5GAMe

Foot region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
83
structure length
75
Chain Sequence
MVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSKGTPLGKILLKGDNITLITS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 Angstrom resolution
pubmed doi rcsb
molecule tags Transcription
molecule keywords U5 snRNA
total genus 8
structure length 75
sequence length 83
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
e PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5game00
4C8QG 5GANj 4V2SA 1H641 4C92G 3JCMc 4EMHA 5GANg 2VXEA 3M4GA 1U1TA 4M7AB 3RIRA 4QVDA 4M7AD 4M7DE 4M77B 3FJPA 2E1HA 3JB9I 1LJOA 5LJ3d 1N9RA 4OP0A 4M7AG 4M7DF 4HT8A 4M78E 4PJOE 1B34A 4M77C 4MMKA 2EWNA 1M8VA 4F7UG 3V8LA 2EAYA 2RM4A 3EFRA 4M75C 1LOJA 3SWNA 5GAN5 1KQ2A 2DXUA 5GAOr 2E65A 5GAMg 4M78A 2RD1A 4X9DA 3JCMf 1MGQA 5GANd 2E10A 4C92A 5GMKh 1M5Q1 3AHUA 2VXFA 4JRIA 4M78G 3RKWA 2DTOA 5GAMj 3RERA 1I81A 3VU3C 4M7DB 5GAOn 3QHSA 3BDUA 4M75D 2FB7A 4M78B 4M75F 4MMLA 4PJOF 5LJ5f 4JUVA 4XTUA 5I21A 4N0AC 5GANf 2DJZA 3JB9G 4C92B 1I4K1 3SWNC 4C92E 4XU0A 4HA8A 4F7UA 5LJ5e 3JCMd 5GAMd 5GAN7 4M78C 1WQ7A 2DTIA 5GMKe 1TH7A 5GAN2 2E41A 4NL3A 4N0AA 2EJ9A 2DTHA 5GAN8 4EMKB 4C92C 2HNIA 5GAOq 5LJ3f 2YLCA 3RKXA 4C8QB 4XQ3A 3JB9H 4HT9A 4EMGA 3SB2A 4M77F 4XTYA 5LJ5g 4PJOA 4Y91A 3L1AA 4C92D 4J5YA 2CGHA 5GMKm 5GMKj 3BY7A 4M78F 1D3BA 2EJGA 4M75B 4M78D 4M75E 5CAIA 2DKGA 3QO3A 4EMKA 1Y96B 4F7UE 2ZGWA 3INZA 2DXTA 3JCMJ 3FB9A 2DZCA 4PJOG 4M7AE 4A54A 3HFNA 4EMKC 3RUXA 4DQ2A 5GAMf 4M7AA 2RB6A 4M77A 3RESA 1YCYA 1X01A 1BIBA 5GAMe 1WQWA 2YHTA 4C8QF 2Y90A 5LJ5d 2JN0A 3JCMV 4M75A 5GAOp 4XTZA 3QUIA 4XU1A 5GAMh 3GIBA 5GAN4 1JBMA 1Y96A 4PNOA 3JCMh 4M75G 1HXDA 4C8QE 3JB9J 2QTXA 3PGGA 1I5LA 2RA2A 3BW1A 3V7SA 4F7UF 3JB9F 1I8FA 3FIFA 3SWNB 4M77G 1LNXA 3BFMA 4WF2A 4PJOD 5GAN3 4M7AF 1U1SA 2VC8A 4XTVA 5GAOm 4M7DG 2K57A 4C92F 5LJ3g 3JCMg 4J6XA 3JCMP 2DVEA 4M7DC 4M7DD 3V8KA 5LJ3e 3HSBA 3V7RA 1HK9A 4RCCA 3EFSA 3V8JA 4NL2A 4X9CA 4A53A 5GANh 3QSUA 4JRKA 3JCMX 4XTXA 4M7DA 3L2ZA 4QVCA 2E64A 5GAOl 4M77D 5GANe 5GAN6 4F7UB 1N9SA 5LJ3h 2EJFA 4XU2A 3JCMQ 1WNLA 4XU3A 3HFOA 5LJ3j 5LJ5h 4JLIA 3V7CA 4M7AC 4PJOC 1BIAA 3JB9D 4NOYA 2FYKA 2YLBA 3RKYA 4C8QA 2DEQA 1KQ1A 2I2LA 4XTWA 5GMKl 4PJOB 3JCMe 4C8QC 4C8QD 1JRIA 3JCMb 1D3BB 4M77E 2DZ9A 4RCBA 5DY9A 5GMKi 3JCMW 4J6WA 5LJ5j 1B34B 4J6YA 1WPYA
chains in the Genus database with same CATH superfamily
1YIJT 1H641 1ZBXA 3JCMc 4FCYA 5FLXE 5IHKA 2FVUA 4OF1A 3OYIA 2QGGA 4M7AG 9ATCB 1IGUA 1M8VA 1BU1A 1QMCA 4A4EA 2EQJA 3TVTA 3CMEQ 2OI3A 1XJWB 8AT1B 1M5Q1 1AD5A 2VXFA 3MP1A 4LUEA 1RABB 1KG1A 2DXCA 3QJ6A 1W4SA 3VV0A 2G6FX 2KXDA 5FU6C 2G3RA 1SRMA 1OOTA 3I5SA 2RHZA 4HA8A 5CQYA 4RG2A 2LMJA 2J06A 4JS4A 1RACB 2Y4YA 2COZA 5KYNA 2K2MA 3X26B 1SKUB 3HRTA 2RJFA 4O5VA 5FU6B 2DD5A 2ROTA 2GQIA 4OMLA 2DNUA 1M1KU 2QQ9A 2QA4A 1RAHB 2DFUA 2D9TA 1EIFA 3EG9B 4OMOA 2D8HA 2RK1A 3BW1A 1VYVA 2DAQA 4F7UF 1I8FA 1M9SA 2AZVA 1LNXA 5CIUA 4C92F 4PLLA 2ED0A 3NHNA 3CCLA 1W6XA 2GCXA 2LJ3A 3S3OA 1VQ5T 3PT9A 1K9MU 1D1CA 3ASKA 3TEEA 1T0HA 2PVDB 3CCVA 4ELYC 3D7SB 2QI2A 2CYZB 1Q86U 1PG5B 3URGA 4J7IA 3G6ET 1X27A 2LCLA 4BDZA 4PJOB 1M3BA 3C12A 1ZA2B 4C8QD 4C5IA 2X3XD 2D8JA 4OMFB 1VQPQ 1HSQA 4JLGA 2KYMA 4QVDA 1BCMA 5KYXA 1WJRA 4C5EA 4M78E 2LJ1A 5CKFA 4F16A 4BE1A 1FMKA 1KHCA 2KXCA 3HRUA 4LN2A 1RI9A 2WSCE 4BY6B 4IUQA 3HHTB 2ZPFB 2GFAA 1QWFA 1AWJA 3OYAA 5GAOn 2PZ1A 3VJPA 1B07A 2X4XA 5I21A 1K73U 3CCET 1Q81C 4XU0A 2DMOA 2GNCA 5GAN2 3QDFA 2MI6A 2X51A 1Y7XA 2B86A 3CBOA 4JPBW 1OX8A 4J83A 1D3BA 2L2PA 3QWYA 1OZ2A 3EH1A 1FMWA 4M7AE 1WHJA 3G71Q 1OULA 2MPXC 2DETA 2RB6A 4PKCC 1I5OB 2OTJA 2QEXT 3VS5A 2DL8A 2ESWA 2NUZA 3PGGA 2EGCA 2CZ0B 1MNDA 1MMAA 3Q1JA 3N5BB 3JCMP 4LXCA 4A53A 3EFSA 1W1FA 1S72Q 2JTEA 4IUUA 3OMCA 1M1KR 4HVUA 1H3HA 1TXQA 4K11A 1W2BS 2D1XA 2EIFA 2FZGB 3V7CA 1VA7A 1KC8R 3CCQA 2KE9A 1K4US 2C06A 1VIFA 3H6ZA 3JCMb 4AFSC 1EFNA 2PUOB 4J6YA 2QDYB 3SFMA 4C8QG 5FROA 4AG2C 3G71A 3R6OA 3ULRB 3QG1A 3CCMT 3M0UA 4L5GA 2RJCA 4DOVA 5HKCA 3V8LA 3HL8A 4OB1B 1K0SA 3CBPA 1QP3A 5KYXB 2E10A 1B3QA 3WXMB 1NJIU 1NZ9A 1WYXA 2DTOA 2KGTA 4PLIA 3CPWP 2RQVA 2JTMA 2RQTA 3L42A 4M78B 1K8AC 1MMGA 2HDAA 4J9DA 1YHQQ 2C0IA 4QW2A 5GMKe 4WTOB 3I35A 3P8BB 3A8OB 1SSHA 2QQRA 2YLCA 4RKUE 2A36A 2DX1A 3LGFA 1M1GA 2DRKA 1YJWA 2HSEB 1VQ9Q 2EJGA 2BE9B 3QO3A 1R77A 3MEUA 1YFNA 3EH2A 1FXXA 2E6NA 1I0CA 3OMGA 4Q5WA 1VIEA 2V8JA 7AT1B 1BBZA 2HCKA 2QTXA 5HK3A 2VV5A 3C94A 1QWEA 4BI8B 1QQJA 2FPEA 2LC4A 5LJ3g 3PTAA 2AT1B 1JXMA 2X4YA 3VYHB 1BCOA 1MNEA 4NL2A 1U3OA 1Y07A 3EFOA 3MJXA 1QCNA 1PC0A 1N9SA 1QVFP 5CR2A 1M90R 4LD9K 2FEIA 2W0ZA 4HCCA 1B7TA 4II1A 1MUZA 1Q81U 1YIJQ 1J3TA 1ZSGA 3I55Q 1U8RA 1RAGB 5GANj 3CCUQ 2LX9A 2QEXQ 2CP0A 4RTTA 1U1TA 1M2OA 1ZSZA 1UHCA 1JU5C 2CUDA 2L0AA 4ZGEB 1BI2A 3SWNA 3PVLA 2MK5A 4R55A 4J9GA 4UC4A 1T0JA 3CCMA 1GXIE 1ZA1B 2KROA 2F1LA 3RERA 2K79A 1I81A 1NYGA 4D8KA 1ZQ1A 4MZMA 2RF0A 5A0DA 4C92E 3GOXA 5KCHA 1S1NA 4NL3A 1TH7A 1ZUYA 1PHTA 1OU9A 1M1KC 3RKXA 3CMEA 3CCRT 3OW2S 2MWOA 3G4SQ 1VQ6T 5CAIA 2GGRA 1VQLT 2ZGWA 2LP5A 3JCMJ 3J7AF 3G4SA 4DQ2A 3M57A 1ABQA 4FYXB 4M77A 4TVRA 2HL5C 4E7HA 1VQ5Q 3FJ5A 2DYIA 3VS7A 2FPDA 2YT6A 1Q82C 2E4HA 2GBQA 3JCMg 4NS5A 5I2MA 1UFFA 4C5HA 1RI0A 3QSUA 2SRCA 3OYLA 4M7DA 1GFCA 1NJIC 4F04B 2ED1A 5GANe 4GLMA 3DB4A 1MHNA 3M9QA 1WNLA 1E7OA 4PFOA 5LJ3j 5LJ5h 3CQTA 1GBRA 1EX4A 2CT3A 1VQ9T 4DEYA 2VWFA 3LWIA 3EFOB 2I2LA 2ZPGB 4DA4A 2LVMA 2EYYA 1JRIA 1VYTA 3NTIA 2JM9A 1H92A 1RAAB 1RAIB 5GANg 1Q81R 2L3SA 1U06A 4MDWA 2JS2A 1OU8A 1JJ2A 4E7LA 1V76A 2A0FB 4RTXA 1X75C 2RD1A 2K4YA 4BB7A 5DLQE 1NPPA 3LH5A 3M0SA 1NG2A 1PSFA 4IURA 3UF4A 3OYKA 1KC8C 2BZYA 2FB7A 5CVIA 2DJZA 3JCMd 1N27A 1TS9A 2XG8D 3KXTA 3UT1A 2K2VA 2ABLA 5LJ3f 2HQXA 2PU9B 5FWBA 3CD6A 2DJQA 1OEBA 4PJOA 1FMVA 2CGHA 5GMKj 3GBQA 4GY5A 2XHCA 1D0XA 2XIDA 4EMKA 1UB4A 2LZ6B 3ZL7C 2LJ0A 1RLQC 2QK0A 1YJWQ 5GAMf 2XDDA 5A0GA 1VQ7T 1Q86R 1CSKA 3I56Q 4HVVA 1TUGB 1SG5A 3UA7A 2NUPA 3GIBA 2K5FA 3EG1A 5C0MA 1MV0B 3JSCA 4WF2A 2P0PA 1RL2A 2ZCFB 2CP2A 2KR3A 2K57A 3PMIA 3OS0A 1K8AR 1K73C 4M7DD 2PVOB 4KUIA 1KQSS 1ABOA 3QZ5B 2LCCA 2A7YA 1MMDA 2JMCA 4QVCA 1FYNA 2AZSA 1SHGA 4PL6A 5DM7R 4XU3A 4LDVA 3MKDA 2EFIA 3NMZC 2KAFA 1Z9ZA 2KBTA 4NOYA 2DEQA 1KQ1A 1S72A 1NPRA 4J7FA 2QQBA 3G1JA 3PIPA 2IG0A 3QYGB 3CCJA 1AEYA 3CCMQ 3JCMW 4DBQA 1WI7A 2J6OA 3CXCP 3JB9I 1LJOA 1KQSA 3VUBA 2H3JA 4F7UG 1I07A 2Y4XA 3KFVA 4YTLA 3A8HB 1AWWA 5HK0A 2ENMA 2Z0WA 3M4YA 1UDLA 3T9NA 4PFPA 2VVKA 2NUTB 1PKTA 3C95A 4QVZA 2F5TX 2O01E 4LNPA 3BDUA 1X6BA 2EQMA 2P0KA 1I4K1 4F7UA 5GAN7 4JJDA 1QKWA 2YRCA 4FSSA 2LNVA 3OS1A 2KNBB 4FYYB 1IO6A 2KT8A 2K9GA 3QYHB 1Y0MA 5FRNA 2YXYA 2P4RA 1VQKT 2QG9B 1PM3A 1PKSA 2H8HA 3H9NA 1GCPA 2QDLA 4OMPA 2C0TA 2YUPA 3VS0A 2RA2A 1N8RU 