5GAMe

Foot region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
83
structure length
75
Chain Sequence
MVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSKGTPLGKILLKGDNITLITS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 Angstrom resolution
pubmed doi rcsb
molecule tags Transcription
total genus 8
structure length 75
sequence length 83
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
e PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5game00
4JUVA 3JCMX 1U1SA 1I8FA 4M7DD 3V7SA 1Y96B 4F7UF 4M78G 5GAMg 4HT9A 1U1TA 2E64A 2ZGWA 3BDUA 1LJOA 4OP0A 5GAN8 3JB9G 3RERA 1N9SA 3FIFA 1X01A 4M7AG 2VXFA 5GAN5 2DKGA 2E10A 3VU3C 5GAOp 4M7AA 4EMKA 4PJOB 4EMKC 3RKXA 4M77F 4M77E 4C8QB 4Y91A 4EMGA 4C92E 3QO3A 4M75A 1WQWA 4M75C 4EMHA 4WF2A 3EFRA 4XU1A 3SWNA 3SWNC 3RIRA 4M75D 4PJOF 4M7DE 4XQ3A 4C8QF 2EJGA 2DXTA 2VXEA 2YHTA 5DY9A 4F7UG 3AHUA 3FJPA 5GMKm 2DVEA 3JB9H 1B34A 4PNOA 4JLIA 3QSUA 2E41A 2I2LA 5GAN2 4XU2A 4X9CA 2EAYA 4M78A 4M78C 3BW1A 2K57A 4XU0A 4DQ2A 1Y96A 4X9DA 1TH7A 1H641 1HK9A 2FYKA 5GAOn 4M78D 3L1AA 3EFSA 5GMKl 3RKYA 1WQ7A 4A53A 5GAN7 4M77B 5GAN3 5GANf 4C92B 1HXDA 5GANj 4M77G 4V2SA 4JRIA 4M7AC 3JCMQ 4M7DB 4M75E 2RA2A 3V8JA 1LOJA 5GMKj 4XTUA 4M7AD 4PJOG 4C92F 4NL3A 1YCYA 3JCMV 4C8QG 2Y90A 2DXUA 1M8VA 3V8KA 5LJ3f 5LJ5f 4M7DF 2E1HA 2RM4A 1WPYA 5LJ3j 1N9RA 2YLCA 1D3BA 3RUXA 1KQ1A 4MMLA 1KQ2A 5GAMf 3JB9I 3HFOA 3JCMf 4F7UA 4MMKA 3V7CA 3FB9A 4QVDA 2DZ9A 4M78E 5GAN4 3JCMJ 4J5YA 2JN0A 2EJ9A 5GANe 3JCMW 3M4GA 3BY7A 5GMKh 4RCCA 2RB6A 4XTYA 1M5Q1 2EJFA 3RESA 4EMKB 4NOYA 4XTZA 3JCMP 5GMKe 2DEQA 4M75B 5GANg 2EWNA 1WNLA 3PGGA 5GANd 4HT8A 3QUIA 4M7AE 3SWNB 3RKWA 4A54A 4QVCA 3JB9D 3HSBA 4C92G 2CGHA 4M77A 2DJZA 4HA8A 4C92A 4M75F 4N0AA 4N0AC 3SB2A 3V8LA 3JCMb 5GAOq 5GAOr 1B34B 5CAIA 4M7DG 4PJOC 3BFMA 4PJOA 1I81A 2VC8A 5LJ3g 5GAOm 4RCBA 5LJ3d 4C8QA 4C8QC 2DTHA 5LJ5d 3INZA 4M78B 4XTXA 4J6YA 5LJ5j 4PJOD 4C8QD 3V7RA 3HFNA 4F7UE 5GMKi 3JCMg 5GAMd 3JCMd 3QHSA 2DTOA 2HNIA 5GAMj 3JB9J 2DTIA 4M78F 5GANh 5I21A 1BIBA 2DZCA 3L2ZA 5GAOl 4M7AB 1BIAA 4NL2A 3JB9F 2E65A 5GAN6 4XTWA 4J6WA 1JBMA 4JRKA 5LJ3h 4M75G 5LJ5h 4M7AF 1MGQA 4XU3A 3GIBA 1JRIA 1D3BB 5LJ3e 5LJ5e 4M77C 5GAMh 1I5LA 2FB7A 4XTVA 3JCMh 4C92C 1I4K1 2QTXA 3JCMc 4PJOE 4F7UB 2RD1A 4M77D 1LNXA 4J6XA 2YLBA 4C92D 4C8QE 5GAMe 3JCMe 4M7DA 4M7DC 5LJ5g
chains in the Genus database with same CATH superfamily
1W2BA 2DBMA 5KH6A 5M9OA 1I8FA 4AFQC 1XQHA 1TTHB 3CC4Q 3A1PA 4OGCA 5FU6B 1VQ7Q 1TUDA 4LN2A 1YI2T 1WI7A 3GPLA 4E6RA 3M53A 1B34A 1RADB 2RN8A 1PSEA 5AYFA 2E70A 3G71Q 3QKJA 1Y71A 3GNFB 4LXCA 3CCQT 3MP6A 4OMPA 3RBBB 4CI0C 1I07A 2XDBA 1JXMA 1WJQA 3M0TA 3S6WA 4ELZC 1UG1A 3EG0A 5I11A 1QVGP 3GBQA 3V8KA 4M7DF 4ZGEB 5KYXA 4JRQA 3OW2P 4A4GA 4XAXB 3RNJA 3M0UA 3LWHA 4E7JA 3OYDA 1NEGA 2QQBA 3VRYA 2VASA 5GMKh 4RKUE 2ROTA 2JNGA 3PGGA 3VUZA 1AVZC 2NUTA 2J6KA 1QCOA 3E1SA 4QVZA 2EGAA 3BFMA 3A8HB 3M0QA 3TSZA 1ZSZA 5FW9A 1X43A 4RTVA 4JPBW 4M4ZA 3QPHA 2QG9B 1XNIA 3EAEA 1BIBA 3X28B 5GAOl 2YSQA 3OYAA 1AWOA 4BDZA 3MEWA 1NBEB 2E5QA 1QVGA 1BCMA 2PVDB 2RJDA 3H0FA 3ME9A 2LJ1A 4M7DD 4HT9A 3QZ5B 5D6YA 3OYHA 3RERA 4E2FB 2E10A 4L5GA 1SHGA 3FC3A 4B9WA 5IN1A 3QZ9B 3A8MB 4EMGA 1VQKT 4B6MA 1WQWA 1TUGB 4M75C 2LQKA 3EFRA 3CC7Q 2RQVA 4JJDA 1Q7YR 2CZ0B 1NJIU 2KR3A 2CP5A 4XU0A 4DQ2A 1QCFA 2HSEB 2DK3A 1K9AA 1BI3A 3PNWC 1SF9A 3UWNA 3DLLA 5GANf 3R6NA 4V2SA 3D7SB 4F14A 4MZPA 1I1JA 2KQWA 3X25B 2A7YA 2DNUA 4GBQA 2AKKA 2PZ1A 2PTKA 3LGFA 1KQ2A 2K4YA 1SKUB 2FRWA 1VYUA 3BY7A 3SFMA 3QWYA 2IG0A 3CBPA 1E7OA 2YWWA 1ZBXA 3EGXB 2YDLA 1XOVA 3QUIA 3AT1B 2DJZA 4C92A 5CAIA 1SSFA 1V1CA 3FLGA 5KE2A 3MP8A 3CC4A 4ZTJA 5CQYA 2EQJA 3CCSQ 2WSEE 3ZL7C 1VQ7A 4JZ3A 1KQSP 2YRVA 1WHLA 2KRNA 3A98A 3WXMB 2CS7A 2EYXA 1NZ9A 1U3OA 1VQ8Q 1AEYA 1M90C 4EPCA 4Q5WA 1YHQQ 2OAWA 1VQMQ 1M1KC 2QI2A 1ZUUA 1QWFA 2DM1A 2VKNA 3G71A 1KHIA 4JUVA 1WX6A 1YJ9T 1KHCA 3EGUA 1ABQA 3CMET 1YCSB 5FU7B 2X4WA 4J9HA 2B8AA 2QDYB 3VS6A 5KYNA 3CBOA 1OZ2A 4JS5A 4M7AA 3CXCS 3VJPA 1H3ZA 1Y07A 4EMKA 1WHMA 1K0XA 2JMCA 4M77E 4XU1A 3SWNA 5J39A 1AOJA 2EKOA 2GBQA 2CREA 2O2OA 3G6ET 1JEGA 1YWOA 2K5IA 2DL7A 1PNJA 5D6WA 4XU2A 2COWA 1KIKA 4D6WA 1YITA 1YWPA 3WVEB 2DD4A 5GANj 4M77G 2DYBA 2GF7A 4JRIA 2CSQA 2RA2A 4GLKA 2QA4Q 4J7IA 1TOVA 5LJ5f 3NTKA 3RUXA 2QQRA 4RTWA 1Y0MA 3EHQA 2DL3A 4OMNA 5GANe 2R58A 2RJFA 4RCCA 1M5Q1 1JJ2P 2M0OA 5DM7R 1TG0A 1K73U 2LQ8A 2VC8A 4PJOC 4C8QC 5IHKA 2DTHA 2FVUA 4BUGA 4J6YA 4F7UE 1K0SA 3LYIA 3T9NA 5A2QE 3JCMd 1QWEA 4E7KA 5C0MA 1AZEA 2YUPA 4YTLA 2KXDA 5I2MA 4RTYA 4FCYA 3NTIA 1UB4A 5FROA 4J9EA 3CC7A 3GNGA 3QDRB 1OYXA 1SPKA 2R5AA 2RD1A 5FWCA 2H3JA 4IIOA 4F17A 1OV3A 2HKNA 2KY9A 4Z88A 2GNCA 3M9QA 3BDUA 1LJOA 2FPEA 3CCJQ 3M0RA 3X26B 1X01A 3PVLA 4LDVA 4E7ZA 2ZAEA 4DA4A 1Q82R 3ER0A 1RAIB 1K8AU 4N4IA 4Y92A 5FWBA 2FPDA 2LQNA 4PNOA 2VB6A 1TSFA 2D8HA 2XKOC 4TVRA 4M78C 2RI2A 1H641 2FYKA 5GJVB 1SRMA 2HMAA 2K3XA 5A0LA 1E6HA 3CMAQ 2LCCA 4M75E 1OX8A 5HY6A 1UJYA 2DVJA 5L23A 3CCSA 2GFAA 5LJ3f 4ZN1A 4O6JA 2PNIA 4F7UA 4AG2C 5GAN4 1UHFA 1QCNA 2HD0A 1K9MR 1D09B 1YHQA 2DLPA 3M56A 1VQMA 1WHJA 1YIJQ 2MWOA 4DBQA 2BZYA 4CRIA 1U8RA 4HVVA 4HA8A 2V8JA 1IREB 2KYBA 2F5KA 2JTMA 5GAOm 2XDPA 1U5SA 2M02A 3CC2T 3KBGA 2E12A 2OTJT 2RQWA 2CUBA 4QQ6A 4WCIA 5I21A 2XIDA 1BIAA 4NL2A 4C0DC 3O8VA 1VQ5Q 1G2BA 8AT1B 1P92A 2LX9A 3HHTB 2ROLA 3SD4A 3CQTA 1VQOQ 5CKEA 1IO6A 3OQ5A 4XTVA 3JCMh 4BY6C 4C92C 5CVIA 1NYFA 4OF1A 1IXDA 1IGQA 2X3WD 1YJNT 3EG9A 3HRTA 4A4FA 5KCHA 1WJRA 2DKGA 3VU3C 1FMVA 1ZLMA 2QA4A 1YI2Q 2QQ9A 3HKSA 4OMMA 3O5ZA 2KGTA 2O9VA 4AT1B 4RG2A 4M75A 4OMOA 3KFVA 2V1RA 4LDXA 3GOXA 3PIPA 2DIQA 4JLIA 3IQLA 3I5RA 4QQGA 1J3TA 1N6AA 2CYZB 4FM4B 1SHFA 1HK9A 3OYKA 3L1AA 3EFOA 3CCQQ 1D1BA 4RG8A 2YXYA 2K2VA 1BCOA 1HXDA 1OX9A 1OOTA 3FRNA 4R56A 4M7AC 2M51A 3E9GA 4KGXB 5CR2A 3VS5A 3J81E 5HK0A 1WIEA 5ECAA 3OYIA 3G4ST 5LJ3j 4KUDK 2CDTA 2EQUA 1TS9A 5GAMf 1VQ9T 2DZ9A 1Q81U 3PFSA 1PD0A 2VWFA 3CPWS 1KD1R 3KUFA 5J3BA 2RMOA 3L2UA 3PMIA 3JB9D 3NFCA 3EG1A 2L8DA 3HSBA 5I2SA 2W0ZA 1B34B 1KD1U 4LUEA 2XICA 2AZSA 5A0DA 1NJIC 1Q86U 3E9FA 1W70A 3CCJA 4AG1C 2LQWA 3JB9J 3CCET 1QVFS 5IXFA 3QBYA 1ZX6A 2NUPA 2K6DA 2DZCA 2O4XB 3I55T 2E65A 1YFNA 2J7IA 3A5ZB 4OMLA 5KYXB 2JM8A 2M0YA 1C6VX 1RI0A 2QTXA 3OMGA 2PUOB 4C8QE 4PJOE 4KGVB 1S72T 2D0QB 4E47A 3QG1A 2NUTB 5CKHA 3A8LB 4D8DA 3S3OA 4PFZA 3ASKA 2L3RA 1UE9A 1OEBA 2JW4A 4M77F 2VYTA 1VQKQ 1AHJB 1ZSZB 5DLOA 1VQNA 4DBRA 1WGSA 2JMAA 1BBZA 4DEXA 2M9UA 1K1ZA 2KI7A 3SEMA 1VQ6A 2E41A 3H6ZA 1R0CB 4ANJA 2OTLT 3RKYA 2QEXT 4MDXA 4EDUA 2QTVA 2VUBA 2DIGA 1V76A 1X6BA 1D0ZA 3RDVA 4ELYC 3ULRB 3P8HA 3OYEA 2FG0A 1D3BA 2HDAA 1KQ1A 4MMLA 3MHXA 1W2BS 3OS0A 4M78E 2MK5A 3GP8A 1Z9ZA 3P8DA 1VQ5A 3JCMW 2EPDA 1MV3A 2HCKA 2G6FX 4XTZA 4QQDA 1QLYA 4OVAA 2RK2A 1H8KA 