5GAN3

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
77
structure length
77
Chain Sequence
TPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 10
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan300
4EMHA 2DEQA 4J6WA 4PJOG 2DXTA 1D3BA 3GIBA 4M78B 1B34A 2E64A 4XU1A 4NL2A 5LJ3d 5GMKm 4F7UF 3L2ZA 2JN0A 4XTUA 5GAN4 2EWNA 3BFMA 3FIFA 3SWNA 3VU3C 4C8QA 4F7UG 1WQ7A 4M7DA 4Y91A 2YLCA 5GAOp 4M77E 2VC8A 2K57A 3FJPA 1U1SA 4XQ3A 3RIRA 2CGHA 4C92F 4M77C 4N0AC 2YLBA 4MMKA 1JBMA 4HA8A 4PJOD 3BW1A 3BY7A 4JUVA 1WPYA 3RKWA 4EMKC 4M77B 4XU0A 4M75B 2RA2A 4C92A 2EJGA 5GAMg 5GAN7 3FB9A 4WF2A 2DXUA 2ZGWA 4J5YA 3RKYA 3RUXA 3V7SA 3V8LA 4EMKB 1Y96A 4XTZA 1MGQA 3JCMf 5GMKj 4C8QE 2E10A 5GANf 5GAOr 1X01A 2RD1A 3JCMb 4M7DE 4PJOC 4XTYA 1I81A 5GAMj 3L1AA 5GMKe 2EAYA 5GAN5 3JB9F 1HXDA 4PJOA 3QSUA 1D3BB 3SWNC 2Y90A 1B34B 5DY9A 4C8QC 5GAMe 1BIBA 3JB9G 4M7DC 4X9CA 2EJFA 5GANj 4M7AG 5GAN8 4C92D 3QUIA 3HFNA 3SWNB 4HT8A 3HFOA 4C8QB 4EMGA 5GANe 4JRIA 4F7UA 4M7DB 5GAMh 5GAN2 3PGGA 2DVEA 3M4GA 2DZCA 2DTHA 4NOYA 4C92E 3QO3A 4M78G 5LJ5f 4MMLA 5LJ5g 3JB9H 4JLIA 5GAMd 4V2SA 2RB6A 2DKGA 1M8VA 2FYKA 2RM4A 4C92C 3V7RA 4PNOA 3RERA 1H641 5GANd 1LOJA 4X9DA 3SB2A 5LJ5j 1KQ2A 4PJOE 3JB9D 2EJ9A 4C92B 1WNLA 4XU3A 3JCMJ 4M7AD 4XTWA 3RKXA 3JCMg 5LJ5e 3HSBA 5GANg 3RESA 5LJ3f 1BIAA 1Y96B 3JCMQ 3EFRA 4QVCA 4F7UE 5GAN6 5GAOl 4M77F 4A54A 4M75F 4M7AF 1JRIA 3JB9J 4PJOB 4M78D 3QHSA 2VXFA 4M77G 4OP0A 4J6XA 4M75G 2QTXA 3JB9I 5GMKh 1LJOA 3JCMP 2FB7A 1I4K1 3JCMe 5GAOn 5LJ5d 4M7AA 1LNXA 4M78F 2DTIA 4F7UB 3JCMX 2YHTA 4J6YA 3AHUA 3JCMh 2HNIA 5GANh 5GAN3 1N9SA 3V8JA 2E65A 4M78A 2DJZA 2E1HA 4C8QF 3JCMd 1YCYA 2DTOA 3V7CA 5I21A 5GAOm 1U1TA 4M7DF 1M5Q1 2VXEA 4C8QG 1TH7A 4M7DG 4M77D 4M75D 2DZ9A 1KQ1A 5LJ3g 3JCMW 1HK9A 3JCMV 4M75E 4M7AE 5GAOq 3EFSA 5LJ5h 4DQ2A 5GMKl 5LJ3j 5CAIA 4JRKA 4M75C 4M7AC 4RCCA 4M77A 4N0AA 4RCBA 2I2LA 4M75A 3INZA 4M78E 4XTXA 4C92G 5LJ3e 4XTVA 3JCMc 3BDUA 1I5LA 4HT9A 2E41A 1WQWA 4M7AB 4QVDA 4A53A 1N9RA 4C8QD 4XU2A 3V8KA 4EMKA 5GAMf 5GMKi 4NL3A 4PJOF 4M7DD 4M78C 1I8FA 5LJ3h
chains in the Genus database with same CATH superfamily
3CCUQ 1NPRA 3H41A 1U06A 2KQWA 2CP0A 2XMFA 3UWNA 5GMKm 2VV5A 2JN0A 4RKUE 2FHDA 2RF0A 2DYBA 3GF5A 3G71A 2CKKA 3EH1A 3CPWA 2OI3A 4OMNA 1KG1A 4QW2A 4LDVA 4M77C 3CC7Q 2O31A 4LDXA 3BW1A 1DJ7B 2D6FA 3R6OA 4C5GA 5GAN7 1V1CA 3TSZA 2KSSA 1VQ5A 2YUNA 3VS4A 3VRZA 4WTOB 3ER0A 1B34B 2LC4A 4ZGEB 2COWA 4B9XA 3ASKA 1X6OA 2QXFA 4EMGA 2RNAA 2DRKA 5CKHA 2DVEA 3OS5A 1RAHB 2EQIA 2HCKA 3DLLA 4MDWA 5GAMd 2RB6A 1MMDA 1K9MU 1WNLA 4BUGA 4XTWA 1A0NB 5HCKA 3M56A 1BIAA 5CO7A 3OYJA 5A0GA 4J9EA 1KHIA 4OGCA 1IZ6A 2BIVA 1UJ0A 1G3YA 2QTXA 2M1HA 3HHTB 1KC8C 2DXCA 3CMAA 3L42A 3M58A 2E5QA 2LVMA 2E5KA 5ECAA 4AFQC 4L5GA 1GCQA 4Y28E 2XHCA 4C8QG 5EG2A 1BI0A 5CKFA 1Y07A 4IIMA 5GMKl 2QA4T 4C0GA 1V76A 1YI2T 4M78E 2OAWA 2JNGA 4DBHA 2EGEA 2H3JA 2JUFA 2EKOA 2NWMA 3I55A 4PL6A 1MV3A 4EMHA 3OSSC 2WACA 2DEUA 4XU1A 1AOJA 4F7UF 3L2ZA 2P4RA 5KYUB 5KYYB 3KBGA 3VU3C 1IGQA 1NG2A 1WHHA 2QQBA 4BI3A 4ZGDB 2HEQA 2NUTB 3EGUA 1YIJT 1VQLA 2YRVA 3HKSA 4B9WA 3O8VA 3SEMA 4A4EA 1GXIE 2DA9A 3JCMf 2CP6A 2XIDA 1JEGA 4JLGA 2MK5A 1D3BB 2RI3A 1OX8A 3RMSA 3CBMA 2JTFA 4JDSA 3MPUB 4C5EA 1YJ9Q 5J39A 5FW9A 4F04B 1UGQB 2ECZA 1H3HA 2IIMA 2DKGA 1VQ4Q 2K4YA 1I5OB 2ATCB 1NZ9A 1LOJA 3EHQA 1YJWT 4PJOE 3CXCS 5EC7A 4C92B 2V26A 3A8GB 4M7AD 1VOMA 1PKSA 4ZN3A 3C95A 4D8KA 3PVLA 1VQ7A 1MMNA 3JCMe 2HAXA 5I22A 4M78F 5D6YA 2CUBA 2KGTA 2OTLQ 2EKHA 4OVAA 2HBPA 3V8JA 2XDDA 5CR2A 2OTJQ 1H92A 4BI4A 1K0SA 1TH7A 1BB9A 2DZ9A 1UGVA 3QIIA 3CXCP 1M1KR 4N4IA 1N8RR 4J7FA 1AD5A 2A3LA 1QWFA 2RQWA 2HMAA 3CCUT 1YN8A 3EG3A 2H8HA 5A0DA 4RCCA 1YWPA 1RADB 3OYGA 4QVDA 4A53A 1QKWA 4AFSC 2ROLA 1W70A 1KD1R 1Q86C 2X4WA 2FZGB 2QDLA 3GLXA 2V1QA 2DAQA 5KYWB 1S72Q 3CD6A 5LJ3d 2RH2A 1ZUYA 4DA4A 3UATA 2LRQA 2VGMA 1VQPT 1VQ6T 1CKBA 2YWWA 1KK7A 3FRNA 4XQ3A 2M02A 2CGHA 2GQVA 4N0AC 1QP2A 1U8RA 1VUBA 2D0QB 4BACA 1ZSZB 3FB9A 2MOXA 3V8LA 2O9SA 5GAMj 3X25B 5GAN5 3G4SA 5FWBA 3G6EQ 1JXMA 1D0YA 3JB9G 1M1KU 3FEOA 2CZ7B 5A2QE 3I56Q 4C92D 1N8RU 4J9HA 3CCQA 2P4TA 2K5FA 1RAFB 4M78G 3OYHA 1ABOA 1VA7A 1UE9A 3CCVA 1KD1U 5AT1B 1M3BA 2C0OA 1XTDA 4BB7A 2GTJA 3EH2A 2CH4W 1WLPB 4M75G 3JB9I 3M53A 2EYQA 4KRTA 5LJ5d 4HCCA 1QW1A 1PM3A 3JCMh 2QEXQ 2EYYA 4ELZC 1WXTA 2E70A 2LP5A 2H3EB 3LWHA 1W2BA 1IGUA 4JPBW 3VS6A 4IUQA 1R0CB 4BI8B 1UEBA 3J81E 2P0QA 3CMAT 2O01E 4FYVB 2EFIA 4XAXB 2QQAA 4JRKA 2JW4A 1VQMA 2YUPA 2I2LA 4F16A 4XTVA 3U23A 1M8VA 4XU2A 2J7IA 2FZCB 2PU9B 4PJOG 4CC4B 3CC4A 4JJCA 1IXDA 2ENMA 4C0DB 1WQ7A 1K73C 2LQ8A 4LDYA 1OPLA 2V1RA 1SRLA 4OMOA 4DOVA 3I55T 3H6ZA 1NJIR 4E7JA 4MMKA 3QBYA 2ZPIB 3MEAA 3QWXX 4PFPA 3RKWA 1C1AA 1Q82C 1KQSA 2E12A 3CCEQ 2L3PA 2L89A 3CEYA 4M7DE 1HSQA 4XTYA 1K4US 2PVOB 4PKCC 4FYYB 2EPDA 1PKTA 2GFAA 3DB4A 3H9NA 1NPPA 3QG1A 1VQLT 1WHLA 2F2VA 2KR3A 4QVZA 2C06A 4FW1A 2BE7D 5DM7R 5LJ5f 2CS7A 2HL3A 4C92C 2JJ9A 1ZQ1A 4OB1B 1MV0B 3UF4A 1LCKA 3A8HB 5D6WA 4DOWA 4ELYC 1K8AC 4X1VA 1JO8A 3JAME 2K2VA 2XDPA 1UTIA 1JRIA 1WXBA 2HZYA 4AG2C 1FXXA 3SDZA 1M27C 4M7AA 2FZKB 2DTIA 1NJIU 3L2RA 2YHTA 1YITA 2SEMA 5GAN3 3I9QA 3PIOA 5CIUA 2ED1A 4ME7A 5I21A 1MHNA 1UHFA 4R55A 3CC2Q 2PVGB 4LD9K 5J3BA 3EFSA 2M9UA 2J06A 1RLPC 2D8HA 5LJ3j 2BUDA 3GPLA 3PVQA 4HVWA 4E7ZA 3VS1A 2LT1A 4LUEA 2RJDA 4CC2A 1T0JA 2D8JA 4PJMA 2HQXA 2LZ6B 3M9QA 4PJLA 2AZVA 4XTUA 1JB0E 1ZX6A 3PFSA 1ZBXA 4M77E 2PUOB 4ATOA 1G5VA 1K0XA 1Y7XA 4GLKA 4E7LA 1NM7A 2YLBA 3X24B 1ZSZC 1H8KA 5DLQE 3CD6T 2DD5A 5CKDA 1VQ8Q 3OYCA 1OQKA 5IAYA 2DXUA 5IHKA 3CBPA 2E4HA 5L8RE 3CCMA 3L1AA 1Y71A 5I2MA 3CMEQ 1YJNQ 4JS5A 1PWTA 2LX9A 1SRMA 2XKOC 2IG0A 4BD3A 3JB9H 5CK9A 2VKNA 1VYUA 3NTKA 4NS5A 1HD3A 5LJ5j 3JCMJ 2DBMA 2DRMA 5M9OA 3CCQT 1YJWA 2A08A 2MI6A 3OYKA 2FB7A 2EGAA 2XK0A 2K5IA 3EHRA 2W0ZA 2F5KA 2KRNA 2G6FX 2YUQA 2FG0A 2HKNA 2DYIA 2IPOB 1U1TA 2EW3A 3QZ5B 1Q7YR 8ATCB 2YXYA 4M7DG 3MEWA 4J8OA 1ZBJA 3TSWA 4JZ4A 2L3SA 1VQNA 2KBTA 4A4HA 2L0AA 5LJ5h 2EBPA 1G83A 2E6NA 2KNBB 3EG2A 1RAIB 4PLLA 4XTXA 1I5LA 1WQWA 4NL3A 4C8QD 4EMKA 1R77A 1GCQC 3CCUA 2DEQA 4C0DC 1TTHB 2L8DA 4E47A 1YP5A 1D1CA 1VQMT 3A1PA 2KROA 4B6MA 1U1SA 2LQNA 3CC7A 2RN8A 1M1GA 3EGDA 4CRIA 3OS1A 1PSEA 2EYZA 5CCAA 3OW2A 1Y96A 4XTZA 5GAOr 2LJ1A 2RD1A 1TUCA 1Q7YU 1SPKA 3BE3A 2R58A 3LLRA 3TCJA 3CCJQ 4FSSA 2J6OA 2DX1A 3RBBB 1X69A 2EQJA 2GQIA 2KRMA 4C5IA 4V2SA 5CKBA 2FYKA 3PNWC 2V8IA 2DIQA 1J3TA 2DFUA 4OB2B 2LQKA 4F7UE 3VYGA 5GAN6 4J7IA 4M77G 1G2BA 1TSFA 1GFCA 1I4K1 5GAOn 1IHVA 4AFUC 2J6FA 1LNXA 1QVGS 1M90R 1QVPA 3LX7A 3R6NA 1YHQT 4FW2A 3G7ZA 5KE3A 4Z89A 2LNHB 4E7HA 5KH6A 3UA7A 1MUZA 3JCMd 3C94A 1VYTA 2DF6A 4HVVA 3HL8A 1O75A 1VIFA 4QQGA 2NYSA 1O9SA 2Y4XA 1AT1B 1YITT 1PRLC 3CPWS 1M2OA 2VYTA 1FMKA 