3FIFA 1YWPA 3SWNB 1K9MC 4PJOD 3CCSA 4B6MA 4M7AF 2V8KA 3ZEHA 3OYYA 1TOVA 4E7KA 3CC4T 2DRMA 2XD0A 1ZLMA 2KMTA 1IHVA 3CC4A 4JS5A 1JQQA 3CCST 2AKKA 1BYMA 2RHUA 3EGDB 2JXBA 1AZEA 4XU2A 2DD4A 1M4ZA 3CCUT 2M0YA 5GMKl 3KUFA 5CK9A 3JCMe 3F70A 3CC7Q 3EG2A 3SD4A 1NYFA 2MOXA 2RHIA 2M0OA 2X3WD 3M4GA 3CPWS 2E3HA 3CCVT 2EBPA 2P84A 4E7SA 2RHXA 4OP0A 1UGPB 4PJMA 3GNFB 5I11A 2J6FA 1VQ5A 2CP5A 1KQ2A 2RMOA 2MIOA 4ZNXA 3WVDB 5GAMg 1PCXA 4JJNK 3PMTA 1TWBA 5GMKh 3PFSA 4KH1B 3OS5A 1QVFS 3VU3C 3CCLQ 2QASA 4M7DB 1Y71A 4M75D 3CCRQ 3M55A 2DILA 3G4ST 1HD3A 1VQ8A 4ORZA 1VQ6Q 5GAN8 5FU7B 2NUTA 1VQLA 2ZZDA 3M5AA 1OYXA 2CP6A 1QVFA 5LJ5g 1Y57A 2L8DA 3NFCA 4RTYA 1TU0B 4Y91A 4X34A 2MCNA 1QVGS 1NLPC 1FWZA 3H41A 1UGQB 3INZA 2RK2A 1HYOA 1TSFA 2XU8A 5I22A 1I1JA 4BUGA 5GAMe 3HPWA 1ZSZB 4OGEA 3CCQQ 3MP6A 1QVGP 3JCMV 3R6NA 3MP8A 5J39A 1HXDA 1K1ZA 1WX6A 3V7SA 5FRMA 2CSQA 4D6WA 2RPNA 2MAMA 3CMAT 3SEMA 3EHQA 4N4IA 3SDZA 4HCBA 3OSSC 1HK9A 3VS2A 3L2ZA 3NPFA 1BK2A 4Z89A 4IKFA 2K3BA 5FW9A 2O4XB 5LJ3h 2EJFA 4WCIA 2RJEA 4A4FA 3VS6A 1K9MR 2CH4W 2DM1A 3RKYA 1VQNQ 3EGDA 1JEGA 2DIGA 4DBFA 1VQ4T 5DY9A 5GMKi 2OTLT 2HAXA 1PRLC 3I56A 1WDXA 4M77B 1R0CB 5CKHA 3M56A 4M7DF 1YJ9Q 3REBB 4BD3A 2RHYA 2YUOA 1R8OB 3H8ZA 2RM4A 4J9BA 3ME9A 2O2OA 5AYFA 2EYQA 2QXFA 3QBYA 3L2WA 1W2BP 5CQXA 5KYYB 4DEXA 4M78G 3RKWA 2FRYA 1WHHA 1UUEA 1UTIA 4X1VA 3JB9G 1YI2T 2FG0A 3SWNC 2DTIA 3CC7T 1Z9QA 4DBRA 1C1AA 2JVVA 3OYEA 1C6VX 2DPPB 4E7JA 1U5SA 1YJWT 2KRSA 3THKA 4J8OA 4M78D 3I56T 2DKGA 1Y96B 1JB0E 2DZCA 4RTUA 4LUDA 4M7AA 3HP9A 2BIVA 4GLKA 4ZGDB 2JS0A 2R58A 2Y90A 1QVGA 4J9FA 2LRQA 3A98A 4C8QE 3OYNA 2JMAA 3CXCA 3MHXA 3EAEA 1M3AA 1OPLA 2O9SA 2RQRA 4J6XA 2CP3A 1GBQA 3JCMX 3OBWA 2CZ6B 1LVKA 2V1QA 4JLIA 3CCJQ 3OY9A 4ME7A 1X2KA 2O4XA 1QLYA 2FZCB 4A4KA 3CCQT 1BI1A 1B34B 1WPYA 2X4JA 5J3BA 3IQLA 2HMAA 4FSXA 2E1HA 1QCFA 4AFZC 4OVAA 4VUBA 3DLLA 3CMAQ 2KQWA 2EAYA 3EG0A 1YBYA 2E65A 1H8KA 3JCMf 3BDLA 4ELZC 1KC8U 1WFWA 4C92A 3VYGA 4MZPA 4LDUA 4JRIA 2EYWA 4RTWA 2JW4A 1W2BA 3QJYA 2A28A 1VQOA 2RN8A 3QHSA 1GCQC 2CUBA 2V26A 4JJBA 1NBEB 1BKBA 2M16A 2X9HA 3RNJA 5LJ5e 2DO3A 4M78C 2BKDN 3OBYA 2OTLQ 1VQOT 1QW1A 4M77F 4XTYA 1MMNA 1WLPB 2LCSA 1HJDA 3E9GA 3QWXX 2XDBA 2D0NA 2XMFA 4CC3A 4ZN1A 1TUCA 4A54A 4EMKC 3RUXA 3X28B 1V1CA 3CCEA 2YRVA 2YHTA 2K5IA 1UGVA 3A1PA 1Y96A 2CREA 2VYTA 3M0PA 3OYGA 1YHQT 1IXDA 2A37A 3OS2A 2HZYA 3E9FA 1M90U 3CC7A 3V8KA 4KT0E 1Q7YR 5GANh 2GF7A 4ESRA 4JDSA 2E64A 2CZ1B 2ZAEA 2GTOA 3JV3A 5D7UA 4F7UB 3JCMQ 2P0QA 1YNZA 2EYZA 3OW2P 4B9XA 3OYBA 2COYA 2LQKA 2DIQA 2DLPA 2FYKA 1G83A 3CCVQ 5GJVB 2DVJA 3AHUA 2DF6A 2K5LA 4HVWA 4XK8E 3CPFA 1XQHA 4FT4A 3RIRA 2VUBA 3FJPA 2DA9A 4Y28E 2MYSA 4HCZA 5CKDA 3G6EQ 2LQWA 1EZZB 3J81E 3EGXA 4HXJA 4XAXB 2WACA 2RI3A 1OI1A 5GAN5 4HKEA 5C6SA 3CCLT 4R0KA 3TU4K 3SHWA 3NTKA 5KH6A 2F69A 4KGZB 2L89A 3H0HA 4JUVA 3E2UA 2LDMA 2EQUA 1D09B 4N0AA 2X35A 2E70A 5GAOq 1ARKA 2FHDA 3ER0A 1M30A 1G3SA 3MO8A 4PJJA 1M3CA 1OX9A 3L2UA 5IHNA 3M59A 2DYBA 2HBWA 1IRXA 3OYDA 4PJOG 2DE0X 4OGCA 3EG3A 3HKSA 5KE2A 1S72T 1Q7YU 5GAMh 1JBMA 2O88A 4J9CA 1X6GA 4M77G 4J9IA 2RO0A 3G7ZA 2VC8A 2JNGA 2OTLA 4N4GA 1YWOA 2NWMA 5ECAA 2LTOA 5LJ3e 4C0FA 5KYYA 1YJNA 1NEBA 4X9CA 3HTRA 2H3EB 2JZ2A 2RQUA 3UA6A 4P5NA 4LD6A 4RMOA 1VQOQ 4EDUA 1WHKA 2QEXA 2IIMA 3LH0A 4QKUA 1KFZA 4PJNA 2XDPA 2EQIA 3PIOA 5A2QE 1GRIA 1QP2A 4FW1A 3VS3A 2R5AA 4C8QC 2FZKB 5CO7A 3M53A 3C0CA 2KRMA 4V2SA 1YJ9T 4KGXB 2ZPBB 3EGUA 3QXEB 3QDRB 5LJ3d 1Q82U 3S3NA 2XK0A 3LWHA 1AHJB 3A5ZB 1ZSZC 4M75C 3CCUA 4X9DA 1MGQA 2BZ8A 5EC7A 5GANd 1WXBA 2HSPA 2QQAA 1YI2Q 3PE0A 3I55A 1LCKA 1UG1A 1UJYA 2D6FA 2QQSA 3VKIA 1PD1A 2KK4A 1PNJA 1K76A 5LJ5f 1K9AA 4XTUA 5GANf 2K3YA 2O31A 2QGFB 4N4HA 1QVPA 4IUVA 3M0QA 1G3YA 3OYJA 3H0FA 2HNIA 1Q82R 4OB2B 4DBHA 3VUZA 1TG0A 1UJ0A 2HEQA 2F5KA 1WXUA 4KBMB 1UEBA 3MCAB 2YUQA 3TSWA 3FB9A 1KJWA 2E5QA 1NM7A 4LE9A 1X01A 1BIBA 1T3LA 2DL4A 2PVGB 4CC4B 4XTZA 2HQHA 5A0LA 1IREB 4PNOA 2CKKA 1VQ9A 4AT1B 4BDYA 1SSFA 5GJWB 4XTVA 2FO0A 1ZUKA 4Z02A 1KD1R 2F2WA 2DVEA 1UGSB 3DKMA 3V7RA 2EKHA 3C4SA 1VUBA 4IIMA 3E1SA 1VQMQ 5GAOl 4M77D 5D6WA 1H3ZA 2RNAA 4F14A 1OZ3A 2HL3A 1VQ7Q 2LT1A 1SPKA 3JB9D 2L3RA 4B9WA 3AT1B 3M0TA 4XTWA 4E7ZA 3QZ9B 1VOMA 5IH2A 4RCBA 1N5ZA 4MMLA 1G3WA 3CEYA 1YP5A 2X4WA 2QA4Q 4M7AB 4M7AD 2COWA 2V8IA 3WVEB 1N9RA 4MMKA 3M0RA 1KIKA 2CDTA 3KBGA 4M78A 1XNIA 2RQWA 3MEWA 2AKLA 3O5ZA 3A8MB 3CXCS 2RI5A 5IXFA 3LYIA 4FT2A 2M51A 3OA6A 3S3MA 1YITA 2A08A 5KCOA 2R57A 4FU6A 4PFZA 1JJ2P 1WQ7A 2M1HA 1PSEA 2E41A 1MV3A 1JXOA 2C0OA 2SEMA 4HT9A 3ZFJA 1KK7A 4CRIA 2YRDA 1PRMC 3PNWC 4FIBA 1YIJA 2D0QB 3L2RA 2CZ7B 4C5GA 4QQ6A 4M75B 1D0ZA 1OQKA 3MEVA 2K6DA 1E6HA 3QKJA 2OTJQ 4J9HA 3HFNA 3LGLA 1YITT 3UDCA 3RESA 2RH2A 2B8AA 5M9OA 5IT9E 4M75G 3JB9J 1I5LA 2JJ9A 2PQWA 2E5KA 5GAOm 1VQLQ 2K3XA 4M7DC 2EW3A 2ECZA 2NLUA 4RCCA 1N8RC 4KH0B 5J26A 3H0IA 2DERA 4E2FB 2KSSA 2DK3A 3U23A 3HFOA 5HY6A 1VQPA 2RJDA 2AIRB 4BACA 1BIAA 4M7AC 5FWCA 1AWOA 1BB9A 2BTTA 1UECA 4C8QA 3S6WA 4R56A 2BUDA 4OMQA 4J6WA 2A3LA 4AMCA 2XICA 3UWNA 1X2QA 1YHQA 1X43A 2JTFA 4BI4A 1VQ7A 2BZXA 2EQKA 4M77C 3CCSQ 1M90C 2QAZA 2DXUA 3NTHA 1NJIR 3VS4A 4OMNA 2XKOC 4CI0C 3L2QA 1VQMT 1IB8A 3I5RA 2JM8A 2I0NA 4C0DC 1KSWA 5L8RE 3CD6T 1UE9A 2LT4A 4MZTA 5D6XA 4M75F 4N0AC 1KQSP 5GAMd 2DL5A 2PNIA 1D1AA 3RMQA 4A4HA 2DTHA 3RBBB 1VQNA 4C92C 2F2VA 1BI3A 1N6AA 3OB9A 4J5YA 2E12A 2EGAA 3MPUB 3OW2A 4M75E 2HQEA 2V1RA 4F7UE 2ZPHB 2DXTA 2M02A 2LQNA 3QPHA 4QQDA 4ZTJA 3I9QA 2KDSA 4FL6A 5LJ5d 5IHIA 4M75A 1ACMB 3EGXB 5GAN4 3META 3I55T 3CC2T 1YN8A 4M4ZA 3JB9F 3GF5A 3BFMA 2MWPA 4ZGJB 4CC2A 1P92A 3TSZA 3RDVA 3A8LB 2IPOB 1SRLA 3A8GB 4KGVB 1WZOA 1CKAA 2J05A 3X24B 4PK4A 3FDRA 4AG1C 2DXBA 1WA7A 1ZBJA 4IUPA 2YUNA 4Y92A 5LL6S 3REAB 4JRQA 2WSFE 2ZPEB 1AOJA 2MMPA 2HKQB 2YLBA 1VQ8Q 4FYVB 2OTJT 2KVQG 1WJSA 1VYUA 1IHWA 4A63B 1JJ2S 1DJ7B 1SF9A 4ATOA 2AHJB 5LJ5j 3MEAA 3DLMA 1QCOA 4C92G 2MF2A 3OYCA 1K73R 2EYXA 2CSIA 4HT8A 1M2VB 1YJNT 2EWNA 2FL7A 3FLGA 4ZTFA 4IUTA 1LOJA 3EHRA 1YCSB 1G3TA 3OQ5A 3E19A 3NGPA 1VQ6A 3OYMA 5GAMj 4KRTA 3FC3A 3CCRA 5CCAA 3CMET 2KRNA 1D0YA 2E3IA 5IAYA 3DB3A 1TUDA 1RLPC 3VS1A 4L6V5 5IXBA 4F17A 1G5VA 1N8RR 4EMKB 1ZX6A 4JJCA 1O9SA 4XQ3A 3UATA 1AT1B 1WXTA 3FEOA 1UHFA 1FX7A 3VRZA 2NUPB 1WGSA 2DBMA 3CC4Q 3ZBDA 4D8DA 4HCKA 5IN1A 1WQWA 2NYSA 2E6ZA 4BI3A 1X6OA 2FRWA 1F1BB 1X69A 1K8AU 4JZ3A 1WJQA 2EKOA 5GAN3 4M7DG 2GFUA 1C0MA 2ROLA 1VQMA 4E6RA 4C0ZA 5KYUB 1VQKQ 3M54A 1Q95G 4E7IA 3HSBA 4QQGA 2VKNA 4KUDK 3TREA 5GAN6 2YDLA 4RTZA 3TQ7P 3TCJA 2FPFA 2HKNA 3VRYA 2KT1A 4LDYA 3QIIA 3OYHA 5CKEA 4ZN3A 1WHMA 2CT4A 3BE3A 4KULA 2QA4T 4C0GA 1G2BA 1A0NB 1UGRB 5HCKA 4L59A 2CS7A 4EMHA 2VXEA 4BE2A 1ZHIA 4M7DE 1XTDA 1NEGA 4PJLA 1PD0A 4JRPA 1Q86C 4OMMA 2LX7A 4RG8A 3X20B 3EG9A 3EFRA 4O6JA 5GAOr 3OSVA 1NLOC 5EG2A 1JO8A 