY6 B;  3SDZ A;  3CC7 A;  4JRP A;  3HPW A;  1BI2 A;  3INZ A;  3FLG A;  3GF5 A;  4BE1 A;  1OZ2 A;  3L2Q A;  2IG0 A;  5HK0 A;  3M53 A;  1YIJ A;  2FL7 A;  2R57 A;  4ZN3 A;  3DB3 A;  4BI4 A;  3QYG B;  1YIJ T;  3QYH B;  5FU7 C;  4HT9 A;  1DJ7 B;  2DO3 A;  1VQK A;  2DD5 A;  3RKY A;  5GAO p;  1KQS S;  3P8B B;  4DQ2 A;  5CQY A;  1Q7Y C;  1VQK T;  1Y96 B;  1UGP B;  1WPY A;  2QQS A;  3LWI A;  2DIG A;  4A4E A;  2HQX A;  2DIQ A;  3CME T;  1IZ6 A;  4M7D G;  4JRK A;  1VQ5 A;  4C92 G;  2CZ6 B;  3QZ9 B;  4C8Q D;  4M77 E;  2QEX A;  1JBM A;  4F7U E;  4MDW A;  4M75 E;  3OYG A;  1VQ9 T;  4J7I A;  3G6E A;  4XTV A;  3SWN B;  3LWH A;  3PGG A;  2NLU A;  3CCM A;  1PSF A;  2E1H A;  3S3N A;  2WSC E;  3CBO A;  5LJ3 h;  3I55 A;  5GAN e;  4MZP A;  1VQO T;  5D6W A;  1YJN A;  2BUD A;  3CCJ T;  3OW2 S;  1N8R C;  1I4K 1;  3I55 T;  3M54 A;  3UWN A;  2EJF A;  3MEV A;  4XAX B;  3JCM P;  2OTL T;  3CC4 T;  1WJQ A;  1YJN T;  2DZ9 A;  3RER A;  1BI3 A;  3ZFJ A;  1VQ4 A;  5GAM d;  1WGS A;  1YBY A;  1B34 B;  4ZN1 A;  2BIV A;  5GAN h;  2ZPI B;  1M1K U;  3CXC S;  2PU9 B;  3S6W A;  4MML A;  3C94 A;  4M7A A;  1LJO A;  2EQK A;  2F69 A;  3PNW C;  3CCU T;  4BE0 A;  3HKS A;  3C4S A;  2XID A;  4TVR A;  4C0F A;  4C8Q C;  4M77 B;  5DY9 A;  4LD9 K;  3F70 A;  4V2S A;  2EWN A;  1P92 A;  3CCS A;  4PJO C;  4M75 B;  4KUL A;  4ELZ C;  3VYG A;  5GAM g;  2LX9 A;  2HAX A;  1QVG A;  2PQW A;  4M7D D;  5GAO r;  4C92 D;  2P4T A;  4LDV A;  2IVW A;  2LTO A;  3LYI A;  3TEE A;  5C0M A;  2QDY B;  5HK3 A;  2XIC A;  5GAN 5;  4OB3 B;  4M7D F;  4C92 F;  3OYA A;  5I21 A;  2RO0 A;  3BFM A;  3BDL A;  3A8M B;  3QDR B;  1VQ6 A;  3TU4 K;  2JNG A;  4M78 A;  2ZPE B;  2GCX A;  5LJ3 f;  3V8L A;  1QVF S;  2RD1 A;  2QA4 A;  4XQ3 A;  4CRI A;  4IUR A;  4P5N A;  4KUI A;  1HXD A;  4LDW A;  3VYH B;  2WSE E;  4PJO E;  3V7R A;  5GAN 6;  3MP8 A;  5CQX A;  3RES A;  3LW5 E;  1N6A A;  3E19 A;  1PSE A;  4HA8 A;  1VQL T;  3OYY A;  1KD1 C;  3OYJ A;  2BKD N;  2KMT A;  4E47 A;  4EMK C;  1G3T A;  4IUT A;  4PL6 A;  3X24 B;  5GMK l;  5GAN 7;  4HCB A;  4OVA A;  