5GAN3

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
77
structure length
77
Chain Sequence
b'TPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 10
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan300
2DTOA 1I8FA 4M75C 2QTXA 1YCYA 4RCCA 3QO3A 2EJFA 4C92D 5I21A 4Y91A 3JCMW 3JB9F 3HFOA 4F7UF 3V7SA 4PNOA 5LJ3g 2DVEA 4M7AG 4M75A 2I2LA 4M78D 4M7DD 3QUIA 4EMKC 4M75E 4N0AC 4EMHA 4C8QG 3RKXA 3JCMJ 5GAN2 2EJGA 4M77C 4M7AF 1I4K1 2YHTA 4N0AA 1U1TA 2JN0A 2Y90A 3JCMh 2E1HA 1X01A 1BIAA 2RD1A 4M77A 5LJ5e 4XU0A 3V8JA 5GAMg 1D3BB 1WQWA 1N9SA 2FB7A 4M77E 5LJ3j 5GAN3 4C92B 3GIBA 4PJOB 2E65A 4C92F 4C8QD 4M7DG 3BW1A 1I5LA 5LJ3h 1B34A 1WNLA 2HNIA 3V8LA 2ZGWA 4M78B 4XU1A 5GANf 4M78F 3SB2A 4M7DF 5GAOq 1MGQA 3HFNA 4J6XA 5GANe 4F7UB 1H641 4WF2A 4M75G 4EMGA 4QVDA 3RKWA 1Y96B 4QVCA 4JRKA 1JRIA 1U1SA 5GAMj 5GAN7 1WQ7A 3V7CA 4X9DA 5GAOm 2YLBA 3FIFA 4M7AB 4HT9A 4A54A 5GAMh 4EMKA 3JCMd 4C8QB 5LJ5f 3RKYA 2EJ9A 4M77G 4C8QF 5GAN5 5GMKj 3RERA 4M75D 3JCMV 4DQ2A 3JCMb 5GMKh 3SWNB 2EAYA 3EFSA 4XTWA 5LJ3d 3L1AA 4J6YA 3PGGA 1LNXA 3JB9J 3BDUA 2RB6A 4OP0A 2DZ9A 5GAN4 4M7DB 4JRIA 2DTIA 2DTHA 5GAOn 4M77D 4HA8A 1N9RA 4XQ3A 3BY7A 5GMKl 4XTYA 4J5YA 3M4GA 3RIRA 3L2ZA 3JB9H 1LJOA 4C92C 1JBMA 4PJOC 3V8KA 4XTVA 4RCBA 5GANg 3JCMf 5GAMd 3JCMc 5GAN6 1D3BA 4M75F 2E10A 2EWNA 3JCMe 4C92A 3QHSA 4M78C 4PJOA 1HXDA 2K57A 4M7DC 2VXFA 5GAOr 2VXEA 4C92E 1I81A 2E41A 4PJOE 3QSUA 1KQ1A 5LJ3f 3INZA 4M78A 2FYKA 4HT8A 5GMKi 4NOYA 1TH7A 4JLIA 4M78E 5LJ3e 4M77B 4F7UA 4XTZA 4X9CA 4M77F 3JCMQ 5GAOl 2RM4A 5GAOp 3HSBA 1M5Q1 1Y96A 4F7UE 5LJ5g 4M7AC 4PJOD 5GANj 2DKGA 4NL2A 5GANd 2VC8A 2RA2A 1B34B 3V7RA 4C8QC 2YLCA 5GANh 4J6WA 4MMKA 5GAN8 4M7AA 4XTUA 5CAIA 2DXTA 3JB9D 4M7AE 5GAMf 4V2SA 4C8QA 1HK9A 5DY9A 3JCMX 1LOJA 3SWNC 4A53A 3BFMA 1M8VA 5GAMe 4C8QE 3JB9I 2DJZA 4M75B 4XU2A 4PJOG 2DEQA 4C92G 3RESA 3FB9A 2DXUA 3SWNA 1WPYA 3FJPA 2CGHA 5GMKm 4XU3A 5LJ5j 1KQ2A 4M7AD 3VU3C 5LJ5d 4JUVA 2DZCA 4XTXA 3AHUA 4M78G 3EFRA 5GMKe 5LJ5h 4PJOF 4EMKB 4NL3A 3JCMg 3JCMP 2E64A 3RUXA 4M7DA 3JB9G 4F7UG 1BIBA 4M7DE 4MMLA