1VQ4T 2X4YA 4EIKA 1WXBA 1G5VA 2KSSA 5GAOq 1YN8A 3CPFA 1RLQC 5CQXA 4KRTA 4OB0B 3HPWA 3OYJA 1HJDA 4PJOA 4C8QA 2ESWA 2M1HA 3INZA 1FMKA 1RAHB 3VYGA 3JV3A 1UGRB 2ZPGB 3DKMA 2KMTA 2LP5A 2Z0WA 1YI2A 1D0XA 1ZA1B 1N8RR 2OJ2A 2KEAA 1AWJA 4J6WA 1FWZA 3CCLT 3GF5A 1O75A 1YJWT 2CSIA 2AT1B 3TEEA 4M7DC 1SEMA 3PT9A 4E7HA 3UATA 1YJ9Q 3CCQA 2A08A 2JVVA 2E64A 2MOXA 3CMEQ 5CO7A 2SEMA 1HSQA 3OSSC 1B07A 4BY6B 1K73C 2AIRB 4FW2A 1M1GA 3ZBDA 3S3NA 1M2OA 4C92E 5DLQE 2P4TA 1UHCA 2GQVA 3G6EQ 1PHTA 3OW2A 4X9CA 4FIBA 1BKBA 1OQKA 4M78A 2D1XA 1PKTA 3LLRA 2A36A 5GAOn 1F1BB 2ENMA 3EH1A 5GAN3 2EYYA 5D7UA 3OS2A 1H92A 4OGEA 3I56A 3V8JA 2V26A 4N4GA 1PM3A 3RR6A 5KYUA 2DMOA 3JB9I 3MEAA 2W10A 2O31A 2JN0A 2CP7A 2RJEA 4EMKB 1UDLA 4HKEA 5GANg 2EWNA 3NMZC 5KYWB 4M7AE 3SWNB 3CCRT 1Q7YU 2RQUA 1K8AC 4ZGDB 3V8LA 4N0AC 2E6NA 2EVRA 2KBTA 1B3QA 2QGFB 1VYTA 2F2VA 2XU8A 4BE2A 2YUQA 3M59A 2BZXA 4LD6A 2KYMA 3L2WA 3CXCP 1G3YA 5GAN6 1VQKA 2HBWA 2C06A 1JBMA 3G7ZA 3GIBA 1C0MA 3M57A 2XK0A 2BKDN 2DL5A 2L89A 4AMCA 5HK3A 1UTIA 2DX1A 3I9QA 3UPUA 2GTOA 1GXIE 1U1SA 3C4SA 2EIFA 2RQRA 1Y57A 1N5ZA 1NLPC 2VXFA 2EFIA 5GAN5 2LZ6B 1MNDA 2ZPFB 2KT8A 3QO3A 2O88A 2BTTA 4EMHA 1X75C 4WF2A 2J06A 4ORZA 3A8GB 2K3YA 5I22A 3VKIA 5IH2A 2EAYA 4RTXA 4C0GA 4N4HA 1W1FA 2FZKB 3SHWA 3OYBA 4LE9A 3CXCA 3EFSA 2LC4A 1S1NA 4M77B 4DBFA 1M2VA 1YITT 2MI6A 1ZBJA 2IVWA 2LX7A 2HSPA 1U06A 1QQJA 3MJXA 2RF0A 4J9GA 3VS4A 2RHXA 1GFCA 3V7CA 2D8JA 2ZPBB 2LCSA 2EJ9A 2RHIA 1KQSA 1D1AA 2HEQA 4X1VA 2EJFA 2A37A 3QIIA 4NOYA 3PMTA 2LJ3A 1WNLA 3KXTA 3NTHA 3RKWA 2X35A 3EGDA 3SB2A 2LT4A 3VRZA 4J9IA 1YJ9A 1I81A 2P0QA 2DPPB 4MZMA 4XTXA 3CC2Q 1Y7XA 8ATCB 5KE3A 2OTJQ 2KK4A 1LPLA 5GJWB 2KXCA 1I5OB 3OBYA 3FDRA 3BE3A 4HCKA 2LMJA 4P5NA 4Z02A 5L8RE 5KYYA 3G6EA 3EGXA 1MUZA 2QAZA 2FB7A 2HKQB 1I4K1 2ZCFB 4F7UB 1LNXA 3JCMX 1Q81C 3CD6T 3V7SA 1QMCA 3REAB 5CKDA 3URGA 1YJNQ 3M4YA 2DO3A 2QYZA 1AT1B 1NEBA 1DJ7B 4AFUC 5GAN8 3R6OA 4R0KA 2FZCB 4ATOA 4GY5A 1GCQC 3QWXX 4JJBA 2RJCA 1KC8C 2E6ZA 3MO8A 1ZSGA 4OMQA 1Q86C 4M7DE 2LNHB 3NPFA 4FW1A 2EJGA 4F7UG 3AHUA 2KNBB 1TXQA 1ZHIA 5FRNA 4OB3B 1ABOA 1JJ2A 2C0OA 2F69A 1RLPC 2L3PA 3REBB 2QGGA 2EGCA 1YCYA 3JCMV 2E3IA 1WHKA 3G4SQ 4HVWA 3NHNA 2JTEA 2VGMA 2DBKA 2CZ6B 1ZUYA 1VQPT 2JT4A 3JCMf 1RUWA 1VQ9Q 4NS5A 1SG5A 4J5YA 4F04B 1Q82U 3M4GA 1JB0E 4K11A 4M75B 2COYA 1TU0B 2BIVA 1MMAA 4RTZA 5FU6C 2L5QA 1PKSA 3N5BB 1VQLT 3VS2A 5LJ3g 3H0HA 5LJ5j 2M16A 1UFFA 1VA7A 3EFOB 2HL5C 3CCEQ 5CKFA 1K4US 3VYHB 1VQ8A 3I55Q 2MF2A 5C6SA 2BUDA 2V1QA 4CC3A 2XG8D 2YRCA 1WHGA 2X4XA 1FMWA 4M75G 3OYYA 4ZGJB 1CSKA 3QXEB 5LJ5e 1M8MA 2FO0A 1K9MU 1G3SA 2CZ1B 1GFDA 4M7DA 1UGQB 2XI9A 1EZZB 3DB3A 5IT9E 1S72Q 1Y96B 1FXXA 3C95A 1WXUA 2NYSA 3M0SA 3GLXA 4HXJA 1M90R 3QYHB 2GTJA 3UF4A 2X9HA 1M1KR 1BI1A 4L59A 1ACMB 1TUCA 2H8HA 2L2PA 2OAUA 1PWTA 4FYVB 2DXTA 1GRIA 4O5VA 2DVEA 2KROA 2WSFE 1BYMA 2I2LA 3CPWP 2EQMA 4ESRA 1X69A 2F2WA 1IRXA 4QKUA 2OTLQ 2EYZA 3L2VA 4A53A 2QEXQ 3CCMT 3CCVT 2E4HA 3HTRA 1HYOA 4PKCC 3CC2A 3OYMA 3M55A 2C0IA 3THKA 2JS0A 4PJJA 5KCOA 2P84A 5J26A 1QVFP 1WA7A 2DFUA 1RABB 2RI3A 4BB7A 2PU9B 1UGPB 1OZ3A 2G3RA 5IAYA 4IUQA 1VQ4Q 4N0AA 2DEUA 4PLLA 3CCUT 1RAGB 1RAEB 2QXFA 2MAMA 3CPWA 2E3HA 2ED0A 1MV0B 4C0FA 1MMGA 1NPPA 1UUEA 2CH4A 1WFWA 1KSWA 2LRQA 2F1LA 2X51A 1PC0A 3CCLQ 1JRIA 1D3BB 5LJ3e 1JU5C 4BE1A 1G3TA 4GLMA 1YJWQ 2EGEA 2FEIA 4B9XA 3M0PA 4VUBA 1U1TA 2KAFA 3OYNA 1EX4A 2EYQA 2ZPEB 1M27C 2MWPA 3FIFA 1Q7YC 1Z9QA 1UJ0A 3VS3A 4PJOB 3G4SA 4C8QB 5LL6S 3HRSA 3H0IA 1D0YA 2HBPA 1VQ9A 2JS2A 2BE7D 1UGVA 3VV0A 1W2BP 5DY9A 4A63B 3JB9H 2B86A 2RNAA 1VQNT 4DEYA 4OB1B 3Q1JA 3OMCA 4IIMA 1VQ6T 1IHWA 2WSCE 3CMAA 2HL3A 5IHNA 4FT4A 3OYLA 1N27A 2BZ8A 2KT1A 2YRDA 4PJMA 1A0NB 1FX7A 4PJNA 1RAAB 4KH0B 4PJOG 4NL3A 4C8QG 2Y90A 2DXUA 1M8VA 1EIFA 2NWMA 2RQTA 1M9SA 3CCEA 3QDFA 4BD3A 3I35A 3HFOA 2PUKB 4II1A 3I55A 2QASA 3FB9A 2O9SA 4FSXA 1YIJA 2CP3A 1OULA 1AD5A 2D9TA 5FU7C 2QK0A 4KULA 1X2KA 3CCRQ 2FL7A 4QVCA 1H3HA 3OYCA 5GAOr 2DAQA 1S72A 2MPXC 4IUUA 4PFPA 4KGZB 4J9BA 3QJ6A 4M78B 4DBHA 5CKBA 2NLUA 3V7RA 3E19A 3HFNA 2DTOA 2HNIA 5GAMj 2DTIA 2VVKA 2RO0A 4JS4A 3VUBA 1WJSA 4JDSA 2DXBA 4OB2B 1VQOA 1BU1A 2XMFA 4KT0E 1RI9A 1MGQA 4CC4B 1GBQA 2HAXA 5KYUB 1O9SA 5CIUA 3LW5E 4M77D 5GAMe 3FJ5A 4ZNXA 3UDCA 4LUDA 2RK1A 4M78G 4MZTA 4IUTA 3U23A 4F7UF 4J9FA 2OTLA 2QEXA 3E2UA 3UA7A 4RTUA 5HKCA 4KBMB 1N9SA 3OBWA 1ZA2B 2BE9B 2O4XA 3X20B 4ME7A 1VIEA 1GCQA 4XK8E 4LDUA 1EFNA 3J7AF 2E5KA 1R77A 2PVOB 2FRYA 4JJNK 2QDLA 1AZGB 1M1FA 1N8RU 2HQHA 1UGSB 2F2XA 2K5LA 4WTOB 5GAN2 4C0DB 1WLPB 1MMDA 1TH7A 2HQXA 1C1AA 2JTFA 4BI3A 2CT4A 4C5HA 2ATCB 5GMKl 1VQ4A 5GAN7 5FRMA 4C92B 1ZQ1A 1YITQ 1W6XA 4PFOA 1G8XA 2J6FA 1LOJA 4BACA 5GMKj 1KFZA 3I56T 2CUDA 4C5EA 2P0PA 4X34A 4AFZC 2FPFA 1G3WA 1UECA 4RTTA 2DL8A 3JCMJ 4Z89A 4HCCA 2ZPIB 3DB4A 3MEVA 2RB6A 4XTYA 3CCLA 3OS5A 5GMKe 4RUGA 5GANd 4JRPA 4PLIA 2I0NA 1YJWA 4C92G 3VS0A 3MCAB 4M75F 5HCKA 3NGPA 2NUZA 3EH2A 3QJYA 3M5AA 2A0FB 2Y4XA 3LGLA 2HZYA 1KJWA 1QVGS 3I5SA 3CEYA 3OW2S 2OX7A 2D6FA 1M2VB 4M7AB 4PL6A 3BDLA 3MEUA 3TU4K 2K3BA 2QQSA 1NJIR 2DF6A 4D8KA 1MHNA 2EBPA 4J6XA 3PVQA 2CKKA 3OYFA 2O01E 2J05A 4J83A 3CD6Q 5IHIA 3JSCA 2PVGB 3C12A 1Q82C 4J9CA 2CP6A 2IIMA 1MNEA 2CH4W 3JB9G 3CC4T 4BI8B 1OU8A 2RHYA 1VQ7T 3EGDB 2EW3A 4M7AG 2KVQG 1IHVA 5GAOp 2L3QA 4LDYA 4QW2A 4Y91A 1NG2A 3RIRA 4M75D 4F16A 1AWWA 1PCXA 2VXEA 2ED1A 3G71T 2IPOB 1NE8A 1M30A 2CZ7B 2HQEA 3CCRA 2H3EB 3G1JA 5KYYB 2EQIA 4OMFB 2L3SA 9ATCB 3X24B 1K9MC 3JCMQ 4XTUA 2DE0X 1B7TA 2A28A 2A3LA 1N9RA 1OPLA 2YLCA 2KDSA 1SRLA 2Y4YA 1VQPQ 4C5GA 2DILA 1BK2A 3TQ7P 4A4EA 1RL2A 4FL6A 2LNVA 1JO8A 1NM7A 1VYVA 2F5TX 1AWXA 3L42A 1VQLQ 1IGUA 2C0TA 5LJ5d 1LVKA 2X3XD 1K76A 2DYIA 2LDMA 5GMKi 1W4SA 2MIOA 2MCNA 2AHJB 2ZPHB 5GANh 1KK7A 3ZEHA 4CC2A 3L2ZA 3RMQA 4PK4A 3J80E 3JRZA 3TSWA 1QW1A 4JRKA 2VGNA 2DRMA 1PRMC 5KYWA 4HVUA 1CKBA 3P8BB 2EQKA 3CMEA 5LJ5g 3OYGA 3H9NA 4L6V5 2DRKA 3C0CA 2ZGWA 4HCZA 2DD5A 4OP0A 2JM9A 4FSSA 3EG3A 1KQSS 4FT2A 2CT3A 4Z8AA 3RKXA 3RMSA 1QVPA 3MP1A 1X2QA 3OSVA 4LNPA 2X4JA 4PJOF 3HL8A 4XQ3A 4C8QF 3CC7T 2YUNA 5A0GA 3FJPA 3JAME 1K73R 1T3LA 2K57A 3HP9A 1T0JA 2GQIA 3LH5A 3OA6A 3CCMQ 1QKWA 2COZA 4RMOA 3CCVQ 1PSFA 2JOYA 1GBRA 4CC7A 4M7DB 2PQWA 1KD1C 3SDZA 2K5FA 1Q95G 2MYSA 1QKXA 3C94A 4FYYB 1ZUKA 1WPYA 4KUIA 1NYGA 4MMKA 4QVDA 2OI3A 2FZGB 3OS1A 1M3AA 4E7IA 3JCMP 5FLXE 4M77A 1BB9A 2EYWA 1YBYA 3CD6A 3JCMb 3FEOA 1IZ6A 3LWIA 3EHRA 4M7DG 1NLOC 4E7SA 4A4KA 3CCUQ 1FYNA 5LJ3d 3LX7A 4PJOD 2RH2A 1ZSZC 4C8QD 3EG9B 3JCMg 3CCST 1X6GA 4M78F 2K9GA 1I0CA 2LCLA 1K8AR 2DETA 2XDDA 1WHHA 3OB9A 2DJQA 3EG2A 4J8OA 4DOVA 4XTWA 1VQ8T 2JJ9A 1JJ2S 5LJ5h 1R0BG 1YHQT 1VQMT 4E7LA 3HRUA 1I5LA 2ABLA 4IUVA 2YLBA 2J6OA 1VIFA 2LT1A 1JXOA 4C5IA 5AT1B 2DERA 2AK5A 4BI4A 3ZFJA 2KRMA 1T0HA 2RI5A 3UA6A 2GGRA 1VQPA 