4E7SA 1WFWA 1WHGA 4M7AB 2RHZA 5GMKi 2EVRA 2D9TA 2JS2A 1QVGP 3GIBA 1VQKQ 4YTLA 2QQ9A 2XU8A 2KI7A 4PFZA 2CH4A 1WHJA 3BFMA 1NEBA 3SWNA 1OX9A 3OYLA 2L2PA 3CQTA 2ZPEB 4E7KA 1UB4A 4PJJA 3VKIA 1M90U 3CPWP 2ZPHB 1WXUA 1G3TA 3CMET 3M54A 4WF2A 1VQOT 4FT4A 1MGQA 2F2XA 3CCLQ 2HSEB 5LL6S 1I0CA 1Z9QA 2JMAA 2RJCA 2CSIA 3OBYA 2KVQG 4P5NA 3OA6A 1RL2A 2DTHA 5C6SA 2RHXA 1M9SA 1M1KC 2M0YA 2X35A 4MMLA 4II1A 3REAB 1N8RC 1BYMA 3CCMT 4PNOA 2SRCA 3VRYA 4X9DA 1RABB 4J9IA 3JB9D 3MEVA 2EJ9A 1WDXA 3ZFJA 5A0LA 4RTVA 8AT1B 4IIOA 3RESA 4LDWA 1KD1C 2P0PA 2RHIA 3CCRT 4M78D 5GJVB 1PRMC 1WYXA 5CKEA 1PHTA 1CSKA 1UG1A 2DETA 2DL4A 1BI2A 2E6ZA 2OTLA 2E3IA 2C0IA 3G1JA 1IRXA 2NUPA 3UT1A 1WGSA 4M75D 4C0ZA 1GFDA 1RUWA 3O5ZA 3MCAB 7AT1B 1EFNA 2JM8A 3INZA 4F17A 3V8KA 2QTVA 1K76A 1I8FA 1VQNT 3OY9A 1S72A 4KUIA 2E64A 4N4HA 4RTZA 5GAN4 2DLPA 3OB9A 4F7UG 4C8QA 4MDXA 2WSEE 5GAOp 2HSPA 3CBOA 2MMPA 1K1ZA 2RQTA 1WJRA 1JBMA 4PLIA 4PJOD 3FJ5A 2QASA 3JRZA 4JRQA 4FIBA 2ROTA 2BZYA 2FPDA 4EMKB 3V7SA 4R56A 1WHKA 2EAYA 2K6DA 2KYMA 3QDRB 4IUVA 3UA6A 4D6WA 3G6EA 1OOTA 5CVIA 3CC7T 3QKJA 1UGPB 1VQ7Q 2PVDB 3I5RA 3EG1A 4ZTJA 4C92E 2YUOA 3QO3A 1YFNA 3MKDA 3HTRA 3MHXA 2IVWA 4IURA 3EGDB 3SB2A 2Y4YA 1FWZA 4IUUA 4IKFA 2AT1B 3RKXA 4JJDA 1Y96B 2QGFB 3D7SB 2ZAEA 3J80E 4KH1B 4DBFA 5KYXA 2RHUA 2ESWA 5L23A 3P8BB 2QEXA 2HNIA 2J6KA 2A28A 2E1HA 3VV0A 5C0MA 3META 3MO8A 3C12A 2FVUA 1VYVA 2HQEA 4KGXB 1BCOA 2RQVA 2WSFE 4M75C 4M7AC 3VYHB 2CT3A 3S6WA 5FU7B 2A7YA 1VQKT 4DBRA 4MZPA 2MAMA 3RMQA 4Q5WA 2KY9A 5HY6A 2A0FB 1PC0A 1MNEA 2EYXA 2K3XA 1KSWA 4CI0C 1SHGA 2DBKA 4AT1B 4A63B 4EPCA 2HDAA 1XOVA 3A8OB 4C92F 3E9GA 2LX7A 4KULA 3CCVQ 3VS0A 2ED0A 4WCIA 4FM4B 2DD4A 2ZPBB 1ZA2B 2LCSA 4PJOC 1M3CA 4HCKA 5GMKe 4ZNXA 1U3OA 2JTEA 1X75C 3HFNA 1X6GA 2K2MA 3SWNB 5GANe 1Y57A 3LH0A 1EZZB 1SG5A 4KGZB 1QQJA 2KXDA 3M59A 4E2FB 1H641 2XD0A 1YWOA 1W2BS 1RI9A 4RMOA 1FYNA 2X4XA 1YJ9T 1AZGB 4QVCA 3FC3A 3LH5A 2KT8A 2VXFA 1HJDA 3JCMP 1D1BA 1VQ4T 1LJOA 1BU1A 2GF7A 4VUBA 4EDUA 3EG9A 5HK3A 1OYXA 2LMJA 4M78A 2Z0WA 1YHQA 3E19A 3OQ5A 2X3WD 3X26B 1XQHA 2CUDA 4BY6C 1KHCA 3WVDB 2OTLT 1TOVA 5IN1A 1GRIA 1C0MA 1Q81C 2OTJT 4J9DA 4C92G 4M75A 2DMOA 4OF1A 4J9GA 3JCMc 1U5SA 3L2UA 1KQSS 4M7DD 4M4ZA 3N5BB 5CQYA 4JS4A 1JJ2A 2O4XA 1M1FA 3QXEB 2DXTA 3S3OA 1HYOA 2RI2A 2NUPB 2K7AA 4OGEA 1OU9A 2BZXA 1BI1A 1Y0MA 3A98A 3OYYA 1QCNA 2NLUA 5IXBA 3TVTA 1Z9ZA 1B7TA 3OYDA 3NPFA 1AEYA 1ZLMA 4TVRA 1S72T 4JUVA 4EMKC 2YRCA 4XU0A 4OMMA 1KQSP 1BI3A 1E7OA 1X01A 4ZGJB 2RHYA 4PJOA 3CMEA 3HRUA 1QVFA 1YJNA 1VQOA 4RG2A 3QUIA 2AIRB 2QK0A 1NYGA 3NTHA 1OU8A 5FWCA 4C8QB 1SHFA 2ZPFB 1Q7YC 1RAEB 5GAN2 1NLOC 4OMLA 4FYXB 1OULA 3VUBA 1TU0B 2BZ8A 2DERA 4X34A 3VS2A 1P92A 3G6ET 2RO0A 3H0HA 1IB8A 5FU6B 2COYA 3I56T 3ZEHA 3L2WA 1SSHA 1ABQA 2X4JA 1ZUUA 1OV3A 3RNJA 4A4GA 2O88A 1M4ZA 1VQ9Q 3CCRA 4IUPA 2JZ2A 2J05A 3C4SA 2QA4Q 3PT9A 1YI2Q 2QQSA 1XNIA 1MNDA 4FSXA 2F1LA 4M77D 1YNZA 2O2OA 1TG0A 1QMCA 4PFOA 3NMZC 3JCMW 1K9MC 2VUBA 3Q1JA 3OBWA 2QEXT 1PNJA 4LDUA 3VS7A 5FU7C 5KYXB 2EGCA 3HRTA 1SKUB 3M0QA 2MWPA 2PTKA 4QKUA 1TS9A 4BE1A 1YCSB 1RAAB 3MEUA 1BCMA 1G3WA 3VS5A 2EYWA 3FLGA 4RTWA 3OYFA 3OMCA 2JT4A 4J6WA 2QAZA 2E3HA 1YIJQ 4XK8E 3NGPA 3AT1B 1G8XA 2KE9A 4O5VA 2ABLA 2BTTA 2HBWA 1IREB 3FJPA 3RIRA 5D7UA 3QYHB 1QLYA 4BDYA 1PG5B 3MP1A 4FT2A 5IHIA 2CP2A 2PUKB 1Q95G 2KAFA 1QCOA 4IUTA 2RA2A 2EJGA 5GAMg 2B86A 4HVUA 3RKYA 1M90C 6AT1B 1XJWB 3CCSQ 3CCJA 1AZEA 3SWNC 5DY9A 4X9CA 2LT4A 2DIGA 3PGGA 1WA7A 3CCET 1JXOA 3QJ6A 1LVKA 3J7AF 1AWJA 5CQXA 2RMOA 1AWOA 3HSBA 2O9VA 3PE0A 2M16A 3EFRA 3JB9J 2XG8D 3A8MB 4OP0A 3H8ZA 1X27A 3OYEA 3QWYA 4PJNA 2YDLA 2DO3A 1AVZC 3QYGB 1D09B 5FROA 2FRWA 2DJZA 4C8QF 1UUEA 1ACMB 5DLOA 4CC3A 3A5ZB 3OYMA 4OMFB 3T9NA 1HK9A 2F69A 2M0OA 2RK1A 3TEEA 2CSQA 1VQPQ 4RTUA 1VQ6Q 2FRYA 2MPXC 3UPUA 4HT9A 1N9RA 1C6VX 3CC2T 3EG9B 2CZ6B 4LNPA 2CT4A 3OW2S 5IHNA 4E6RA 3L2QA 1W6XA 4M78B 2ZZDA 1VQKA 2LNVA 3HP9A 4Z88A 1H3ZA 2JVVA 3LGLA 4M7DA 1WX6A 1W4SA 2CYZB 3G71Q 2MF2A 4KH0B 1AWWA 4ZTFA 1QKXA 2DL3A 1R0BG 2YT6A 3NFCA 2CZ1B 3OYAA 4M75B 1D0XA 4LE9A 3RUXA 3ZL7C 3CCLA 2E10A 2O4XB 3F70A 1VQ5Q 1ZSGA 1CKAA 4C5HA 3OW2P 2JS0A 3QSUA 2DPPB 2Y90A 2RQUA 1K9AA 4C8QC 2XDBA 1WIEA 3RR6A 3M0SA 1BBZA 1GL5A 3GOXA 1E6HA 1N6AA 1VQ8T 2PZ1A 2DZCA 3E2UA 1NBEB 2QI2A 2W10A 4LUDA 1B07A 1M30A 5FU6C 1NEGA 2C0TA 2RPNA 4JJBA 2AKLA 2V8JA 1YJNT 4XU3A 1AWXA 1QP3A 5GANg 2DL7A 3KUFA 5AYFA 1VQ9T 4A54A 4PJOB 3ZBDA 3C0CA 3EGXA 2OJ2A 5I11A 1YJ9A 3BDLA 3CMAQ 1NYFA 2MCNA 1VQ4A 1JU5C 3EG0A 4L59A 4L6V5 3V7CA 3CXCA 5IH2A 3VJPA 1ZA1B 4RG8A 2D1XA 5LJ3g 2KT1A 1SEMA 3M4YA 3OSVA 4M75E 4M7AE 3GP8A 2FPFA 4M77A 2P84A 2B8AA 5GAMf 3I55Q 2RQRA 2KK4A 2OTJA 1KC8R 4FYWB 1ZHIA 3M0PA 4NL2A 1WZOA 2EWNA 3JSCA 1UECA 2VGNA 2JXBA 2MWOA 4FCYA 2HQHA 4BY6B 3A8LB 3LWIA 4J9BA 1VQLQ 3CCST 1IHWA 5KE2A 4ORZA 3ULRB 2YSQA 4F14A 2LCLA 1W1FA 4HCBA 1E6GA 1BK2A 3JB9F 5GAMe 1BIBA 2KEAA 1M2VA 2PQWA 1WJSA 4ZN1A 2DJQA 2RI5A 4Z02A 1WI7A 4FU6A 3WXMB 1FX7A 1OPKA 4QT7A 3OYBA 5LJ5g 1PSFA 4OB0B 3CCJT 5GANd 1S1NA 1FMWA 1M3AA 3LW5E 1KC8U 4DBQA 4BE0A 4JRPA 1OZ2A 4M75F 4M7AF 2L5QA 3I56A 1D0ZA 3M0TA 3EFOA 4AG1C 3DB3A 2JTMA 1UGRB 2V8KA 4J6YA 2VASA 4DEXA 2JM9A 3QDFA 3OMGA 2AKKA 2A36A 2R5AA 5FLXE 1EX4A 2K3YA 1M5Q1 2VXEA 5J26A 3PMTA 1UGSB 5IXFA 3E1SA 2RJFA 1I07A 3JCMV 2VVKA 2FEIA 2BE9B 1LPLA 4DEYA 2DILA 3IQLA 4J9FA 4KBMB 5FRNA 1MMAA 3E9FA 4A4KA 4RCBA 4LN2A 2GCXA 1EIFA 2CP7A 2DK3A 2QG9B 4MZMA 4C0FA 4PJOF 4M78C 2KXCA 4OMPA 2K9GA 4D8DA 4BE2A 2XICA 2K79A 3G71T 3REBB 3CD6Q 4JZ3A 4MZTA 1NJIC 3P8DA 5KCHA 2PNIA 2KDSA 5KYNA 2M51A 4RTYA 3FIFA 3QZ9B 2YLCA 2P0KA 2GNCA 5D6XA 3TQ7P 1TUGB 4UC4A 4KT0E 1R8OB 1N5ZA 1VQ5T 1WPYA 2BKDN 3I35A 4AFZC 4RTTA 4AMCA 2K3BA 2GBQA 5HK0A 2DVJA 2FL7A 4J5YA 4HKEA 2RJEA 3FDRA 2QYZA 5GANf 4Z8AA 3JCMb 2EQKA 1HXDA 3G4SQ 1RAGB 4Y92A 3LYIA 2X9HA 4GBQA 1YBYA 4M7AG 1Q86R 3S3MA 1RLQC 3HFOA 3L2VA 4M7DB 4JRIA 1B3QA 4F7UA 5GAMh 3CCQQ 2LTOA 5I2SA 4NOYA 2LJ0A 2LQWA 3CCLT 2DL5A 1VIEA 2AHJB 2K5LA 3CCEA 1D1AA 4LXCA 5FRMA 3THKA 4RTXA 1IO6A 2ZPGB 1NE8A 5LJ3f 3JCMQ 2HL5C 1KJWA 2G3RA 3OYIA 4O6JA 2CREA 3QHSA 3GNFB 4OB3B 4ANJA 2I0NA 2GTOA 1OI1A 4HCZA 3JCMX 2OAUA 3MP6A 1N9SA 3PMIA 2E65A 1PD0A 5GAOm 1V29B 3OYNA 1F1BB 2GFUA 3M0RA 5HKCA 2JMCA 3HPWA 1SF9A 2ZCFB 1KQ1A 3GNGA 1QWEA 1SSFA 1Q86U 1UHCA 5CAIA 3GBQA 3EGXB 4N0AA 5LJ3e 2COZA 1VQMQ 1WJQA 1G3SA 2EQMA 4OMQA 3DKMA 3PTAA 1TWBA 2R57A 2F2WA 3CC4Q 1B34A 3URGA 3CC2A 1X43A 3X28B 1W2BP 3SHWA 4Y91A 1OZ3A 1UJYA 2QGGA 2AK5A 2MYSA 4GLMA 4J83A 4QQDA 2CP3A 4HA8A 1UDLA 3JV3A 2R5MA 1GCPA 2RK2A 4M77B 4K11A 1PCXA 2ZGWA 4R0KA 4KUDK 5GMKj 3OS0A 1I81A 2X51A 1MMGA 2EJFA 3ME9A 5GANj 2GGRA 3X20B 2YRDA 2AZSA 3M4GA 1M8MA 1X2QA 2LDMA 3RDVA 1UFFA 5GJWB 3V7RA 1VQ8A 1GBQA 1K73R 1KQ2A 1YHQQ 