chains in the Genus database with same CATH superfamily
2RJDA 1IRXA 5LJ3g 1UGVA 4M7DD 3KUFA 4N0AC 1T0JA 4N4IA 2JN0A 1OPKA 2PNIA 4CI0C 5KCOA 3ZEHA 4JS5A 2YXYA 3CCVT 1D1CA 1H92A 3VS0A 3HFNA 5GANe 4ORZA 1IREB 1K9MC 2JMAA 3OW2P 1PD1A 4QT7A 5IHIA 1U5SA 5CR2A 2RMOA 4C8QB 5AT1B 5GMKj 2JUFA 3CXCA 2M02A 1JJ2S 3JV3A 2M0YA 1W2BS 1VQLQ 3VS5A 1B3QA 3CC4Q 4D8KA 3G71T 1VA7A 4E7ZA 1RAFB 1JU5C 4LDVA 3CCMQ 1RI9A 1WX6A 3M4GA 3L2ZA 3JB9H 2X3XD 4Y28E 4KUIA 1NJIR 1JEGA 1NZ9A 1UGRB 3A8OB 2CP5A 4ZTJA 2OTJA 2E41A 3EFOA 1ZLMA 3MKDA 3QKJA 1BI3A 1YI2Q 3TREA 3H8ZA 3LWIA 1WHHA 3Q1JA 3NPFA 2JM9A 4DOVA 3OMGA 4M7AA 3OYYA 2OTLA 2HQHA 2ROTA 4RUGA 1XNIA 3HRSA 2GNCA 3RMSA 3FJPA 3URGA 5GMKm 4E7IA 1VUBA 2DZCA 3P8HA 1K0XA 2ED1A 2X4YA 1HD3A 2HBWA 4HVUA 3L42A 3QYGB 7AT1B 3GPLA 1Y57A 2QQRA 2LVMA 3V7SA 2DVEA 4M7AG 2HSEB 2OX7A 2M0OA 1D1AA 4HCBA 1ZSZA 1WA7A 4M7AF 3I56Q 2R5AA 2YHTA 5GJVB 2LNVA 5CO7A 3AT1B 4O5VA 2DXCA 1YJ9A 2EQUA 3KBGA 4PLLA 4A4KA 2DXBA 3OYGA 1YCSB 4C92F 2D8HA 2F2VA 1YJNA 1YIJT 3V8LA 1WDXA 2QGGA 2JZ2A 4Z02A 4GLKA 2C0TA 3PTAA 1Q86C 2KNBB 3S6WA 1NYFA 2A36A 3PNWC 3JCMb 3MO8A 1QCNA 4LDXA 3CCVQ 1XTDA 3VKIA 2CDTA 2COYA 3RBBB 3MCAB 3LH0A 3L2RA 4HA8A 2NUTB 2EIFA 2RHIA 4J9FA 4C92C 4R0KA 4XTVA 2LZ6B 4RCBA 2K3BA 3VS3A 1D3BA 1WGSA 4OMPA 1YITQ 2ZPFB 5IXBA 4E7SA 1CSKA 2BKDN 3PVQA 5LJ3e 1RABB 2RI3A 1RADB 4OMFB 1I07A 5LJ5g 2NUZA 1QMCA 2DKGA 5CK9A 2QGFB 1PRLC 3C0CA 1U8RA 1FX7A 1WHGA 2KK4A 3SDZA 2A0FB 2P4RA 1QQJA 3CC7A 4L59A 4QQGA 1NLOC 3M0TA 1H3HA 4NL3A 1SEMA 2LRQA 5I11A 3M59A 2F2XA 4LDWA 3EGUA 3WVEB 3UA6A 3M0SA 1FXXA 3JCMW 3RMQA 2JM8A 1VQMQ 1VQ5T 2B8AA 4M78D 1RAGB 1BK2A 3UATA 3OS0A 4ZNXA 5A0DA 1IZ6A 2YUNA 3HL8A 1WYXA 2EVRA 2CZ7B 1X01A 1IHWA 4Z88A 2DRMA 3T9NA 2AZVA 1AT1B 4PJOB 4AT1B 2DL3A 2CP0A 3SD4A 2K5IA 2L5QA 2KROA 4FU6A 3FC3A 3CCSQ 1MV3A 2HQXA 1MGQA 4Z8AA 2EYQA 1UGPB 1QCFA 5GAN7 5C0MA 1X27A 1SHFA 2MWOA 1KD1R 5D7UA 5FU6B 4EDUA 1E6GA 2PUKB 2XK0A 4JJBA 2QA4A 3G4SQ 2ED0A 1WI7A 2RB6A 3L2VA 2BZ8A 5GAOn 1NBEB 1Z9ZA 2E6NA 4JPBW 4BE2A 3OYJA 1WFWA 3RIRA 