2YHTA 4QT7A 5GMKm 2R5MA 1VQNQ 3QSUA 2LVMA 2EKHA 3H8ZA 2KRSA 1VQ6Q 4M78D 1M4ZA 3TCJA 1OI1A 1WQ7A 1XJWB 1PD1A 3L2QA 1UEBA 2V8KA 1VQLA 3PIOA 2QQAA 1M90U 4C92F 1OPKA 2VV5A 2QA4T 3DLMA 1M1KU 2E1HA 4JZ4A 3CBMA 1NPRA 3VS1A 2L0AA 2NUPB 1G83A 1QP3A 2DA9A 1D1CA 4LDWA 1JQQA 4R55A 1QP2A 2K2MA 4J9DA 5CK9A 2CP2A 1T3SA 2K79A 1X6OA 4HT8A 4A54A 4UC4A 4FU6A 4ZTFA 1V29B 4J7FA 1N8RC 3UT1A 4KH1B 2OTJA 3H41A 1PRLC 1WDXA 1CKAA 3LH0A 5IXBA 5GAMd 4DOWA 3QHSA 1RAFB 2MMPA 1RACB 5EG2A 4FYXB 1R8OB 2LTOA 2K7AA 3TREA 3MPUB 4JJCA 3JB9F 1VUBA 1X27A 5EC7A 3PE0A 4AFSC 1HD3A 2CP0A 5LJ3h 4M7AF 1BI0A 2KE9A 1M3CA 2JZ2A 2XD0A 2RHUA 2ZZDA 3JCMc 2ECZA 4C92D 2FHDA 3JCMe 1M3BA 1YJNA 2DL4A 5GAMg 4ZN3A 3CCMA 1SSHA 3CCVA 3CCJT 3QYGB 4BDYA 2AKLA 2AZVA 3WVDB 2WACA 4PJLA 1Q81R 4EMKC 1YP5A 4FYWB 2YT6A 4MDWA 3SWNC 4IKFA 2R57A 3M58A 1GCPA 1QVFA 2RHZA 2V8IA 3L2RA 4HCBA 4C0ZA 4Y28E 5CCAA 3BW1A 3PTAA 1Y96A 4X9DA 1KC8R 4IURA 1Q86R 3CMAT 3CCUA 4A4HA 4M7AD 7AT1B 3I56Q 1KG1A 1KC8U 3M54A 1WYXA 2RM4A 3TVTA 1MMNA 1VOMA 2GFUA 4IUPA 3VS7A 3RESA 1YIJT 2DEQA 1PG5B 5D6XA 1WZOA 2CGHA 2YUOA 3MKDA 1LCKA 1OU9A 2RPNA 1TWBA 6AT1B 2GCXA 1YNZA 4RCBA 2SRCA 4LD9K 3S3MA 2JXBA 1BI2A 2JUFA 2D0NA 2DXCA 1E6GA 3F70A 3META 1IB8A 4JLGA 1WXTA 1VQ5T 3OY9A 1GL5A 2P4RA 4XU3A 1VQOT 1ARKA 2LJ0A 4BE0A 2P0KA 4M77C 5GAMh 2XHCA 1XTDA 3A8OB
chains in the Genus database with same CATH topology
3JCMX 5KH6A 5M9OA 4J83A 1W2BA 1Q81C 3CD6T 4MDXA 1I8FA 3JSCA 3V7SA 2PVGB 3C12A 4OF1A 1Q82C 1YJNT 5CKDA 3URGA 3M4YA 2DO3A 1XQHA 3HRTA 1DJ7B 5GAN8 3JB9G 3CC4T 4BI8B 4A4FA 3R6OA 4OGCA 2RHYA 5FU6B 5KCHA 1VQ7T 1WJRA 4M7AG 2KVQG 2DKGA 3VU3C 2QA4A 5GAOp 1YI2T 2QQ9A 3HKSA 4LDYA 4ATOA 4GY5A 4QW2A 4RG2A 4Y91A 2RJCA 4M75A 1KC8C 2E6ZA 3MO8A 3GPLA 1Q86C 3RIRA 4M75D 4M7DE 4LDXA 2EJGA 2VXEA 3PIPA 3GOXA 4F7UG 2DIQA 3AHUA 3M53A 1B34A 4JLIA 1PSEA 4QQGA 5AYFA 2E70A 1N6AA 3G71T 1ZHIA 3QKJA 1NE8A 2CYZB 1Y71A 4FM4B 3GNFB 2CZ7B 1HK9A 2HQEA 3CCRA 3OYKA 3L1AA 5FRNA 3CCQT 4RG8A 3MP6A 4OB3B 4OMFB 1JJ2A 2F69A 2K2VA 4CI0C 1HXDA 3X24B 3FRNA 4R56A 2XDBA 1K9MC 3E9GA 4M7AC 1WJQA 3JCMQ 3S6WA 4XTUA 4ELZC 5CR2A 1YCYA 3JCMV 3J81E 2A3LA 3V8KA 5HK0A 3G4ST 3OYIA 4M7DF 4ZGEB 5LJ3j 1N9RA 2YLCA 4KUDK 2EQUA 2KDSA 2VGMA 2CZ6B 2Y4YA 5GAMf 4A4GA 4JRQA 4XAXB 3JCMf 4C5GA 1VQ9T 3LWHA 4NS5A 4E7JA 2DZ9A 1Q81U 3PFSA 4J5YA 3OYDA 1Q82U 3CPWS 2QQBA 3M4GA 1JB0E 3KUFA 5GMKh 4A4EA 5J3BA 4RKUE 1RL2A 4FL6A 4M75B 2JNGA 3PGGA 3L2UA 3VUZA 2LNVA 2BIVA 3PMIA 3JB9D 3NFCA 3HSBA 2L8DA 3E1SA 4QVZA 5FU6C 5I2SA 2L5QA 3N5BB 1B34B 1KD1U 2F5TX 3L42A 1VQLT 3BFMA 2XICA 5LJ3g 5A0DA 5LJ5d 3A8HB 1NJIC 1Q86U 3E9FA 5LJ5j 2LDMA 5GMKi 1W4SA 2M16A 3CCJA 2AHJB 2ZPHB 3QPHA 3JB9J 3CCET 1QVFS 5GANh 5CKFA 3QBYA 1XNIA 3ZEHA 3EAEA 1BIBA 2DZCA 2O4XB 3L2ZA 3VYHB 3X28B 5GAOl 2MF2A 5C6SA 2BUDA 3OYAA 3RMQA 3I55T 1VQPT 2E65A 3J80E 2XG8D 3A5ZB 3JRZA 4BDZA 1QW1A 2X4XA 4JRKA 4M75G 2VGNA 3OYYA 3MEWA 4ZGJB 5A2QE 3QXEB 5LJ5e 1K9MU 2QTXA 1RI0A 2E5QA 3OMGA 2PUOB 1G3SA 4C8QE 1QVGA 4PJOE 2CZ1B 3P8BB 4M7DA 2PVDB 2EQKA 1UGQB 2RJDA 5LJ5g 2XI9A 3OYGA 3CMEA 3ME9A 3DB3A 5IT9E 1S72T 4L6V5 4M7DD 1Y96B 1FXXA 4HT9A 3QZ5B 3C95A 3GLXA 3QYHB 2ZGWA 5D6YA 2D0QB 4HCZA 2DD5A 4E47A 3QG1A 5CKHA 3OYHA 4OP0A 3A8LB 3RERA 3S3OA 1KQSS 1BI1A 4L59A 3ASKA 2L3RA 4FT2A 2E10A 4L5GA 3FC3A 4B9WA 2OAUA 5IN1A 3QZ9B 1QVPA 3A8MB 3MP1A 2VYTA 4M77F 3RKXA 3RMSA 4EMGA 1AHJB 1WQWA 4M75C 3OSVA 5DLOA 2LQKA 1VQKT 3EFRA 2X4JA 1VQNA 4PJOF 3HL8A 4XQ3A 4C8QF 3CC7T 1WGSA 2DXTA 4O5VA 5A0GA 3FJPA 2DVEA 2M9UA 2WSFE 1BYMA 3JAME 2CZ0B 1VQ6A 2E41A 2I2LA 1NJIU 2EQMA 4XU0A 4DQ2A 2K57A 2DK3A 3HP9A 1BI3A 3PNWC 3H6ZA 2OTLT 3OA6A 3RKYA 3L2VA 3UWNA 4A53A 4EDUA 2QEXT 5GANf 3DLLA 4RMOA 3CCMT 3CCVT 1PSFA 4V2SA 2JOYA 2VUBA 4MZPA 2KQWA 2DIGA 3X25B 4M7DB 4PKCC 2PQWA 1KD1C 2A7YA 3SDZA 4ELYC 2K5FA 3OYMA 3CC2A 3M55A 1VQ8A 3C94A 3P8HA 3OYEA 1WPYA 5KCOA 1D3BA 3LGFA 1KQ1A 4KUIA 4MMLA 5J26A 2K4YA 3MHXA 1KQ2A 1W2BS 4MMKA 3OS0A 4QVDA 4M78E 2RI3A 3GP8A 3P8DA 4BB7A 1VQ5A 3OS1A 3JCMW 3BY7A 2PU9B 3SFMA 1UGPB 2IG0A 4E7IA 3JCMP 3CBPA 4XTZA 4QQDA 1ZBXA 4OVAA 1OZ3A 1XOVA 3QUIA 2RK2A 5FLXE 2G3RA 5IAYA 4IUQA 2DJZA 4M77A 1VQ4T 4C92A 2X4YA 1YBYA 4N0AA 1G5VA 2KSSA 3JCMb 5GAOq 3FEOA 5CAIA 3CPFA 1IZ6A 5CQXA 4PLLA 3LWIA 4M7DG 4OB0B 1SSFA 3HPWA 3OYJA 4PJOA 4A4KA 3CCUT 5LJ3d 4C8QA 2M1HA 3INZA 3LX7A 3FLGA 2RH2A 5KE2A 4PJOD 4C8QD 3MP8A 3JCMg 3CC4A 2QXFA 2MAMA 5CQYA 2EQJA 3VYGA 3CPWA 2WSEE 3CCST 4ZTJA 1VQ7A 4M78F 2LCLA 2YRVA 1UGRB 2ZPGB 3DKMA 2KMTA 4C0FA 2XDDA 1YI2A 1NPPA 3WXMB 2CS7A 1NZ9A 3OB9A 2LRQA 4J8OA 4DOVA 4XTWA 1VQ8T 4J6WA 1M90C 4EPCA 1FWZA 5LJ5h 1JJ2S 4Q5WA 1YHQT 1VQMT 3CCLT 1JRIA 1D3BB 5LJ3e 4E7LA 1M1KC 3GF5A 3HRUA 2QI2A 1I5LA 4BE1A 1O75A 1G3TA 1YJWT 4IUVA 2YLBA 3TEEA 3G71A 1KHIA 4M7DC 4JUVA 4B9XA 1VIFA 2LT1A 3PT9A 4E7HA 1YJ9T 1KHCA 4VUBA 3CCQA 1U1TA 2KAFA 4C5IA 3CMET 2JVVA 3OYNA 2E64A 2EYQA 5FU7B 2ZPEB 5CO7A 2X4WA 4BI4A 2B8AA 2QDYB 3ZFJA 3CBOA 2MWPA 3FIFA 1OZ2A 3OSSC 2RI5A 1Q7YC 4BY6B 4JS5A 1K73C 4M7AA 3CXCS 3VJPA 1H3ZA 1M1GA 1Y07A 3ZBDA 4EMKA 3G4SA 4C8QB 3S3NA 4M77E 5LL6S 4PJOB 4C92E 5DLQE 3HRSA 2P4TA 1VQPA 4XU1A 2HBPA 3SWNA 5J39A 1VQ9A 2EKOA 3VV0A 2YHTA 2GQVA 3G6ET 5DY9A 3JB9H 5GMKm 2R5MA 2K5IA 1VQNT 3OW2A 3QSUA 5D6WA 2LVMA 4XU2A 4OB1B 3Q1JA 4FIBA 1BKBA 4X9CA 3OMCA 4M78A 3H8ZA 3LLRA 1VQ6T 5GAOn 4M78D 4D6WA 2WSCE 1M4ZA 3CMAA 1YITA 3TCJA 5GAN3 1OI1A 1WQ7A 3WVEB 4FT4A 3OS2A 1UEBA 3OYLA 3L2QA 4OGEA 1N27A 2DD4A 2V8KA 4M77G 3I56A 5GANj 2GF7A 1VQLA 3CD6A 3PIOA 4JRIA 2QQAA 3V8JA 1FX7A 2RA2A 1M90U 4GLKA 4PJOG 4C92F 4NL3A 2VV5A 2Y90A 2DXUA 3DLMA 4J7IA 4C8QG 1EIFA 4N4GA 2QA4T 1M8VA 1M9SA 5LJ5f 1M1KU 2E1HA 3CCEA 3NTKA 3CBMA 3RUXA 2QQRA 4BD3A 1NPRA 3JB9I 3HFOA 2PUKB 4II1A 3I55A 3PTAA 3FB9A 3MEAA 4FSXA 1QP3A 2JN0A 4LDWA 1YIJA 4R55A 5GANe 1QP2A 2R58A 2RJEA 2RJFA 4RCCA 4EMKB 1M5Q1 2D9TA 2M0OA 5FU7C 5CK9A 4HKEA 5DM7R 4KULA 2EWNA 5GANg 1X6OA 4HT8A 4M7AE 3SWNB 3CCRT 1Q7YU 4A54A 2FL7A 4QVCA 4UC4A 1K8AC 4ZGDB 3OYCA 4FU6A 1K73U 3V8LA 2DAQA 4N0AC 1V29B 5GAOr 4ZTFA 1S72A 2E6NA 4IUUA 2LQ8A 4J7FA 1N8RC 2VC8A 4PJOC 3UT1A 4C8QC 2OTJA 2DTHA 2FVUA 3QJ6A 4M78B 5CKBA 4BUGA 2NLUA 4J6YA 2XU8A 4BE2A 3LH0A 3V7RA 3E19A 3HFNA 3LYIA 3T9NA 4DOWA 4F7UE 3QHSA 2DTOA 3JCMd 5GAMd 2HNIA 2MMPA 5C0MA 5GAMj 4E7KA 2DTIA 5EG2A 2RO0A 1R8OB 3M59A 4JS4A 3VUBA 4LD6A 2LTOA 4YTLA 3TREA 1WJSA 3L2WA 4JDSA 2DXBA 3JB9F 1G3YA 1VUBA 5GAN6 1VQKA 4OB2B 1VQOA 5I2MA 2C06A 1JBMA 1UB4A 3NTIA 4KT0E 5LJ3h 5FROA 4M7AF 1BI0A 1MGQA 3G7ZA 3CC7A 2HAXA 3GIBA 3GNGA 3QDRB 1OYXA 2JZ2A 3M57A 2XK0A 2XD0A 2RHUA 1O9SA 2BKDN 2L89A 2R5AA 2ZZDA 2RD1A 3LW5E 4M77D 5CIUA 3JCMc 4C92D 2FHDA 5GAMe 5HK3A 3JCMe 3UPUA 1YJNA 2H3JA 1GXIE 3UDCA 1U1SA 3C4SA 2RK1A 4M78G 2KY9A 4IUTA 4MZTA 4F7UF 5GAMg 2OTLA 2EIFA 4ZN3A 2QEXA 3CCMA 3M9QA 3BDUA 