4L59 A;  4MZM A;  3S3O A;  5J39 A;  1MHN A;  5CAI A;  4M7D C;  1WNL A;  4C92 C;  3A8O B;  4NL3 A;  2YLB A;  3M9Q A;  1N9S A;  4EMH A;  2L3R A;  1FWZ A;  2VYT A;  3LX7 A;  4FT2 A;  3QXE B;  1RL2 A;  2LCL A;  3CCU A;  3L1A A;  3OBW A;  3CPW S;  1Q7Y U;  4A4G A;  4KBM B;  2ZPF B;  1FXX A;  3JCM W;  4L6V 5;  4C5E A;  2LNV A;  1W2B A;  1NJI C;  2EAY A;  3N5B B;  1QW1 A;  3CBP A;  5J3B A;  3L2R A;  2XDD A;  2PVD B;  2RK1 A;  4XTY A;  3JCM X;  1K9M C;  4E7L A;  1YHQ T;  5HKC A;  3I56 T;  2D6F A;  4PJO B;  2DPP B;  4FIB A;  2CZ1 B;  2RH2 A;  2RHX A;  4BB7 A;  2RJF A;  3DKM A;  1QP2 A;  2CS7 A;  2LT1 A;  4OB0 B;  2PVO B;  3L2Z A;  4BI8 B;  3PTA A;  3RUX A;  4JS5 A;  1VQP T;  1KC8 C;  2OTJ A;  2RK2 A;  3QKJ A;  2KY9 A;  1HK9 A;  4XTW A;  3BDU A;  1BI0 A;  3RMQ A;  4LDX A;  2O4X B;  1N8R U;  3RIR A;  2OTJ T;  5CKD A;  2CGH A;  1BYM A;  2YHT A;  4C0D C;  4A4H A;  3EAE A;  1VIF A;  3HP9 A;  5GAN d;  4Y28 E;  1B34 A;  2K5L A;  3CCV T;  3GLX A;  3RKW A;  3A8G B;  2HNI A;  4B9X A;  1O75 A;  4VUB A;  4XTZ A;  2E6N A;  3OYM A;  3JB9 H;  3KBG A;  2LRQ A;  2ZPB B;  4R55 A;  4QQG A;  1YJW A;  2YLC A;  3A8L B;  4EMK B;  3Q1J A;  4M77 A;  5M9O A;  5GAN 8;  1VQN A;  4F7U A;  4E7H A;  2RHU A;  3MEA A;  4M75 A;  5A0L A;  2K5F A;  5GAN g;  1RI0 A;  3M59 A;  2JUF A;  5GAM f;  1NPR A;  3CC7 T;  2K3X A;  4M75 F;  5FU6 B;  4BE2 A;  1G3W A;  5D6Y A;  3J81 E;  3PIO A;  3HRU A;  3HHT B;  4LDU A;  5CKE A;  3MHX A;  2XD0 A;  5GMK i;  2I2L A;  4ZGE B;  3E9G A;  3CEY A;  2GFA A;  1EIF A;  4LD6 A;  3G4S A;  2G3R A;  4NL2 A;  3VV0 A;  3G4S T;  2C06 A;  4FSX A;  3HL8 A;  1NZ9 A;  3OSS C;  5CKB A;  1BI1 A;  4BDZ A;  4XU2 A;  2L5Q A;  3AHU A;  3HRT A;  3OS2 A;  3C12 A;  3VKI A;  2VGM A;  2LQ8 A;  2V8J A;  1M90 C;  2E41 A;  1VQ5 T;  2EYQ A;  3VU3 C;  5C6S A;  2HD0 A;  2VV5 A;  4BI3 A;  5GAN 2;  2CYZ B;  1KD1 U;  3PFS A;  2QEX T;  1M1G A;  4ZTF A;  2R5A A;  5LJ5 j;  3CD6 A;  1U1S A;  2RHY A;  3QII A;  4LDY A;  3OS5 A;  5DM7 R;  3G6E T;  1V29 B;  4XU3 A;  5IAY A;  3CCM T;  2E64 A;  5EG2 A;  4Q5W A;  