1E6HA 2GFAA 4KH0B 3V8KA 2LX7A 4OB3B 1WIEA 3U23A 3L2UA 1ZUYA 2KY9A 4KUDK 1VQPQ 5KYXA 5CKHA 1VQKA 3LW5E 4HVWA 2CSQA 4ANJA 3X28B 4OB2B 1PD0A 2H3JA 2WSCE 3BE3A 2ZPEB 1YHQA 1Q7YC 5CVIA 1WHLA 3OYDA 1BBZA 5CAIA 2LCCA 3JB9D 5GAMf 2QG9B 2KXCA 4C8QE 2EW3A 3LGFA 4C0GA 1IGQA 2QDYB 2LJ3A 5LJ5d 4QQDA 2V8JA 2RJFA 2V8KA 2M16A 4AFUC 4M7DA 5FROA 2DL4A 2DBKA 3X24B 2NUPB 4RG2A 2PU9B 4DBFA 4DBQA 2QEXQ 3JAME 2CP7A 4X1VA 4M75E 3RKXA 1MMDA 1B7TA 2RQWA 3I5RA 3CPWS 1WQWA 2E3HA 3G6EQ 4M7DG 1NEGA 1OZ2A 1RUWA 4AFQC 2D6FA 2DD4A 5GANf 3SB2A 4M7DF 5GAOq 2VASA 2DNUA 4QVCA 2D1XA 1S72A 3QWYA 5KYUA 4IUTA 1MUZA 3JRZA 4X34A 4IUUA 3R6NA 3OSSC 4ZGEB 2YUPA 3O8VA 2GTJA 3VRZA 3CBMA 1KSWA 3A8LB 5KE2A 3CCJT 4II1A 3BY7A 2XDBA 3I5SA 5DM7R 2L89A 1OPLA 2P0KA 4WTOB 2EYWA 1VQKQ 2O9VA 1KG1A 2DPPB 5A0GA 4M7DC 5GAOr 4E6RA 3O5ZA 4AG2C 2K2VA 1WZOA 4A4GA 4RTWA 1UGQB 4E7HA 3LLRA 1GFCA 3GNFB 2V1RA 1D1BA 2DL8A 4MMKA 5GAN8 2VGNA 2RQTA 1JJ2P 9ATCB 4MZMA 2EBPA 3LYIA 3H6ZA 2BZYA 3JCMX 1C6VX 3EG0A 5CQXA 4J9HA 2RHXA 4BY6C 5GMKe 4EMKB 1Q95G 3JCMg 2E64A 2W0ZA 1R8OB 2E70A 2LQ8A 4XAXB 4ME7A 1VQNQ 3OYEA 5I21A 3CCUA 2EYZA 1NJIU 2RQUA 1RLQC 2KSSA 3CMEA 2JXBA 3QUIA 4ZGDB 2DAQA 3ZBDA 2J6FA 3SHWA 4JJCA 3R6OA 5HK0A 4M77A 3V8JA 2JTFA 6AT1B 1QVGS 4C92B 2L2PA 4A4EA 1KFZA 2D0NA 2PZ1A 2RQRA 1MV0B 3A8HB 4LD6A 4J6XA 3FDRA 1CKBA 2XHCA 4DA4A 3EG3A 2DYBA 3FIFA 1OU9A 2K6DA 4AG1C 1K9MR 1YFNA 4M77G 1M2VB 2E12A 4BE0A 1SKUB 4OMOA 2GF7A 5KYWA 5D6YA 3PGGA 1ARKA 2FPFA 3CMAT 4J9CA 5GAN4 2DTHA 3EG1A 2KEAA 1Y0MA 2CUBA 4A4HA 4OMLA 1ZX6A 1I0CA 5GAMd 1Q82C 1QVFP 2ZPGB 3X25B 4B6MA 2F5KA 4E2FB 3VYGA 4PJOE 1VYTA 2LP5A 4AMCA 3QSUA 5LJ3f 1HSQA 3OS2A 1SF9A 2O4XB 2R58A 5J26A 5IT9E 5A0LA 2ECZA 1TUGB 2COWA 4NL2A 3CC2T 3V7RA 5FRNA 2QQSA 2OJ2A 1VQLA 3CC4A 2F5TX 2QK0A 2EFIA 3M0PA 3QJ6A 3JB9I 2VVKA 3CCMA 4PJJA 1J3TA 2YRDA 3C94A 1K73C 3H0IA 3LGLA 1OX9A 1GFDA 4A63B 3JCMP 4KULA 1QCOA 3M54A 3CEYA 3REBB 5L8RE 3RNJA 1YI2A 2I2LA 4C0ZA 1M90C 3JCMJ 4DBRA 3NGPA 1TG0A 1N9SA 3VYHB 4B9XA 3TU4K 4M78F 3EAEA 1TXQA 2XDDA 1B07A 1FMWA 1G2BA 3VS7A 