1RI0A 1X2KA 1VQ7T 2HKQB 4PK4A 5LJ5e 2WSCE 3WVEB 3TU4K 5GAOl 1Q82R 5GMKh 1RACB 2QQRA 1M2VB 2KYBA 2VWFA 1WHMA 1VQ9A 3AHUA 3MJXA 9ATCB 1YITQ 1ZUKA 5GANh 2QA4A 1ARKA 1OEBA 4RUGA 1YI2A 3P8HA 1JJ2S 3PIPA 1NLPC 1YCYA 4M7DF 5KYUA 5KYYA 3LGFA 2FPEA 2A37A 3VS3A 2KMTA 3H0FA 3M55A 5GAOq 2NUTA 2L3RA 3I5SA 3UDCA 1GBRA 1K8AR 3BDUA 1PD1A 3EFOB 1AHJB 3SD4A 4JJNK 5LJ3h 3DLMA 3EAEA 3KXTA 2NUZA 1YIJA 1K73U 2CP5A 1Q81R 1D3BA 5IT9E 5KCOA 2KRSA 1JJ2P 1N27A 4BDZA 4EIKA 1QVFS 1QCFA 1VQOQ 1X6BA 4HXJA 1TXQA 2VC8A 1Q82U 2K57A 1I1JA 3KFVA 3M0UA 3BY7A 3S3NA 1KIKA 3MP8A 3G4ST 4C92A 4J9CA 4FL6A 4C8QE 2DNUA 3CCMQ 3CCSA 2OX7A 2DE0X 3QJYA 4A4FA 4M7DC 3SFMA 2XI9A 2X3XD 5GAN8 2CZ0B 1TUDA 2CDTA 3CCVT 1KFZA 4ESRA 4HT8A 1QVFP 2DXBA 3H0IA 1T0HA 3CCRQ 2EQUA 3TREA 3HRSA 4JLIA 2X4YA 1K8AU 2RM4A 2HD0A 3VUZA 3RERA 3QPHA 2MIOA 2JOYA 4KGVB 1BKBA 3NHNA 4GY5A 3JCMg 2QDYB 1Q81U 2L3QA 1JQQA 4M77F 2LJ3A 1YJWQ 3M5AA 4QQ6A 2FO0A 4J6XA 2EIFA 3CPFA 4F7UB 4E7IA 5KYWA 4N4GA 2DTOA 1T3LA 3M57A 2LCCA 2D0NA 2DL8A 1VQNQ 4CC7A 2F5TX 1FMVA 4DQ2A 3NTIA 1T3SA 1VQPA 1VQ6A 1QVGA 4LD6A 2DM1A 1ZSZA 3CC4T 2E41A 1K9MR 3OS2A 2VB6A
chains in the Genus database with same CATH topology
1NPRA 2KK4A 2OTJA 4Q5WA 2KQWA 2KY9A 2HQXA 5HY6A 3UWNA 3M9QA 1ZHIA 4NL2A 2K3XA 5GMKm 2VV5A 2JN0A 4XTUA 4RKUE 4CI0C 2EWNA 1JB0E 2FHDA 3JSCA 2VGNA 3GF5A 2MWOA 3PFSA 1ZBXA 4M77E 3G71A 4EPCA 2PUOB 2CKKA 4ATOA 3CPWA 1XOVA 1G5VA 1KG1A 4QW2A 3A8OB 4BY6B 1Y7XA 4GLKA 3A8LB 3E9GA 4LDVA 2YLBA 4M77C 3X24B 3LWIA 4E7LA 4LDXA 3BW1A 1DJ7B 5DLQE 3CD6T 4KULA 2D6FA 3R6OA 2DD5A 5CKDA 3CCST 3OYCA 4C5GA 5KE2A 5GAN7 5IAYA 2DXUA 4FM4B 2KSSA 2DD4A 2LCLA 2ZPBB 3CBPA 4HCBA 1VQ5A 4PJOC 5L8RE 3CCMA 3L1AA 5GMKe 3JB9F 1Y71A 3ER0A 5I2MA 1B34B 2LC4A 5GAMe 1BIBA 4ZGEB 4B9XA 3ASKA 1X6OA 1WJSA 2PQWA 4JS5A 1X75C 2QXFA 3HFNA 4ZN1A 3SWNB 2LX9A 2RI5A 4Z02A 4EMGA 2XKOC 5GANe 5CKHA 2IG0A 4FU6A 3WXMB 4BD3A 2DVEA 1FX7A 3LH0A 3OS5A 3OYBA 3DLLA 5LJ5g 3JB9H 4MDWA 5GAMd 2RB6A 5CK9A 1PSFA 4OB0B 3M59A 1K9MU 3NTKA 1H641 3CCJT 4NS5A 5GANd 2XD0A 5LJ5j 1W2BS 1WNLA 3JCMJ 4BUGA 4RMOA 4XTWA 3LW5E 2X4XA 3M56A 1KC8U 5M9OA 1BIAA 3CCQT 5CO7A 3OYJA 1YJ9T 4BE0A 5A0GA 4QVCA 3FC3A 4JRPA 1OZ2A 1KHIA 4OGCA 1IZ6A 4M75F 4C92F 1YJWA 4M7AF 2L5QA 2BIVA 2MI6A 2VXFA 3I56A 1G3YA 2QTXA 3OYKA 3JCMP 1LJOA 2M1HA 2FB7A 3HHTB 1VQ4T 1KC8C 2XK0A 3DB3A 2DXCA 2GF7A 2JTMA 2K5IA 4VUBA 4EDUA 3CMAA 3L42A 1UGRB 2V8KA 2F5KA 2E5QA 2LVMA 3M58A 4J6YA 5HK3A 4L5GA 1OYXA 3OMGA 4Y28E 4M78A 2R5AA 5FLXE 2K3YA 1U1TA 3QZ5B 2XHCA 1YHQA 1M5Q1 2VXEA 3E19A 4C8QG 4M7DG 3OQ5A 3PMTA 5J26A 3MEWA 1UGSB 4J8OA 5EG2A 3E1SA 3X26B 1XQHA 1VQNA 1BI0A 2RJFA 5CKFA 1Y07A 4A4HA 3JCMV 1KHCA 4BY6C 3WVDB 2OTLT 5LJ5h 5IN1A 5GMKl 2QA4T 2E6NA 4C0GA 3OS2A 1Q81C 4KBMB 1YI2T 5FRNA 2OTJT 3E9FA 4A4KA 4PLLA 4RCBA 4M75A 2GCXA 4M78E 4XTXA 4C92G 4OF1A 1I5LA 3JCMc 1EIFA 2JNGA 1WQWA 2DK3A 4MZMA 2H3JA 4C8QD 4C0FA 2JUFA 4EMKA 2EKOA 4NL3A 3L2UA 3I55A 3N5BB 5CQYA 4M78C 4PL6A 4PJOF 3CCUA 4EMHA 2DEQA 2O4XA 4JS4A 1JJ2A 1M1FA 3QXEB 3OSSC 4C0DC 2DXTA 4BE2A 3S3OA 2L8DA 2WACA 2XICA 3G71T 4XU1A 4MZTA 1NJIC 3P8DA 4E47A 5KCHA 2RI2A 3L2ZA 4F7UF 2KDSA 3KBGA 4OGEA 3FIFA 3VU3C 1BI1A 1VQMT 3OYYA 2YLCA 3QZ9B 2NLUA 2P0KA 2QQBA 1U1SA 4BI3A 3OYDA 5D6XA 4ZGDB 3CC7A 1YIJT 4UC4A 1M1GA 4KT0E 1R8OB 4TVRA 4JUVA 1WPYA 1S72T 1VQ5T 2BKDN 4EMKC 1VQLA 2YRVA 3HKSA 4XU0A 4B9WA 3O8VA 4A4EA 4CRIA 3OS1A 1PSEA 1GXIE 5CCAA 3OW2A 5HK0A 2FL7A 4J5YA 4HKEA 1Y96A 2RJEA 3FDRA 4XTZA 3JCMf 5GAOr 5GANf 1BI3A 1X01A 2RD1A 2XIDA 4ZGJB 3JCMb 4JLGA 2RHYA 1Q7YU 2EQKA 4PJOA 1HXDA 2R58A 1D3BB 2RI3A 3LLRA 3HRUA 3TCJA 3CMEA 1QVFA 3LYIA 1YJNA 3RMSA 1VQOA 1YBYA 3CBMA 2JTFA 4JDSA 4RG2A 3QUIA 4M7AG 3NTHA 3S3MA 3L2VA 3HFOA 4C8QB 4M7DB 4JRIA 4F7UA 2ZPFB 2EQJA 1Q7YC 5GAMh 4C5EA 5GAN2 2LTOA 5I2SA 5J39A 4NOYA 1UGQB 3VUBA 4V2SA 4C5IA 4X34A 3CCLT 2DKGA 5CKBA 2FYKA 2K4YA 3PNWC 2V8IA 1P92A 3G6ET 1VIEA 2RO0A 1NZ9A 2AHJB 1LOJA 2K5LA 1YJWT 3CCEA 4PJOE 3CXCS 5FU6B 4C92B 3I56T 3A8GB 5FRMA 4M7AD 2DIQA 2ZPGB 1NE8A 3ZEHA 5LJ3f 4OB2B 4ZN3A 2LQKA 3JCMQ 3C95A 3L2WA 4F7UE 3VYGA 2X4JA 5GAN6 2G3RA 3OYIA 4J7IA 4O6JA 3QHSA 4M77G 4A4GA 1VQ7A 1M4ZA 3GNFB 1I4K1 4OB3B 3JCMe 5GAOn 1KQSS 2HAXA 1OI1A 1LNXA 4M78F 1QVGS 1QVPA 3LX7A 5D6YA 4HCZA 1YHQT 3CCRA 3G7ZA 4IUPA 2JZ2A 3JCMX 2OAUA 3C4SA 5KE3A 3MP6A 3PT9A 4OVAA 1N9SA 2HBPA 3V8JA 2XDDA 4E7HA 3PMIA 2E65A 5CR2A 2QQSA 5KH6A 1XNIA 5GAOm 3JCMd 1V29B 3C94A 4BI4A 3OYNA 4FSXA 2GFUA 5HKCA 1TH7A 3HL8A 4M77D 1O75A 1VIFA 2DZ9A 3HPWA 3QIIA 2ZCFB 4QQGA 1KQ1A 3JCMW 3GNGA 1K9MC 4N4IA 1O9SA 2VUBA 2Y4XA 3Q1JA 3OBWA 4J7FA 2QEXT 1YITT 2A3LA 1SSFA 4LDUA 3CPWS 5FU7C 1Q86U 3CCUT 3HRTA 5CAIA 2VYTA 2MWPA 4BE1A 5A0DA 4RCCA 3OYGA 4N0AA 5LJ3e 3MEUA 3OYFA 1G3WA 3FLGA 4QVDA 4M7AB 4A53A 2RHZA 5GMKi 3OMCA 2D9TA 1WJQA 1Q86C 2X4WA 1G3SA 2EQMA 4J6WA 3GLXA 3DKMA 2DAQA 3PTAA 4XK8E 2R57A 3CD6A 3GIBA 1B34A 5LJ3d 2RH2A 4YTLA 2QQ9A 2XU8A 3URGA 4DA4A 3CC2A 2LRQA 2VGMA 3X28B 3BFMA 1VQPT 3SWNA 1VQ6T 4O5VA 4Y91A 3OYLA 1OZ3A 1IREB 3FJPA 3FRNA 4XQ3A 2ZPEB 3RIRA 4J83A 2CGHA 1UB4A 3QYHB 4QQDA 4E7KA 2GQVA 4N0AC 1QP2A 4BDYA 3VKIA 3MP1A 4FT2A 4HA8A 1U8RA 2R5MA 1M90U 1VUBA 2D0QB 2PUKB 2KAFA 2RK2A 2ZPHB 4M77B 4BACA 4IUTA 2RA2A 3RMQA 1G3TA 3CMET 2EJGA 3M54A 5GAMg 3FB9A 4WF2A 2ZGWA 3RKYA 1VQOT 3V8LA 4FT4A 5GMKj 4KUDK 1MGQA 1M90C 3OS0A 1I81A 5LL6S 3X25B 5GAMj 5GAN5 3G4SA 3CCJA 3SWNC 5DY9A 3JB9G 4X9CA 1M1KU 2EJFA 3ME9A 5GANj 3FEOA 2CZ7B 2RJCA 5A2QE 1N8RU 3X20B 2LT4A 4C92D 2DIGA 3OBYA 2KVQG 3CCQA 4P5NA 2P4TA 3PGGA 2K5FA 3OA6A 1RL2A 3M4GA 2DTHA 3CCET 5C6SA 2RHXA 1M9SA 3QJ6A 4M78G 2LDMA 3OYHA 2X35A 4MMLA 1M1KC 4II1A 3J7AF 1N8RC 1BYMA 3CCVA 3CCMT 3V7RA 4PNOA 1VQ8A 1KD1U 4X9DA 1KQ2A 3JB9D 3MEVA 1RI0A 2EJ9A 5CQXA 3ZFJA 1VQ7T 3HSBA 5A0LA 5LJ5e 1XTDA 2WSCE 4BB7A 3RESA 3WVEB 2M16A 3EFRA 4LDWA 3TU4K 5GAOl 1KD1C 2P0PA 2RHIA 3CCRT 3JB9J 4M78D 2XG8D 3A8MB 4OP0A 3H8ZA 4M75G 3JB9I 3M53A 5GMKh 3OYEA 2EYQA 2QQRA 4M7DD 5LJ5d 5CKEA 4HCCA 2DO3A 1VQ9A 1QW1A 2E6ZA 1BI2A 2OTLA 3AHUA 3QYGB 3JCMh 4ELZC 5GANh 2QA4A 2E70A 5FROA 1YI2A 3P8HA 1JJ2S 3LWHA 2DJZA 3PIPA 4C8QF 1YCYA 1W2BA 4M7DF 3UT1A 3LGFA 1WGSA 4M75D 4IUQA 4C0ZA 5DLOA 4BI8B 1UEBA 2KMTA 3J81E 3A5ZB 3OYMA 4OMFB 3T9NA 1HK9A 2P0QA 2F69A 3CMAT 3M55A 2M0OA 5GAOq 2O01E 3MCAB 2L3RA 2EFIA 4XAXB 2RK1A 2QQAA 3TEEA 4JRKA 1VQMA 3UDCA 2I2LA 3INZA 4XTVA 3UPUA 3BDUA 4HT9A 1N9RA 1M8VA 4XU2A 3V8KA 3CC2T 1AHJB 3SD4A 2CZ6B 1I8FA 5LJ3h 3DLMA 3EAEA 3KXTA 4JJNK 1VQNT 3OW2S 2PU9B 1YIJA 1K73U 4PJOG 3L2QA 3OY9A 1S72A 3CC4A 1D3BA 4KUIA 4M78B 2ZZDA 5KCOA 2LNVA 2E64A 5IT9E 1VQKA 4N4HA 1N27A 4C0DB 3HP9A 4BDZA 5GAN4 1H3ZA 2JVVA 3OB9A 3LGLA 4F7UG 4C8QA 1QVFS 1WQ7A 4M7DA 2WSEE 5GAOp 1K73C 4MDXA 3CBOA 2LQ8A 2VC8A 1W4SA 2K57A 4LDYA 1Q82U 2CYZB 