5HKCA 3CCVA 1LJOA 3CCJT 3QYGB 4KBMB 1N9SA 3OBWA 4BDYA 3X26B 1X01A 2VXFA 2EFIA 5GAN5 2O4XA 3WVDB 4LDVA 3X20B 4ME7A 2WACA 2ZPFB 1VIEA 4EMKC 4XK8E 4DA4A 4LDUA 3QO3A 3ER0A 4EMHA 3J7AF 1X75C 1K8AU 4N4IA 4WF2A 2PVOB 4JJNK 4MDWA 3SWNC 4IKFA 3A8GB 2R57A 3M58A 2K3YA 1M1FA 1N8RU 1UGSB 2K5LA 4PNOA 3VKIA 1QVFA 2RHZA 2V8IA 5GAN2 3L2RA 4HCBA 4C0DB 4C0ZA 2EAYA 2XKOC 4TVRA 4M78C 3BW1A 4Y28E 4C0GA 4N4HA 1Y96A 5CCAA 4X9DA 1TH7A 1H641 2FYKA 2HQXA 2RI2A 3OYBA 3CXCA 2JTFA 3EFSA 2LC4A 4IURA 4BI3A 4C5HA 5GMKl 1VQ4A 2K3XA 5GAN7 4M77B 5FRMA 4C92B 1ZQ1A 3CMAT 5A0LA 1YITT 3CCUA 2LCCA 2MI6A 4M75E 1LOJA 4BACA 4A4HA 5GMKj 4M7AD 3I56T 5HY6A 2IVWA 2P0PA 4X34A 4C5EA 1KG1A 1KC8U 3CCSA 1G3WA 2GFAA 5LJ3f 3M54A 4ZN1A 2RM4A 4O6JA 2RHXA 4F7UA 3V7CA 3JCMJ 5GAN4 2GFUA 2ZPBB 2HD0A 2ZPIB 2EJ9A 2RHIA 3DB4A 4IUPA 4HCCA 1KQSA 3MEVA 2RB6A 4XTYA 2EJFA 1YHQA 3RESA 3M56A 3QIIA 4NOYA 1VQMA 3CCLA 3PMTA 3OS5A 5GMKe 2DEQA 2MWOA 1YIJT 1WNLA 5GANd 3KXTA 4JRPA 3NTHA 4PLIA 5D6XA 4CRIA 3RKWA 1YJWA 2X35A 1U8RA 4C92G 2CGHA 4HA8A 2V8JA 3MCAB 4M75F 3SB2A 2LT4A 3QJYA 1IREB 3M5AA 2F5KA 2GCXA 1YJ9A 2Y4XA 1I81A 2P0QA 3LGLA 2JTMA 4RCBA 2XDPA 2DPPB 4MZMA 5GAOm 4XTXA 4LD9K 3S3MA 1QVGS 3CC2T 1BI2A 1Y7XA 2JUFA 5KE3A 2DXCA 3CEYA 3KBGA 2E12A 2OTJT 2KK4A 3OW2S 3F70A 3META 4QQ6A 5I21A 2D6FA 2XIDA 1BIAA 4M7AB 3OBYA 3FDRA 4JLGA 3BDLA 3MEUA 3O8VA 4NL2A 4PL6A 4C0DC 3TU4K 4P5NA 1VQ5T 2QQSA 3OY9A 4Z02A 1P92A 2LX9A 3HHTB 5L8RE 4XU3A 3SD4A 1MHNA 3G6EA 4BE0A 2P0KA 5CKEA 1VQOT 3OQ5A 4M77C 5GAMh 2FB7A 4XTVA 3JCMh 4BY6C 2XHCA 1I4K1 4C92C 2ZCFB 4F7UB 5CVIA 1LNXA 4J6XA 2CKKA 3OYFA 2O01E 1XTDA 3A8OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JUV A;  3JCM X;  1U1S A;  1I8F A;  4M7D D;  3V7S A;  1Y96 B;  4F7U F;  4M78 G;  5GAM g;  4HT9 A;  1U1T A;  2E64 A;  2ZGW A;  3BDU A;  1LJO A;  4OP0 A;  5GAN 8;  3JB9 G;  3RER A;  1N9S A;  3FIF A;  1X01 A;  4M7A G;  2VXF A;  5GAN 5;  2DKG A;  2E10 A;  3VU3 C;  5GAO p;  4M7A A;  4EMK A;  4PJO B;  4EMK C;  3RKX A;  4M77 F;  4M77 E;  4C8Q B;  4Y91 A;  4EMG A;  4C92 E;  3QO3 A;  4M75 A;  1WQW A;  4M75 C;  4EMH A;  4WF2 A;  3EFR A;  4XU1 A;  3SWN A;  3SWN C;  3RIR A;  4M75 D;  4PJO F;  4M7D E;  4XQ3 A;  4C8Q F;  2EJG A;  2DXT A;  2VXE A;  2YHT A;  5DY9 A;  4F7U G;  3AHU A;  3FJP A;  5GMK m;  2DVE A;  3JB9 H;  1B34 A;  4PNO A;  4JLI A;  3QSU A;  2E41 A;  2I2L A;  5GAN 2;  4XU2 A;  4X9C A;  2EAY A;  4M78 A;  4M78 C;  3BW1 A;  2K57 A;  4XU0 A;  4DQ2 A;  1Y96 A;  4X9D A;  1TH7 A;  1H64 1;  1HK9 A;  2FYK A;  5GAO n;  4M78 D;  3L1A A;  3EFS A;  5GMK l;  3RKY A;  1WQ7 A;  4A53 A;  5GAN 7;  4M77 B;  5GAN 3;  5GAN f;  4C92 B;  1HXD A;  5GAN j;  4M77 G;  4V2S A;  4JRI A;  4M7A C;  3JCM Q;  4M7D B;  4M75 E;  2RA2 A;  3V8J A;  1LOJ A;  5GMK j;  4XTU A;  4M7A D;  4PJO G;  4C92 F;  4NL3 A;  1YCY A;  3JCM V;  4C8Q G;  2Y90 A;  2DXU A;  1M8V A;  3V8K A;  5LJ3 f;  5LJ5 f;  4M7D F;  2E1H A;  2RM4 A;  1WPY A;  5LJ3 j;  1N9R A;  2YLC A;  1D3B A;  3RUX A;  1KQ1 A;  4MML A;  1KQ2 A;  5GAM f;  3JB9 I;  3HFO A;  3JCM f;  4F7U A;  4MMK A;  3V7C A;  3FB9 A;  4QVD A;  2DZ9 A;  4M78 E;  5GAN 4;  3JCM J;  4J5Y A;  2JN0 A;  2EJ9 A;  5GAN e;  3JCM W;  3M4G A;  3BY7 A;  5GMK h;  4RCC A;  2RB6 A;  4XTY A;  1M5Q 1;  2EJF A;  3RES A;  4EMK B;  4NOY A;  4XTZ A;  3JCM P;  5GMK e;  2DEQ A;  4M75 B;  5GAN g;  2EWN A;  1WNL A;  3PGG A;  5GAN d;  4HT8 A;  3QUI A;  4M7A E;  3SWN B;  3RKW A;  4A54 A;  4QVC A;  3JB9 D;  3HSB A;  4C92 G;  2CGH A;  4M77 A;  2DJZ A;  4HA8 A;  4C92 A;  4M75 F;  4N0A A;  4N0A C;  3SB2 A;  3V8L A;  3JCM b;  5GAO q;  5GAO r;  1B34 B;  5CAI A;  4M7D G;  4PJO C;  3BFM A;  4PJO A;  1I81 A;  2VC8 A;  5LJ3 g;  5GAO m;  4RCB A;  5LJ3 d;  4C8Q A;  4C8Q C;  2DTH A;  5LJ5 d;  3INZ A;  4M78 B;  4XTX A;  4J6Y A;  5LJ5 j;  4PJO D;  4C8Q D;  3V7R A;  3HFN A;  4F7U E;  5GMK i;  3JCM g;  5GAM d;  3JCM d;  3QHS A;  2DTO A;  2HNI A;  5GAM j;  3JB9 J;  2DTI A;  4M78 F;  5GAN h;  5I21 A;  1BIB A;  2DZC A;  3L2Z A;  5GAO l;  4M7A B;  1BIA A;  4NL2 A;  3JB9 F;  2E65 A;  5GAN 6;  4XTW A;  4J6W A;  1JBM A;  4JRK A;  5LJ3 h;  4M75 G;  5LJ5 h;  4M7A F;  1MGQ A;  4XU3 A;  3GIB A;  1JRI A;  1D3B B;  5LJ3 e;  5LJ5 e;  4M77 C;  5GAM h;  1I5L A;  2FB7 A;  4XTV A;  3JCM h;  4C92 C;  1I4K 1;  2QTX A;  3JCM c;  4PJO E;  4F7U B;  2RD1 A;  4M77 D;  1LNX A;  4J6X A;  2YLB A;  4C92 D;  4C8Q E;  5GAM e;  3JCM e;  4M7D A;  4M7D C;  5LJ5 g; 
#chains in the Genus database with same CATH topology
 1W2B A;  2DBM A;  5KH6 A;  5M9O A;  1I8F A;  4AFQ C;  1XQH A;  1TTH B;  3CC4 Q;  3A1P A;  4OGC A;  5FU6 B;  1VQ7 Q;  1TUD A;  4LN2 A;  1YI2 T;  1WI7 A;  3GPL A;  4E6R A;  3M53 A;  1B34 A;  1RAD B;  2RN8 A;  1PSE A;  5AYF A;  2E70 A;  3G71 Q;  3QKJ A;  1Y71 A;  3GNF B;  4LXC A;  3CCQ T;  3MP6 A;  4OMP A;  3RBB B;  4CI0 C;  1I07 A;  2XDB A;  1JXM A;  1WJQ A;  3M0T A;  3S6W A;  4ELZ C;  1UG1 A;  3EG0 A;  5I11 A;  1QVG P;  3GBQ A;  3V8K A;  4M7D F;  4ZGE B;  5KYX A;  4JRQ A;  3OW2 P;  4A4G A;  4XAX B;  3RNJ A;  3M0U A;  3LWH A;  4E7J A;  3OYD A;  1NEG A;  2QQB A;  3VRY A;  2VAS A;  5GMK h;  4RKU E;  2ROT A;  2JNG A;  3PGG A;  3VUZ A;  1AVZ C;  2NUT A;  2J6K A;  1QCO A;  3E1S A;  4QVZ A;  2EGA A;  3BFM A;  3A8H B;  3M0Q A;  3TSZ A;  1ZSZ A;  5FW9 A;  1X43 A;  4RTV A;  4JPB W;  4M4Z A;  3QPH A;  2QG9 B;  1XNI A;  3EAE A;  1BIB A;  3X28 B;  5GAO l;  2YSQ A;  3OYA A;  1AWO A;  4BDZ A;  3MEW A;  1NBE B;  2E5Q A;  1QVG A;  1BCM A;  2PVD B;  2RJD A;  3H0F A;  3ME9 A;  2LJ1 A;  4M7D D;  4HT9 A;  3QZ5 B;  5D6Y A;  3OYH A;  3RER A;  4E2F B;  2E10 A;  4L5G A;  1SHG A;  3FC3 A;  4B9W A;  5IN1 A;  3QZ9 B;  3A8M B;  4EMG A;  1VQK T;  4B6M A;  1WQW A;  1TUG B;  4M75 C;  2LQK A;  3EFR A;  3CC7 Q;  2RQV A;  4JJD A;  1Q7Y R;  2CZ0 B;  1NJI U;  2KR3 A;  2CP5 A;  4XU0 A;  4DQ2 A;  1QCF A;  2HSE B;  2DK3 A;  1K9A A;  1BI3 A;  3PNW C;  1SF9 A;  3UWN A;  3DLL A;  5GAN f;  3R6N A;  4V2S A;  3D7S B;  4F14 A;  4MZP A;  1I1J A;  2KQW A;  3X25 B;  2A7Y A;  2DNU A;  4GBQ A;  2AKK A;  2PZ1 A;  2PTK A;  3LGF A;  1KQ2 A;  2K4Y A;  1SKU B;  2FRW A;  1VYU A;  3BY7 A;  3SFM A;  3QWY A;  2IG0 A;  3CBP A;  1E7O A;  2YWW A;  1ZBX A;  3EGX B;  2YDL A;  1XOV A;  3QUI A;  3AT1 B;  2DJZ A;  4C92 A;  5CAI A;  1SSF A;  1V1C A;  3FLG A;  5KE2 A;  3MP8 A;  3CC4 A;  4ZTJ A;  5CQY A;  2EQJ A;  3CCS Q;  2WSE E;  3ZL7 C;  1VQ7 A;  4JZ3 A;  1KQS P;  2YRV A;  1WHL A;  2KRN A;  3A98 A;  3WXM B;  2CS7 A;  2EYX A;  1NZ9 A;  1U3O A;  1VQ8 Q;  1AEY A;  1M90 C;  4EPC A;  4Q5W A;  1YHQ Q;  2OAW A;  1VQM Q;  1M1K C;  2QI2 A;  1ZUU A;  1QWF A;  2DM1 A;  2VKN A;  3G71 A;  1KHI A;  4JUV A;  1WX6 A;  1YJ9 T;  1KHC A;  3EGU