1U1SA 5GAOm 4PK4A 1X6OA 2EQMA 5KYNA 1Q86R 2DILA 1PNJA 1OX8A 2F69A 2PVOB 3I56A 1M1KU 4ZN1A 3S3MA 4KGZB 3TCJA 4CC3A 4AFZC 1VQOQ 4L5GA 4JRIA 3THKA 1UUEA 4IURA 1WXBA 1VQ4Q 2L3RA 2BE7D 4MDXA 1LJOA 4FL6A 3TEEA 2H8HA 2MMPA 3H41A 4VUBA 1MMGA 3JCMe 4M78C 1Y07A 2VXFA 2YWWA 2DERA 1TS9A 4LDUA 4BDZA 1X75C 2DK3A 2DM1A 4NOYA 4FIBA 3CXCS 2CZ0B 3CCLT 2RHUA 1ZA1B 3OBWA 5GAOl 3ZFJA 4ESRA 1D09B 2O2OA 2VV5A 1KQSA 2VC8A 2HKNA 1M1GA 3MEAA 3CCVA 1FWZA 2GTOA 1KD1U 2OTJT 2A28A 2DF6A 4KBMB 5FWBA 1VQ8T 3QIIA 4M75B 1ZBXA 1U3OA 3SWNA 2CGHA 2BTTA 2M9UA 3HRUA 1V1CA 1W6XA 2NWMA 4C5IA 2HCKA 3JB9G 4KRTA 1YITA 3E2UA 2CT3A 3X20B 2OTLT 3OYMA 2GGRA 4J9IA 2XG8D 3JB9F 5KCHA 2ESWA 2DIGA 2X35A 3HFOA 2CP3A 1H3ZA 3TVTA 5IHNA 3C4SA 2XMFA 1VQ9T 1GL5A 3OYAA 4ZN3A 4J9EA 2CSIA 1T3SA 4FSXA 4LUEA 3DLLA 1YJWT 3EH1A 1VQ6T 8AT1B 3H0HA 1N27A 1WNLA 3GBQA 2RK1A 1YJ9T 4X9DA 1BB9A 2YLBA 1YBYA 5GAMh 1VQMA 5LJ5f 1SSFA 3PFSA 1G3SA 2M1HA 5LJ3d 1MMAA 3MJXA 5CKEA 2RN8A 4FYVB 1ABOA 4CRIA 5EG2A 1BI0A 4J8OA 4M77D 5GMKl 4OGEA 4XTYA 4BI8B 1PKTA 2KYMA 1X2QA 1BU1A 3CCSA 1PWTA 3NTIA 3QHSA 4C92E 3CCQT 1OULA 3VJPA 2FVUA 2ATCB 3PT9A 2JS2A 2CP6A 3EG9B 4PJOD 1AZEA 4M7AC 1R77A 4BD3A 5GANh 2FG0A 3G4SA 2DXTA 1G3WA 2DJZA 1XOVA 1Q7YR 3UF4A 5KYYB 4HVVA 1OZ3A 4XU3A 3VU3C 3A98A 3EHQA 4A4FA 1UGSB 3RUXA 1VQPA 4FSSA 1FMVA 2WACA 1ZQ1A 2W10A 3M0QA 3QO3A 1UJYA 3G71Q 3OQ5A 2KI7A 1WHJA 1LVKA 5GJWB 4PNOA 2SRCA 1PM3A 1ZSZC 3GOXA 2YUQA 1RL2A 2L3QA 2QAZA 3PMTA 4J7FA 2K5LA 2RO0A 5GAN2 1D0ZA 2KVQG 3EGDA 1U1TA 5FU7C 2Y90A 3M0RA 1X69A 1BIAA 2XD0A 2J6OA 1AWJA 4RTTA 1IXDA 1K8AC 5J39A 3QPHA 4F7UB 1H641 1M3CA 1Y96B 1VQ9Q 3D7SB 1XJWB 1BKBA 1WQ7A 2QEXA 4HT9A 4A54A 2IIMA 4RKUE 3S3OA 4UC4A 2YDLA 1AD5A 2CZ6B 4DQ2A 2DJQA 2DL5A 3QWXX 3C12A 1YJWQ 2EYYA 2EAYA 2K79A 1VQ6Q 4R56A 4RTYA 2GQVA 1W4SA 2EKHA 4RTXA 3G6EA 1MNDA 2LTOA 2DA9A 1ZBJA 3KFVA 1KHIA 5A2QE 4PKCC 3VV0A 1SRMA 2QA4T 4PFPA 5CIUA 2VXEA 2QQ9A 3A8GB 4HT8A 3OW2A 3OYNA 1GCQA 4XTZA 1YIJQ 4C5HA 3OBYA 1EZZB 5M9OA 1WJQA 2RK2A 1B34B 1S1NA 2D0QB 4RTZA 1VOMA 1K9MU 3CBPA 4C8QA 5DY9A 