2MMPA 2MF2A 4DOVA 3I55T 3H6ZA 4ZTFA 1WJRA 4E7JA 4MMKA 1JBMA 4PLIA 4PJOD 3QBYA 2ZPIB 3BY7A 3MEAA 3RKWA 3S3NA 3JRZA 4JRQA 3NFCA 2CZ1B 3OYAA 1Q82C 4M75B 1KQSA 3MP8A 3G4ST 4MZPA 2E12A 4FIBA 4C92A 4FL6A 4EMKB 3V7SA 2L89A 3RUXA 4C8QE 2E10A 3CEYA 2O4XB 3F70A 4R56A 3CCLA 4M7DE 4XTYA 4C5HA 2EAYA 4IUVA 3QDRB 3G6EA 3CCSA 3QSUA 4D6WA 3QJYA 2DPPB 2Y90A 4C8QC 2PVOB 5CVIA 4PKCC 3SFMA 4A4FA 3QKJA 3CC7T 2XDBA 4M7DC 2GFAA 2XI9A 1UGPB 5GAN8 2CZ0B 2PVDB 3DB4A 3GOXA 3CCVT 1NPPA 3QG1A 1VQLT 4HT8A 1N6AA 1VQ8T 2DXBA 4ZTJA 2DZCA 4QVZA 4C92E 2C06A 2QI2A 3QO3A 5DM7R 2EQUA 3TREA 3HRSA 5LJ5f 4JLIA 2X4YA 1K8AU 5FU6C 2CS7A 2RM4A 2HD0A 3VUZA 4C92C 3MHXA 3RERA 3QPHA 1ZQ1A 2IVWA 2JOYA 4IURA 4OB1B 3SB2A 2Y4YA 1FWZA 1BKBA 2V8JA 3A8HB 5D6WA 1YJNT 4IUUA 4XU3A 4GY5A 4IKFA 4DOWA 3RKXA 3JCMg 1QP3A 2QDYB 4ELYC 5GANg 1Q81U 1K8AC 1Y96B 3KUFA 5AYFA 3JAME 2K2VA 3J80E 2XDPA 4M77F 4A54A 1VQ9T 1JRIA 4PJOB 3M5AA 4QQ6A 3ZBDA 4J6XA 2EIFA 2RHUA 3CPFA 1FXXA 3SDZA 1YJ9A 4M7AA 2DTIA 3BDLA 4F7UB 1NJIU 3P8BB 3L2RA 2YHTA 2QEXA 4E7IA 1YITA 2HNIA 5GAN3 1VQ4A 4N4GA 4L59A 4L6V5 3PIOA 5CIUA 3VV0A 2E1HA 4ME7A 2DTOA 3V7CA 5I21A 3CXCA 1MHNA 5C0MA 3M57A 2LCCA 3META 3VJPA 4R55A 3MO8A 4RG8A 3C12A 2PVGB 2FVUA 5LJ3g 4LD9K 5J3BA 2HQEA 3M4YA 3OSVA 4M75E 4M7AE 2F5TX 3GP8A 3EFSA 2M9UA 4DQ2A 3NTIA 5LJ3j 2BUDA 3GPLA 1VQPA 1VQ6A 4M75C 2WSFE 4M7AC 3VYHB 1QVGA 4LD6A 4M77A 3S6WA 3CC4T 5FU7B 2A7YA 1VQKT 2LT1A 2E41A 2B8AA 5GAMf 2RJDA 2MAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMH A;  2DEQ A;  4J6W A;  4PJO G;  2DXT A;  1D3B A;  3GIB A;  4M78 B;  1B34 A;  2E64 A;  4XU1 A;  4NL2 A;  5LJ3 d;  5GMK m;  4F7U F;  3L2Z A;  2JN0 A;  4XTU A;  5GAN 4;  2EWN A;  3BFM A;  3FIF A;  3SWN A;  3VU3 C;  4C8Q A;  4F7U G;  1WQ7 A;  4M7D A;  4Y91 A;  2YLC A;  5GAO p;  4M77 E;  2VC8 A;  2K57 A;  3FJP A;  1U1S A;  4XQ3 A;  3RIR A;  2CGH A;  4C92 F;  4M77 C;  4N0A C;  2YLB A;  4MMK A;  1JBM A;  4HA8 A;  4PJO D;  3BW1 A;  3BY7 A;  4JUV A;  1WPY A;  3RKW A;  4EMK C;  4M77 B;  4XU0 A;  4M75 B;  2RA2 A;  4C92 A;  2EJG A;  5GAM g;  5GAN 7;  3FB9 A;  4WF2 A;  2DXU A;  2ZGW A;  4J5Y A;  3RKY A;  3RUX A;  3V7S A;  3V8L A;  4EMK B;  1Y96 A;  4XTZ A;  1MGQ A;  3JCM f;  5GMK j;  4C8Q E;  2E10 A;  5GAN f;  5GAO r;  1X01 A;  2RD1 A;  3JCM b;  4M7D E;  4PJO C;  4XTY A;  1I81 A;  5GAM j;  3L1A A;  5GMK e;  2EAY A;  5GAN 5;  3JB9 F;  1HXD A;  4PJO A;  3QSU A;  1D3B B;  3SWN C;  2Y90 A;  1B34 B;  5DY9 A;  4C8Q C;  5GAM e;  1BIB A;  3JB9 G;  4M7D C;  4X9C A;  2EJF A;  5GAN j;  4M7A G;  5GAN 8;  4C92 D;  3QUI A;  3HFN A;  3SWN B;  4HT8 A;  3HFO A;  4C8Q B;  4EMG A;  5GAN e;  4JRI A;  4F7U A;  4M7D B;  5GAM h;  5GAN 2;  3PGG A;  2DVE A;  3M4G A;  2DZC A;  2DTH A;  4NOY A;  4C92 E;  3QO3 A;  4M78 G;  5LJ5 f;  4MML A;  5LJ5 g;  3JB9 H;  4JLI A;  5GAM d;  4V2S A;  2RB6 A;  2DKG A;  1M8V A;  2FYK A;  2RM4 A;  4C92 C;  3V7R A;  4PNO A;  3RER A;  1H64 1;  5GAN d;  1LOJ A;  4X9D A;  3SB2 A;  5LJ5 j;  1KQ2 A;  4PJO E;  3JB9 D;  2EJ9 A;  4C92 B;  1WNL A;  4XU3 A;  3JCM J;  4M7A D;  4XTW A;  3RKX A;  3JCM g;  5LJ5 e;  3HSB A;  5GAN g;  3RES A;  5LJ3 f;  1BIA A;  1Y96 B;  3JCM Q;  3EFR A;  4QVC A;  4F7U E;  5GAN 6;  5GAO l;  4M77 F;  4A54 A;  4M75 F;  4M7A F;  1JRI A;  3JB9 J;  4PJO B;  4M78 D;  3QHS A;  2VXF A;  4M77 G;  4OP0 A;  4J6X A;  4M75 G;  2QTX A;  3JB9 I;  5GMK h;  1LJO A;  3JCM P;  2FB7 A;  1I4K 1;  3JCM e;  5GAO n;  5LJ5 d;  4M7A A;  1LNX A;  4M78 F;  2DTI A;  4F7U B;  3JCM X;  2YHT A;  4J6Y A;  3AHU A;  3JCM h;  2HNI A;  5GAN h;  5GAN 3;  1N9S A;  3V8J A;  2E65 A;  4M78 A;  2DJZ A;  2E1H A;  4C8Q F;  3JCM d;  1YCY A;  2DTO A;  3V7C A;  5I21 A;  5GAO m;  1U1T A;  4M7D F;  1M5Q 1;  2VXE A;  4C8Q G;  1TH7 A;  4M7D G;  4M77 D;  4M75 D;  2DZ9 A;  1KQ1 A;  5LJ3 g;  3JCM W;  1HK9 A;  3JCM V;  4M75 E;  4M7A E;  5GAO q;  3EFS A;  5LJ5 h;  4DQ2 A;  5GMK l;  5LJ3 j;  5CAI A;  4JRK A;  4M75 C;  4M7A C;  4RCC A;  4M77 A;  4N0A A;  4RCB A;  2I2L A;  4M75 A;  3INZ A;  4M78 E;  4XTX A;  4C92 G;  5LJ3 e;  4XTV A;  3JCM c;  3BDU A;  1I5L A;  4HT9 A;  2E41 A;  1WQW A;  4M7A B;  4QVD A;  4A53 A;  1N9R A;  4C8Q D;  4XU2 A;  3V8K A;  4EMK A;  5GAM f;  5GMK i;  4NL3 A;  4PJO F;  4M7D D;  4M78 C;  1I8F A;  5LJ3 h; 
#chains in the Genus database with same CATH topology
 3CCU Q;  1NPR A;  3H41 A;  1U06 A;  2KQW A;  2CP0 A;  2XMF A;  3UWN A;  5GMK m;  2VV5 A;  2JN0 A;  4RKU E;  2FHD A;  2RF0 A;  2DYB A;  3GF5 A;  3G71 A;  2CKK A;  3EH1 A;  3CPW A;  2OI3 A;  4OMN A;  1KG1 A;  4QW2 A;  4LDV A;  4M77 C;  3CC7 Q;  2O31 A;  4LDX A;  3BW1 A;  1DJ7 B;  2D6F A;  3R6O A;  4C5G A;  5GAN 7;  1V1C A;  3TSZ A;  2KSS A;  1VQ5 A;  2YUN A;  3VS4 A;  3VRZ A;  4WTO B;  3ER0 A;  1B34 B;  2LC4 A;  4ZGE B;  2COW A;  4B9X A;  3ASK A;  1X6O A;  2QXF A;  4EMG A;  2RNA A;  2DRK A;  5CKH A;  2DVE A;  3OS5 A;  1RAH B;  2EQI A;  2HCK A;  3DLL A;  4MDW A;  5GAM d;  2RB6 A;  1MMD A;  1K9M U;  1WNL A;  4BUG A;  4XTW A;  1A0N B;  5HCK A;  3M56 A;  1BIA A;  5CO7 A;  3OYJ A;  5A0G A;  4J9E A;  1KHI A;  4OGC A;  1IZ6 A;  2BIV A;  1UJ0 A;  1G3Y A;  2QTX A;  2M1H A;  3HHT B;  1KC8 C;  2DXC A;  3CMA A;  3L42 A;  3M58 A;  2E5Q A;  2LVM A;  2E5K A;  5ECA A;  4AFQ C;  4L5G A;  1GCQ A;  4Y28 E;  2XHC A;  4C8Q G;  5EG2 A;  1BI0 A;  5CKF A;  1Y07 A;  4IIM A;  5GMK l;  2QA4 T;  4C0G A;  1V76 A;  1YI2 T;  4M78 E;  2OAW A;  2JNG A;  4DBH A;  2EGE A;  2H3J A;  2JUF A;  2EKO A;  2NWM A;  3I55 A;  4PL6 A;  1MV3 A;  4EMH A;  3OSS C;  2WAC A;  2DEU A;  4XU1 A;  1AOJ A;  4F7U F;  3L2Z A;  2P4R A;  5KYU B;  5KYY B;  3KBG A;  3VU3 C;  1IGQ A;  1NG2 A;  1WHH A;  2QQB A;  4BI3 A;  4ZGD B;  2HEQ A;  2NUT B;  3EGU A;  1YIJ T;  1VQL A;  2YRV A;  3HKS A;  4B9W A;  3O8V A;  3SEM A;  4A4E A;  1GXI E;  2DA9 A;  3JCM f;  2CP6 A;  2XID A;  1JEG A;  4JLG A;  2MK5 A;  1D3B B;  2RI3 A;  1OX8 A;  3RMS A;  3CBM A;  2JTF A;  4JDS A;  3MPU B;  4C5E A;  1YJ9 Q;  5J39 A;  5FW9 A;  4F04 B;  1UGQ B;  2ECZ A;  1H3H A;  2IIM A;  2DKG A;  1VQ4 Q;  2K4Y A;  1I5O B;  2ATC B;  1NZ9 A;  1LOJ A;  3EHQ A;  1YJW T;  4PJO E;  3CXC S;  5EC7 A;  4C92 B;  2V26 A;  3A8G B;  4M7A D;  1VOM A;  1PKS A;  4ZN3 A;  3C95 A;  4D8K A;  3PVL A;  1VQ7 A;  1MMN A;  3JCM e;  2HAX A;  5I22 A;  4M78 F;  5D6Y A;  2CUB A;  2KGT A;  2OTL Q;  2EKH A;  4OVA A;  2HBP A;  3V8J A;  2XDD A;  5CR2 A;  2OTJ Q;  1H92 A;  4BI4 A;  1K0S A;  1TH7 A;  1BB9 A;  2DZ9 A;  1UGV A;  3QII A;  3CXC P;  1M1K R;  4N4I A;  1N8R R;  4J7F A;  1AD5 A;  2A3L A;  1QWF A;  2RQW A;  2HMA A;  3CCU T;  1YN8 A;  3EG3 A;  2H8H A;  5A0D A;  4RCC A;  1YWP A;  1RAD B;  3OYG A;  4QVD A;  4A53 A;  