4MDXA 2J7IA 3GLXA 2OAWA 2AK5A 2XI9A 2JT4A 4LDXA 4CC7A 1WHGA 1GL5A 2K7AA 1VQ8T 3CBMA 4FW2A 4LDWA 2DBKA 1W70A 2BE7D 2DEUA 2L5QA 3JB9H 1KD1U 3CCEQ 4EMGA 3SB2A 4IIOA 4BE0A 1RAFB 3L1AA 1YITQ 4M78F 2OX7A 4OB3B 1YJNQ 5DLOA 3J80E 3LX7A 5L23A 2LQ8A 4C8QF 3CMAA 1IGQA 5GAOp 4XU1A 5CKBA 2L3PA 2L3QA 3JCMh 3RMSA 1LPLA 3O8VA 3G71T 3L2VA 1KHIA 1AWXA 1U1SA 3CPWA 1WHLA 2IVWA 3PVQA 2ATCB 4FYWB 4DOWA 4J9EA 1AZGB 1V29B 4EPCA 2QYZA 1VQ4Q 2VASA 2KYBA 1G8XA 2R5MA 5KYUA 5KYWB 3CC2A 2VGMA 2PUKB 4AFUC 2GTJA 1BI0A 5D6YA 4RUGA 1D3BB 2DZ9A 1O75A 5AT1B 2EGEA 1R0BG 5I2SA 1KD1C 1GFDA 1VQNT 2F2XA 3GP8A 2HBPA 4PJOE 1B34A 1QKXA 2GQVA 4E47A 4RTVA 1VQKA 3G6EA 2KI7A 1SEMA 3CD6Q 2W10A 1CKBA 4EIKA 3HRSA 1OPKA 2EPDA 1Q7YC 3LLRA 3UPUA 2YSQA 2M9UA 4PJOF 4C92B 1RUWA 2KEAA 2WSEE 3GNGA 2EVRA 2JUFA 2EJ9A 4A4GA 3P8HA 4C8QB 1AVZC 2ZPIB 4Z88A 5FU7C 4Z8AA 4C92D 5GMKm 3BY7A 3LW5E 1IZ6A 8ATCB 3M58A 1PWTA 2KY9A 3RR6A 6AT1B 4FM4B 1WIEA 1YI2A 3CC2Q 1E6GA 2CH4A 3X25B 1SHFA 1YCYA 2PTKA 3FRNA 2LNHB 2VB6A 1M27C 2JN0A 4OB0B 1NE8A 3QUIA 1OV3A 4QT7A 4AFQC 1M2VA 1VQPT 1M8MA 3OYFA 1ZUUA 2OAUA 1M1FA 3JAME 4ANJA 3JRZA 1TTHB 2JOYA 3CCJT 2QTVA 1XOVA 3GPLA 1GCQA 3V8JA 4JRKA 4XTXA 4C0DB 2CP7A 2O9VA 2YWWA 4JZ4A 2DL7A 2HD0A 1RADB 5KE3A 1T3SA 4GBQA 2P4TA 4BY6C 4PJOC 1RAEB 1YJ9A 1VQ4A 2DL3A 2J6KA 1K0XA 3P8DA 5KYWA 2OJ2A 2VGNA 4M77E 2RI2A 1D1BA
chains in the Genus database with same CATH topology
1YIJT 2X4JA 5J3BA 1H641 1ZBXA 3JCMc 3UWNA 5GANg 5FLXE 1YHQA 2FVUA 4FSXA 4OF1A 2E1HA 3OYIA 4MDWA 4OVAA 4VUBA 2JTFA 4BI4A 3DLLA 4M7AG 1VQ7A 2EQKA 4M77C 1JJ2A 1M8VA 4E7LA 2KQWA 1M90C 2EAYA 4A4EA 2EQJA 2DXUA 1YIJA 1YBYA 2E65A 1X75C 2RD1A 3NTHA 4CI0C 2K4YA 2XKOC 3BDLA 3JCMf 4ELZC 1KC8U 4BB7A 5DLQE 1NPPA 3L2QA 1VQMT 4C92A 3VYGA 1M5Q1 4MZPA 2VXFA 4C0DC 4LDUA 4JRIA 3MP1A 1W2BA 3QJYA 1PSFA 4IURA 5L8RE 3CD6T 1KG1A 1VQOA 2DXCA 3QHSA 2LT4A 3QJ6A 4MZTA 2FB7A 1W4SA 4M75F 5D6XA 3VV0A 3OYKA 1KC8C 1BKBA 4M7DG 5CVIA 2G3RA 4N0AC 2DJZA 2M16A 5FU6C 5LJ5e 3JCMd 1N27A 5GAMd 4HA8A 2RHZA 2XG8D 2DO3A 4M78C 3KXTA 3UT1A 2K2VA 2BKDN 4RG2A 5CQYA 3RMQA 3OBYA 4A4HA 2DTHA 1VQNA 4C92C 4JS4A 1VQOT 1BI3A 5LJ3f 1N6AA 2HQXA 2PU9B 2Y4YA 3CD6A 1QW1A 4PJOA 3OB9A 4M77F 4XTYA 3X26B 3HRTA 2RJFA 4J5YA 2CGHA 2E12A 5GMKj 4O5VA 3OW2A 3E9GA 4GY5A 2XHCA 4M75E 2HQEA 2DD5A 5FU6B 2XDBA 2XIDA 4EMKA 1UB4A 4F7UE 2ZPHB 2DXTA 4ZN1A 4A54A 3QPHA 4QQDA 3RUXA 4EMKC 3X28B 5GAMf 2XDDA 4ZTJA 2KDSA 2QQ9A 4FL6A 5A0GA 3CCEA 2QA4A 1M1KU 1VQ7T 2YRVA 2YHTA 5LJ5d 2K5IA 2D9TA 4M75A 3GIBA 1EIFA 2K5FA 3META 1Y96A 5GAN4 3I55T 3CC2T 2RK1A 5C0MA 3BW1A 4F7UF 2DAQA 2VYTA 3JB9F 1I8FA 1M9SA 3GF5A 3JSCA 1LNXA 3BFMA 4WF2A 3OYGA 2P0PA 1YHQT 1RL2A 2MWPA 2ZCFB 3OS2A 5CIUA 4ZGJB 2K57A 4C92F 1P92A 4PLLA 3PMIA 3E9FA 3OS0A 1K73C 3CCLA 1M90U 4M7DD 2PVOB 2GCXA 4KUIA 3V8KA 3CC7A 3S3OA 3A8LB 3PT9A 4KT0E 1KQSS 1K9MU 3A8GB 1VQ5T 5GANh 2GF7A 3QZ5B 1Q82U 2LCCA 2A7YA 3X24B 3ASKA 4JDSA 4QVCA 2E64A 3FDRA 2DXBA 2CZ1B 3TEEA 2PVDB 3CCVA 4IUPA 4F7UB 4PL6A 5LL6S 5DM7R 3JCMQ 4XU3A 4LDVA 4NL3A 2P0QA 4ELYC 4JRQA 2EFIA 2WSFE 4B9XA 2KAFA 2ZPEB 2QI2A 2CYZB 2MMPA 3OYBA 2LQKA 2DIQA 2FYKA 2YLBA 4NOYA 1Q86U 3URGA 4J7IA 3G6ET 2DEQA 1KQ1A 2LCLA 4BDZA 2KVQG 1S72A 4PJOB 1NPRA 4J7FA 2OTJT 2QQBA 1WJSA 3PIPA 3C12A 2IG0A 3QYGB 4C8QD 4C5IA 3CCJA 1JJ2S 1DJ7B 4ATOA 3JCMW 2AHJB 3AHUA 5LJ5j 3MEAA 4OMFB 3DLMA 4C92G 2K5LA 4XK8E 2MF2A 1XQHA 3CPFA 4JLGA 4FT4A 3RIRA 4QVDA 2VUBA 3OYCA 3FJPA 3JB9I 1WJRA 1LJOA 4Y28E 4HCZA 5CKDA 4C5EA 4HT8A 1KQSA 3J81E 4M78E 1YJNT 5CKFA 2EWNA 3VUBA 4BE1A 1KHCA 2FL7A 2H3JA 3FLGA 2WACA 2Y4XA 3HRUA 4XAXB 4F7UG 4YTLA 4ZTFA 2RI3A 1LOJA 4IUTA 1OI1A 5GAN5 3A8HB 4HKEA 5C6SA 2WSCE 5HK0A 4BY6B 3CCLT 3TU4K 4IUQA 3CCQT 1G3TA 3HHTB 3OQ5A 3E19A 2ZPFB 3M4YA 1VQ6A 2GFAA 3T9NA 3NTKA 3OYMA 5GAMj 5KH6A 3FC3A 3CCRA 5CCAA 3C95A 4QVZA 3OYAA 2F69A 3CMET 2F5TX 2O01E 5GAOn 3BDUA 3VJPA 2EQMA 5IAYA 2L89A 3DB3A 2P0KA 4JUVA 2X4XA 5I21A 1K73U 4L6V5 1I4K1 4F7UA 1Q81C 4XU0A 5GAN7 3CCET 2LDMA 2EQUA 1G5VA 5GAN2 4N0AA 2X35A 2MI6A 4EMKB 2E70A 5GAOq 1Y7XA 1O9SA 3CBOA 4XQ3A 2LNVA 3OS1A 2FHDA 3FEOA 3ER0A 1G3SA 3MO8A 1FX7A 4J83A 1D3BA 3QYHB 3L2UA 1WGSA 5FRNA 1OZ2A 3M59A 3OYDA 4PJOG 1VQKT 4M7AE 4OGCA 3ZBDA 3HKSA 2RB6A 5KE2A 4PKCC 5IN1A 1WQWA 1S72T 2OTJA 2QEXT 1Q7YU 5GAMh 2E6ZA 1JBMA 4BI3A 3PGGA 1X6OA 2RA2A 1K8AU 1N8RU 3FIFA 3SWNB 4M77G 1K9MC 1WJQA 4PJOD 3CCSA 2EKOA 2RO0A 3G7ZA 2VC8A 2V8KA 2JNGA 2CZ0B 2GFUA 3ZEHA 5GAN3 3OYYA 4N4GA 1VQMA 2OTLA 3Q1JA 4C0ZA 3N5BB 4E7KA 2LTOA 3CC4T 3M54A 3JCMP 4E7IA 5LJ3e 4QQGA 3HSBA 4C0FA 2XD0A 1YJNA 2KMTA 4A53A 4KUDK 3EFSA 3CC4A 4X9CA 3TREA 4IUUA 2JZ2A 3OMCA 4JS5A 3CCST 4RMOA 4P5NA 4LD6A 5GAN6 1BYMA 2RHUA 1W2BS 4XU2A 3TCJA 4EDUA 2EIFA 2QEXA 3LH0A 3V7CA 4LDYA 2DD4A 3QIIA 3OYHA 2XDPA 1M4ZA 3CCQA 3PIOA 2C06A 5A2QE 5CKEA 4ZN3A 4KULA 3CCUT 5GMKl 3KUFA 5CK9A 3JCMe 3F70A 1QP2A 3SD4A 4C0GA 2QA4T 1VIFA 3H6ZA 4C8QC 2R5AA 3JCMb 5CO7A 3M53A 2RHIA 2PUOB 2M0OA 4J6YA 2QDYB 3SFMA 4C8QG 1UGRB 4V2SA 1YJ9T 4L59A 2CS7A 5FROA 4EMHA 3G71A 2VXEA 4BE2A 3M4GA 3CPWS 2ZPBB 3R6OA 3CCVT 1ZHIA 3QXEB 1XTDA 4M7DE 4JRPA 1Q86C 3QG1A 3CCMT 3QDRB 5LJ3d 2RHXA 4L5GA 2RJCA 4OP0A 4RG8A 1UGPB 4DOVA 3GNFB 3S3NA 2XK0A 3LWHA 1AHJB 3X20B 3A5ZB 1VQ5A 5HKCA 3V8LA 3HL8A 3EFRA 4M75C 4O6JA 4OB1B 1KQ2A 3CCUA 5GAOr 3OSVA 3WVDB 5GAMg 4X9DA 3CBPA 1MGQA 1QP3A 3PMTA 5EG2A 5GANd 4JJNK 2E10A 5GMKh 3PFSA 3WXMB 1NJIU 3OS5A 2QQAA 1QVFS 1NZ9A 3I55A 4MDXA 2DTOA 2D6FA 4PLIA 3GLXA 3VU3C 2QQSA 3VKIA 2KK4A 4M7DB 2XI9A 2JTMA 1Y71A 3L42A 4M75D 4M78B 1K8AC 5LJ5f 4LDXA 4XTUA 5GANf 2K3YA 1VQ8T 3CBMA 4LDWA 4N4HA 3M55A 4QW2A 1QVPA 4IUVA 5GMKe 3G4ST 1G3YA 1VQ8A 5A0LA 5GAN8 3OYJA 5FU7B 2L5QA 2HNIA 3A8OB 3P8BB 1VQLA 2ZZDA 2QQRA 1OYXA 2YLCA 3M5AA 4RKUE 3JB9H 1KD1U 1QVFA 4EMGA 3SB2A 3LGFA 5LJ5g 2L8DA 3NFCA 4BE0A 4OB2B 1M1GA 1YJWA 4Y91A 3L1AA 3VUZA 4M78F 2EJGA 2F5KA 4KBMB 4X34A 1QVGS 3QO3A 1UEBA 1FWZA 3MCAB 1UGQB 3INZA 3MEUA 2RK2A 3FB9A 4OB3B 2E5QA 2XU8A 5DLOA 3J80E 3LX7A 4BUGA 1X01A 1BIBA 1FXXA 2LQ8A 3HPWA 2E6NA 4OGEA 2PVGB 3MP6A 4C8QF 5GAMe 3JCMV 3CMAA 5GAOp 4XTZA 4XU1A 3MP8A 3OMGA 1VIEA 2V8JA 1IREB 4Q5WA 4PNOA 2CKKA 5CKBA 3RMSA 1HXDA 3JCMh 5J39A 2QTXA 1VQ9A 3O8VA 3G71T 3V7SA 3L2VA 5HK3A 4BDYA 2VV5A 1SSFA 1KHIA 3C94A 5FRMA 1U1SA 4XTVA 4BI8B 3CPWA 4D6WA 2IVWA 2LC4A 2MAMA 4Z02A 5LJ3g 3PTAA 3CMAT 4M7AC 4N4IA 2X4YA 2DVEA 3SDZA 1UGSB 4HCBA 4DOWA 3OSSC 3DKMA 3V7RA 3VYHB 1HK9A 3C4SA 1VUBA 4NL2A 1V29B 3E1SA 4EPCA 3L2ZA 1Y07A 5GAOl 4M77D 5D6WA 4IKFA 1N9SA 2R5MA 1H3ZA 2O4XB 5LJ3h 2EJFA 3CC2A 2VGMA 2PUKB 5CR2A 4LD9K 2RJEA 4A4FA 1OZ3A 2LT1A 4HCCA 3JB9D 4II1A 2L3RA 3RKYA 1Q81U 1BI0A 4B9WA 4XTWA 5D6YA 1U8RA 2DIGA 3QZ9B 1D3BB 1VQ4T 2DZ9A 4RCBA 5DY9A 5GMKi 2OTLT 1O75A 4MMLA 1G3WA 5GANj 2HAXA 2LX9A 3CEYA 3I56A 2X4WA 1U1TA 4M7AB 4M7AD 4M77B 