2DEQA 3I55T 3FB9A 2A7YA 2L8DA 2KGTA 1YHQT 2FO0A 2DE0X 3NTHA 1BIBA 3JCMQ 1UE9A 2D8JA 4FCYA 2EJFA 2HL5C 3M57A 1VQ7T 2Y4XA 2EQJA 2RH2A 2O9SA 4QW2A 4M75A 2PVGB 2HMAA 2KDSA 2Y4YA 4C8QG 4ZTFA 4ELZC 2EJGA 1N8RC 2MF2A 1G3YA 1K4US 1UFFA 1Q81C 2E65A 1X43A 5LJ3h 3HHTB 2KMTA 2ZGWA 4M78B 2HEQA 5CKDA 2RJCA 4M75G 1KC8R 2MAMA 1VQNA 3OB9A 3RR6A 4LNPA 3QZ5B 2J7IA 3RERA 4F04B 2CP2A 3DLMA 4EPCA 3CCRT 4J6YA 2KT8A 2X3WD 1S72T 2DETA 2VWFA 2K5FA 2V26A 2P0PA 1VQ5Q 4Y92A 3FJ5A 3OYLA 2HL3A 2AIRB 4L6V5 5HY6A 3JCMf 1DJ7B 3VRYA 1HXDA 4JZ3A 2AHJB 1Q82R 1M1KC 4OMNA 4JLIA 3QBYA 4MDWA 1F1BB 2PUOB 3ASKA 3MHXA 1MNEA 2CS7A 1M5Q1 2FRYA 3ULRB 4GBQA 4KH1B 2JT4A 2RA2A 2EYXA 2DD5A 2LDMA 4XTUA 1KIKA 2QXFA 3E9GA 1YWPA 1M4ZA 3LX7A 1Q86U 5FLXE 3PIOA 4MZPA 1SRLA 1ZUUA 2KBTA 4FT4A 4XK8E 4CC7A 1OV3A 3EFRA 1IHVA 2YSQA 2EPDA 4D8DA 4KT0E 3QDRB 2FZKB 4BI4A 2JW4A 2OAWA 2NUTA 2DTOA 1K73R 2QTXA 4RCCA 4OGCA 3I9QA 1KD1C 3PE0A 3CXCP 4HXJA 3EG2A 1W2BP 2VGMA 3GP8A 2JTEA 3OYBA 3I55Q 3P8DA 2O88A 5IN1A 1M90R 2CT4A 4CC2A 5GAN3 2OI3A 3CMET 1C1AA 4DEYA 3EFOB 1TUDA 4XU1A 2VUBA 2YRVA 1VQ7Q 1P92A 4BUGA 4C0FA 4IUQA 3PMIA 2NYSA 2K7AA 2J05A 2XI9A 1AZGB 1R0BG 4O6JA 1D0YA 4WCIA 3M53A 4M7AB 2MIOA 1RAHB 2LX9A 4OF1A 1OI1A 1LCKA 2LT1A 2IG0A 2ZCFB 8ATCB 4R55A 4BDYA 1T0HA 4QQ6A 4N4HA 3M9QA 5EC7A 1NYGA 4AFSC 2A08A 4LXCA 1RAAB 4J83A 4CC4B 4OB1B 5I22A 5IXFA 2RQVA 4GY5A 4F17A 1K0SA 4FYYB 4OB0B 4PJOA 1HYOA 3HPWA 1ZSZB 3N5BB 1U06A 2LQWA 2FZCB 4M77F 5FU7B 3MEUA 4F7UE 3GLXA 2EGEA 4DEXA 3ZL7C 2YLCA 2KAFA 2E5KA 3M0UA 1VQOA 2DL7A 3M58A 3OS1A 1XQHA 3E9FA 4PJOG 1FMKA 4OMMA 1VQ4A 3MP1A 5LJ5h 4PJOF 4PFZA 1AEYA 1VQLT 3CC4T 1OU8A 1RI0A 1TU0B 1M1FA 3EH2A 5IAYA 2RHZA 1AVZC 1OEBA 2AKKA 1BI2A 3OYIA 3CCET 3CCJQ 3CCMT 1AWWA 2KRNA 3CMAA 4KGXB 2XIDA 3S3NA 4M77C 4N0AA 4JDSA 1M8MA 3MPUB 2COZA 1D3BB 3QZ9B 3GIBA 4DOWA 4C8QD 1YI2T 4D6WA 1N6AA 1UJ0A 5FW9A 5CCAA 1GBQA 3WVDB 3OYHA 1WXUA 1M27C 4J9BA 1Q7YU 2KE9A 3CD6T 2CH4A 1LPLA 2P0QA 1VYVA 4LDYA 2V8IA 4FT2A 3JCMd 2KT1A 1QLYA 3M56A 2NUPA 1Z9QA 4M75D 5GMKh 1A0NB 1G8XA 2FRWA 5AYFA 2DEUA 