1QKW A;  4AFS C;  2ROL A;  1W70 A;  1KD1 R;  1Q86 C;  2X4W A;  2FZG B;  2QDL A;  3GLX A;  2V1Q A;  2DAQ A;  5KYW B;  1S72 Q;  3CD6 A;  5LJ3 d;  2RH2 A;  1ZUY A;  4DA4 A;  3UAT A;  2LRQ A;  2VGM A;  1VQP T;  1VQ6 T;  1CKB A;  2YWW A;  1KK7 A;  3FRN A;  4XQ3 A;  2M02 A;  2CGH A;  2GQV A;  4N0A C;  1QP2 A;  1U8R A;  1VUB A;  2D0Q B;  4BAC A;  1ZSZ B;  3FB9 A;  2MOX A;  3V8L A;  2O9S A;  5GAM j;  3X25 B;  5GAN 5;  3G4S A;  5FWB A;  3G6E Q;  1JXM A;  1D0Y A;  3JB9 G;  1M1K U;  3FEO A;  2CZ7 B;  5A2Q E;  3I56 Q;  4C92 D;  1N8R U;  4J9H A;  3CCQ A;  2P4T A;  2K5F A;  1RAF B;  4M78 G;  3OYH A;  1ABO A;  1VA7 A;  1UE9 A;  3CCV A;  1KD1 U;  5AT1 B;  1M3B A;  2C0O A;  1XTD A;  4BB7 A;  2GTJ A;  3EH2 A;  2CH4 W;  1WLP B;  4M75 G;  3JB9 I;  3M53 A;  2EYQ A;  4KRT A;  5LJ5 d;  4HCC A;  1QW1 A;  1PM3 A;  3JCM h;  2QEX Q;  2EYY A;  4ELZ C;  1WXT A;  2E70 A;  2LP5 A;  2H3E B;  3LWH A;  1W2B A;  1IGU A;  4JPB W;  3VS6 A;  4IUQ A;  1R0C B;  4BI8 B;  1UEB A;  3J81 E;  2P0Q A;  3CMA T;  2O01 E;  4FYV B;  2EFI A;  4XAX B;  2QQA A;  4JRK A;  2JW4 A;  1VQM A;  2YUP A;  2I2L A;  4F16 A;  4XTV A;  3U23 A;  1M8V A;  4XU2 A;  2J7I A;  2FZC B;  2PU9 B;  4PJO G;  4CC4 B;  3CC4 A;  4JJC A;  1IXD A;  2ENM A;  4C0D B;  1WQ7 A;  1K73 C;  2LQ8 A;  4LDY A;  1OPL A;  2V1R A;  1SRL A;  4OMO A;  4DOV A;  3I55 T;  3H6Z A;  1NJI R;  4E7J A;  4MMK A;  3QBY A;  2ZPI B;  3MEA A;  3QWX X;  4PFP A;  3RKW A;  1C1A A;  1Q82 C;  1KQS A;  2E12 A;  3CCE Q;  2L3P A;  2L89 A;  3CEY A;  4M7D E;  1HSQ A;  4XTY A;  1K4U S;  2PVO B;  4PKC C;  4FYY B;  2EPD A;  1PKT A;  2GFA A;  3DB4 A;  3H9N A;  1NPP A;  3QG1 A;  1VQL T;  1WHL A;  2F2V A;  2KR3 A;  4QVZ A;  2C06 A;  4FW1 A;  2BE7 D;  5DM7 R;  5LJ5 f;  2CS7 A;  2HL3 A;  4C92 C;  2JJ9 A;  1ZQ1 A;  4OB1 B;  1MV0 B;  3UF4 A;  1LCK A;  3A8H B;  5D6W A;  4DOW A;  4ELY C;  1K8A C;  4X1V A;  1JO8 A;  3JAM E;  2K2V A;  2XDP A;  1UTI A;  1JRI A;  1WXB A;  2HZY A;  4AG2 C;  1FXX A;  3SDZ A;  1M27 C;  4M7A A;  2FZK B;  2DTI A;  1NJI U;  3L2R A;  2YHT A;  1YIT A;  2SEM A;  5GAN 3;  3I9Q A;  3PIO A;  5CIU A;  2ED1 A;  4ME7 A;  5I21 A;  1MHN A;  1UHF A;  4R55 A;  3CC2 Q;  2PVG B;  4LD9 K;  5J3B A;  3EFS A;  2M9U A;  2J06 A;  1RLP C;  2D8H A;  5LJ3 j;  2BUD A;  3GPL A;  3PVQ A;  4HVW A;  4E7Z A;  3VS1 A;  2LT1 A;  4LUE A;  2RJD A;  4CC2 A;  1T0J A;  2D8J A;  4PJM A;  2HQX A;  2LZ6 B;  3M9Q A;  4PJL A;  2AZV A;  4XTU A;  1JB0 E;  1ZX6 A;  3PFS A;  1ZBX A;  4M77 E;  2PUO B;  4ATO A;  1G5V A;  1K0X A;  1Y7X A;  4GLK A;  4E7L A;  1NM7 A;  2YLB A;  3X24 B;  1ZSZ C;  1H8K A;  5DLQ E;  3CD6 T;  2DD5 A;  5CKD A;  1VQ8 Q;  3OYC A;  1OQK A;  5IAY A;  2DXU A;  5IHK A;  3CBP A;  2E4H A;  5L8R E;  3CCM A;  3L1A A;  1Y71 A;  5I2M A;  3CME Q;  1YJN Q;  4JS5 A;  1PWT A;  2LX9 A;  1SRM A;  2XKO C;  2IG0 A;  4BD3 A;  3JB9 H;  5CK9 A;  2VKN A;  1VYU A;  3NTK A;  4NS5 A;  1HD3 A;  5LJ5 j;  3JCM J;  2DBM A;  2DRM A;  5M9O A;  3CCQ T;  1YJW A;  2A08 A;  2MI6 A;  3OYK A;  2FB7 A;  2EGA A;  2XK0 A;  2K5I A;  3EHR A;  2W0Z A;  2F5K A;  2KRN A;  2G6F X;  2YUQ A;  2FG0 A;  2HKN A;  2DYI A;  2IPO B;  1U1T A;  2EW3 A;  3QZ5 B;  1Q7Y R;  8ATC B;  2YXY A;  4M7D G;  3MEW A;  4J8O A;  1ZBJ A;  3TSW A;  4JZ4 A;  2L3S A;  1VQN A;  2KBT A;  4A4H A;  2L0A A;  5LJ5 h;  2EBP A;  1G83 A;  2E6N A;  2KNB B;  3EG2 A;  1RAI B;  4PLL A;  4XTX A;  1I5L A;  1WQW A;  4NL3 A;  4C8Q D;  4EMK A;  1R77 A;  1GCQ C;  3CCU A;  2DEQ A;  4C0D C;  1TTH B;  2L8D A;  4E47 A;  1YP5 A;  1D1C A;  1VQM T;  3A1P A;  2KRO A;  4B6M A;  1U1S A;  2LQN A;  3CC7 A;  2RN8 A;  1M1G A;  3EGD A;  4CRI A;  3OS1 A;  1PSE A;  2EYZ A;  5CCA A;  3OW2 A;  1Y96 A;  4XTZ A;  5GAO r;  2LJ1 A;  2RD1 A;  1TUC A;  1Q7Y U;  1SPK A;  3BE3 A;  2R58 A;  3LLR A;  3TCJ A;  3CCJ Q;  4FSS A;  2J6O A;  2DX1 A;  3RBB B;  1X69 A;  2EQJ A;  2GQI A;  2KRM A;  4C5I A;  4V2S A;  5CKB A;  2FYK A;  3PNW C;  2V8I A;  2DIQ A;  1J3T A;  2DFU A;  4OB2 B;  2LQK A;  4F7U E;  3VYG A;  5GAN 6;  4J7I A;  4M77 G;  1G2B A;  1TSF A;  1GFC A;  1I4K 1;  5GAO n;  1IHV A;  4AFU C;  2J6F A;  1LNX A;  1QVG S;  1M90 R;  1QVP A;  3LX7 A;  3R6N A;  1YHQ T;  4FW2 A;  3G7Z A;  5KE3 A;  4Z89 A;  2LNH B;  4E7H A;  5KH6 A;  3UA7 A;  1MUZ A;  3JCM d;  3C94 A;  1VYT A;  2DF6 A;  4HVV A;  3HL8 A;  1O75 A;  1VIF A;  4QQG A;  2NYS A;  1O9S A;  2Y4X A;  1AT1 B;  1YIT T;  1PRL C;  3CPW S;  1M2O A;  2VYT A;  1FMK A;  4E7S A;  1WFW A;  1WHG A;  4M7A B;  2RHZ A;  5GMK i;  2EVR A;  2D9T A;  2JS2 A;  1QVG P;  3GIB A;  1VQK Q;  4YTL A;  2QQ9 A;  2XU8 A;  2KI7 A;  4PFZ A;  2CH4 A;  1WHJ A;  3BFM A;  1NEB A;  3SWN A;  1OX9 A;  3OYL A;  2L2P A;  3CQT A;  2ZPE B;  4E7K A;  1UB4 A;  4PJJ A;  3VKI A;  1M90 U;  3CPW P;  2ZPH B;  1WXU A;  1G3T A;  3CME T;  3M54 A;  4WF2 A;  1VQO T;  4FT4 A;  1MGQ A;  2F2X A;  3CCL Q;  2HSE B;  5LL6 S;  1I0C A;  1Z9Q A;  2JMA A;  2RJC A;  2CSI A;  3OBY A;  2KVQ G;  4P5N A;  3OA6 A;  1RL2 A;  2DTH A;  5C6S A;  2RHX A;  1M9S A;  1M1K C;  2M0Y A;  2X35 A;  4MML A;  4II1 A;  3REA B;  1N8R C;  1BYM A;  3CCM T;  4PNO A;  2SRC A;  3VRY A;  4X9D A;  1RAB B;  4J9I A;  3JB9 D;  3MEV A;  2EJ9 A;  1WDX A;  3ZFJ A;  5A0L A;  4RTV A;  8AT1 B;  4IIO A;  3RES A;  4LDW A;  1KD1 C;  2P0P A;  2RHI A;  3CCR T;  4M78 D;  5GJV B;  1PRM C;  1WYX A;  5CKE A;  1PHT A;  1CSK A;  1UG1 A;  2DET A;  2DL4 A;  1BI2 A;  2E6Z A;  2OTL A;  2E3I A;  2C0I A;  3G1J A;  1IRX A;  2NUP A;  3UT1 A;  1WGS A;  4M75 D;  4C0Z A;  1GFD A;  1RUW A;  3O5Z A;  3MCA B;  7AT1 B;  1EFN A;  2JM8 A;  3INZ A;  4F17 A;  3V8K A;  2QTV A;  1K76 A;  1I8F A;  1VQN T;  3OY9 A;  1S72 A;  4KUI A;  2E64 A;  4N4H A;  4RTZ A;  5GAN 4;  2DLP A;  3OB9 A;  4F7U G;  4C8Q A;  4MDX A;  2WSE E;  5GAO p;  2HSP A;  3CBO A;  2MMP A;  1K1Z A;  2RQT A;  1WJR A;  1JBM A;  4PLI A;  4PJO D;  3FJ5 A;  2QAS A;  3JRZ A;  4JRQ A;  4FIB A;  2ROT A;  2BZY A;  2FPD A;  4EMK B;  3V7S A;  4R56 A;  1WHK A;  2EAY A;  2K6D A;  2KYM A;  3QDR B;  4IUV A;  3UA6 A;  4D6W A;  3G6E A;  1OOT A;  5CVI A;  3CC7 T;  3QKJ A;  1UGP B;  1VQ7 Q;  2PVD B;  3I5R A;  3EG1 A;  4ZTJ A;  4C92 E;  2YUO A;  3QO3 A;  1YFN A;  3MKD A;  3HTR A;  3MHX A;  2IVW A;  4IUR A;  3EGD B;  3SB2 A;  2Y4Y A;  1FWZ A;  4IUU A;  4IKF A;  2AT1 B;  3RKX A;  4JJD A;  1Y96 B;  2QGF B;  3D7S B;  2ZAE A;  3J80 E;  4KH1 B;  4DBF A;  5KYX A;  2RHU A;  2ESW A;  5L23 A;  3P8B B;  2QEX A;  2HNI A;  2J6K A;  2A28 A;  2E1H A;  3VV0 A;  5C0M A;  3MET A;  3MO8 A;  3C12 A;  2FVU A;  1VYV A;  2HQE A;  4KGX B;  1BCO A;  2RQV A;  2WSF E;  4M75 C;  4M7A C;  3VYH B;  2CT3 A;  3S6W A;  5FU7 B;  2A7Y