2V8IA 5I2SA 3WVEB 5CKHA 1KD1C 1N9RA 1VQNT 3M56A 3GP8A 4M7DF 2HBPA 4PJOE 1B34A 4MMKA 2RHYA 4BD3A 1R8OB 3H8ZA 4ZGEB 2GQVA 1BI2A 2RM4A 3KBGA 4E47A 3SWNA 1VQKA 3ME9A 5AYFA 4R55A 4M78A 3G6EA 2EYQA 1XNIA 2QXFA 3MEWA 3QBYA 4UC4A 3L2WA 3CCMA 3HRSA 5CQXA 3A8MB 1GXIE 4M78G 3RKWA 3RERA 3CXCS 1I81A 2RI5A 3LLRA 3LYIA 4FT2A 3UPUA 1Q7YC 2M9UA 1ZQ1A 3OA6A 4PJOF 4MZMA 3S3MA 1YITA 5KCOA 2R57A 4FU6A 3JB9G 4C92B 5A0DA 3SWNC 4C92E 3GOXA 1YI2T 5KCHA 1WQ7A 2DTIA 2M1HA 1TH7A 1PSEA 2E41A 2WSEE 2JUFA 3GNGA 2EJ9A 3CC7T 4A4GA 1M1KC 3RKXA 2JVVA 3P8HA 4C8QB 3OYEA 3CMEA 3CCRT 3ZFJA 2DPPB 4HT9A 3OW2S 4CRIA 2ZPIB 5FU7C 4E7JA 2MWOA 4C92D 1YJWT 5GMKm 3PNWC 1VQ6T 3BY7A 3LW5E 1IZ6A 2D0QB 4FIBA 3L2RA 2CZ7B 4C5GA 3M58A 4J8OA 4M75B 4M78D 4QQ6A 2DKGA 3MEVA 5CAIA 3I56T 2KY9A 3QKJA 1Y96B 1VQLT 1JB0E 2ZGWA 3JCMJ 4M7AF 3J7AF 4FM4B 2DZCA 3G4SA 1YI2A 3HFNA 4M7AA 3LGLA 4DQ2A 3HP9A 2BIVA 3M57A 3UDCA 3X25B 1YITT 4M77A 3RESA 1YCYA 2RH2A 3FRNA 4GLKA 2B8AA 4ZGDB 2Y90A 2R58A 2JN0A 4OB0B 1NE8A 5M9OA 3QUIA 4TVRA 5IT9E 1VQPT 1QVGA 2LRQA 4C8QE 4M75G 3JB9J 1I5LA 3OYFA 4E7HA 3OYNA 2PQWA 3CXCA 2OAUA 1M1FA 3JAME 3MHXA 5GAOm 3EAEA 2K3XA 3JRZA 1Q82C 2JOYA 3JCMg 4J6XA 3CCJT 4NS5A 1XOVA 5I2MA 3GPLA 4M7DC 4C5HA 2NLUA 4RCCA 3V8JA 1RI0A 1N8RC 3QSUA 4JRKA 3OYLA 3JCMX 3OBWA 4XTXA 4M7DA 4C0DB 2CZ6B 5J26A 1NJIC 2HD0A 5GANe 5KE3A 3DB4A 2P4TA 4BY6C 1MHNA 3M9QA 1WNLA 2KSSA 2DK3A 3HFOA 5LJ3j 4JLIA 5HY6A 2RJDA 5LJ5h 4BACA 1BIAA 1VQPA 1VQ9T 1VQ4A 1YJ9A 4PJOC 3LWIA 4C8QA 3OY9A 2I2LA 4ME7A 3S6WA 2ZPGB 3P8DA 2O4XA 4DA4A 2LVMA 2VGNA 4R56A 1JRIA 2BUDA 4M77E 4A4KA 3NTIA 2RI2A 4J6WA 1BI1A 1B34B 2A3LA 1WPYA 2XICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8Q G;  5GAN j;  4V2S A;  1H64 1;  4C92 G;  3JCM c;  4EMH A;  5GAN g;  2VXE A;  3M4G A;  1U1T A;  4M7A B;  3RIR A;  4QVD A;  4M7A D;  4M7D E;  4M77 B;  3FJP A;  2E1H A;  3JB9 I;  1LJO A;  5LJ3 d;  1N9R A;  4OP0 A;  4M7A G;  4M7D F;  4HT8 A;  4M78 E;  4PJO E;  1B34 A;  4M77 C;  4MMK A;  2EWN A;  1M8V A;  4F7U G;  3V8L A;  2EAY A;  2RM4 A;  3EFR A;  4M75 C;  1LOJ A;  3SWN A;  5GAN 5;  1KQ2 A;  2DXU A;  5GAO r;  2E65 A;  5GAM g;  4M78 A;  2RD1 A;  4X9D A;  3JCM f;  1MGQ A;  5GAN d;  2E10 A;  4C92 A;  5GMK h;  1M5Q 1;  3AHU A;  2VXF A;  4JRI A;  4M78 G;  3RKW A;  2DTO A;  5GAM j;  3RER A;  1I81 A;  3VU3 C;  4M7D B;  5GAO n;  3QHS A;  3BDU A;  4M75 D;  2FB7 A;  4M78 B;  4M75 F;  4MML A;  4PJO F;  5LJ5 f;  4JUV A;  4XTU A;  5I21 A;  4N0A C;  5GAN f;  2DJZ A;  3JB9 G;  4C92 B;  1I4K 1;  3SWN C;  4C92 E;  4XU0 A;  4HA8 A;  4F7U A;  5LJ5 e;  3JCM d;  5GAM d;  5GAN 7;  4M78 C;  1WQ7 A;  2DTI A;  5GMK e;  1TH7 A;  5GAN 2;  2E41 A;  4NL3 A;  4N0A A;  2EJ9 A;  2DTH A;  5GAN 8;  4EMK B;  4C92 C;  2HNI A;  5GAO q;  5LJ3 f;  2YLC A;  3RKX A;  4C8Q B;  4XQ3 A;  3JB9 H;  4HT9 A;  4EMG A;  3SB2 A;  4M77 F;  4XTY A;  5LJ5 g;  4PJO A;  4Y91 A;  3L1A A;  4C92 D;  4J5Y A;  2CGH A;  5GMK m;  5GMK j;  3BY7 A;  4M78 F;  1D3B A;  2EJG A;  4M75 B;  4M78 D;  4M75 E;  5CAI A;  2DKG A;  3QO3 A;  4EMK A;  1Y96 B;  4F7U E;  2ZGW A;  3INZ A;  2DXT A;  3JCM J;  3FB9 A;  2DZC A;  4PJO G;  4M7A E;  4A54 A;  3HFN A;  4EMK C;  3RUX A;  4DQ2 A;  5GAM f;  4M7A A;  2RB6 A;  4M77 A;  3RES A;  1YCY A;  1X01 A;  1BIB A;  5GAM e;  1WQW A;  2YHT A;  4C8Q F;  2Y90 A;  5LJ5 d;  2JN0 A;  3JCM V;  4M75 A;  5GAO p;  4XTZ A;  3QUI A;  4XU1 A;  5GAM h;  3GIB A;  5GAN 4;  1JBM A;  1Y96 A;  4PNO A;  3JCM h;  4M75 G;  1HXD A;  4C8Q E;  3JB9 J;  2QTX A;  3PGG A;  1I5L A;  2RA2 A;  3BW1 A;  3V7S A;  4F7U F;  3JB9 F;  1I8F A;  3FIF A;  3SWN B;  4M77 G;  1LNX A;  3BFM A;  4WF2 A;  4PJO D;  5GAN 3;  4M7A F;  1U1S A;  2VC8 A;  4XTV A;  5GAO m;  4M7D G;  2K57 A;  4C92 F;  5LJ3 g;  3JCM g;  4J6X A;  3JCM P;  2DVE A;  4M7D C;  4M7D D;  3V8K A;  5LJ3 e;  3HSB A;  3V7R A;  1HK9 A;  4RCC A;  3EFS A;  3V8J A;  4NL2 A;  4X9C A;  4A53 A;  5GAN h;  3QSU A;  4JRK A;  3JCM X;  4XTX A;  4M7D A;  3L2Z A;  4QVC A;  2E64 A;  5GAO l;  4M77 D;  5GAN e;  5GAN 6;  4F7U B;  1N9S A;  5LJ3 h;  2EJF A;  4XU2 A;  3JCM Q;  1WNL A;  4XU3 A;  3HFO A;  5LJ3 j;  5LJ5 h;  4JLI A;  3V7C A;  4M7A C;  4PJO C;  1BIA A;  3JB9 D;  4NOY A;  2FYK A;  2YLB A;  3RKY A;  4C8Q A;  2DEQ A;  1KQ1 A;  2I2L A;  4XTW A;  5GMK l;  4PJO B;  3JCM e;  4C8Q C;  4C8Q D;  1JRI A;  3JCM b;  1D3B B;  4M77 E;  2DZ9 A;  4RCB A;  5DY9 A;  5GMK i;  3JCM W;  4J6W A;  5LJ5 j;  1B34 B;  4J6Y A;  1WPY A; 
#chains in the Genus database with same CATH topology
 1YIJ T;  1H64 1;  1ZBX A;  3JCM c;  4FCY A;  5FLX E;  5IHK A;  2FVU A;  4OF1 A;  3OYI A;  2QGG A;  4M7A G;  9ATC B;  1IGU A;  1M8V A;  1BU1 A;  1QMC A;  4A4E A;  2EQJ A;  3TVT A;  3CME Q;  2OI3 A;  1XJW B;  8AT1 B;  1M5Q 1;  1AD5 A;  2VXF A;  3MP1 A;  4LUE A;  1RAB B;  1KG1 A;  2DXC A;  3QJ6 A;  1W4S A;  3VV0 A;  2G6F X;  2KXD A;  5FU6 C;  2G3R A;  1SRM A;  1OOT A;  3I5S A;  2RHZ A;  4HA8 A;  5CQY A;  4RG2 A;  2LMJ A;  2J06 A;  4JS4 A;  1RAC B;  2Y4Y A;  2COZ A;  5KYN A;  2K2M A;  3X26 B;  1SKU B;  3HRT A;  2RJF A;  4O5V A;  5FU6 B;  2DD5 A;  2ROT A;  2GQI A;  4OML A;  2DNU A;  1M1K U;  2QQ9 A;  2QA4 A;  1RAH B;  2DFU A;  2D9T A;  1EIF A;  3EG9 B;  4OMO A;  2D8H A;  2RK1 A;  3BW1 A;  1VYV A;  2DAQ A;  4F7U F;  1I8F A;  1M9S A;  2AZV A;  1LNX A;  5CIU A;  4C92 F;  4PLL A;  2ED0 A;  3NHN A;  3CCL A;  1W6X A;  2GCX A;  2LJ3 A;  3S3O A;  1VQ5 T;  3PT9 A;  1K9M U;  1D1C A;  3ASK A;  3TEE A;  1T0H A;  2PVD B;  3CCV A;  4ELY C;  3D7S B;  2QI2 A;  2CYZ B;  1Q86 U;  1PG5 B;  3URG A;  4J7I A;  3G6E T;  1X27 A;  2LCL A;  4BDZ A;  4PJO B;  1M3B A;  3C12 A;  1ZA2 B;  4C8Q D;  4C5I A;  2X3X D;  2D8J A;  4OMF B;  1VQP Q;  1HSQ A;  4JLG A;  2KYM A;  4QVD A;  1BCM A;  5KYX A;  1WJR A;  4C5E A;  4M78 E;  2LJ1 A;  5CKF A;  4F16 A;  4BE1 A;  1FMK A;  1KHC A;  2KXC A;  3HRU A;  4LN2 A;  1RI9 A;  2WSC E;  4BY6 B;  4IUQ A;  3HHT B;  2ZPF B;  2GFA A;  1QWF A;  1AWJ A;  3OYA A;  5GAO n;  2PZ1 A;  3VJP A;  1B07 A;  2X4X A;  5I21 A;  1K73 U;  3CCE T;  1Q81 C;  4XU0 A;  2DMO A;  2GNC A;  5GAN 2;  3QDF A;  2MI6 A;  2X51 A;  1Y7X A;  2B86 A;  3CBO A;  4JPB W;  1OX8 A;  4J83 A;  1D3B A;  2L2P A;  3QWY A;  1OZ2 A;  3EH1 A;  1FMW A;  4M7A E;  1WHJ A;  3G71 Q;  1OUL A;  2MPX C;  2DET A;  2RB6 A;  4PKC C;  1I5O B;  2OTJ A;  2QEX T;  3VS5 A;  2DL8 A;  2ESW A;  2NUZ A;  3PGG A;  2EGC A;  2CZ0 B;  1MND A;  1MMA A;  3Q1J A;  3N5B B;  3JCM P;  4LXC A;  4A53 A;  3EFS A;  1W1F A;  1S72 Q;  2JTE A;  4IUU A;  3OMC A;  1M1K R;  4HVU A;  1H3H A;  1TXQ A;  4K11 A;  1W2B S;  2D1X A;  2EIF A;  2FZG B;  3V7C A;  1VA7 A;  1KC8 R;  3CCQ A;  2KE9 A;  1K4U S;  2C06 A;  1VIF A;  3H6Z A;  3JCM b;  