3ME9A 4E7KA 1JBMA 1TOVA 3I56T 3JCMc 2JTMA 4JJNK 2RF0A 1TSFA 3INZA 1UTIA 4FW2A 3GF5A 1KHCA 2AKLA 1YNZA 4J9GA 4M78E 3QYHB 1EIFA 2JVVA 5DLQE 2CH4W 2HQEA 1N5ZA 2XICA 2R57A 1PKSA 2RI2A 4BACA 4JRPA 2E4HA 1LOJA 4PJLA 4IIMA 5HK3A 2X4XA 3META 3VS1A 1YP5A 1HJDA 4MMLA 3CMAQ 2R5MA 2GBQA 2HBPA 1KQSS 2EKOA 3X26B 3PVLA 1JB0E 2DMOA 1RLPC 1YITT 2V1QA 2E1HA 1VIEA 1JJ2A 2XKOC 2YRCA 4BI3A 1W2BA 4HCCA 5KYXB 2CUDA 4F16A 3OYFA 2IVWA 3CCEQ 1NLPC 3CC2Q 1K8AR 3CCLA 1WLPB 2C06A 1NE8A 4N4GA 3G71A 4E47A 1W1FA 1M9SA 2C0OA 3QG1A 3CBOA 1WJRA 2AK5A 4EMKA 2KYBA 3UT1A 2X9HA 1ACMB 2EJ9A 3RKYA 2YT6A 5FWCA 3TQ7P 4Q5WA 1VQ8A 2ZPIB 2RI5A 3EFSA 3L1AA 3FEOA 2DZ9A 3E19A 4M7DB 2CYZB 3NMZC 1VQMT 3UA7A 2DRKA 3CD6Q 5I2SA 2LJ0A 3ER0A 3DB4A 5D6WA 1VYUA 1YJNT 4C92A 2K3XA 1VQ9A 1BI1A 2RPNA 4RTVA 4C0DC 4LE9A 1ZHIA 2DYIA 1KC8U 3WXMB 2RM4A 4K11A 3CCST 1C0MA 2RHYA 1YJWA 1VQ6A 3CPWP 4BY6B 4FYWB 4M7AE 2VB6A 1BCMA 1YN8A 3SWNC 2X4JA 1M8VA 1M2VA 2BZXA 4C92G 3J7AF 4LUDA 3DKMA 1TWBA 4XTXA 4F14A 3QJYA 2PQWA 5KYUB 4LN2A 4PJNA 1ZA2B 1QVFA 3G4ST 3OYKA 3I35A 1QVFS 1I8FA 4IUVA 4RMOA 4Y91A 3J80E 3MEWA 2F2WA 1YIJA 4EMKC 2VYTA 4C5EA 4EMHA 3MP6A 4PLIA 1Q82U 1I4K1 2M51A 4E7JA 2O31A 2O4XA 3JCMh 3IQLA 1VQPT 1BCOA 1K9AA 2K3YA 3OMCA 3H9NA 3EGXB 4IIOA 1N8RR 3HP9A 4Z89A 4JZ4A 4M4ZA 2HNIA 3CCLQ 3CCQA 3DB3A 1Q81R 5CQYA 5D6XA 3RDVA 4WF2A 1PC0A 4QVDA 3CC7T 2OTJQ 4BE1A 2KQWA 4GLMA 5GAMj 1UDLA 2LCSA 4ZGJB 1VIFA 1VQ8Q 3E1SA 4QVZA 2B86A 1K73U 1WJSA 3M55A 3NHNA 1QKWA 4XTWA 2A3LA 1LNXA 2OTLQ 3BDUA 2QEXT 1NJIC 4FYXB 3A5ZB 1N9RA 2P4TA 1E7OA 1AWOA 2MOXA 1M90U 4RTUA 2PTKA 1AHJB 5J3BA 1QWFA 2MPXC 2DIQA 4IKFA 3G6ET 1TH7A 1TUCA 1CKAA 3MP8A 4M77B 5KE3A 5GAOp 5GANj 1M1KR 4BB7A 4JLGA 1QVGP 4J6WA 2LQNA 3FLGA 2QI2A 3OA6A 1UEBA 4V2SA 1YJ9Q 1EFNA 4QKUA 1Y71A 4A53A 2ZAEA 1NEBA 1YJNQ 2JS0A 1UG1A 1VQ5A 2OAUA 1BYMA 3AHUA 2VKNA 3OW2S 2DX1A 3P8BB 1UHFA 2QASA 2P84A 2LC4A 1O9SA 2YUOA 5KYWB 3UDCA 2E3IA 1OYXA 1W70A 2BE9B 2I0NA 5C6SA 1VQKT 4JJDA 2L3SA 1GRIA 4ELYC 5CKBA 3SEMA 1WHMA 4XU0A 2QYZA 1NG2A 3CCQQ 2JMCA 2LT4A 2FB7A 3A1PA 