A;  1ABQ A;  3CME T;  1YCS B;  5FU7 B;  2X4W A;  4J9H A;  2B8A A;  2QDY B;  3VS6 A;  5KYN A;  3CBO A;  1OZ2 A;  4JS5 A;  4M7A A;  3CXC S;  3VJP A;  1H3Z A;  1Y07 A;  4EMK A;  1WHM A;  1K0X A;  2JMC A;  4M77 E;  4XU1 A;  3SWN A;  5J39 A;  1AOJ A;  2EKO A;  2GBQ A;  2CRE A;  2O2O A;  3G6E T;  1JEG A;  1YWO A;  2K5I A;  2DL7 A;  1PNJ A;  5D6W A;  4XU2 A;  2COW A;  1KIK A;  4D6W A;  1YIT A;  1YWP A;  3WVE B;  2DD4 A;  5GAN j;  4M77 G;  2DYB A;  2GF7 A;  4JRI A;  2CSQ A;  2RA2 A;  4GLK A;  2QA4 Q;  4J7I A;  1TOV A;  5LJ5 f;  3NTK A;  3RUX A;  2QQR A;  4RTW A;  1Y0M A;  3EHQ A;  2DL3 A;  4OMN A;  5GAN e;  2R58 A;  2RJF A;  4RCC A;  1M5Q 1;  1JJ2 P;  2M0O A;  5DM7 R;  1TG0 A;  1K73 U;  2LQ8 A;  2VC8 A;  4PJO C;  4C8Q C;  5IHK A;  2DTH A;  2FVU A;  4BUG A;  4J6Y A;  4F7U E;  1K0S A;  3LYI A;  3T9N A;  5A2Q E;  3JCM d;  1QWE A;  4E7K A;  5C0M A;  1AZE A;  2YUP A;  4YTL A;  2KXD A;  5I2M A;  4RTY A;  4FCY A;  3NTI A;  1UB4 A;  5FRO A;  4J9E A;  3CC7 A;  3GNG A;  3QDR B;  1OYX A;  1SPK A;  2R5A A;  2RD1 A;  5FWC A;  2H3J A;  4IIO A;  4F17 A;  1OV3 A;  2HKN A;  2KY9 A;  4Z88 A;  2GNC A;  3M9Q A;  3BDU A;  1LJO A;  2FPE A;  3CCJ Q;  3M0R A;  3X26 B;  1X01 A;  3PVL A;  4LDV A;  4E7Z A;  2ZAE A;  4DA4 A;  1Q82 R;  3ER0 A;  1RAI B;  1K8A U;  4N4I A;  4Y92 A;  5FWB A;  2FPD A;  2LQN A;  4PNO A;  2VB6 A;  1TSF A;  2D8H A;  2XKO C;  4TVR A;  4M78 C;  2RI2 A;  1H64 1;  2FYK A;  5GJV B;  1SRM A;  2HMA A;  2K3X A;  5A0L A;  1E6H A;  3CMA Q;  2LCC A;  4M75 E;  1OX8 A;  5HY6 A;  1UJY A;  2DVJ A;  5L23 A;  3CCS A;  2GFA A;  5LJ3 f;  4ZN1 A;  4O6J A;  2PNI A;  4F7U A;  4AG2 C;  5GAN 4;  1UHF A;  1QCN A;  2HD0 A;  1K9M R;  1D09 B;  1YHQ A;  2DLP A;  3M56 A;  1VQM A;  1WHJ A;  1YIJ Q;  2MWO A;  4DBQ A;  2BZY A;  4CRI A;  1U8R A;  4HVV A;  4HA8 A;  2V8J A;  1IRE B;  2KYB A;  2F5K A;  2JTM A;  5GAO m;  2XDP A;  1U5S A;  2M02 A;  3CC2 T;  3KBG A;  2E12 A;  2OTJ T;  2RQW A;  2CUB A;  4QQ6 A;  4WCI A;  5I21 A;  2XID A;  1BIA A;  4NL2 A;  4C0D C;  3O8V A;  1VQ5 Q;  1G2B A;  8AT1 B;  1P92 A;  2LX9 A;  3HHT B;  2ROL A;  3SD4 A;  3CQT A;  1VQO Q;  5CKE A;  1IO6 A;  3OQ5 A;  4XTV A;  3JCM h;  4BY6 C;  4C92 C;  5CVI A;  1NYF A;  4OF1 A;  1IXD A;  1IGQ A;  2X3W D;  1YJN T;  3EG9 A;  3HRT A;  4A4F A;  5KCH A;  1WJR A;  2DKG A;  3VU3 C;  1FMV A;  1ZLM A;  2QA4 A;  1YI2 Q;  2QQ9 A;  3HKS A;  4OMM A;  3O5Z A;  2KGT A;  2O9V A;  4AT1 B;  4RG2 A;  4M75 A;  4OMO A;  3KFV A;  2V1R A;  4LDX A;  3GOX A;  3PIP A;  2DIQ A;  4JLI A;  3IQL A;  3I5R A;  4QQG A;  1J3T A;  1N6A A;  2CYZ B;  4FM4 B;  1SHF A;  1HK9 A;  3OYK A;  3L1A A;  3EFO A;  3CCQ Q;  1D1B A;  4RG8 A;  2YXY A;  2K2V A;  1BCO A;  1HXD A;  1OX9 A;  1OOT A;  3FRN A;  4R56 A;  4M7A C;  2M51 A;  3E9G A;  4KGX B;  5CR2 A;  3VS5 A;  3J81 E;  5HK0 A;  1WIE A;  5ECA A;  3OYI A;  3G4S T;  5LJ3 j;  4KUD K;  2CDT A;  2EQU A;  1TS9 A;  5GAM f;  1VQ9 T;  2DZ9 A;  1Q81 U;  3PFS A;  1PD0 A;  2VWF A;  3CPW S;  1KD1 R;  3KUF A;  5J3B A;  2RMO A;  3L2U A;  3PMI A;  3JB9 D;  3NFC A;  3EG1 A;  2L8D A;  3HSB A;  5I2S A;  2W0Z A;  1B34 B;  1KD1 U;  4LUE A;  2XIC A;  2AZS A;  5A0D A;  1NJI C;  1Q86 U;  3E9F A;  1W70 A;  3CCJ A;  4AG1 C;  2LQW A;  3JB9 J;  3CCE T;  1QVF S;  5IXF A;  3QBY A;  1ZX6 A;  2NUP A;  2K6D A;  2DZC A;  2O4X B;  3I55 T;  2E65 A;  1YFN A;  2J7I A;  3A5Z B;  4OML A;  5KYX B;  2JM8 A;  2M0Y A;  1C6V X;  1RI0 A;  2QTX A;  3OMG A;  2PUO B;  4C8Q E;  4PJO E;  4KGV B;  1S72 T;  2D0Q B;  4E47 A;  3QG1 A;  2NUT B;  5CKH A;  3A8L B;  4D8D A;  3S3O A;  4PFZ A;  3ASK A;  2L3R A;  1UE9 A;  1OEB A;  2JW4 A;  4M77 F;  2VYT A;  1VQK Q;  1AHJ B;  1ZSZ B;  5DLO A;  1VQN A;  4DBR A;  1WGS A;  2JMA A;  1BBZ A;  4DEX A;  2M9U A;  1K1Z A;  2KI7 A;  3SEM A;  1VQ6 A;  2E41 A;  3H6Z A;  1R0C B;  4ANJ A;  2OTL T;  3RKY A;  2QEX T;  4MDX A;  4EDU A;  2QTV A;  2VUB A;  2DIG A;  1V76 A;  1X6B A;  1D0Z A;  3RDV A;  4ELY C;  3ULR B;  3P8H A;  3OYE A;  2FG0 A;  1D3B A;  2HDA A;  1KQ1 A;  4MML A;  3MHX A;  1W2B S;  3OS0 A;  4M78 E;  2MK5 A;  3GP8 A;  1Z9Z A;  3P8D A;  1VQ5 A;  3JCM W;  2EPD A;  1MV3 A;  2HCK A;  2G6F X;  4XTZ A;  4QQD A;  1QLY A;  4OVA A;  2RK2 A;  1H8K A;  1VQ4 T;  2X4Y A;  4EIK A;  1WXB A;  1G5V A;  2KSS A;  5GAO q;  1YN8 A;  3CPF A;  1RLQ C;  5CQX A;  4KRT A;  4OB0 B;  3HPW A;  3OYJ A;  1HJD A;  4PJO A;  4C8Q A;  2ESW A;  2M1H A;  3INZ A;  1FMK A;  1RAH B;  3VYG A;  3JV3 A;  1UGR B;  2ZPG B;  3DKM A;  2KMT A;  2LP5 A;  2Z0W A;  1YI2 A;  1D0X A;  1ZA1 B;  1N8R R;  2OJ2 A;  2KEA A;  1AWJ A;  4J6W A;  1FWZ A;  3CCL T;  3GF5 A;  1O75 A;  1YJW T;  2CSI A;  2AT1 B;  3TEE A;  4M7D C;  1SEM A;  3PT9 A;  4E7H A;  3UAT A;  1YJ9 Q;  3CCQ A;  2A08 A;  2JVV A;  2E64 A;  2MOX A;  3CME Q;  5CO7 A;  2SEM A;  1HSQ A;  3OSS C;  1B07 A;  4BY6 B;  1K73 C;  2AIR B;  4FW2 A;  1M1G A;  3ZBD A;  3S3N A;  1M2O A;  4C92 E;  5DLQ E;  2P4T A;  1UHC A;  2GQV A;  3G6E Q;  1PHT A;  3OW2 A;  4X9C A;  4FIB A;  1BKB A;  1OQK A;  4M78 A;  2D1X A;  1PKT A;  3LLR A;  2A36 A;  5GAO n;  1F1B B;  2ENM A;  3EH1 A;  5GAN 3;  2EYY A;  5D7U A;  3OS2 A;  1H92 A;  4OGE A;  3I56 A;  3V8J A;  2V26 A;  4N4G A;  1PM3 A;  3RR6 A;  5KYU A;  2DMO A;  3JB9 I;  3MEA A;  2W10 A;  2O31 A;  2JN0 A;  2CP7 A;  2RJE A;  4EMK B;  1UDL A;  4HKE A;  5GAN g;  2EWN A;  3NMZ C;  5KYW B;  4M7A E;  3SWN B;  3CCR T;  1Q7Y U;  2RQU A;  1K8A C;  4ZGD B;  3V8L A;  4N0A C;  2E6N A;  2EVR A;  2KBT A;  1B3Q A;  2QGF B;  1VYT A;  2F2V A;  2XU8 A;  4BE2 A;  2YUQ A;  3M59 A;  2BZX A;  4LD6 A;  2KYM A;  3L2W A;  3CXC P;  1G3Y A;  5GAN 6;  1VQK A;  2HBW A;  2C06 A;  1JBM A;  3G7Z A;  3GIB A;  1C0M A;  3M57 A;  2XK0 A;  2BKD N;  2DL5 A;  2L89 A;  4AMC A;  5HK3 A;  1UTI A;  2DX1 A;  3I9Q A;  3UPU A;  2GTO A;  1GXI E;  1U1S A;  3C4S A;  2EIF A;  2RQR A;  1Y57 A;  1N5Z A;  1NLP C;  2VXF A;  2EFI A;  5GAN 5;  2LZ6 B;  1MND A;  2ZPF B;  2KT8 A;  3QO3 A;  2O88 A;  2BTT A;  4EMH A;  1X75 C;  4WF2 A;  2J06 A;  4ORZ A;  3A8G B;  2K3Y A;  5I22 A;  3VKI A;  5IH2 A;  2EAY A;  4RTX A;  4C0G A;  4N4H A;  1W1F A;  2FZK B;  3SHW A;  3OYB A;  4LE9 A;  3CXC A;  3EFS A;  2LC4 A;  1S1N A;  4M77 B;  4DBF A;  1M2V A;  1YIT T;  2MI6 A;  1ZBJ A;  2IVW A;  2LX7 A;  2HSP A;  1U06 A;  1QQJ A;  3MJX A;  2RF0 A;  4J9G A;  3VS4 A;  2RHX A;  1GFC A;  3V7C A;  2D8J A;  2ZPB B;  2LCS A;  2EJ9 A;  2RHI A;  1KQS A;  1D1A A;  2HEQ A;  4X1V A;  2EJF A;  2A37 A;  3QII A;  4NOY A;  3PMT A;  2LJ3 A;  1WNL A;  3KXT A;  3NTH A;  3RKW A;  2X35 A;  3EGD A;  3SB2 A;  2LT4 A;  3VRZ A;  4J9I A;  1YJ9 A;  1I81 A;  2P0Q A;  2DPP B;  4MZM A;  4XTX A;  3CC2 Q;  1Y7X A;  8ATC