4AFS C;  1EFN A;  2PUO B;  4J6Y A;  2QDY B;  3SFM A;  4C8Q G;  5FRO A;  4AG2 C;  3G71 A;  3R6O A;  3ULR B;  3QG1 A;  3CCM T;  3M0U A;  4L5G A;  2RJC A;  4DOV A;  5HKC A;  3V8L A;  3HL8 A;  4OB1 B;  1K0S A;  3CBP A;  1QP3 A;  5KYX B;  2E10 A;  1B3Q A;  3WXM B;  1NJI U;  1NZ9 A;  1WYX A;  2DTO A;  2KGT A;  4PLI A;  3CPW P;  2RQV A;  2JTM A;  2RQT A;  3L42 A;  4M78 B;  1K8A C;  1MMG A;  2HDA A;  4J9D A;  1YHQ Q;  2C0I A;  4QW2 A;  5GMK e;  4WTO B;  3I35 A;  3P8B B;  3A8O B;  1SSH A;  2QQR A;  2YLC A;  4RKU E;  2A36 A;  2DX1 A;  3LGF A;  1M1G A;  2DRK A;  1YJW A;  2HSE B;  1VQ9 Q;  2EJG A;  2BE9 B;  3QO3 A;  1R77 A;  3MEU A;  1YFN A;  3EH2 A;  1FXX A;  2E6N A;  1I0C A;  3OMG A;  4Q5W A;  1VIE A;  2V8J A;  7AT1 B;  1BBZ A;  2HCK A;  2QTX A;  5HK3 A;  2VV5 A;  3C94 A;  1QWE A;  4BI8 B;  1QQJ A;  2FPE A;  2LC4 A;  5LJ3 g;  3PTA A;  2AT1 B;  1JXM A;  2X4Y A;  3VYH B;  1BCO A;  1MNE A;  4NL2 A;  1U3O A;  1Y07 A;  3EFO A;  3MJX A;  1QCN A;  1PC0 A;  1N9S A;  1QVF P;  5CR2 A;  1M90 R;  4LD9 K;  2FEI A;  2W0Z A;  4HCC A;  1B7T A;  4II1 A;  1MUZ A;  1Q81 U;  1YIJ Q;  1J3T A;  1ZSG A;  3I55 Q;  1U8R A;  1RAG B;  5GAN j;  3CCU Q;  2LX9 A;  2QEX Q;  2CP0 A;  4RTT A;  1U1T A;  1M2O A;  1ZSZ A;  1UHC A;  1JU5 C;  2CUD A;  2L0A A;  4ZGE B;  1BI2 A;  3SWN A;  3PVL A;  2MK5 A;  4R55 A;  4J9G A;  4UC4 A;  1T0J A;  3CCM A;  1GXI E;  1ZA1 B;  2KRO A;  2F1L A;  3RER A;  2K79 A;  1I81 A;  1NYG A;  4D8K A;  1ZQ1 A;  4MZM A;  2RF0 A;  5A0D A;  4C92 E;  3GOX A;  5KCH A;  1S1N A;  4NL3 A;  1TH7 A;  1ZUY A;  1PHT A;  1OU9 A;  1M1K C;  3RKX A;  3CME A;  3CCR T;  3OW2 S;  2MWO A;  3G4S Q;  1VQ6 T;  5CAI A;  2GGR A;  1VQL T;  2ZGW A;  2LP5 A;  3JCM J;  3J7A F;  3G4S A;  4DQ2 A;  3M57 A;  1ABQ A;  4FYX B;  4M77 A;  4TVR A;  2HL5 C;  4E7H A;  1VQ5 Q;  3FJ5 A;  2DYI A;  3VS7 A;  2FPD A;  2YT6 A;  1Q82 C;  2E4H A;  2GBQ A;  3JCM g;  4NS5 A;  5I2M A;  1UFF A;  4C5H A;  1RI0 A;  3QSU A;  2SRC A;  3OYL A;  4M7D A;  1GFC A;  1NJI C;  4F04 B;  2ED1 A;  5GAN e;  4GLM A;  3DB4 A;  1MHN A;  3M9Q A;  1WNL A;  1E7O A;  4PFO A;  5LJ3 j;  5LJ5 h;  3CQT A;  1GBR A;  1EX4 A;  2CT3 A;  1VQ9 T;  4DEY A;  2VWF A;  3LWI A;  3EFO B;  2I2L A;  2ZPG B;  4DA4 A;  2LVM A;  2EYY A;  1JRI A;  1VYT A;  3NTI A;  2JM9 A;  1H92 A;  1RAA B;  1RAI B;  5GAN g;  1Q81 R;  2L3S A;  1U06 A;  4MDW A;  2JS2 A;  1OU8 A;  1JJ2 A;  4E7L A;  1V76 A;  2A0F B;  4RTX A;  1X75 C;  2RD1 A;  2K4Y A;  4BB7 A;  5DLQ E;  1NPP A;  3LH5 A;  3M0S A;  1NG2 A;  1PSF A;  4IUR A;  3UF4 A;  3OYK A;  1KC8 C;  2BZY A;  2FB7 A;  5CVI A;  2DJZ A;  3JCM d;  1N27 A;  1TS9 A;  2XG8 D;  3KXT A;  3UT1 A;  2K2V A;  2ABL A;  5LJ3 f;  2HQX A;  2PU9 B;  5FWB A;  3CD6 A;  2DJQ A;  1OEB A;  4PJO A;  1FMV A;  2CGH A;  5GMK j;  3GBQ A;  4GY5 A;  2XHC A;  1D0X A;  2XID A;  4EMK A;  1UB4 A;  2LZ6 B;  3ZL7 C;  2LJ0 A;  1RLQ C;  2QK0 A;  1YJW Q;  5GAM f;  2XDD A;  5A0G A;  1VQ7 T;  1Q86 R;  1CSK A;  3I56 Q;  4HVV A;  1TUG B;  1SG5 A;  3UA7 A;  2NUP A;  3GIB A;  2K5F A;  3EG1 A;  5C0M A;  1MV0 B;  3JSC A;  4WF2 A;  2P0P A;  1RL2 A;  2ZCF B;  2CP2 A;  2KR3 A;  2K57 A;  3PMI A;  3OS0 A;  1K8A R;  1K73 C;  4M7D D;  2PVO B;  4KUI A;  1KQS S;  1ABO A;  3QZ5 B;  2LCC A;  2A7Y A;  1MMD A;  2JMC A;  4QVC A;  1FYN A;  2AZS A;  1SHG A;  4PL6 A;  5DM7 R;  4XU3 A;  4LDV A;  3MKD A;  2EFI A;  3NMZ C;  2KAF A;  1Z9Z A;  2KBT A;  4NOY A;  2DEQ A;  1KQ1 A;  1S72 A;  1NPR A;  4J7F A;  2QQB A;  3G1J A;  3PIP A;  2IG0 A;  3QYG B;  3CCJ A;  1AEY A;  3CCM Q;  3JCM W;  4DBQ A;  1WI7 A;  2J6O A;  3CXC P;  3JB9 I;  1LJO A;  1KQS A;  3VUB A;  2H3J A;  4F7U G;  1I07 A;  2Y4X A;  3KFV A;  4YTL A;  3A8H B;  1AWW A;  5HK0 A;  2ENM A;  2Z0W A;  3M4Y A;  1UDL A;  3T9N A;  4PFP A;  2VVK A;  2NUT B;  1PKT A;  3C95 A;  4QVZ A;  2F5T X;  2O01 E;  4LNP A;  3BDU A;  1X6B A;  2EQM A;  2P0K A;  1I4K 1;  4F7U A;  5GAN 7;  4JJD A;  1QKW A;  2YRC A;  4FSS A;  2LNV A;  3OS1 A;  2KNB B;  4FYY B;  1IO6 A;  2KT8 A;  2K9G A;  3QYH B;  1Y0M A;  5FRN A;  2YXY A;  2P4R A;  1VQK T;  2QG9 B;  1PM3 A;  1PKS A;  2H8H A;  3H9N A;  1GCP A;  2QDL A;  4OMP A;  2C0T A;  2YUP A;  3VS0 A;  2RA2 A;  1N8R U;  3FIF A;  1YWP A;  3SWN B;  1K9M C;  4PJO D;  3CCS A;  4B6M A;  4M7A F;  2V8K A;  3ZEH A;  3OYY A;  1TOV A;  4E7K A;  3CC4 T;  2DRM A;  2XD0 A;  1ZLM A;  2KMT A;  1IHV A;  3CC4 A;  4JS5 A;  1JQQ A;  3CCS T;  2AKK A;  1BYM A;  2RHU A;  3EGD B;  2JXB A;  1AZE A;  4XU2 A;  2DD4 A;  1M4Z A;  3CCU T;  2M0Y A;  5GMK l;  3KUF A;  5CK9 A;  3JCM e;  3F70 A;  3CC7 Q;  3EG2 A;  3SD4 A;  1NYF A;  2MOX A;  2RHI A;  2M0O A;  2X3W D;  3M4G A;  3CPW S;  2E3H A;  3CCV T;  2EBP A;  2P84 A;  4E7S A;  2RHX A;  4OP0 A;  1UGP B;  4PJM A;  3GNF B;  5I11 A;  2J6F A;  1VQ5 A;  2CP5 A;  1KQ2 A;  2RMO A;  2MIO A;  4ZNX A;  3WVD B;  5GAM g;  1PCX A;  4JJN K;  3PMT A;  1TWB A;  5GMK h;  3PFS A;  4KH1 B;  3OS5 A;  1QVF S;  3VU3 C;  3CCL Q;  2QAS A;  4M7D B;  1Y71 A;  4M75 D;  3CCR Q;  3M55 A;  2DIL A;  3G4S T;  1HD3 A;  1VQ8 A;  4ORZ A;  1VQ6 Q;  5GAN 8;  5FU7 B;  2NUT A;  1VQL A;  2ZZD A;  3M5A A;  1OYX A;  2CP6 A;  1QVF A;  5LJ5 g;  1Y57 A;  2L8D A;  3NFC A;  4RTY A;  1TU0 B;  4Y91 A;  4X34 A;  2MCN A;  1QVG S;  1NLP C;  1FWZ A;  3H41 A;  1UGQ B;  3INZ A;  2RK2 A;  1HYO A;  1TSF A;  2XU8 A;  5I22 A;  1I1J A;  4BUG A;  5GAM e;  3HPW A;  1ZSZ B;  4OGE A;  3CCQ Q;  3MP6 A;  1QVG P;  3JCM V;  3R6N A;  3MP8 A;  5J39 A;  1HXD A;  1K1Z A;  1WX6 A;  3V7S A;  5FRM A;  2CSQ A;  4D6W A;  2RPN A;  2MAM A;  3CMA T;  3SEM A;  3EHQ A;  4N4I A;  3SDZ A;  4HCB A;  3OSS C;  1HK9 A;  3VS2 A;  3L2Z A;  3NPF A;  1BK2 A;  4Z89 A;  4IKF A;  2K3B A;  5FW9 A;  2O4X B;  5LJ3 h;  2EJF A;  4WCI A;  2RJE A;  4A4F A;  3VS6 A;  1K9M R;  2CH4 W;  2DM1 A;  3RKY A;  1VQN Q;  3EGD A;  1JEG A;  2DIG A;  4DBF A;  1VQ4 T;  5DY9 A;  5GMK i;  2OTL T;  2HAX A;  1PRL C;  3I56 A;  1WDX A;  4M77 B;  1R0C B;  5CKH A;  3M56 A;  4M7D F;  1YJ9 Q;  3REB B;  4BD3 A;  2RHY A;  2YUO A;  1R8O B;  3H8Z A;  2RM4 A;  4J9B A;  3ME9 A;  2O2O A;  5AYF A;  2EYQ A;  2QXF A;  3QBY A;  3L2W A;  1W2B P;  5CQX A;  5KYY B;  4DEX A;  4M78 G;  3RKW A;  2FRY A;  1WHH A;  1UUE A;  1UTI A;  4X1V A;  3JB9 G;  1YI2 T;  2FG0 A;  3SWN C;  2DTI A;  3CC7 T;  1Z9Q A;  4DBR A;  1C1A A;  2JVV A;  3OYE A;  1C6V X;  2DPP B;  4E7J A;  1U5S A;  1YJW T;  2KRS A;  3THK A;  4J8O A;  4M78 D;  3I56 T;  2DKG A;  1Y96 B;  1JB0 E;  2DZC A;  4RTU A;  4LUD A;  4M7A A;  3HP9 A;  2BIV A;  4GLK A;  4ZGD B;  2JS0 A;  2R58 A;  2Y90 A;  1QVG A;  4J9F A;  2LRQ A;  3A98 A;  4C8Q E;  3OYN A;  2JMA A;  3CXC A;  3MHX A;  3EAE A;  1M3A A;  1OPL A;  2O9S