A;  1VQK T;  4DBR A;  4MZP A;  2MAM A;  3RMQ A;  4Q5W A;  2KY9 A;  5HY6 A;  2A0F B;  1PC0 A;  1MNE A;  2EYX A;  2K3X A;  1KSW A;  4CI0 C;  1SHG A;  2DBK A;  4AT1 B;  4A63 B;  4EPC A;  2HDA A;  1XOV A;  3A8O B;  4C92 F;  3E9G A;  2LX7 A;  4KUL A;  3CCV Q;  3VS0 A;  2ED0 A;  4WCI A;  4FM4 B;  2DD4 A;  2ZPB B;  1ZA2 B;  2LCS A;  4PJO C;  1M3C A;  4HCK A;  5GMK e;  4ZNX A;  1U3O A;  2JTE A;  1X75 C;  3HFN A;  1X6G A;  2K2M A;  3SWN B;  5GAN e;  1Y57 A;  3LH0 A;  1EZZ B;  1SG5 A;  4KGZ B;  1QQJ A;  2KXD A;  3M59 A;  4E2F B;  1H64 1;  2XD0 A;  1YWO A;  1W2B S;  1RI9 A;  4RMO A;  1FYN A;  2X4X A;  1YJ9 T;  1AZG B;  4QVC A;  3FC3 A;  3LH5 A;  2KT8 A;  2VXF A;  1HJD A;  3JCM P;  1D1B A;  1VQ4 T;  1LJO A;  1BU1 A;  2GF7 A;  4VUB A;  4EDU A;  3EG9 A;  5HK3 A;  1OYX A;  2LMJ A;  4M78 A;  2Z0W A;  1YHQ A;  3E19 A;  3OQ5 A;  2X3W D;  3X26 B;  1XQH A;  2CUD A;  4BY6 C;  1KHC A;  3WVD B;  2OTL T;  1TOV A;  5IN1 A;  1GRI A;  1C0M A;  1Q81 C;  2OTJ T;  4J9D A;  4C92 G;  4M75 A;  2DMO A;  4OF1 A;  4J9G A;  3JCM c;  1U5S A;  3L2U A;  1KQS S;  4M7D D;  4M4Z A;  3N5B B;  5CQY A;  4JS4 A;  1JJ2 A;  2O4X A;  1M1F A;  3QXE B;  2DXT A;  3S3O A;  1HYO A;  2RI2 A;  2NUP B;  2K7A A;  4OGE A;  1OU9 A;  2BZX A;  1BI1 A;  1Y0M A;  3A98 A;  3OYY A;  1QCN A;  2NLU A;  5IXB A;  3TVT A;  1Z9Z A;  1B7T A;  3OYD A;  3NPF A;  1AEY A;  1ZLM A;  4TVR A;  1S72 T;  4JUV A;  4EMK C;  2YRC A;  4XU0 A;  4OMM A;  1KQS P;  1BI3 A;  1E7O A;  1X01 A;  4ZGJ B;  2RHY A;  4PJO A;  3CME A;  3HRU A;  1QVF A;  1YJN A;  1VQO A;  4RG2 A;  3QUI A;  2AIR B;  2QK0 A;  1NYG A;  3NTH A;  1OU8 A;  5FWC A;  4C8Q B;  1SHF A;  2ZPF B;  1Q7Y C;  1RAE B;  5GAN 2;  1NLO C;  4OML A;  4FYX B;  1OUL A;  3VUB A;  1TU0 B;  2BZ8 A;  2DER A;  4X34 A;  3VS2 A;  1P92 A;  3G6E T;  2RO0 A;  3H0H A;  1IB8 A;  5FU6 B;  2COY A;  3I56 T;  3ZEH A;  3L2W A;  1SSH A;  1ABQ A;  2X4J A;  1ZUU A;  1OV3 A;  3RNJ A;  4A4G A;  2O88 A;  1M4Z A;  1VQ9 Q;  3CCR A;  4IUP A;  2JZ2 A;  2J05 A;  3C4S A;  2QA4 Q;  3PT9 A;  1YI2 Q;  2QQS A;  1XNI A;  1MND A;  4FSX A;  2F1L A;  4M77 D;  1YNZ A;  2O2O A;  1TG0 A;  1QMC A;  4PFO A;  3NMZ C;  3JCM W;  1K9M C;  2VUB A;  3Q1J A;  3OBW A;  2QEX T;  1PNJ A;  4LDU A;  3VS7 A;  5FU7 C;  5KYX B;  2EGC A;  3HRT A;  1SKU B;  3M0Q A;  2MWP A;  2PTK A;  4QKU A;  1TS9 A;  4BE1 A;  1YCS B;  1RAA B;  3MEU A;  1BCM A;  1G3W A;  3VS5 A;  2EYW A;  3FLG A;  4RTW A;  3OYF A;  3OMC A;  2JT4 A;  4J6W A;  2QAZ A;  2E3H A;  1YIJ Q;  4XK8 E;  3NGP A;  3AT1 B;  1G8X A;  2KE9 A;  4O5V A;  2ABL A;  2BTT A;  2HBW A;  1IRE B;  3FJP A;  3RIR A;  5D7U A;  3QYH B;  1QLY A;  4BDY A;  1PG5 B;  3MP1 A;  4FT2 A;  5IHI A;  2CP2 A;  2PUK B;  1Q95 G;  2KAF A;  1QCO A;  4IUT A;  2RA2 A;  2EJG A;  5GAM g;  2B86 A;  4HVU A;  3RKY A;  1M90 C;  6AT1 B;  1XJW B;  3CCS Q;  3CCJ A;  1AZE A;  3SWN C;  5DY9 A;  4X9C A;  2LT4 A;  2DIG A;  3PGG A;  1WA7 A;  3CCE T;  1JXO A;  3QJ6 A;  1LVK A;  3J7A F;  1AWJ A;  5CQX A;  2RMO A;  1AWO A;  3HSB A;  2O9V A;  3PE0 A;  2M16 A;  3EFR A;  3JB9 J;  2XG8 D;  3A8M B;  4OP0 A;  3H8Z A;  1X27 A;  3OYE A;  3QWY A;  4PJN A;  2YDL A;  2DO3 A;  1AVZ C;  3QYG B;  1D09 B;  5FRO A;  2FRW A;  2DJZ A;  4C8Q F;  1UUE A;  1ACM B;  5DLO A;  4CC3 A;  3A5Z B;  3OYM A;  4OMF B;  3T9N A;  1HK9 A;  2F69 A;  2M0O A;  2RK1 A;  3TEE A;  2CSQ A;  1VQP Q;  4RTU A;  1VQ6 Q;  2FRY A;  2MPX C;  3UPU A;  4HT9 A;  1N9R A;  1C6V X;  3CC2 T;  3EG9 B;  2CZ6 B;  4LNP A;  2CT4 A;  3OW2 S;  5IHN A;  4E6R A;  3L2Q A;  1W6X A;  4M78 B;  2ZZD A;  1VQK A;  2LNV A;  3HP9 A;  4Z88 A;  1H3Z A;  2JVV A;  3LGL A;  4M7D A;  1WX6 A;  1W4S A;  2CYZ B;  3G71 Q;  2MF2 A;  4KH0 B;  1AWW A;  4ZTF A;  1QKX A;  2DL3 A;  1R0B G;  2YT6 A;  3NFC A;  2CZ1 B;  3OYA A;  4M75 B;  1D0X A;  4LE9 A;  3RUX A;  3ZL7 C;  3CCL A;  2E10 A;  2O4X B;  3F70 A;  1VQ5 Q;  1ZSG A;  1CKA A;  4C5H A;  3OW2 P;  2JS0 A;  3QSU A;  2DPP B;  2Y90 A;  2RQU A;  1K9A A;  4C8Q C;  2XDB A;  1WIE A;  3RR6 A;  3M0S A;  1BBZ A;  1GL5 A;  3GOX A;  1E6H A;  1N6A A;  1VQ8 T;  2PZ1 A;  2DZC A;  3E2U A;  1NBE B;  2QI2 A;  2W10 A;  4LUD A;  1B07 A;  1M30 A;  5FU6 C;  1NEG A;  2C0T A;  2RPN A;  4JJB A;  2AKL A;  2V8J A;  1YJN T;  4XU3 A;  1AWX A;  1QP3 A;  5GAN g;  2DL7 A;  3KUF A;  5AYF A;  1VQ9 T;  4A54 A;  4PJO B;  3ZBD A;  3C0C A;  3EGX A;  2OJ2 A;  5I11 A;  1YJ9 A;  3BDL A;  3CMA Q;  1NYF A;  2MCN A;  1VQ4 A;  1JU5 C;  3EG0 A;  4L59 A;  4L6V 5;  3V7C A;  3CXC A;  5IH2 A;  3VJP A;  1ZA1 B;  4RG8 A;  2D1X A;  5LJ3 g;  2KT1 A;  1SEM A;  3M4Y A;  3OSV A;  4M75 E;  4M7A E;  3GP8 A;  2FPF A;  4M77 A;  2P84 A;  2B8A A;  5GAM f;  3I55 Q;  2RQR A;  2KK4 A;  2OTJ A;  1KC8 R;  4FYW B;  1ZHI A;  3M0P A;  4NL2 A;  1WZO A;  2EWN A;  3JSC A;  1UEC A;  2VGN A;  2JXB A;  2MWO A;  4FCY A;  2HQH A;  4BY6 B;  3A8L B;  3LWI A;  4J9B A;  1VQL Q;  3CCS T;  1IHW A;  5KE2 A;  4ORZ A;  3ULR B;  2YSQ A;  4F14 A;  2LCL A;  1W1F A;  4HCB A;  1E6G A;  1BK2 A;  3JB9 F;  5GAM e;  1BIB A;  2KEA A;  1M2V A;  2PQW A;  1WJS A;  4ZN1 A;  2DJQ A;  2RI5 A;  4Z02 A;  1WI7 A;  4FU6 A;  3WXM B;  1FX7 A;  1OPK A;  4QT7 A;  3OYB A;  5LJ5 g;  1PSF A;  4OB0 B;  3CCJ T;  5GAN d;  1S1N A;  1FMW A;  1M3A A;  3LW5 E;  1KC8 U;  4DBQ A;  4BE0 A;  4JRP A;  1OZ2 A;  4M75 F;  4M7A F;  2L5Q A;  3I56 A;  1D0Z A;  3M0T A;  3EFO A;  4AG1 C;  3DB3 A;  2JTM A;  1UGR B;  2V8K A;  4J6Y A;  2VAS A;  4DEX A;  2JM9 A;  3QDF A;  3OMG A;  2AKK A;  2A36 A;  2R5A A;  5FLX E;  1EX4 A;  2K3Y A;  1M5Q 1;  2VXE A;  5J26 A;  3PMT A;  1UGS B;  5IXF A;  3E1S A;  2RJF A;  1I07 A;  3JCM V;  2VVK A;  2FEI A;  2BE9 B;  1LPL A;  4DEY A;  2DIL A;  3IQL A;  4J9F A;  4KBM B;  5FRN A;  1MMA A;  3E9F A;  4A4K A;  4RCB A;  4LN2 A;  2GCX A;  1EIF A;  2CP7 A;  2DK3 A;  2QG9 B;  4MZM A;  4C0F A;  4PJO F;  4M78 C;  2KXC A;  4OMP A;  2K9G A;  4D8D A;  4BE2 A;  2XIC A;  2K79 A;  3G71 T;  3REB B;  3CD6 Q;  4JZ3 A;  4MZT A;  1NJI C;  3P8D A;  5KCH A;  2PNI A;  2KDS A;  5KYN A;  2M51 A;  4RTY A;  3FIF A;  3QZ9 B;  2YLC A;  2P0K A;  2GNC A;  5D6X A;  3TQ7 P;  1TUG B;  4UC4 A;  4KT0 E;  1R8O B;  1N5Z A;  1VQ5 T;  1WPY A;  2BKD N;  3I35 A;  4AFZ C;  4RTT A;  4AMC A;  2K3B A;  2GBQ A;  5HK0 A;  2DVJ A;  2FL7 A;  4J5Y A;  4HKE A;  2RJE A;  3FDR A;  2QYZ A;  5GAN f;  4Z8A A;  3JCM b;  2EQK A;  1HXD A;  3G4S Q;  1RAG B;  4Y92 A;  3LYI A;  2X9H A;  4GBQ A;  1YBY A;  4M7A G;  1Q86 R;  3S3M A;  1RLQ C;  3HFO A;  3L2V A;  4M7D B;  4JRI A;  1B3Q A;  4F7U A;  5GAM h;  3CCQ Q;  2LTO A;  5I2S A;  4NOY A;  2LJ0 A;  2LQW A;  3CCL T;  2DL5 A;  1VIE A;  2AHJ B;  2K5L A;  3CCE