B;  5KE3 A;  2OTJ Q;  2KK4 A;  1LPL A;  5GJW B;  2KXC A;  1I5O B;  3OBY A;  3FDR A;  3BE3 A;  4HCK A;  2LMJ A;  4P5N A;  4Z02 A;  5L8R E;  5KYY A;  3G6E A;  3EGX A;  1MUZ A;  2QAZ A;  2FB7 A;  2HKQ B;  1I4K 1;  2ZCF B;  4F7U B;  1LNX A;  3JCM X;  1Q81 C;  3CD6 T;  3V7S A;  1QMC A;  3REA B;  5CKD A;  3URG A;  1YJN Q;  3M4Y A;  2DO3 A;  2QYZ A;  1AT1 B;  1NEB A;  1DJ7 B;  4AFU C;  5GAN 8;  3R6O A;  4R0K A;  2FZC B;  4ATO A;  4GY5 A;  1GCQ C;  3QWX X;  4JJB A;  2RJC A;  1KC8 C;  2E6Z A;  3MO8 A;  1ZSG A;  4OMQ A;  1Q86 C;  4M7D E;  2LNH B;  3NPF A;  4FW1 A;  2EJG A;  4F7U G;  3AHU A;  2KNB B;  1TXQ A;  1ZHI A;  5FRN A;  4OB3 B;  1ABO A;  1JJ2 A;  2C0O A;  2F69 A;  1RLP C;  2L3P A;  3REB B;  2QGG A;  2EGC A;  1YCY A;  3JCM V;  2E3I A;  1WHK A;  3G4S Q;  4HVW A;  3NHN A;  2JTE A;  2VGM A;  2DBK A;  2CZ6 B;  1ZUY A;  1VQP T;  2JT4 A;  3JCM f;  1RUW A;  1VQ9 Q;  4NS5 A;  1SG5 A;  4J5Y A;  4F04 B;  1Q82 U;  3M4G A;  1JB0 E;  4K11 A;  4M75 B;  2COY A;  1TU0 B;  2BIV A;  1MMA A;  4RTZ A;  5FU6 C;  2L5Q A;  1PKS A;  3N5B B;  1VQL T;  3VS2 A;  5LJ3 g;  3H0H A;  5LJ5 j;  2M16 A;  1UFF A;  1VA7 A;  3EFO B;  2HL5 C;  3CCE Q;  5CKF A;  1K4U S;  3VYH B;  1VQ8 A;  3I55 Q;  2MF2 A;  5C6S A;  2BUD A;  2V1Q A;  4CC3 A;  2XG8 D;  2YRC A;  1WHG A;  2X4X A;  1FMW A;  4M75 G;  3OYY A;  4ZGJ B;  1CSK A;  3QXE B;  5LJ5 e;  1M8M A;  2FO0 A;  1K9M U;  1G3S A;  2CZ1 B;  1GFD A;  4M7D A;  1UGQ B;  2XI9 A;  1EZZ B;  3DB3 A;  5IT9 E;  1S72 Q;  1Y96 B;  1FXX A;  3C95 A;  1WXU A;  2NYS A;  3M0S A;  3GLX A;  4HXJ A;  1M90 R;  3QYH B;  2GTJ A;  3UF4 A;  2X9H A;  1M1K R;  1BI1 A;  4L59 A;  1ACM B;  1TUC A;  2H8H A;  2L2P A;  2OAU A;  1PWT A;  4FYV B;  2DXT A;  1GRI A;  4O5V A;  2DVE A;  2KRO A;  2WSF E;  1BYM A;  2I2L A;  3CPW P;  2EQM A;  4ESR A;  1X69 A;  2F2W A;  1IRX A;  4QKU A;  2OTL Q;  2EYZ A;  3L2V A;  4A53 A;  2QEX Q;  3CCM T;  3CCV T;  2E4H A;  3HTR A;  1HYO A;  4PKC C;  3CC2 A;  3OYM A;  3M55 A;  2C0I A;  3THK A;  2JS0 A;  4PJJ A;  5KCO A;  2P84 A;  5J26 A;  1QVF P;  1WA7 A;  2DFU A;  1RAB B;  2RI3 A;  4BB7 A;  2PU9 B;  1UGP B;  1OZ3 A;  2G3R A;  5IAY A;  4IUQ A;  1VQ4 Q;  4N0A A;  2DEU A;  4PLL A;  3CCU T;  1RAG B;  1RAE B;  2QXF A;  2MAM A;  3CPW A;  2E3H A;  2ED0 A;  1MV0 B;  4C0F A;  1MMG A;  1NPP A;  1UUE A;  2CH4 A;  1WFW A;  1KSW A;  2LRQ A;  2F1L A;  2X51 A;  1PC0 A;  3CCL Q;  1JRI A;  1D3B B;  5LJ3 e;  1JU5 C;  4BE1 A;  1G3T A;  4GLM A;  1YJW Q;  2EGE A;  2FEI A;  4B9X A;  3M0P A;  4VUB A;  1U1T A;  2KAF A;  3OYN A;  1EX4 A;  2EYQ A;  2ZPE B;  1M27 C;  2MWP A;  3FIF A;  1Q7Y C;  1Z9Q A;  1UJ0 A;  3VS3 A;  4PJO B;  3G4S A;  4C8Q B;  5LL6 S;  3HRS A;  3H0I A;  1D0Y A;  2HBP A;  1VQ9 A;  2JS2 A;  2BE7 D;  1UGV A;  3VV0 A;  1W2B P;  5DY9 A;  4A63 B;  3JB9 H;  2B86 A;  2RNA A;  1VQN T;  4DEY A;  4OB1 B;  3Q1J A;  3OMC A;  4IIM A;  1VQ6 T;  1IHW A;  2WSC E;  3CMA A;  2HL3 A;  5IHN A;  4FT4 A;  3OYL A;  1N27 A;  2BZ8 A;  2KT1 A;  2YRD A;  4PJM A;  1A0N B;  1FX7 A;  4PJN A;  1RAA B;  4KH0 B;  4PJO G;  4NL3 A;  4C8Q G;  2Y90 A;  2DXU A;  1M8V A;  1EIF A;  2NWM A;  2RQT A;  1M9S A;  3CCE A;  3QDF A;  4BD3 A;  3I35 A;  3HFO A;  2PUK B;  4II1 A;  3I55 A;  2QAS A;  3FB9 A;  2O9S A;  4FSX A;  1YIJ A;  2CP3 A;  1OUL A;  1AD5 A;  2D9T A;  5FU7 C;  2QK0 A;  4KUL A;  1X2K A;  3CCR Q;  2FL7 A;  4QVC A;  1H3H A;  3OYC A;  5GAO r;  2DAQ A;  1S72 A;  2MPX C;  4IUU A;  4PFP A;  4KGZ B;  4J9B A;  3QJ6 A;  4M78 B;  4DBH A;  5CKB A;  2NLU A;  3V7R A;  3E19 A;  3HFN A;  2DTO A;  2HNI A;  5GAM j;  2DTI A;  2VVK A;  2RO0 A;  4JS4 A;  3VUB A;  1WJS A;  4JDS A;  2DXB A;  4OB2 B;  1VQO A;  1BU1 A;  2XMF A;  4KT0 E;  1RI9 A;  1MGQ A;  4CC4 B;  1GBQ A;  2HAX A;  5KYU B;  1O9S A;  5CIU A;  3LW5 E;  4M77 D;  5GAM e;  3FJ5 A;  4ZNX A;  3UDC A;  4LUD A;  2RK1 A;  4M78 G;  4MZT A;  4IUT A;  3U23 A;  4F7U F;  4J9F A;  2OTL A;  2QEX A;  3E2U A;  3UA7 A;  4RTU A;  5HKC A;  4KBM B;  1N9S A;  3OBW A;  1ZA2 B;  2BE9 B;  2O4X A;  3X20 B;  4ME7 A;  1VIE A;  1GCQ A;  4XK8 E;  4LDU A;  1EFN A;  3J7A F;  2E5K A;  1R77 A;  2PVO B;  2FRY A;  4JJN K;  2QDL A;  1AZG B;  1M1F A;  1N8R U;  2HQH A;  1UGS B;  2F2X A;  2K5L A;  4WTO B;  5GAN 2;  4C0D B;  1WLP B;  1MMD A;  1TH7 A;  2HQX A;  1C1A A;  2JTF A;  4BI3 A;  2CT4 A;  4C5H A;  2ATC B;  5GMK l;  1VQ4 A;  5GAN 7;  5FRM A;  4C92 B;  1ZQ1 A;  1YIT Q;  1W6X A;  4PFO A;  1G8X A;  2J6F A;  1LOJ A;  4BAC A;  5GMK j;  1KFZ A;  3I56 T;  2CUD A;  4C5E A;  2P0P A;  4X34 A;  4AFZ C;  2FPF A;  1G3W A;  1UEC A;  4RTT A;  2DL8 A;  3JCM J;  4Z89 A;  4HCC A;  2ZPI B;  3DB4 A;  3MEV A;  2RB6 A;  4XTY A;  3CCL A;  3OS5 A;  5GMK e;  4RUG A;  5GAN d;  4JRP A;  4PLI A;  2I0N A;  1YJW A;  4C92 G;  3VS0 A;  3MCA B;  4M75 F;  5HCK A;  3NGP A;  2NUZ A;  3EH2 A;  3QJY A;  3M5A A;  2A0F B;  2Y4X A;  3LGL A;  2HZY A;  1KJW A;  1QVG S;  3I5S A;  3CEY A;  3OW2 S;  2OX7 A;  2D6F A;  1M2V B;  4M7A B;  4PL6 A;  3BDL A;  3MEU A;  3TU4 K;  2K3B A;  2QQS A;  1NJI R;  2DF6 A;  4D8K A;  1MHN A;  2EBP A;  4J6X A;  3PVQ A;  2CKK A;  3OYF A;  2O01 E;  2J05 A;  4J83 A;  3CD6 Q;  5IHI A;  3JSC A;  2PVG B;  3C12 A;  1Q82 C;  4J9C A;  2CP6 A;  2IIM A;  1MNE A;  2CH4 W;  3JB9 G;  3CC4 T;  4BI8 B;  1OU8 A;  2RHY A;  1VQ7 T;  3EGD B;  2EW3 A;  4M7A G;  2KVQ G;  1IHV A;  5GAO p;  2L3Q A;  4LDY A;  4QW2 A;  4Y91 A;  1NG2 A;  3RIR A;  4M75 D;  4F16 A;  1AWW A;  1PCX A;  2VXE A;  2ED1 A;  3G71 T;  2IPO B;  1NE8 A;  1M30 A;  2CZ7 B;  2HQE A;  3CCR A;  2H3E B;  3G1J A;  5KYY B;  2EQI A;  4OMF B;  2L3S A;  9ATC B;  3X24 B;  1K9M C;  3JCM Q;  4XTU A;  2DE0 X;  1B7T A;  2A28 A;  2A3L A;  1N9R A;  1OPL A;  2YLC A;  2KDS A;  1SRL A;  2Y4Y A;  1VQP Q;  4C5G A;  2DIL A;  1BK2 A;  3TQ7 P;  4A4E A;  1RL2 A;  4FL6 A;  2LNV A;  1JO8 A;  1NM7 A;  1VYV A;  2F5T X;  1AWX A;  3L42 A;  1VQL Q;  1IGU A;  2C0T A;  5LJ5 d;  1LVK A;  2X3X D;  1K76 A;  2DYI A;  2LDM A;  5GMK i;  1W4S A;  2MIO A;  2MCN A;  2AHJ B;  2ZPH B;  5GAN h;  1KK7 A;  3ZEH A;  4CC2 A;  3L2Z A;  3RMQ A;  4PK4 A;  3J80 E;  3JRZ A;  3TSW A;  1QW1 A;  4JRK A;  2VGN A;  2DRM A;  1PRM C;  5KYW A;  4HVU A;  1CKB A;  3P8B B;  2EQK A;  3CME A;  5LJ5 g;  3OYG A;  3H9N A;  4L6V 5;  2DRK A;  3C0C A;  2ZGW A;  4HCZ A;  2DD5 A;  4OP0 A;  2JM9 A;  4FSS A;  3EG3 A;  1KQS S;  4FT2 A;  2CT3 A;  4Z8A A;  3RKX A;  3RMS A;  1QVP A;  3MP1 A;  1X2Q A;  3OSV A;  4LNP A;  2X4J A;  4PJO F;  3HL8 A;  4XQ3 A;  4C8Q F;  3CC7 T;  2YUN A;  5A0G A;  3FJP A;  3JAM E;  1K73 R;  1T3L A;  2K57 A;  3HP9 A;  1T0J A;  2GQI A;  3LH5 A;  3OA6 A;  3CCM Q;  1QKW A;  2COZ A;  4RMO A;  3CCV Q;  1PSF A;  2JOY