3A8MB 1I5LA 3HTRA 1GXIE 3UWNA 4B9WA 2MI6A 1SG5A 1MMNA 3V7CA 2EQIA 2KRSA 2KRMA 2RJEA 2DBMA 1KJWA 5GAN5 4C8QF 1K76A 3HKSA 5HCKA 2H3EB 1GCPA 1NPPA 3LH5A 2C0IA 3I55A 1VQNT 2BIVA 2FHDA 4J9DA 3CC7Q 1X6GA 2HDAA 2AZSA 5L23A 1VQ7A 2ABLA 1UECA 2JNGA 1IGUA 4M75F 5CKFA 4NS5A 2K57A 1GCQC 1V29B 3HRTA 2BUDA 5GMKi 1JO8A 2AT1B 4HKEA 4C5GA 2SEMA 4C8QC 4OVAA 2LMJA 2DO3A 1EX4A 1HK9A 2QQAA 1AWXA 4FW1A 2F1LA 3CPFA 4XU2A 2D9TA 3VS4A 3CPWA 1KQ2A 4M7AD 5DLOA 4JUVA 2HKQB 1M3BA 1QP2A 2XU8A 3NTKA 3QDFA 4M7DE 4M75C 3BDLA 4C92D 2EQKA 3CCRA 2EGAA 2A37A 1M30A 1H8KA 1NPRA 4JRQA 2NLUA 3G1JA 2FPDA 1IO6A 4EIKA 2QA4Q 2RD1A 5LJ5e 1PSEA 5GAMg 3EG9A 2WSFE 5LJ3j 4HCKA 1SPKA 1Y7XA 1YWOA 1IB8A 2G3RA 1TTHB 1RAEB 3OY9A 3VUBA 1QP3A 1T3LA 1QKXA 3G7ZA 1ZSGA 4EMGA 4C0DB 4JRKA 1JRIA 5KYYA 2MYSA 2K4YA 4MZTA 3CCJA 3EGXA 3OS5A 2RNAA 4RG8A 2MCNA 1RAIB 1I1JA 1KQSP 3L2QA 1PRMC 2LQKA 3JCMV 2Z0WA 3CCUT 1G5VA 2FL7A 3SWNB 1YHQQ 3VUZA 3JB9J 1PHTA 2FPEA 5I2MA 2HAXA 3NFCA 3J81E 4P5NA 2J6KA 5GANg 1QVPA 1KK7A 3TSWA 1PCXA 1KQ1A 1X6BA 4DBHA 2FYKA 3CQTA 1WXTA 4HCZA 2CKKA 2FZGB 1K1ZA 5KH6A 4F7UA 1K8AU 4LD9K 2PVDB 2CZ1B 4X9CA 3HSBA 1G83A 1Y96A 1OQKA 4FM4B 3OSVA 2DFUA 1UHCA 2MWPA 1M3AA 1M2OA 2QTVA 2KR3A 2O01E 2ZZDA 1I5OB 1GBRA 2K2MA 3FRNA 1RACB 3QXEB 1QVGA 1WPYA 2LCLA 1O75A 5FRMA 1KC8C 3CCRQ 2E5QA 3VS2A 4F7UG 1SHGA 1S72Q 1VQOT 1YCYA 1V76A 1X2KA 4F7UF 3C95A 2LJ1A 1VQ4T 4YTLA 4TVRA 1QW1A 2IPOB 3MEVA 3REAB 1QWEA 2CREA 2DLPA 2ROLA 2ZPBB 2GQIA 2HSPA 4M77E 1JQQA 1NM7A 2GFUA 3M5AA 2G6FX 3KXTA 1FYNA 3BW1A 1B34A 1WHKA 4J7IA 3SFMA 2GCXA 4ATOA 1SSHA 1AOJA 2E6ZA 2FEIA 3RKWA 3EHRA 3TSZA 2X4WA 1PSFA 2KXDA 4KGVB 1ABQA 4PJMA 4OMQA 1R0CB 2ZPHB 2HD0A 4PL6A 2QDLA 2JJ9A 2XDPA 2WSEE 4OP0A 5IH2A 3JSCA 2DTIA 3L2WA 1JXMA 4PFOA 4XQ3A 4J5YA 3PIPA 1MHNA 2ENMA 4JS4A 1JXOA 4PJOC 3CCEA 2LNHB 1N8RU 5GAN6 3CC2A 5ECAA 2E10A 2EWNA 3GNGA 1I81A 1OOTA 3CCUQ 3EGDB 1Q81U 1UB4A 4M78A 3CMEQ 2JOYA 2DVJA 5HKCA 1PG5B 2L0AA 2EGCA 3VS6A 2X51A 5GANd 5LL6S 2K9GA 3OYCA 3UPUA 5FU6C 2MK5A 1ZUKA 3BFMA 5GAMe 3F70A 3LWHA 3H0FA 3M4YA 3RESA 3CD6A 2DXUA 2J06A 5LJ5j 2HZYA 4E7LA 4M78G 1G3TA 2L3PA 1D0XA 2QQBA 5IHKA 4IUPA