A;  2RQR A;  4J6X A;  2CP3 A;  1GBQ A;  3JCM X;  3OBW A;  2CZ6 B;  1LVK A;  2V1Q A;  4JLI A;  3CCJ Q;  3OY9 A;  4ME7 A;  1X2K A;  2O4X A;  1QLY A;  2FZC B;  4A4K A;  3CCQ T;  1BI1 A;  1B34 B;  1WPY A;  2X4J A;  5J3B A;  3IQL A;  2HMA A;  4FSX A;  2E1H A;  1QCF A;  4AFZ C;  4OVA A;  4VUB A;  3DLL A;  3CMA Q;  2KQW A;  2EAY A;  3EG0 A;  1YBY A;  2E65 A;  1H8K A;  3JCM f;  3BDL A;  4ELZ C;  1KC8 U;  1WFW A;  4C92 A;  3VYG A;  4MZP A;  4LDU A;  4JRI A;  2EYW A;  4RTW A;  2JW4 A;  1W2B A;  3QJY A;  2A28 A;  1VQO A;  2RN8 A;  3QHS A;  1GCQ C;  2CUB A;  2V26 A;  4JJB A;  1NBE B;  1BKB A;  2M16 A;  2X9H A;  3RNJ A;  5LJ5 e;  2DO3 A;  4M78 C;  2BKD N;  3OBY A;  2OTL Q;  1VQO T;  1QW1 A;  4M77 F;  4XTY A;  1MMN A;  1WLP B;  2LCS A;  1HJD A;  3E9G A;  3QWX X;  2XDB A;  2D0N A;  2XMF A;  4CC3 A;  4ZN1 A;  1TUC A;  4A54 A;  4EMK C;  3RUX A;  3X28 B;  1V1C A;  3CCE A;  2YRV A;  2YHT A;  2K5I A;  1UGV A;  3A1P A;  1Y96 A;  2CRE A;  2VYT A;  3M0P A;  3OYG A;  1YHQ T;  1IXD A;  2A37 A;  3OS2 A;  2HZY A;  3E9F A;  1M90 U;  3CC7 A;  3V8K A;  4KT0 E;  1Q7Y R;  5GAN h;  2GF7 A;  4ESR A;  4JDS A;  2E64 A;  2CZ1 B;  2ZAE A;  2GTO A;  3JV3 A;  5D7U A;  4F7U B;  3JCM Q;  2P0Q A;  1YNZ A;  2EYZ A;  3OW2 P;  4B9X A;  3OYB A;  2COY A;  2LQK A;  2DIQ A;  2DLP A;  2FYK A;  1G83 A;  3CCV Q;  5GJV B;  2DVJ A;  3AHU A;  2DF6 A;  2K5L A;  4HVW A;  4XK8 E;  3CPF A;  1XQH A;  4FT4 A;  3RIR A;  2VUB A;  3FJP A;  2DA9 A;  4Y28 E;  2MYS A;  4HCZ A;  5CKD A;  3G6E Q;  2LQW A;  1EZZ B;  3J81 E;  3EGX A;  4HXJ A;  4XAX B;  2WAC A;  2RI3 A;  1OI1 A;  5GAN 5;  4HKE A;  5C6S A;  3CCL T;  4R0K A;  3TU4 K;  3SHW A;  3NTK A;  5KH6 A;  2F69 A;  4KGZ B;  2L89 A;  3H0H A;  4JUV A;  3E2U A;  2LDM A;  2EQU A;  1D09 B;  4N0A A;  2X35 A;  2E70 A;  5GAO q;  1ARK A;  2FHD A;  3ER0 A;  1M30 A;  1G3S A;  3MO8 A;  4PJJ A;  1M3C A;  1OX9 A;  3L2U A;  5IHN A;  3M59 A;  2DYB A;  2HBW A;  1IRX A;  3OYD A;  4PJO G;  2DE0 X;  4OGC A;  3EG3 A;  3HKS A;  5KE2 A;  1S72 T;  1Q7Y U;  5GAM h;  1JBM A;  2O88 A;  4J9C A;  1X6G A;  4M77 G;  4J9I A;  2RO0 A;  3G7Z A;  2VC8 A;  2JNG A;  2OTL A;  4N4G A;  1YWO A;  2NWM A;  5ECA A;  2LTO A;  5LJ3 e;  4C0F A;  5KYY A;  1YJN A;  1NEB A;  4X9C A;  3HTR A;  2H3E B;  2JZ2 A;  2RQU A;  3UA6 A;  4P5N A;  4LD6 A;  4RMO A;  1VQO Q;  4EDU A;  1WHK A;  2QEX A;  2IIM A;  3LH0 A;  4QKU A;  1KFZ A;  4PJN A;  2XDP A;  2EQI A;  3PIO A;  5A2Q E;  1GRI A;  1QP2 A;  4FW1 A;  3VS3 A;  2R5A A;  4C8Q C;  2FZK B;  5CO7 A;  3M53 A;  3C0C A;  2KRM A;  4V2S A;  1YJ9 T;  4KGX B;  2ZPB B;  3EGU A;  3QXE B;  3QDR B;  5LJ3 d;  1Q82 U;  3S3N A;  2XK0 A;  3LWH A;  1AHJ B;  3A5Z B;  1ZSZ C;  4M75 C;  3CCU A;  4X9D A;  1MGQ A;  2BZ8 A;  5EC7 A;  5GAN d;  1WXB A;  2HSP A;  2QQA A;  1YI2 Q;  3PE0 A;  3I55 A;  1LCK A;  1UG1 A;  1UJY A;  2D6F A;  2QQS A;  3VKI A;  1PD1 A;  2KK4 A;  1PNJ A;  1K76 A;  5LJ5 f;  1K9A A;  4XTU A;  5GAN f;  2K3Y A;  2O31 A;  2QGF B;  4N4H A;  1QVP A;  4IUV A;  3M0Q A;  1G3Y A;  3OYJ A;  3H0F A;  2HNI A;  1Q82 R;  4OB2 B;  4DBH A;  3VUZ A;  1TG0 A;  1UJ0 A;  2HEQ A;  2F5K A;  1WXU A;  4KBM B;  1UEB A;  3MCA B;  2YUQ A;  3TSW A;  3FB9 A;  1KJW A;  2E5Q A;  1NM7 A;  4LE9 A;  1X01 A;  1BIB A;  1T3L A;  2DL4 A;  2PVG B;  4CC4 B;  4XTZ A;  2HQH A;  5A0L A;  1IRE B;  4PNO A;  2CKK A;  1VQ9 A;  4AT1 B;  4BDY A;  1SSF A;  5GJW B;  4XTV A;  2FO0 A;  1ZUK A;  4Z02 A;  1KD1 R;  2F2W A;  2DVE A;  1UGS B;  3DKM A;  3V7R A;  2EKH A;  3C4S A;  1VUB A;  4IIM A;  3E1S A;  1VQM Q;  5GAO l;  4M77 D;  5D6W A;  1H3Z A;  2RNA A;  4F14 A;  1OZ3 A;  2HL3 A;  1VQ7 Q;  2LT1 A;  1SPK A;  3JB9 D;  2L3R A;  4B9W A;  3AT1 B;  3M0T A;  4XTW A;  4E7Z A;  3QZ9 B;  1VOM A;  5IH2 A;  4RCB A;  1N5Z A;  4MML A;  1G3W A;  3CEY A;  1YP5 A;  2X4W A;  2QA4 Q;  4M7A B;  4M7A D;  2COW A;  2V8I A;  3WVE B;  1N9R A;  4MMK A;  3M0R A;  1KIK A;  2CDT A;  3KBG A;  4M78 A;  1XNI A;  2RQW A;  3MEW A;  2AKL A;  3O5Z A;  3A8M B;  3CXC S;  2RI5 A;  5IXF A;  3LYI A;  4FT2 A;  2M51 A;  3OA6 A;  3S3M A;  1YIT A;  2A08 A;  5KCO A;  2R57 A;  4FU6 A;  4PFZ A;  1JJ2 P;  1WQ7 A;  2M1H A;  1PSE A;  2E41 A;  1MV3 A;  1JXO A;  2C0O A;  2SEM A;  4HT9 A;  3ZFJ A;  1KK7 A;  4CRI A;  2YRD A;  1PRM C;  3PNW C;  4FIB A;  1YIJ A;  2D0Q B;  3L2R A;  2CZ7 B;  4C5G A;  4QQ6 A;  4M75 B;  1D0Z A;  1OQK A;  3MEV A;  2K6D A;  1E6H A;  3QKJ A;  2OTJ Q;  4J9H A;  3HFN A;  3LGL A;  1YIT T;  3UDC A;  3RES A;  2RH2 A;  2B8A A;  5M9O A;  5IT9 E;  4M75 G;  3JB9 J;  1I5L A;  2JJ9 A;  2PQW A;  2E5K A;  5GAO m;  1VQL Q;  2K3X A;  4M7D C;  2EW3 A;  2ECZ A;  2NLU A;  4RCC A;  1N8R C;  4KH0 B;  5J26 A;  3H0I A;  2DER A;  4E2F B;  2KSS A;  2DK3 A;  3U23 A;  3HFO A;  5HY6 A;  1VQP A;  2RJD A;  2AIR B;  4BAC A;  1BIA A;  4M7A C;  5FWC A;  1AWO A;  1BB9 A;  2BTT A;  1UEC A;  4C8Q A;  3S6W A;  4R56 A;  2BUD A;  4OMQ A;  4J6W A;  2A3L A;  4AMC A;  2XIC A;  3UWN A;  1X2Q A;  1YHQ A;  1X43 A;  2JTF A;  4BI4 A;  1VQ7 A;  2BZX A;  2EQK A;  4M77 C;  3CCS Q;  1M90 C;  2QAZ A;  2DXU A;  3NTH A;  1NJI R;  3VS4 A;  4OMN A;  2XKO C;  4CI0 C;  3L2Q A;  1VQM T;  1IB8 A;  3I5R A;  2JM8 A;  2I0N A;  4C0D C;  1KSW A;  5L8R E;  3CD6 T;  1UE9 A;  2LT4 A;  4MZT A;  5D6X A;  4M75 F;  4N0A C;  1KQS P;  5GAM d;  2DL5 A;  2PNI A;  1D1A A;  3RMQ A;  4A4H A;  2DTH A;  3RBB B;  1VQN A;  4C92 C;  2F2V A;  1BI3 A;  1N6A A;  3OB9 A;  4J5Y A;  2E12 A;  2EGA A;  3MPU B;  3OW2 A;  4M75 E;  2HQE A;  2V1R A;  4F7U E;  2ZPH B;  2DXT A;  2M02 A;  2LQN A;  3QPH A;  4QQD A;  4ZTJ A;  3I9Q A;  2KDS A;  4FL6 A;  5LJ5 d;  5IHI A;  4M75 A;  1ACM B;  3EGX B;  5GAN 4;  3MET A;  3I55 T;  3CC2 T;  1YN8 A;  4M4Z A;  3JB9 F;  3GF5 A;  3BFM A;  2MWP A;  4ZGJ B;  4CC2 A;  1P92 A;  3TSZ A;  3RDV A;  3A8L B;  2IPO B;  1SRL A;  3A8G B;  4KGV B;  1WZO A;  1CKA A;  2J05 A;  3X24 B;  4PK4 A;  3FDR A;  4AG1 C;  2DXB A;  1WA7 A;  1ZBJ A;  4IUP A;  2YUN A;  4Y92 A;  5LL6 S;  3REA B;  4JRQ A;  2WSF E;  2ZPE B;  1AOJ A;  2MMP A;  2HKQ B;  2YLB A;  1VQ8 Q;  4FYV B;  2OTJ T;  2KVQ G;  1WJS A;  1VYU A;  1IHW A;  4A63 B;  1JJ2 S;  1DJ7 B;  1SF9 A;  4ATO A;  2AHJ B;  5LJ5 j;  3MEA A;  3DLM A;  1QCO A;  4C92 G;  2MF2 A;  3OYC A;  1K73 R;  2EYX A;  2CSI A;  4HT8 A;  1M2V B;  1YJN T;  2EWN A;  2FL7 A;  3FLG A;  4ZTF A;  4IUT A;  1LOJ A;  3EHR A;  1YCS B;  1G3T A;  3OQ5 A;  3E19 A;  3NGP A;  1VQ6 A;  3OYM A;  5GAM j;  4KRT A;  3FC3 A;  3CCR A;  5CCA A;  3CME T;  2KRN A;  1D0Y A;  2E3I A;  5IAY A;  3DB3 A;  1TUD A;  1RLP C;  3VS1 A;  4L6V 5;  5IXB A;  4F17 A;  1G5V A;  1N8R R;  4EMK B;  1ZX6 A;  4JJC A;  1O9S A;  4XQ3 A;  3UAT A;  1AT1 B;  1WXT A;  