4NS5 A;  3L2W A;  3JB9 D;  5GAN 4;  4D6W A;  5GAN 3;  2MMP A;  3E1S A;  3OBY A;  4J6X A;  5J26 A;  4XTX A;  5FRN A;  2VXF A;  3JB9 F;  4R56 A;  1JJ2 S;  2ZPH B;  2RA2 A;  4II1 A;  2KQW A;  1VQ4 T;  1QP3 A;  2Y90 A;  4HCZ A;  4JDS A;  1BIB A;  4QQ6 A;  2M9U A;  3MO8 A;  1XQH A;  4FU6 A;  3OYH A;  1NJI U;  4M7A D;  1Q86 C;  5KCO A;  2RJD A;  2E5Q A;  2DAQ A;  3LH0 A;  3L2V A;  4RCB A;  2EQU A;  2LC4 A;  1K9M U;  3TCJ A;  4M7A F;  1Y7X A;  4ELY C;  4ZGD B;  4PJO A;  2WAC A;  2XU8 A;  3S3M A;  5FRM A;  4E7I A;  3GNG A;  5LL6 S;  2JN0 A;  3QO3 A;  4OGE A;  4F7U B;  5A2Q E;  3CCR A;  1KQ2 A;  2DTI A;  4OB2 B;  2O4X A;  3CCS T;  3CCR T;  3A5Z B;  1OYX A;  5FU7 B;  3CCE A;  4IUU A;  3OQ5 A;  2RJC A;  4FL6 A;  2B8A A;  3OYB A;  3HSB A;  3OSV A;  2KDS A;  2FYK A;  2M16 A;  4OB1 B;  5CK9 A;  4M78 D;  3PT9 A;  2O01 E;  3QJ6 A;  1VQ6 T;  2DK3 A;  1M9S A;  3ZBD A;  1S72 A;  3JCM c;  4IUV A;  1R8O B;  4HCC A;  1VQ7 A;  4M78 F;  4QVZ A;  4C8Q E;  3LLR A;  2RI3 A;  3NFC A;  2QA4 T;  2VC8 A;  4X34 A;  4EMG A;  3A8H B;  3C95 A;  3QPH A;  4EMK A;  5A0G A;  2LCC A;  3MP6 A;  3CXC A;  1XTD A;  2QQB A;  2EJ9 A;  3GNF B;  4C0G A;  5GAN f;  1VQM A;  1VQ8 A;  1Q81 C;  4EPC A;  3X20 B;  3OS0 A;  1M8V A;  4IUQ A;  1YCY A;  4QQD A;  1N27 A;  1D3B B;  3NTH A;  1YIT A;  4BUG A;  5LJ3 j;  2RHZ A;  2VXE A;  1QVP A;  1W2B S;  2QQA A;  2KVQ G;  2FHD A;  3QUI A;  2ZCF B;  4M77 G;  4O6J A;  4PLL A;  3TRE A;  5GAO n;  3OYL A;  3GOX A;  3CCL A;  2MAM A;  4M75 G;  2X35 A;  3P8H A;  4M78 C;  3FC3 A;  3MEU A;  2F5T X;  2ZZD A;  4JLI A;  1YI2 A;  2P0K A;  3OYF A;  1Y07 A;  3PIP A;  1YI2 T;  4C8Q B;  3UT1 A;  2K3Y A;  5KCH A;  2AHJ B;  3QHS A;  1WQW A;  4DOW A;  1U8R A;  2MWO A;  3ME9 A;  5CR2 A;  4BY6 C;  3RKX A;  3UPU A;  1I5L A;  4M7D E;  4C92 E;  2DXT A;  4N0A A;  4FT4 A;  2JOY A;  3JCM g;  4XK8 E;  1U1T A;  3QG1 A;  4MZT A;  2A7Y A;  3G7Z A;  5LJ5 e;  5KE2 A;  1TH7 A;  2QQ9 A;  3OYD A;  3P8D A;  1Q82 C;  5HY6 A;  3L2U A;  3OB9 A;  4Y91 A;  4BD3 A;  3WVE B;  3V7S A;  2DTH A;  2DXC A;  2HQE