A;  1GBR A;  4CC7 A;  4M7D B;  2PQW A;  1KD1 C;  3SDZ A;  2K5F A;  1Q95 G;  2MYS A;  1QKX A;  3C94 A;  4FYY B;  1ZUK A;  1WPY A;  4KUI A;  1NYG A;  4MMK A;  4QVD A;  2OI3 A;  2FZG B;  3OS1 A;  1M3A A;  4E7I A;  3JCM P;  5FLX E;  4M77 A;  1BB9 A;  2EYW A;  1YBY A;  3CD6 A;  3JCM b;  3FEO A;  1IZ6 A;  3LWI A;  3EHR A;  4M7D G;  1NLO C;  4E7S A;  4A4K A;  3CCU Q;  1FYN A;  5LJ3 d;  3LX7 A;  4PJO D;  2RH2 A;  1ZSZ C;  4C8Q D;  3EG9 B;  3JCM g;  3CCS T;  1X6G A;  4M78 F;  2K9G A;  1I0C A;  2LCL A;  1K8A R;  2DET A;  2XDD A;  1WHH A;  3OB9 A;  2DJQ A;  3EG2 A;  4J8O A;  4DOV A;  4XTW A;  1VQ8 T;  2JJ9 A;  1JJ2 S;  5LJ5 h;  1R0B G;  1YHQ T;  1VQM T;  4E7L A;  3HRU A;  1I5L A;  2ABL A;  4IUV A;  2YLB A;  2J6O A;  1VIF A;  2LT1 A;  1JXO A;  4C5I A;  5AT1 B;  2DER A;  2AK5 A;  4BI4 A;  3ZFJ A;  2KRM A;  1T0H A;  2RI5 A;  3UA6 A;  2GGR A;  1VQP A;  2YHT A;  4QT7 A;  5GMK m;  2R5M A;  1VQN Q;  3QSU A;  2LVM A;  2EKH A;  3H8Z A;  2KRS A;  1VQ6 Q;  4M78 D;  1M4Z A;  3TCJ A;  1OI1 A;  1WQ7 A;  1XJW B;  1PD1 A;  3L2Q A;  1UEB A;  2V8K A;  1VQL A;  3PIO A;  2QQA A;  1M90 U;  4C92 F;  1OPK A;  2VV5 A;  2QA4 T;  3DLM A;  1M1K U;  2E1H A;  4JZ4 A;  3CBM A;  1NPR A;  3VS1 A;  2L0A A;  2NUP B;  1G83 A;  1QP3 A;  2DA9 A;  1D1C A;  4LDW A;  1JQQ A;  4R55 A;  1QP2 A;  2K2M A;  4J9D A;  5CK9 A;  2CP2 A;  1T3S A;  2K79 A;  1X6O A;  4HT8 A;  4A54 A;  4UC4 A;  4FU6 A;  4ZTF A;  1V29 B;  4J7F A;  1N8R C;  3UT1 A;  4KH1 B;  2OTJ A;  3H41 A;  1PRL C;  1WDX A;  1CKA A;  3LH0 A;  5IXB A;  5GAM d;  4DOW A;  3QHS A;  1RAF B;  2MMP A;  1RAC B;  5EG2 A;  4FYX B;  1R8O B;  2LTO A;  2K7A A;  3TRE A;  3MPU B;  4JJC A;  3JB9 F;  1VUB A;  1X27 A;  5EC7 A;  3PE0 A;  4AFS C;  1HD3 A;  2CP0 A;  5LJ3 h;  4M7A F;  1BI0 A;  2KE9 A;  1M3C A;  2JZ2 A;  2XD0 A;  2RHU A;  2ZZD A;  3JCM c;  2ECZ A;  4C92 D;  2FHD A;  3JCM e;  1M3B A;  1YJN A;  2DL4 A;  5GAM g;  4ZN3 A;  3CCM A;  1SSH A;  3CCV A;  3CCJ T;  3QYG B;  4BDY A;  2AKL A;  2AZV A;  3WVD B;  2WAC A;  4PJL A;  1Q81 R;  4EMK C;  1YP5 A;  4FYW B;  2YT6 A;  4MDW A;  3SWN C;  4IKF A;  2R57 A;  3M58 A;  1GCP A;  1QVF A;  2RHZ A;  2V8I A;  3L2R A;  4HCB A;  4C0Z A;  4Y28 E;  5CCA A;  3BW1 A;  3PTA A;  1Y96 A;  4X9D A;  1KC8 R;  4IUR A;  1Q86 R;  3CMA T;  3CCU A;  4A4H A;  4M7A D;  7AT1 B;  3I56 Q;  1KG1 A;  1KC8 U;  3M54 A;  1WYX A;  2RM4 A;  3TVT A;  1MMN A;  1VOM A;  2GFU A;  4IUP A;  3VS7 A;  3RES A;  1YIJ T;  2DEQ A;  1PG5 B;  5D6X A;  1WZO A;  2CGH A;  2YUO A;  3MKD A;  1LCK A;  1OU9 A;  2RPN A;  1TWB A;  6AT1 B;  2GCX A;  1YNZ A;  4RCB A;  2SRC A;  4LD9 K;  3S3M A;  2JXB A;  1BI2 A;  2JUF A;  2D0N A;  2DXC A;  1E6G A;  3F70 A;  3MET A;  1IB8 A;  4JLG A;  1WXT A;  1VQ5 T;  3OY9 A;  1GL5 A;  2P4R A;  4XU3 A;  1VQO T;  1ARK A;  2LJ0 A;  4BE0 A;  2P0K A;  4M77 C;  5GAM h;  2XHC A;  1XTD A;  3A8O B; 
#chains in the Genus database with same CATH homology
 3JCM X;  5KH6 A;  5M9O A;  4J83 A;  1W2B A;  1Q81 C;  3CD6 T;  4MDX A;  1I8F A;  3JSC A;  3V7S A;  2PVG B;  3C12 A;  4OF1 A;  1Q82 C;  1YJN T;  5CKD A;  3URG A;  3M4Y A;  2DO3 A;  1XQH A;  3HRT A;  1DJ7 B;  5GAN 8;  3JB9 G;  3CC4 T;  4BI8 B;  4A4F A;  3R6O A;  4OGC A;  2RHY A;  5FU6 B;  5KCH A;  1VQ7 T;  1WJR A;  4M7A G;  2KVQ G;  2DKG A;  3VU3 C;  2QA4 A;  5GAO p;  1YI2 T;  2QQ9 A;  3HKS A;  4LDY A;  4ATO A;  4GY5 A;  4QW2 A;  4RG2 A;  4Y91 A;  2RJC A;  4M75 A;  1KC8 C;  2E6Z A;  3MO8 A;  3GPL A;  1Q86 C;  3RIR A;  4M75 D;  4M7D E;  4LDX A;  2EJG A;  2VXE A;  3PIP A;  3GOX A;  4F7U G;  2DIQ A;  3AHU A;  3M53 A;  1B34 A;  4JLI A;  1PSE A;  4QQG A;  5AYF A;  2E70 A;  1N6A A;  3G71 T;  1ZHI A;  3QKJ A;  1NE8 A;  2CYZ B;  1Y71 A;  4FM4 B;  3GNF B;  2CZ7 B;  1HK9 A;  2HQE A;  3CCR A;  3OYK A;  3L1A A;  5FRN A;  3CCQ T;  4RG8 A;  3MP6 A;  4OB3 B;  4OMF B;  1JJ2 A;  2F69 A;  2K2V A;  4CI0 C;  1HXD A;  3X24 B;  3FRN A;  4R56 A;  2XDB A;  1K9M C;  3E9G A;  4M7A C;  1WJQ A;  3JCM Q;  3S6W A;  4XTU A;  4ELZ C;  5CR2 A;  1YCY A;  3JCM V;  3J81 E;  2A3L A;  3V8K A;  5HK0 A;  3G4S T;  3OYI A;  4M7D F;  4ZGE B;  5LJ3 j;  1N9R A;  2YLC A;  4KUD K;  2EQU A;  2KDS A;  2VGM A;  2CZ6 B;  2Y4Y A;  5GAM f;  4A4G A;  4JRQ A;  4XAX B;  3JCM f;  4C5G A;  1VQ9 T;  3LWH A;  4NS5 A;  4E7J A;  2DZ9 A;  1Q81 U;  3PFS A;  4J5Y A;  3OYD A;  1Q82 U;  3CPW S;  2QQB A;  3M4G A;  1JB0 E;  3KUF A;  5GMK h;  4A4E A;  5J3B A;  4RKU E;  1RL2 A;  4FL6 A;  4M75 B;  2JNG A;  3PGG A;  3L2U A;  3VUZ A;  2LNV A;  2BIV A;  3PMI A;  3JB9 D;  3NFC A;  3HSB A;  2L8D A;  3E1S A;  4QVZ A;  5FU6 C;  5I2S A;  2L5Q A;  3N5B B;  1B34 B;  1KD1 U;  2F5T X;  3L42 A;  1VQL T;  3BFM A;  2XIC A;  5LJ3 g;  5A0D A;  5LJ5 d;  3A8H B;  1NJI C;  1Q86 U;  3E9F A;  5LJ5 j;  2LDM A;  5GMK i;  1W4S A;  2M16 A;  3CCJ A;  2AHJ B;  2ZPH B;  3QPH A;  3JB9 J;  3CCE T;  1QVF S;  5GAN h;  5CKF A;  3QBY A;  1XNI A;  3ZEH A;  3EAE A;  1BIB A;  2DZC A;  2O4X B;  3L2Z A;  3VYH B;  3X28 B;  5GAO l;  2MF2 A;  5C6S A;  2BUD A;  3OYA A;  3RMQ A;  3I55 T;  1VQP T;  2E65 A;  3J80 E;  2XG8 D;  3A5Z B;  3JRZ A;  4BDZ A;  1QW1 A;  2X4X A;  4JRK A;  4M75 G;  2VGN A;  3OYY A;  3MEW A;  4ZGJ B;  5A2Q E;  3QXE B;  5LJ5 e;  1K9M U;  2QTX A;  1RI0 A;  2E5Q A;  3OMG A;  2PUO B;  1G3S A;  4C8Q E;  1QVG A;  4PJO E;  2CZ1 B;  3P8B B;  4M7D A;  2PVD B;  2EQK A;  1UGQ B;  2RJD A;  5LJ5 g;  2XI9 A;  3OYG A;  3CME A;  3ME9 A;  3DB3 A;  5IT9 E;  1S72 T;  4L6V 5;  4M7D D;  1Y96 B;  1FXX A;  4HT9 A;  3QZ5 B;  3C95 A;  3GLX A;  3QYH B;  2ZGW A;  5D6Y A;  2D0Q B;  4HCZ A;  2DD5 A;  4E47 A;  3QG1 A;  5CKH A;  3OYH A;  4OP0 A;  3A8L B;  3RER A;  3S3O A;  1KQS S;  1BI1 A;  4L59 A;  3ASK A;  2L3R A;  4FT2 A;  2E10 A;  4L5G A;  3FC3 A;  4B9W A;  2OAU A;  5IN1 A;  3QZ9 B;  1QVP A;  3A8M B;  3MP1 A;  2VYT A;  4M77 F;  3RKX A;  3RMS A;  4EMG A;  1AHJ B;  1WQW A;  4M75 C;  3OSV A;  5DLO A;  2LQK A;  1VQK T;  3EFR A;  2X4J A;  1VQN A;  4PJO F;  3HL8 A;  4XQ3 A;  4C8Q F;  3CC7 T;  1WGS A;  2DXT A;  4O5V A;  5A0G A;  3FJP A;  2DVE A;  2M9U A;  2WSF E;  1BYM A;  3JAM E;  2CZ0 B;  1VQ6 A;  2E41 A;  2I2L A;  1NJI U;  2EQM A;  4XU0 A;  4DQ2 A;  2K57 A;  2DK3 A;  3HP9 A;  1BI3 A;  3PNW C;  3H6Z A;  2OTL T;  3OA6 A;  3RKY A;  3L2V A;  3UWN A;  4A53 A;  4EDU A;  2QEX T;  5GAN f;  3DLL A;  4RMO A;  3CCM T;  3CCV T;  1PSF A;  4V2S A;  2JOY A;  2VUB A;  4MZP A;  2KQW A;  2DIG A;  3X25 B;  4M7D B;  4PKC C;  2PQW A;  1KD1 C;  2A7Y A;  3SDZ A;  4ELY C;  2K5F A;  3OYM A;  3CC2 A;  3M55 A;  1VQ8 A;  3C94 A;  3P8H A;  3OYE A;  1WPY A;  5KCO A;  1D3B A;  3LGF A;  1KQ1 A;  4KUI A;  4MML A;  5J26 A;  2K4Y A;  3MHX A;  1KQ2 A;  1W2B