3FEO A;  1UHF A;  1FX7 A;  3VRZ A;  2NUP B;  1WGS A;  2DBM A;  3CC4 Q;  3ZBD A;  4D8D A;  4HCK A;  5IN1 A;  1WQW A;  2NYS A;  2E6Z A;  4BI3 A;  1X6O A;  2FRW A;  1F1B B;  1X69 A;  1K8A U;  4JZ3 A;  1WJQ A;  2EKO A;  5GAN 3;  4M7D G;  2GFU A;  1C0M A;  2ROL A;  1VQM A;  4E6R A;  4C0Z A;  5KYU B;  1VQK Q;  3M54 A;  1Q95 G;  4E7I A;  3HSB A;  4QQG A;  2VKN A;  4KUD K;  3TRE A;  5GAN 6;  2YDL A;  4RTZ A;  3TQ7 P;  3TCJ A;  2FPF A;  2HKN A;  3VRY A;  2KT1 A;  4LDY A;  3QII A;  3OYH A;  5CKE A;  4ZN3 A;  1WHM A;  2CT4 A;  3BE3 A;  4KUL A;  2QA4 T;  4C0G A;  1G2B A;  1A0N B;  1UGR B;  5HCK A;  4L59 A;  2CS7 A;  4EMH A;  2VXE A;  4BE2 A;  1ZHI A;  4M7D E;  1XTD A;  1NEG A;  4PJL A;  1PD0 A;  4JRP A;  1Q86 C;  4OMM A;  2LX7 A;  4RG8 A;  3X20 B;  3EG9 A;  3EFR A;  4O6J A;  5GAO r;  3OSV A;  1NLO C;  5EG2 A;  1JO8 A;  4MDX A;  2J7I A;  3GLX A;  2OAW A;  2AK5 A;  2XI9 A;  2JT4 A;  4LDX A;  4CC7 A;  1WHG A;  1GL5 A;  2K7A A;  1VQ8 T;  3CBM A;  4FW2 A;  4LDW A;  2DBK A;  1W70 A;  2BE7 D;  2DEU A;  2L5Q A;  3JB9 H;  1KD1 U;  3CCE Q;  4EMG A;  3SB2 A;  4IIO A;  4BE0 A;  1RAF B;  3L1A A;  1YIT Q;  4M78 F;  2OX7 A;  4OB3 B;  1YJN Q;  5DLO A;  3J80 E;  3LX7 A;  5L23 A;  2LQ8 A;  4C8Q F;  3CMA A;  1IGQ A;  5GAO p;  4XU1 A;  5CKB A;  2L3P A;  2L3Q A;  3JCM h;  3RMS A;  1LPL A;  3O8V A;  3G71 T;  3L2V A;  1KHI A;  1AWX A;  1U1S A;  3CPW A;  1WHL A;  2IVW A;  3PVQ A;  2ATC B;  4FYW B;  4DOW A;  4J9E A;  1AZG B;  1V29 B;  4EPC A;  2QYZ A;  1VQ4 Q;  2VAS A;  2KYB A;  1G8X A;  2R5M A;  5KYU A;  5KYW B;  3CC2 A;  2VGM A;  2PUK B;  4AFU C;  2GTJ A;  1BI0 A;  5D6Y A;  4RUG A;  1D3B B;  2DZ9 A;  1O75 A;  5AT1 B;  2EGE A;  1R0B G;  5I2S A;  1KD1 C;  1GFD A;  1VQN T;  2F2X A;  3GP8 A;  2HBP A;  4PJO E;  1B34 A;  1QKX A;  2GQV A;  4E47 A;  4RTV A;  1VQK A;  3G6E A;  2KI7 A;  1SEM A;  3CD6 Q;  2W10 A;  1CKB A;  4EIK A;  3HRS A;  1OPK A;  2EPD A;  1Q7Y C;  3LLR A;  3UPU A;  2YSQ A;  2M9U A;  4PJO F;  4C92 B;  1RUW A;  2KEA A;  2WSE E;  3GNG A;  2EVR A;  2JUF A;  2EJ9 A;  4A4G A;  3P8H A;  4C8Q B;  1AVZ C;  2ZPI B;  4Z88 A;  5FU7 C;  4Z8A A;  4C92 D;  5GMK m;  3BY7 A;  3LW5 E;  1IZ6 A;  8ATC B;  3M58 A;  1PWT A;  2KY9 A;  3RR6 A;  6AT1 B;  4FM4 B;  1WIE A;  1YI2 A;  3CC2 Q;  1E6G A;  2CH4 A;  3X25 B;  1SHF A;  1YCY A;  2PTK A;  3FRN A;  2LNH B;  2VB6 A;  1M27 C;  2JN0 A;  4OB0 B;  1NE8 A;  3QUI A;  1OV3 A;  4QT7 A;  4AFQ C;  1M2V A;  1VQP T;  1M8M A;  3OYF A;  1ZUU A;  2OAU A;  1M1F A;  3JAM E;  4ANJ A;  3JRZ A;  1TTH B;  2JOY A;  3CCJ T;  2QTV A;  1XOV A;  3GPL A;  1GCQ A;  3V8J A;  4JRK A;  4XTX A;  4C0D B;  2CP7 A;  2O9V A;  2YWW A;  4JZ4 A;  2DL7 A;  2HD0 A;  1RAD B;  5KE3 A;  1T3S A;  4GBQ A;  2P4T A;  4BY6 C;  4PJO C;  1RAE B;  1YJ9 A;  1VQ4 A;  2DL3 A;  2J6K A;  1K0X A;  3P8D A;  5KYW A;  2OJ2 A;  2VGN A;  4M77 E;  2RI2 A;  1D1B A; 
#chains in the Genus database with same CATH homology
 1YIJ T;  2X4J A;  5J3B A;  1H64 1;  1ZBX A;  3JCM c;  3UWN A;  5GAN g;  5FLX E;  1YHQ A;  2FVU A;  4FSX A;  4OF1 A;  2E1H A;  3OYI A;  4MDW A;  4OVA A;  4VUB A;  2JTF A;  4BI4 A;  3DLL A;  4M7A G;  1VQ7 A;  2EQK A;  4M77 C;  1JJ2 A;  1M8V A;  4E7L A;  2KQW A;  1M90 C;  2EAY A;  4A4E A;  2EQJ A;  2DXU A;  1YIJ A;  1YBY A;  2E65 A;  1X75 C;  2RD1 A;  3NTH A;  4CI0 C;  2K4Y A;  2XKO C;  3BDL A;  3JCM f;  4ELZ C;  1KC8 U;  4BB7 A;  5DLQ E;  1NPP A;  3L2Q A;  1VQM T;  4C92 A;  3VYG A;  1M5Q 1;  4MZP A;  2VXF A;  4C0D C;  4LDU A;  4JRI A;  3MP1 A;  1W2B A;  3QJY A;  1PSF A;  4IUR A;  5L8R E;  3CD6 T;  1KG1 A;  1VQO A;  2DXC A;  3QHS A;  2LT4 A;  3QJ6 A;  4MZT A;  2FB7 A;  1W4S A;  4M75 F;  5D6X A;  3VV0 A;  3OYK A;  1KC8 C;  1BKB A;  4M7D G;  5CVI A;  2G3R A;  4N0A C;  2DJZ A;  2M16 A;  5FU6 C;  5LJ5 e;  3JCM d;  1N27 A;  5GAM d;  4HA8 A;  2RHZ A;  2XG8 D;  2DO3 A;  4M78 C;  3KXT A;  3UT1 A;  2K2V A;  2BKD N;  4RG2 A;  5CQY A;  3RMQ A;  3OBY A;  4A4H A;  2DTH A;  1VQN A;  4C92 C;  4JS4 A;  1VQO T;  1BI3 A;  5LJ3 f;  1N6A A;  2HQX A;  2PU9 B;  2Y4Y A;  3CD6 A;  1QW1 A;  4PJO A;  3OB9 A;  4M77 F;  4XTY A;  3X26 B;  3HRT A;  2RJF A;  4J5Y A;  2CGH A;  2E12 A;  5GMK j;  4O5V A;  3OW2 A;  3E9G A;  4GY5 A;  2XHC A;  4M75 E;  2HQE A;  2DD5 A;  5FU6 B;  2XDB A;  2XID A;  4EMK A;  1UB4 A;  4F7U E;  2ZPH B;  2DXT A;  4ZN1 A;  4A54 A;  3QPH A;  4QQD A;  3RUX A;  4EMK C;  3X28 B;  5GAM f;  2XDD A;  4ZTJ A;  2KDS A;  2QQ9 A;  4FL6 A;  5A0G A;  3CCE A;  2QA4 A;  1M1K U;  1VQ7 T;  2YRV A;  2YHT A;  5LJ5 d;  2K5I A;  2D9T A;  4M75 A;  3GIB A;  1EIF A;  2K5F A;  3MET A;  1Y96 A;  5GAN 4;  3I55 T;  3CC2 T;  2RK1 A;  5C0M A;  3BW1 A;  4F7U F;  2DAQ A;  2VYT A;  3JB9 F;  1I8F A;  1M9S A;  3GF5 A;  3JSC A;  1LNX A;  3BFM A;  4WF2 A;  3OYG A;  2P0P A;  1YHQ T;  1RL2 A;  2MWP A;  2ZCF B;  3OS2 A;  5CIU A;  4ZGJ B;  2K57 A;  4C92 F;  1P92 A;  4PLL A;  3PMI A;  3E9F A;  3OS0 A;  1K73 C;  3CCL A;  1M90 U;  4M7D D;  2PVO B;  2GCX A;  4KUI A;  3V8K A;  3CC7 A;  3S3O A;  3A8L B;  3PT9 A;  4KT0 E;  1KQS S;  1K9M U;  3A8G B;  1VQ5 T;  5GAN h;  2GF7 A;  3QZ5 B;  1Q82 U;  2LCC A;  2A7Y A;  3X24 B;  3ASK A;  4JDS A;  4QVC A;  2E64 A;  3FDR A;  2DXB A;  2CZ1 B;  3TEE A;  2PVD B;  3CCV A;  4IUP A;  4F7U B;  4PL6 A;  5LL6 S;  5DM7 R;  3JCM Q;  4XU3 A;  4LDV A;  4NL3 A;  2P0Q A;  4ELY C;  4JRQ A;  2EFI A;  2WSF E;  4B9X A;  2KAF A;  2ZPE B;  2QI2 A;  2CYZ B;  2MMP A;  3OYB A;  2LQK A;  2DIQ A;  2FYK A;  2YLB A;  4NOY A;  1Q86 U;  3URG A;  4J7I A;  3G6E T;  2DEQ A;  1KQ1 A;  2LCL A;  4BDZ A;  2KVQ G;  1S72 A;  4PJO B;  1NPR A;  4J7F A;  2OTJ T;  2QQB A;  1WJS A;  3PIP A;  3C12 A;  2IG0 A;  3QYG B;  4C8Q D;  4C5I A;  3CCJ A;  1JJ2 S;  1DJ7 B;  4ATO A;  3JCM W;  2AHJ B;  3AHU A;  5LJ5 j;  3MEA A;  4OMF B;  3DLM A;  4C92 G;  2K5L A;  4XK8 E;  2MF2 A;  1XQH A;  3CPF A;  4JLG A;  4FT4 A;  3RIR A;  4QVD A;  2VUB A;  3OYC A;  3FJP A;  3JB9 I;  1WJR A;  1LJO A;  4Y28 E;  4HCZ A;  5CKD A;  4C5E A;  4HT8 A;  1KQS A;  3J81 E;  4M78 E;  1YJN T;  5CKF A;  2EWN A;  3VUB A;  4BE1 A;  1KHC A;  2FL7 A;  2H3J A;  3FLG A;  2WAC A;  2Y4X A;  3HRU A;  4XAX B;  4F7U G;  4YTL A;  4ZTF A;  2RI3 A;  1LOJ A;  4IUT A;  1OI1 A;  5GAN 5;  3A8H B;  4HKE A;  5C6S A;  2WSC E;  5HK0 A;  4BY6 B;  3CCL T;  3TU4 K;  4IUQ A;  3CCQ T;  1G3T A;  3HHT B;  3OQ5 A;  3E19 A;  2ZPF B;  3M4Y A;  1VQ6 A;  2GFA A;  3T9N A;  3NTK A;  3OYM A;  5GAM j;  5KH6 A;  3FC3 A;  3CCR A;  5CCA A;  3C95 A;  4QVZ A;  3OYA A;  2F69 A;  3CME T;  2F5T X;  2O01 E;  5GAO n;  3BDU A;  3VJP A;  2EQM A;  5IAY A;  2L89 A;  3DB3 A;  2P0K A;  4JUV A;  2X4X A;  5I21 A;  1K73 U;  4L6V 5;  1I4K 1;  4F7U A;  