A;  1X6O A;  1LNX A;  4IKF A;  4GY5 A;  4RG2 A;  2L89 A;  3JCM J;  2LQK A;  1KHC A;  1W4S A;  5CO7 A;  1M5Q 1;  5LJ5 h;  3GPL A;  1K73 C;  5GAO m;  4DA4 A;  3EFR A;  4JS4 A;  1ZQ1 A;  4KUD K;  3OMG A;  1G5V A;  5CKH A;  3H8Z A;  1JRI A;  2EIF A;  4GLK A;  4M77 D;  3JB9 G;  1NPP A;  2X4Y A;  5L8R E;  1LOJ A;  2LVM A;  1YJW T;  4Z02 A;  4M75 D;  5DLO A;  2OAU A;  3J80 E;  3SWN C;  1VQN T;  4M77 F;  4C0Z A;  3KXT A;  3RMS A;  4F7U F;  2RJE A;  4IUP A;  2RB6 A;  2P0Q A;  1NE8 A;  2CZ7 B;  3ZEH A;  4C92 B;  1SSF A;  4JJN K;  4M7D B;  2QTX A;  2DKG A;  4N4I A;  3M58 A;  4BDY A;  2F5K A;  2RI2 A;  4M7A G;  3CMA A;  3DLL A;  1VIE A;  2OTL A;  2FVU A;  2XG8 D;  3JCM e;  2L8D A;  3CMA T;  3X26 B;  4J6Y A;  5FRO A;  4C5I A;  1JB0 E;  2X4J A;  3SFM A;  5GMK j;  2XI9 A;  3E9F A;  1YJ9 A;  4YTL A;  2PVG B;  5FLX E;  2JTM A;  4OGC A;  4A53 A;  1ZBX A;  4PKC C;  2XDP A;  4QW2 A;  3JCM h;  3OYK A;  4OF1 A;  5GAM j;  3J7A F;  1N9R A;  3QBY A;  3QZ5 B;  2RHI A;  2QI2 A;  4M77 C;  2MF2 A;  1Q81 U;  2VGN A;  3MCA B;  4M75 C;  3T9N A;  2DVE A;  4M78 G;  5IN1 A;  3URG A;  5LJ5 f;  3CD6 T;  1D3B A;  5I2S A;  2KAF A;  3FEO A;  4HKE A;  1O9S A;  4C0D B;  1G3S A;  2VUB A;  2LT4 A;  3CBM A;  4XTU A;  4ATO A;  2E6Z A;  1VUB A;  3SD4 A;  2Y4X A;  3FJP A;  3JCM V;  3CME A;  2E10 A;  1M1F A;  1BIA A;  2ZGW A;  2XK0 A;  2K57 A;  2E65 A;  5LJ3 e;  3MP1 A;  4C5H A;  3WXM B;  4C8Q A;  1VQ9 A;  1KQS A;  3ASK A;  3NTI A;  2DTO A;  4PJO D;  3M57 A;  4C8Q F;  1QVG S;  3V8K A;  3L42 A;  3MEW A;  3G71 A;  3M55 A;  3HFO A;  4PJO F;  1VQO A;  4HT8 A;  3CCJ A;  2M1H A;  2V8K A;  3OMC A;  4JRI A;  3G71 T;  1KC8 U;  1WQ7 A;  3OYN A;  3CC4 A;  2JTF A;  4FM4 B;  3JCM f;  3JAM E;  4O5V A;  3DLM A;  1UGS B;  4A4F A;  4BAC A;  1IRE B;  3H6Z A;  1K8A C;  2JVV A;  4XU0 A;  1AHJ B;  2E70 A;  2WSF E;  5CVI A;  4A54 A;  4E7K A;  1FX7 A;  1Q82 U;  3JB9 J;  3CCE T;  4CI0 C;  2MWP A;  2JZ2 A;  3OW2 A;  4X9D A;  3X25 B;  5KE3 A;  5LJ5 d;  3KUF A;  3SB2 A;  2RI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...