S;  4MMK A;  3OS0 A;  4QVD A;  4M78 E;  2RI3 A;  3GP8 A;  3P8D A;  4BB7 A;  1VQ5 A;  3OS1 A;  3JCM W;  3BY7 A;  2PU9 B;  3SFM A;  1UGP B;  2IG0 A;  4E7I A;  3JCM P;  3CBP A;  4XTZ A;  4QQD A;  1ZBX A;  4OVA A;  1OZ3 A;  1XOV A;  3QUI A;  2RK2 A;  5FLX E;  2G3R A;  5IAY A;  4IUQ A;  2DJZ A;  4M77 A;  1VQ4 T;  4C92 A;  2X4Y A;  1YBY A;  4N0A A;  1G5V A;  2KSS A;  3JCM b;  5GAO q;  3FEO A;  5CAI A;  3CPF A;  1IZ6 A;  5CQX A;  4PLL A;  3LWI A;  4M7D G;  4OB0 B;  1SSF A;  3HPW A;  3OYJ A;  4PJO A;  4A4K A;  3CCU T;  5LJ3 d;  4C8Q A;  2M1H A;  3INZ A;  3LX7 A;  3FLG A;  2RH2 A;  5KE2 A;  4PJO D;  4C8Q D;  3MP8 A;  3JCM g;  3CC4 A;  2QXF A;  2MAM A;  5CQY A;  2EQJ A;  3VYG A;  3CPW A;  2WSE E;  3CCS T;  4ZTJ A;  1VQ7 A;  4M78 F;  2LCL A;  2YRV A;  1UGR B;  2ZPG B;  3DKM A;  2KMT A;  4C0F A;  2XDD A;  1YI2 A;  1NPP A;  3WXM B;  2CS7 A;  1NZ9 A;  3OB9 A;  2LRQ A;  4J8O A;  4DOV A;  4XTW A;  1VQ8 T;  4J6W A;  1M90 C;  4EPC A;  1FWZ A;  5LJ5 h;  1JJ2 S;  4Q5W A;  1YHQ T;  1VQM T;  3CCL T;  1JRI A;  1D3B B;  5LJ3 e;  4E7L A;  1M1K C;  3GF5 A;  3HRU A;  2QI2 A;  1I5L A;  4BE1 A;  1O75 A;  1G3T A;  1YJW T;  4IUV A;  2YLB A;  3TEE A;  3G71 A;  1KHI A;  4M7D C;  4JUV A;  4B9X A;  1VIF A;  2LT1 A;  3PT9 A;  4E7H A;  1YJ9 T;  1KHC A;  4VUB A;  3CCQ A;  1U1T A;  2KAF A;  4C5I A;  3CME T;  2JVV A;  3OYN A;  2E64 A;  2EYQ A;  5FU7 B;  2ZPE B;  5CO7 A;  2X4W A;  4BI4 A;  2B8A A;  2QDY B;  3ZFJ A;  3CBO A;  2MWP A;  3FIF A;  1OZ2 A;  3OSS C;  2RI5 A;  1Q7Y C;  4BY6 B;  4JS5 A;  1K73 C;  4M7A A;  3CXC S;  3VJP A;  1H3Z A;  1M1G A;  1Y07 A;  3ZBD A;  4EMK A;  3G4S A;  4C8Q B;  3S3N A;  4M77 E;  5LL6 S;  4PJO B;  4C92 E;  5DLQ E;  3HRS A;  2P4T A;  1VQP A;  4XU1 A;  2HBP A;  3SWN A;  5J39 A;  1VQ9 A;  2EKO A;  3VV0 A;  2YHT A;  2GQV A;  3G6E T;  5DY9 A;  3JB9 H;  5GMK m;  2R5M A;  2K5I A;  1VQN T;  3OW2 A;  3QSU A;  5D6W A;  2LVM A;  4XU2 A;  4OB1 B;  3Q1J A;  4FIB A;  1BKB A;  4X9C A;  3OMC A;  4M78 A;  3H8Z A;  3LLR A;  1VQ6 T;  5GAO n;  4M78 D;  4D6W A;  2WSC E;  1M4Z A;  3CMA A;  1YIT A;  3TCJ A;  5GAN 3;  1OI1 A;  1WQ7 A;  3WVE B;  4FT4 A;  3OS2 A;  1UEB A;  3OYL A;  3L2Q A;  4OGE A;  1N27 A;  2DD4 A;  2V8K A;  4M77 G;  3I56 A;  5GAN j;  2GF7 A;  1VQL A;  3CD6 A;  3PIO A;  4JRI A;  2QQA A;  3V8J A;  1FX7 A;  2RA2 A;  1M90 U;  4GLK A;  4PJO G;  4C92 F;  4NL3 A;  2VV5 A;  2Y90 A;  2DXU A;  3DLM A;  4J7I A;  4C8Q G;  1EIF A;  4N4G A;  2QA4 T;  1M8V A;  1M9S A;  5LJ5 f;  1M1K U;  2E1H A;  3CCE A;  3NTK A;  3CBM A;  3RUX A;  2QQR A;  4BD3 A;  1NPR A;  3JB9 I;  3HFO A;  2PUK B;  4II1 A;  3I55 A;  3PTA A;  3FB9 A;  3MEA A;  4FSX A;  1QP3 A;  2JN0 A;  4LDW A;  1YIJ A;  4R55 A;  5GAN e;  1QP2 A;  2R58 A;  2RJE A;  2RJF A;  4RCC A;  4EMK B;  1M5Q 1;  2D9T A;  2M0O A;  5FU7 C;  5CK9 A;  4HKE A;  5DM7 R;  4KUL A;  2EWN A;  5GAN g;  1X6O A;  4HT8 A;  4M7A E;  3SWN B;  3CCR T;  1Q7Y U;  4A54 A;  2FL7 A;  4QVC A;  4UC4 A;  1K8A C;  4ZGD B;  3OYC A;  4FU6 A;  1K73 U;  3V8L A;  2DAQ A;  4N0A C;  1V29 B;  5GAO r;  4ZTF A;  1S72 A;  2E6N A;  4IUU A;  2LQ8 A;  4J7F A;  1N8R C;  2VC8 A;  4PJO C;  3UT1 A;  4C8Q C;  2OTJ A;  2DTH A;  2FVU A;  3QJ6 A;  4M78 B;  5CKB A;  4BUG A;  2NLU A;  4J6Y A;  2XU8 A;  4BE2 A;  3LH0 A;  3V7R A;  3E19 A;  3HFN A;  3LYI A;  3T9N A;  4DOW A;  4F7U E;  3QHS A;  2DTO A;  3JCM d;  5GAM d;  2HNI A;  2MMP A;  5C0M A;  5GAM j;  4E7K A;  2DTI A;  5EG2 A;  2RO0 A;  1R8O B;  3M59 A;  4JS4 A;  3VUB A;  4LD6 A;  2LTO A;  4YTL A;  3TRE A;  1WJS A;  3L2W A;  4JDS A;  2DXB A;  3JB9 F;  1G3Y A;  1VUB A;  5GAN 6;  1VQK A;  4OB2 B;  1VQO A;  5I2M A;  2C06 A;  1JBM A;  1UB4 A;  3NTI A;  4KT0 E;  5LJ3 h;  5FRO A;  4M7A F;  1BI0 A;  1MGQ A;  3G7Z A;  3CC7 A;  2HAX A;  3GIB A;  3GNG A;  3QDR B;  1OYX A;  2JZ2 A;  3M57 A;  2XK0 A;  2XD0 A;  2RHU A;  1O9S A;  2BKD N;  2L89 A;  2R5A A;  2ZZD A;  2RD1 A;  3LW5 E;  4M77 D;  5CIU A;  3JCM c;  4C92 D;  2FHD A;  5GAM e;  5HK3 A;  3JCM e;  3UPU A;  1YJN A;  2H3J A;  1GXI E;  3UDC A;  1U1S A;  3C4S A;  2RK1 A;  4M78 G;  2KY9 A;  4IUT A;  4MZT A;  4F7U F;  5GAM g;  2OTL A;  2EIF A;  4ZN3 A;  2QEX A;  3CCM A;  3M9Q A;  3BDU A;  5HKC A;  3CCV A;  1LJO A;  3CCJ T;  3QYG B;  4KBM B;  1N9S A;  3OBW A;  4BDY A;  3X26 B;  1X01 A;  2VXF A;  2EFI A;  5GAN 5;  2O4X A;  3WVD B;  4LDV A;  3X20 B;  4ME7 A;  2WAC A;  2ZPF B;  1VIE A;  4EMK C;  4XK8 E;  4DA4 A;  4LDU A;  3QO3 A;  3ER0 A;  4EMH A;  3J7A F;  1X75 C;  1K8A U;  4N4I A;  4WF2 A;  2PVO B;  4JJN K;  4MDW A;  3SWN C;  4IKF A;  3A8G B;  2R57 A;  3M58 A;  2K3Y A;  1M1F A;  1N8R U;  1UGS B;  2K5L A;  4PNO A;  3VKI A;  1QVF A;  2RHZ A;  2V8I A;  5GAN 2;  3L2R A;  4HCB A;  4C0D B;  4C0Z A;  2EAY A;  2XKO C;  4TVR A;  4M78 C;  3BW1 A;  4Y28 E;  4C0G A;  4N4H A;  1Y96 A;  5CCA A;  4X9D A;  1TH7 A;  1H64 1;  2FYK A;  2HQX A;  2RI2 A;  3OYB A;  3CXC A;  2JTF A;  3EFS A;  2LC4 A;  4IUR A;  4BI3 A;  4C5H A;  5GMK l;  1VQ4 A;  2K3X A;  5GAN 7;  4M77 B;  5FRM A;  4C92 B;  1ZQ1 A;  3CMA T;  5A0L A;  1YIT T;  3CCU A;  2LCC A;  2MI6 A;  4M75 E;  1LOJ A;  4BAC A;  4A4H A;  5GMK j;  4M7A D;  3I56 T;  5HY6 A;  2IVW A;  2P0P A;  4X34 A;  4C5E A;  1KG1 A;  1KC8 U;  3CCS A;  1G3W A;  2GFA A;  5LJ3 f;  3M54 A;  4ZN1 A;  2RM4 A;  4O6J A;  2RHX A;  4F7U A;  3V7C A;  3JCM J;  5GAN 4;  2GFU A;  2ZPB B;  2HD0 A;  2ZPI B;  2EJ9 A;  2RHI A;  3DB4 A;  4IUP A;  4HCC A;  1KQS A;  3MEV A;  2RB6 A;  4XTY A;  2EJF A;  1YHQ A;  3RES A;  3M56 A;  3QII A;  4NOY A;  1VQM A;  3CCL A;  3PMT A;  3OS5 A;  5GMK e;  2DEQ A;  2MWO A;  1YIJ T;  1WNL A;  5GAN d;  3KXT A;  4JRP A;  3NTH A;  4PLI A;  5D6X A;  4CRI A;  3RKW A;  1YJW A;  2X35 A;  1U8R A;  4C92 G;  2CGH A;  4HA8 A;  2V8J A;  3MCA B;  4M75 F;  3SB2 A;  2LT4 A;  3QJY A;  1IRE B;  3M5A A;  2F5K A;  2GCX A;  1YJ9 A;  2Y4X A;  1I81 A;  2P0Q A;  3LGL A;  2JTM A;  4RCB A;  2XDP A;  2DPP B;  4MZM A;  5GAO m;  4XTX A;  4LD9 K;  3S3M A;  1QVG S;  3CC2 T;  1BI2 A;  1Y7X A;  2JUF A;  5KE3 A;  2DXC A;  3CEY A;  3KBG A;  2E12 A;  2OTJ T;  2KK4 A;  3OW2 S;  3F70 A;  3MET A;  4QQ6 A;  5I21 A;  2D6F A;  2XID A;  1BIA A;  4M7A B;  3OBY A;  3FDR A;  4JLG A;  3BDL A;  3MEU A;  3O8V A;  4NL2 A;  4PL6 A;  4C0D C;  3TU4 K;  4P5N A;  1VQ5 T;  2QQS A;  3OY9 A;  4Z02 A;  1P92 A;  2LX9 A;  3HHT B;  5L8R E;  4XU3 A;  3SD4 A;  1MHN A;  3G6E A;  4BE0 A;  2P0K A;  5CKE A;  1VQO T;  3OQ5 A;  4M77 C;  5GAM h;  2FB7 A;  4XTV A;  3JCM h;  4BY6 C;  2XHC A;  1I4K 1;  4C92 C;  2ZCF B;  4F7U B;  5CVI A;  1LNX A;  4J6X A;  2CKK A;  3OYF A;  2O01 E;  1XTD A;  3A8O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...