1Q81 C;  4XU0 A;  5GAN 7;  3CCE T;  2LDM A;  2EQU A;  1G5V A;  5GAN 2;  4N0A A;  2X35 A;  2MI6 A;  4EMK B;  2E70 A;  5GAO q;  1Y7X A;  1O9S A;  3CBO A;  4XQ3 A;  2LNV A;  3OS1 A;  2FHD A;  3FEO A;  3ER0 A;  1G3S A;  3MO8 A;  1FX7 A;  4J83 A;  1D3B A;  3QYH B;  3L2U A;  1WGS A;  5FRN A;  1OZ2 A;  3M59 A;  3OYD A;  4PJO G;  1VQK T;  4M7A E;  4OGC A;  3ZBD A;  3HKS A;  2RB6 A;  5KE2 A;  4PKC C;  5IN1 A;  1WQW A;  1S72 T;  2OTJ A;  2QEX T;  1Q7Y U;  5GAM h;  2E6Z A;  1JBM A;  4BI3 A;  3PGG A;  1X6O A;  2RA2 A;  1K8A U;  1N8R U;  3FIF A;  3SWN B;  4M77 G;  1K9M C;  1WJQ A;  4PJO D;  3CCS A;  2EKO A;  2RO0 A;  3G7Z A;  2VC8 A;  2V8K A;  2JNG A;  2CZ0 B;  2GFU A;  3ZEH A;  5GAN 3;  3OYY A;  4N4G A;  1VQM A;  2OTL A;  3Q1J A;  4C0Z A;  3N5B B;  4E7K A;  2LTO A;  3CC4 T;  3M54 A;  3JCM P;  4E7I A;  5LJ3 e;  4QQG A;  3HSB A;  4C0F A;  2XD0 A;  1YJN A;  2KMT A;  4A53 A;  4KUD K;  3EFS A;  3CC4 A;  4X9C A;  3TRE A;  4IUU A;  2JZ2 A;  3OMC A;  4JS5 A;  3CCS T;  4RMO A;  4P5N A;  4LD6 A;  5GAN 6;  1BYM A;  2RHU A;  1W2B S;  4XU2 A;  3TCJ A;  4EDU A;  2EIF A;  2QEX A;  3LH0 A;  3V7C A;  4LDY A;  2DD4 A;  3QII A;  3OYH A;  2XDP A;  1M4Z A;  3CCQ A;  3PIO A;  2C06 A;  5A2Q E;  5CKE A;  4ZN3 A;  4KUL A;  3CCU T;  5GMK l;  3KUF A;  5CK9 A;  3JCM e;  3F70 A;  1QP2 A;  3SD4 A;  4C0G A;  2QA4 T;  1VIF A;  3H6Z A;  4C8Q C;  2R5A A;  3JCM b;  5CO7 A;  3M53 A;  2RHI A;  2PUO B;  2M0O A;  4J6Y A;  2QDY B;  3SFM A;  4C8Q G;  1UGR B;  4V2S A;  1YJ9 T;  4L59 A;  2CS7 A;  5FRO A;  4EMH A;  3G71 A;  2VXE A;  4BE2 A;  3M4G A;  3CPW S;  2ZPB B;  3R6O A;  3CCV T;  1ZHI A;  3QXE B;  1XTD A;  4M7D E;  4JRP A;  1Q86 C;  3QG1 A;  3CCM T;  3QDR B;  5LJ3 d;  2RHX A;  4L5G A;  2RJC A;  4OP0 A;  4RG8 A;  1UGP B;  4DOV A;  3GNF B;  3S3N A;  2XK0 A;  3LWH A;  1AHJ B;  3X20 B;  3A5Z B;  1VQ5 A;  5HKC A;  3V8L A;  3HL8 A;  3EFR A;  4M75 C;  4O6J A;  4OB1 B;  1KQ2 A;  3CCU A;  5GAO r;  3OSV A;  3WVD B;  5GAM g;  4X9D A;  3CBP A;  1MGQ A;  1QP3 A;  3PMT A;  5EG2 A;  5GAN d;  4JJN K;  2E10 A;  5GMK h;  3PFS A;  3WXM B;  1NJI U;  3OS5 A;  2QQA A;  1QVF S;  1NZ9 A;  3I55 A;  4MDX A;  2DTO A;  2D6F A;  4PLI A;  3GLX A;  3VU3 C;  2QQS A;  3VKI A;  2KK4 A;  4M7D B;  2XI9 A;  2JTM A;  1Y71 A;  3L42 A;  4M75 D;  4M78 B;  1K8A C;  5LJ5 f;  4LDX A;  4XTU A;  5GAN f;  2K3Y A;  1VQ8 T;  3CBM A;  4LDW A;  4N4H A;  3M55 A;  4QW2 A;  1QVP A;  4IUV A;  5GMK e;  3G4S T;  1G3Y A;  1VQ8 A;  5A0L A;  5GAN 8;  3OYJ A;  5FU7 B;  2L5Q A;  2HNI A;  3A8O B;  3P8B B;  1VQL A;  2ZZD A;  2QQR A;  1OYX A;  2YLC A;  3M5A A;  4RKU E;  3JB9 H;  1KD1 U;  1QVF A;  4EMG A;  3SB2 A;  3LGF A;  5LJ5 g;  2L8D A;  3NFC A;  4BE0 A;  4OB2 B;  1M1G A;  1YJW A;  4Y91 A;  3L1A A;  3VUZ A;  4M78 F;  2EJG A;  2F5K A;  4KBM B;  4X34 A;  1QVG S;  3QO3 A;  1UEB A;  1FWZ A;  3MCA B;  1UGQ B;  3INZ A;  3MEU A;  2RK2 A;  3FB9 A;  4OB3 B;  2E5Q A;  2XU8 A;  5DLO A;  3J80 E;  3LX7 A;  4BUG A;  1X01 A;  1BIB A;  1FXX A;  2LQ8 A;  3HPW A;  2E6N A;  4OGE A;  2PVG B;  3MP6 A;  4C8Q F;  5GAM e;  3JCM V;  3CMA A;  5GAO p;  4XTZ A;  4XU1 A;  3MP8 A;  3OMG A;  1VIE A;  2V8J A;  1IRE B;  4Q5W A;  4PNO A;  2CKK A;  5CKB A;  3RMS A;  1HXD A;  3JCM h;  5J39 A;  2QTX A;  1VQ9 A;  3O8V A;  3G71 T;  3V7S A;  3L2V A;  5HK3 A;  4BDY A;  2VV5 A;  1SSF A;  1KHI A;  3C94 A;  5FRM A;  1U1S A;  4XTV A;  4BI8 B;  3CPW A;  4D6W A;  2IVW A;  2LC4 A;  2MAM A;  4Z02 A;  5LJ3 g;  3PTA A;  3CMA T;  4M7A C;  4N4I A;  2X4Y A;  2DVE A;  3SDZ A;  1UGS B;  4HCB A;  4DOW A;  3OSS C;  3DKM A;  3V7R A;  3VYH B;  1HK9 A;  3C4S A;  1VUB A;  4NL2 A;  1V29 B;  3E1S A;  4EPC A;  3L2Z A;  1Y07 A;  5GAO l;  4M77 D;  5D6W A;  4IKF A;  1N9S A;  2R5M A;  1H3Z A;  2O4X B;  5LJ3 h;  2EJF A;  3CC2 A;  2VGM A;  2PUK B;  5CR2 A;  4LD9 K;  2RJE A;  4A4F A;  1OZ3 A;  2LT1 A;  4HCC A;  3JB9 D;  4II1 A;  2L3R A;  3RKY A;  1Q81 U;  1BI0 A;  4B9W A;  4XTW A;  5D6Y A;  1U8R A;  2DIG A;  3QZ9 B;  1D3B B;  1VQ4 T;  2DZ9 A;  4RCB A;  5DY9 A;  5GMK i;  2OTL T;  1O75 A;  4MML A;  1G3W A;  5GAN j;  2HAX A;  2LX9 A;  3CEY A;  3I56 A;  2X4W A;  1U1T A;  4M7A B;  4M7A D;  4M77 B;  2V8I A;  5I2S A;  3WVE B;  5CKH A;  1KD1 C;  1N9R A;  1VQN T;  3M56 A;  3GP8 A;  4M7D F;  2HBP A;  4PJO E;  1B34 A;  4MMK A;  2RHY A;  4BD3 A;  1R8O B;  3H8Z A;  4ZGE B;  2GQV A;  1BI2 A;  2RM4 A;  3KBG A;  4E47 A;  3SWN A;  1VQK A;  3ME9 A;  5AYF A;  4R55 A;  4M78 A;  3G6E A;  2EYQ A;  1XNI A;  2QXF A;  3MEW A;  3QBY A;  4UC4 A;  3L2W A;  3CCM A;  3HRS A;  5CQX A;  3A8M B;  1GXI E;  4M78 G;  3RKW A;  3RER A;  3CXC S;  1I81 A;  2RI5 A;  3LLR A;  3LYI A;  4FT2 A;  3UPU A;  1Q7Y C;  2M9U A;  1ZQ1 A;  3OA6 A;  4PJO F;  4MZM A;  3S3M A;  1YIT A;  5KCO A;  2R57 A;  4FU6 A;  3JB9 G;  4C92 B;  5A0D A;  3SWN C;  4C92 E;  3GOX A;  1YI2 T;  5KCH A;  1WQ7 A;  2DTI A;  2M1H A;  1TH7 A;  1PSE A;  2E41 A;  2WSE E;  2JUF A;  3GNG A;  2EJ9 A;  3CC7 T;  4A4G A;  1M1K C;  3RKX A;  2JVV A;  3P8H A;  4C8Q B;  3OYE A;  3CME A;  3CCR T;  3ZFJ A;  2DPP B;  4HT9 A;  3OW2 S;  4CRI A;  2ZPI B;  5FU7 C;  4E7J A;  2MWO A;  4C92 D;  1YJW T;  5GMK m;  3PNW C;  1VQ6 T;  3BY7 A;  3LW5 E;  1IZ6 A;  2D0Q B;  4FIB A;  3L2R A;  2CZ7 B;  4C5G A;  3M58 A;  4J8O A;  4M75 B;  4M78 D;  4QQ6 A;  2DKG A;  3MEV A;  5CAI A;  3I56 T;  2KY9 A;  3QKJ A;  1Y96 B;  1VQL T;  1JB0 E;  2ZGW A;  3JCM J;  4M7A F;  3J7A F;  4FM4 B;  2DZC A;  3G4S A;  1YI2 A;  3HFN A;  4M7A A;  3LGL A;  4DQ2 A;  3HP9 A;  2BIV A;  3M57 A;  3UDC A;  3X25 B;  1YIT T;  4M77 A;  3RES A;  1YCY A;  2RH2 A;  3FRN A;  4GLK A;  2B8A A;  4ZGD B;  2Y90 A;  2R58 A;  2JN0 A;  4OB0 B;  1NE8 A;  5M9O A;  3QUI A;  4TVR A;  5IT9 E;  1VQP T;  1QVG A;  2LRQ A;  4C8Q E;  4M75 G;  3JB9 J;  1I5L A;  3OYF A;  4E7H A;  3OYN A;  2PQW A;  3CXC A;  2OAU A;  1M1F A;  3JAM E;  3MHX A;  5GAO m;  3EAE A;  2K3X A;  3JRZ A;  1Q82 C;  2JOY A;  3JCM g;  4J6X A;  3CCJ T;  4NS5 A;  1XOV A;  5I2M A;  3GPL A;  4M7D C;  4C5H A;  2NLU A;  4RCC A;  3V8J A;  1RI0 A;  1N8R C;  3QSU A;  4JRK A;  3OYL A;  3JCM X;  3OBW A;  4XTX A;  4M7D A;  4C0D B;  2CZ6 B;  5J26 A;  1NJI C;  2HD0 A;  5GAN e;  5KE3 A;  3DB4 A;  2P4T A;  4BY6 C;  1MHN A;  3M9Q A;  1WNL A;  2KSS A;  2DK3 A;  3HFO A;  5LJ3 j;  4JLI A;  5HY6 A;  2RJD A;  5LJ5 h;  4BAC A;  1BIA A;  1VQP A;  1VQ9 T;  1VQ4 A;  1YJ9 A;  4PJO C;  3LWI A;  4C8Q A;  3OY9 A;  2I2L A;  4ME7 A;  3S6W A;  2ZPG B;  3P8D A;  2O4X A;  4DA4 A;  2LVM A;  2VGN A;  4R56 A;  1JRI A;  2BUD A;  4M77 E;  4A4K A;  3NTI A;  2RI2 A;  4J6W A;  1BI1 A;  1B34 B;  2A3L A;  1WPY A;  2XIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...