A;  1D1A A;  4LXC A;  5FRM A;  3THK A;  4RTX A;  1IO6 A;  2ZPG B;  1NE8 A;  5LJ3 f;  3JCM Q;  2HL5 C;  1KJW A;  2G3R A;  3OYI A;  4O6J A;  2CRE A;  3QHS A;  3GNF B;  4OB3 B;  4ANJ A;  2I0N A;  2GTO A;  1OI1 A;  4HCZ A;  3JCM X;  2OAU A;  3MP6 A;  1N9S A;  3PMI A;  2E65 A;  1PD0 A;  5GAO m;  1V29 B;  3OYN A;  1F1B B;  2GFU A;  3M0R A;  5HKC A;  2JMC A;  3HPW A;  1SF9 A;  2ZCF B;  1KQ1 A;  3GNG A;  1QWE A;  1SSF A;  1Q86 U;  1UHC A;  5CAI A;  3GBQ A;  3EGX B;  4N0A A;  5LJ3 e;  2COZ A;  1VQM Q;  1WJQ A;  1G3S A;  2EQM A;  4OMQ A;  3DKM A;  3PTA A;  1TWB A;  2R57 A;  2F2W A;  3CC4 Q;  1B34 A;  3URG A;  3CC2 A;  1X43 A;  3X28 B;  1W2B P;  3SHW A;  4Y91 A;  1OZ3 A;  1UJY A;  2QGG A;  2AK5 A;  2MYS A;  4GLM A;  4J83 A;  4QQD A;  2CP3 A;  4HA8 A;  1UDL A;  3JV3 A;  2R5M A;  1GCP A;  2RK2 A;  4M77 B;  4K11 A;  1PCX A;  2ZGW A;  4R0K A;  4KUD K;  5GMK j;  3OS0 A;  1I81 A;  2X51 A;  1MMG A;  2EJF A;  3ME9 A;  5GAN j;  2GGR A;  3X20 B;  2YRD A;  2AZS A;  3M4G A;  1M8M A;  1X2Q A;  2LDM A;  3RDV A;  1UFF A;  5GJW B;  3V7R A;  1VQ8 A;  1GBQ A;  1K73 R;  1KQ2 A;  1YHQ Q;  1RI0 A;  1X2K A;  1VQ7 T;  2HKQ B;  4PK4 A;  5LJ5 e;  2WSC E;  3WVE B;  3TU4 K;  5GAO l;  1Q82 R;  5GMK h;  1RAC B;  2QQR A;  1M2V B;  2KYB A;  2VWF A;  1WHM A;  1VQ9 A;  3AHU A;  3MJX A;  9ATC B;  1YIT Q;  1ZUK A;  5GAN h;  2QA4 A;  1ARK A;  1OEB A;  4RUG A;  1YI2 A;  3P8H A;  1JJ2 S;  3PIP A;  1NLP C;  1YCY A;  4M7D F;  5KYU A;  5KYY A;  3LGF A;  2FPE A;  2A37 A;  3VS3 A;  2KMT A;  3H0F A;  3M55 A;  5GAO q;  2NUT A;  2L3R A;  3I5S A;  3UDC A;  1GBR A;  1K8A R;  3BDU A;  1PD1 A;  3EFO B;  1AHJ B;  3SD4 A;  4JJN K;  5LJ3 h;  3DLM A;  3EAE A;  3KXT A;  2NUZ A;  1YIJ A;  1K73 U;  2CP5 A;  1Q81 R;  1D3B A;  5IT9 E;  5KCO A;  2KRS A;  1JJ2 P;  1N27 A;  4BDZ A;  4EIK A;  1QVF S;  1QCF A;  1VQO Q;  1X6B A;  4HXJ A;  1TXQ A;  2VC8 A;  1Q82 U;  2K57 A;  1I1J A;  3KFV A;  3M0U A;  3BY7 A;  3S3N A;  1KIK A;  3MP8 A;  3G4S T;  4C92 A;  4J9C A;  4FL6 A;  4C8Q E;  2DNU A;  3CCM Q;  3CCS A;  2OX7 A;  2DE0 X;  3QJY A;  4A4F A;  4M7D C;  3SFM A;  2XI9 A;  2X3X D;  5GAN 8;  2CZ0 B;  1TUD A;  2CDT A;  3CCV T;  1KFZ A;  4ESR A;  4HT8 A;  1QVF P;  2DXB A;  3H0I A;  1T0H A;  3CCR Q;  2EQU A;  3TRE A;  3HRS A;  4JLI A;  2X4Y A;  1K8A U;  2RM4 A;  2HD0 A;  3VUZ A;  3RER A;  3QPH A;  2MIO A;  2JOY A;  4KGV B;  1BKB A;  3NHN A;  4GY5 A;  3JCM g;  2QDY B;  1Q81 U;  2L3Q A;  1JQQ A;  4M77 F;  2LJ3 A;  1YJW Q;  3M5A A;  4QQ6 A;  2FO0 A;  4J6X A;  2EIF A;  3CPF A;  4F7U B;  4E7I A;  5KYW A;  4N4G A;  2DTO A;  1T3L A;  3M57 A;  2LCC A;  2D0N A;  2DL8 A;  1VQN Q;  4CC7 A;  2F5T X;  1FMV A;  4DQ2 A;  3NTI A;  1T3S A;  1VQP A;  1VQ6 A;  1QVG A;  4LD6 A;  2DM1 A;  1ZSZ A;  3CC4 T;  2E41 A;  1K9M R;  3OS2 A;  2VB6 A; 
#chains in the Genus database with same CATH homology
 1NPR A;  2KK4 A;  2OTJ A;  4Q5W A;  2KQW A;  2KY9 A;  2HQX A;  5HY6 A;  3UWN A;  3M9Q A;  1ZHI A;  4NL2 A;  2K3X A;  5GMK m;  2VV5 A;  2JN0 A;  4XTU A;  4RKU E;  4CI0 C;  2EWN A;  1JB0 E;  2FHD A;  3JSC A;  2VGN A;  3GF5 A;  2MWO A;  3PFS A;  1ZBX A;  4M77 E;  3G71 A;  4EPC A;  2PUO B;  2CKK A;  4ATO A;  3CPW A;  1XOV A;  1G5V A;  1KG1 A;  4QW2 A;  3A8O B;  4BY6 B;  1Y7X A;  4GLK A;  3A8L B;  3E9G A;  4LDV A;  2YLB A;  4M77 C;  3X24 B;  3LWI A;  4E7L A;  4LDX A;  3BW1 A;  1DJ7 B;  5DLQ E;  3CD6 T;  4KUL A;  2D6F A;  3R6O A;  2DD5 A;  5CKD A;  3CCS T;  3OYC A;  4C5G A;  5KE2 A;  5GAN 7;  5IAY A;  2DXU A;  4FM4 B;  2KSS A;  2DD4 A;  2LCL A;  2ZPB B;  3CBP A;  4HCB A;  1VQ5 A;  4PJO C;  5L8R E;  3CCM A;  3L1A A;  5GMK e;  3JB9 F;  1Y71 A;  3ER0 A;  5I2M A;  1B34 B;  2LC4 A;  5GAM e;  1BIB A;  4ZGE B;  4B9X A;  3ASK A;  1X6O A;  1WJS A;  2PQW A;  4JS5 A;  1X75 C;  2QXF A;  3HFN A;  4ZN1 A;  3SWN B;  2LX9 A;  2RI5 A;  4Z02 A;  4EMG A;  2XKO C;  5GAN e;  5CKH A;  2IG0 A;  4FU6 A;  3WXM B;  4BD3 A;  2DVE A;  1FX7 A;  3LH0 A;  3OS5 A;  3OYB A;  3DLL A;  5LJ5 g;  3JB9 H;  4MDW A;  5GAM d;  2RB6 A;  5CK9 A;  1PSF A;  4OB0 B;  3M59 A;  1K9M U;  3NTK A;  1H64 1;  3CCJ T;  4NS5 A;  5GAN d;  2XD0 A;  5LJ5 j;  1W2B S;  1WNL A;  3JCM J;  4BUG A;  4RMO A;  4XTW A;  3LW5 E;  2X4X A;  3M56 A;  1KC8 U;  5M9O A;  1BIA A;  3CCQ T;  5CO7 A;  3OYJ A;  1YJ9 T;  4BE0 A;  5A0G A;  4QVC A;  3FC3 A;  4JRP A;  1OZ2 A;  1KHI A;  4OGC A;  1IZ6 A;  4M75 F;  4C92 F;  1YJW A;  4M7A F;  2L5Q A;  2BIV A;  2MI6 A;  2VXF A;  3I56 A;  1G3Y A;  2QTX A;  3OYK A;  3JCM P;  1LJO A;  2M1H A;  2FB7 A;  3HHT B;  1VQ4 T;  1KC8 C;  2XK0 A;  3DB3 A;  2DXC A;  2GF7 A;  2JTM A;  2K5I A;  4VUB A;  4EDU A;  3CMA A;  3L42 A;  1UGR B;  2V8K A;  2F5K A;  2E5Q A;  2LVM A;  3M58 A;  4J6Y A;  5HK3 A;  4L5G A;  1OYX A;  3OMG A;  4Y28 E;  4M78 A;  2R5A A;  5FLX E;  2K3Y A;  1U1T A;  3QZ5 B;  2XHC A;  1YHQ A;  1M5Q 1;  2VXE A;  3E19 A;  4C8Q G;  4M7D G;  3OQ5 A;  3PMT A;  5J26 A;  3MEW A;  1UGS B;  4J8O A;  5EG2 A;  3E1S A;  3X26 B;  1XQH A;  1VQN A;  1BI0 A;  2RJF A;  5CKF A;  1Y07 A;  4A4H A;  3JCM V;  1KHC A;  4BY6 C;  3WVD B;  2OTL T;  5LJ5 h;  5IN1 A;  5GMK l;  2QA4 T;  2E6N A;  4C0G A;  3OS2 A;  1Q81 C;  4KBM B;  1YI2 T;  5FRN A;  2OTJ T;  3E9F A;  4A4K A;  4PLL A;  4RCB A;  4M75 A;  2GCX A;  4M78 E;  4XTX A;  4C92 G;  4OF1 A;  1I5L A;  3JCM c;  1EIF A;  2JNG A;  1WQW A;  2DK3 A;  4MZM A;  2H3J A;  4C8Q D;  4C0F A;  2JUF A;  4EMK A;  2EKO A;  4NL3 A;  3L2U A;  3I55 A;  3N5B B;  5CQY A;  4M78 C;  4PL6 A;  4PJO F;  3CCU A;  4EMH A;  2DEQ A;  2O4X A;  4JS4 A;  1JJ2 A;  1M1F A;  3QXE B;  3OSS C;  4C0D C;  2DXT A;  4BE2 A;  3S3O A;  2L8D A;  2WAC A;  2XIC A;  3G71 T;  4XU1 A;  4MZT A;  1NJI C;  3P8D A;  4E47 A;  5KCH A;  2RI2 A;  3L2Z A;  4F7U F;  2KDS A;  3KBG A;  4OGE A;  3FIF A;  3VU3 C;  1BI1 A;  1VQM T;  3OYY A;  2YLC A;  3QZ9 B;  2NLU A;  2P0K A;  2QQB A;  1U1S A;  4BI3 A;  3OYD A;  5D6X A;  4ZGD B;  3CC7 A;  1YIJ T;  4UC4 A;  1M1G A;  4KT0 E;  1R8O B;  4TVR A;  4JUV A;  1WPY A;  1S72 T;  1VQ5 T;  2BKD N;  4EMK C;  1VQL A;  2YRV A;  3HKS A;  4XU0 A;  4B9W A;  3O8V A;  4A4E A;  4CRI A;  3OS1 A;  1PSE A;  1GXI E;  5CCA A;  3OW2 A;  5HK0 A;  2FL7 A;  4J5Y A;  4HKE A;  1Y96 A;  2RJE A;  3FDR A;  4XTZ A;  3JCM f;  5GAO r;  5GAN f;  1BI3 A;  1X01 A;  2RD1 A;  2XID A;  4ZGJ B;  3JCM b;  4JLG A;  2RHY A;  1Q7Y U;  2EQK A;  4PJO A;  1HXD A;  2R58 A;  1D3B B;  2RI3 A;  3LLR A;  3HRU A;  3TCJ A;  3CME A;  1QVF A;  3LYI A;  1YJN A;  3RMS A;  1VQO A;  1YBY A;  3CBM A;  2JTF A;  4JDS A;  4RG2 A;  3QUI A;  4M7A G;  3NTH A;  3S3M A;  3L2V A;  3HFO A;  4C8Q B;  4M7D B;  4JRI A;  4F7U A;  2ZPF B;  2EQJ A;  1Q7Y C;  5GAM h;  4C5E A;  5GAN 2;  2LTO A;  5I2S A;  5J39 A;  4NOY A;  1UGQ B;  3VUB A;  4V2S A;  4C5I A;  4X34 A;  3CCL T;  2DKG A;  5CKB A;  2FYK A;  2K4Y A;  3PNW C;  2V8I A;  1P92 A;  3G6E T;  1VIE A;  2RO0 A;  1NZ9 A;  2AHJ B;  1LOJ A;  2K5L A;  1YJW T;  3CCE A;  4PJO E;  3CXC S;  5FU6 B;  4C92 B;  3I56 T;  3A8G B;  5FRM A;  4M7A D;  2DIQ A;  2ZPG B;  1NE8 A;  3ZEH A;  5LJ3 f;  4OB2 B;  4ZN3 A;  2LQK A;  3JCM Q;  3C95 A;  3L2W A;  4F7U E;  3VYG A;  2X4J A;  5GAN 6;  2G3R A;  3OYI A;  4J7I A;  4O6J A;  3QHS A;  4M77 G;  4A4G A;  1VQ7 A;  1M4Z A;  3GNF B;  1I4K 1;  4OB3 B;  3JCM e;  5GAO n;  1KQS S;  2HAX A;  1OI1 A;  1LNX A;  4M78 F;  1QVG S;  1QVP A;  3LX7 A;  5D6Y A;  4HCZ A;  1YHQ T;  3CCR A;  3G7Z A;  4IUP A;  2JZ2 A;  3JCM X;  2OAU A;  3C4S A;  5KE3 A;  3MP6 A;  3PT9 A;  4OVA A;  1N9S A;  2HBP A;  3V8J A;  2XDD A;  4E7H A;  3PMI A;  2E65 A;  5CR2 A;  2QQS A;  5KH6 A;  1XNI A;  5GAO m;  3JCM d;  1V29 B;  3C94 A;  4BI4 A;  3OYN A;  4FSX A;  2GFU A;  5HKC A;  1TH7 A;  3HL8 A;  4M77 D;  1O75 A;  1VIF A;  2DZ9 A;  3HPW A;  3QII A;  2ZCF B;  4QQG A;  1KQ1 A;  3JCM W;  3GNG A;  1K9M C;  4N4I A;  1O9S A;  2VUB A;  2Y4X A;  3Q1J A;  3OBW A;  4J7F A;  2QEX T;  1YIT T;  2A3L A;  1SSF A;  4LDU A;  3CPW S;  5FU7 C;  1Q86 U;  3CCU T;  3HRT A;  5CAI A;  2VYT A;  2MWP A;  4BE1 A;  5A0D A;  4RCC A;  3OYG A;  4N0A A;  5LJ3 e;  3MEU A;  3OYF A;  1G3W A;  3FLG A;  4QVD A;  4M7A B;  4A53 A;  2RHZ A;  5GMK i;  3OMC A;  2D9T A;  1WJQ A;  1Q86 C;  2X4W A;  1G3S A;  2EQM A;  4J6W A;  3GLX A;  3DKM A;  2DAQ A;  3PTA A;  4XK8 E;  2R57 A;  3CD6 A;  3GIB A;  1B34 A;  5LJ3 d;  2RH2 A;  4YTL A;  2QQ9 A;  2XU8 A;  3URG A;  4DA4 A;  3CC2 A;  2LRQ A;  2VGM A;  3X28 B;  3BFM A;  1VQP T;  3SWN A;  1VQ6 T;  4O5V A;  4Y91 A;  3OYL A;  1OZ3 A;  1IRE B;  3FJP A;  3FRN A;  4XQ3 A;  2ZPE B;  3RIR A;  4J83 A;  2CGH A;  1UB4 A;  3QYH B;  4QQD A;  4E7K A;  2GQV A;  4N0A C;  1QP2 A;  4BDY A;  3VKI A;  3MP1 A;  4FT2 A;  4HA8 A;  1U8R A;  2R5M A;  1M90 U;  1VUB A;  2D0Q B;  2PUK B;  2KAF A;  2RK2 A;  2ZPH B;  4M77 B;  4BAC A;  4IUT A;  2RA2 A;  3RMQ A;  1G3T A;  3CME T;  2EJG A;  3M54 A;  5GAM g;  3FB9 A;  4WF2 A;  2ZGW A;  3RKY A;  1VQO T;  3V8L A;  4FT4 A;  5GMK j;  4KUD K;  1MGQ A;  1M90 C;  3OS0 A;  1I81 A;  5LL6 S;  3X25 B;  5GAM j;  5GAN 5;  3G4S A;  3CCJ A;  3SWN C;  5DY9 A;  3JB9 G;  4X9C A;  1M1K U;  2EJF A;  3ME9 A;  5GAN j;  3FEO A;  2CZ7 B;  2RJC A;  5A2Q E;  1N8R U;  3X20 B;  2LT4 A;  4C92 D;  2DIG A;  3OBY A;  2KVQ G;  3CCQ A;  4P5N A;  2P4T A;  3PGG A;  2K5F A;  3OA6 A;  1RL2 A;  3M4G A;  2DTH A;  3CCE T;  5C6S A;  2RHX A;  1M9S A;  3QJ6 A;  4M78 G;  2LDM A;  3OYH A;  2X35 A;  4MML A;  1M1K C;  4II1 A;  3J7A F;  1N8R C;  1BYM A;  3CCV A;  3CCM T;  3V7R A;  4PNO A;  1VQ8 A;  1KD1 U;  4X9D A;  1KQ2 A;  3JB9 D;  3MEV A;  1RI0 A;  2EJ9 A;  5CQX A;  3ZFJ A;  1VQ7 T;  3HSB A;  5A0L A;  5LJ5 e;  1XTD A;  2WSC E;  4BB7 A;  3RES A;  3WVE B;  2M16 A;  3EFR A;  4LDW A;  3TU4 K;  5GAO l;  1KD1 C;  2P0P A;  2RHI A;  3CCR T;  3JB9 J;  4M78 D;  2XG8 D;  3A8M B;  4OP0 A;  3H8Z A;  4M75 G;  3JB9 I;  3M53 A;  5GMK h;  3OYE A;  2EYQ A;  2QQR A;  4M7D D;  5LJ5 d;  5CKE A;  4HCC A;  2DO3 A;  1VQ9 A;  1QW1 A;  2E6Z A;  1BI2 A;  2OTL A;  3AHU A;  3QYG B;  3JCM h;  4ELZ C;  5GAN h;  2QA4 A;  2E70 A;  5FRO A;  1YI2 A;  3P8H A;  1JJ2 S;  3LWH A;  2DJZ A;  3PIP A;  4C8Q F;  1YCY A;  1W2B A;  4M7D F;  3UT1 A;  3LGF A;  1WGS A;  4M75 D;  4IUQ A;  4C0Z A;  5DLO A;  4BI8 B;  1UEB A;  2KMT A;  3J81 E;  3A5Z B;  3OYM A;  4OMF B;  3T9N A;  1HK9 A;  2P0Q A;  2F69 A;  3CMA T;  3M55 A;  2M0O A;  5GAO q;  2O01 E;  3MCA B;  2L3R A;  2EFI A;  4XAX B;  2RK1 A;  2QQA A;  3TEE A;  4JRK A;  1VQM A;  3UDC A;  2I2L A;  3INZ A;  4XTV A;  3UPU A;  3BDU A;  4HT9 A;  1N9R A;  1M8V A;  4XU2 A;  3V8K A;  3CC2 T;  1AHJ B;  3SD4 A;  2CZ6 B;  1I8F A;  5LJ3 h;  3DLM A;  3EAE A;  3KXT A;  4JJN K;  1VQN T;  3OW2 S;  2PU9 B;  1YIJ A;  1K73 U;  4PJO G;  3L2Q A;  3OY9 A;  1S72 A;  3CC4 A;  1D3B A;  4KUI A;  4M78 B;  2ZZD A;  5KCO A;  2LNV A;  2E64 A;  5IT9 E;  1VQK A;  4N4H A;  1N27 A;  4C0D B;  3HP9 A;  4BDZ A;  5GAN 4;  1H3Z A;  2JVV A;  3OB9 A;  3LGL A;  4F7U G;  4C8Q A;  1QVF S;  1WQ7 A;  4M7D A;  2WSE E;  5GAO p;  1K73 C;  4MDX A;  3CBO A;  2LQ8 A;  2VC8 A;  1W4S A;  2K57 A;  4LDY A;  1Q82 U;  2CYZ B;  2MMP A;  2MF2 A;  4DOV A;  3I55 T;  3H6Z A;  4ZTF A;  1WJR A;  4E7J A;  4MMK A;  1JBM A;  4PLI A;  4PJO D;  3QBY A;  2ZPI B;  3BY7 A;  3MEA A;  3RKW A;  3S3N A;  3JRZ A;  4JRQ A;  3NFC A;  2CZ1 B;  3OYA A;  1Q82 C;  4M75 B;  1KQS A;  3MP8 A;  3G4S T;  4MZP A;  2E12 A;  4FIB A;  4C92 A;  4FL6 A;  4EMK B;  3V7S A;  2L89 A;  3RUX A;  4C8Q E;  2E10 A;  3CEY A;  2O4X B;  3F70 A;  4R56 A;  3CCL A;  4M7D E;  4XTY A;  4C5H A;  2EAY A;  4IUV A;  3QDR B;  3G6E A;  3CCS A;  3QSU A;  4D6W A;  3QJY A;  2DPP B;  2Y90 A;  4C8Q C;  2PVO B;  5CVI A;  4PKC C;  3SFM A;  4A4F A;  3QKJ A;  3CC7 T;  2XDB A;  4M7D C;  2GFA A;  2XI9 A;  1UGP B;  5GAN 8;  2CZ0 B;  2PVD B;  3DB4 A;  3GOX A;  3CCV T;  1NPP A;  3QG1 A;  1VQL T;  4HT8 A;  1N6A A;  1VQ8 T;  2DXB A;  4ZTJ A;  2DZC A;  4QVZ A;  4C92 E;  2C06 A;  2QI2 A;  3QO3 A;  5DM7 R;  2EQU A;  3TRE A;  3HRS A;  5LJ5 f;  4JLI A;  2X4Y A;  1K8A U;  5FU6 C;  2CS7 A;  2RM4 A;  2HD0 A;  3VUZ A;  4C92 C;  3MHX A;  3RER A;  3QPH A;  1ZQ1 A;  2IVW A;  2JOY A;  4IUR A;  4OB1 B;  3SB2 A;  2Y4Y A;  1FWZ A;  1BKB A;  2V8J A;  3A8H B;  5D6W A;  1YJN T;  4IUU A;  4XU3 A;  4GY5 A;  4IKF A;  4DOW A;  3RKX A;  3JCM g;  1QP3 A;  2QDY B;  4ELY C;  5GAN g;  1Q81 U;  1K8A C;  1Y96 B;  3KUF A;  5AYF A;  3JAM E;  2K2V A;  3J80 E;  2XDP A;  4M77 F;  4A54 A;  1VQ9 T;  1JRI A;  4PJO B;  3M5A A;  4QQ6 A;  3ZBD A;  4J6X A;  2EIF A;  2RHU A;  3CPF A;  1FXX A;  3SDZ A;  1YJ9 A;  4M7A A;  2DTI A;  3BDL A;  4F7U B;  1NJI U;  3P8B B;  3L2R A;  2YHT A;  2QEX A;  4E7I A;  1YIT A;  2HNI A;  5GAN 3;  1VQ4 A;  4N4G A;  4L59 A;  4L6V 5;  3PIO A;  5CIU A;  3VV0 A;  2E1H A;  4ME7 A;  2DTO A;  3V7C A;  5I21 A;  3CXC A;  1MHN A;  5C0M A;  3M57 A;  2LCC A;  3MET A;  3VJP A;  4R55 A;  3MO8 A;  4RG8 A;  3C12 A;  2PVG B;  2FVU A;  5LJ3 g;  4LD9 K;  5J3B A;  2HQE A;  3M4Y A;  3OSV A;  4M75 E;  4M7A E;  2F5T X;  3GP8 A;  3EFS A;  2M9U A;  4DQ2 A;  3NTI A;  5LJ3 j;  2BUD A;  3GPL A;  1VQP A;  1VQ6 A;  4M75 C;  2WSF E;  4M7A C;  3VYH B;  1QVG A;  4LD6 A;  4M77 A;  3S6W A;  3CC4 T;  5FU7 B;  2A7Y A;  1VQK T;  2LT1 A;  2E41 A;  2B8A A;  5GAM f;  2RJD A;  2MAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...