chains in the Genus database with same CATH topology
4XAXB 4ME7A 3OYKA 1QVFS 1I8FA 3OYEA 4IUVA 5I21A 4RMOA 3CCUA 2EJFA 3M57A 2RJDA 1VQ7T 4Y91A 2Y4XA 3J80E 1NJIU 5LJ3g 2EQJA 2RH2A 3MEWA 4QW2A 2KSSA 3CMEA 4M75A 2PVGB 2KDSA 1YIJA 3KUFA 2VYTA 3QUIA 2Y4YA 4N0AC 4C5EA 4EMHA 4C8QG 4EMKC 4ELZC 4ZGDB 2DAQA 3ZBDA 4ZTFA 3MP6A 4PLIA 2EJGA 1Q82U 1N8RC 1I4K1 4N4IA 4E7JA 2MF2A 1G3YA 2JN0A 2O4XA 3JCMh 3R6OA 1VQPT 4CI0C 5HK0A 4M77A 5KCOA 3V8JA 2JTFA 1QVGS 1Q81C 2K3YA 3OMCA 3ZEHA 4C92B 4JS5A 2E65A 4A4EA 3HP9A 3CCVT 5LJ3h 3HHTB 2KMTA 2HNIA 2ZGWA 3CCQA 4M78B 3DB3A 3CC4A 5CQYA 3A8HB 3HFNA 4LD6A 4J6XA 5D6XA 3FDRA 5GANe 2XHCA 5CKDA 2RJCA 4M75G 4WF2A 4QVDA 3CC7T 1IREB 3J7AF 4BE1A 1K9MC 2MAMA 2KQWA 5GAMj 4DA4A 1VQNA 3OB9A 3JB9F 3FIFA 5CR2A 4ZGJB 1VIFA 4M7DD 3E1SA 4QVZA 3QZ5B 4C8QB 3RERA 4M77G 5GMKj 1K73U 2JUFA 2E12A 3DLMA 3CXCA 1WJSA 3M55A 4EPCA 3CCRT 1JJ2S 4BE0A 4XTWA 2GF7A 1W2BS 4J6YA 5D6YA 3PGGA 1S72T 2A3LA 3CMAT 1LNXA 3G71T 3BDUA 2QEXT 5GAN4 1NJIC 2DTHA 2K5FA 3A5ZB 1N9RA 4LDVA 2P4TA 2P0PA 3M4GA 3OYLA 3L2ZA 4A4HA 3JB9H 1M90U 4Y28E 4KUIA 4L6V5 5HY6A 3JCMf 1DJ7B 5GAMd 1Q82C 1NZ9A 1UGRB 3A8OB 2ZPGB 3X25B 4ZTJA 2F5KA 1HXDA 3VYGA 2OTJA 1AHJB 4PJOE 5J3BA 2AHJB 2E41A 3QSUA 2DIQA 5LJ3f 1M1KC 4IKFA 3G6ET 3OS2A 2O4XB 2R58A 1TH7A 3QBYA 3QKJA 4JLIA 1BI3A 4MDWA 5J26A 2PUOB 3MP8A 4M77B 5KE3A 5IT9E 3ASKA 3MHXA 5GAOp 2CS7A 3TREA 1M5Q1 5A0LA 3H8ZA 3LWIA 5GANj 3Q1JA 4NL2A 2RA2A 3CC2T 3V7RA 5FRNA 2QQSA 2DD5A 2LDMA 4JLGA 4J6WA 4BB7A 4DOVA 3OMGA 1VQLA 4M7AA 4XTUA 3FLGA 2F5TX 2QI2A 1UEBA 2QXFA 3E9GA 1M4ZA 3LX7A 3OYYA 5FLXE 3PIOA 1Q86U 2EFIA 4MZPA 2OTLA 4V2SA 1Y71A 4A53A 3QJ6A 3JB9I 1XNIA 3CCMA 3HRSA 1VQ5A 2OAUA 3C94A 3FJPA 3RMSA 3URGA 5GMKm 1K73C 4FT4A 4E7IA 4XK8E 1VUBA 2DZCA 3P8HA 1BYMA 3AHUA 3LGLA 3EFRA 3JCMP 4KT0E 2X4YA 4KULA 3QDRB 4BI4A 3OW2S 3M54A 3P8BB 3L42A 2DTOA 3QYGB 3GPLA 2LC4A 2QTXA 4RCCA 2QQRA 1O9SA 2LVMA 4OGCA 3CEYA 3V7SA 3UDCA 1KD1C 1OYXA 2DVEA 5L8RE 1YI2A 4M7AG 2I2LA 4C0ZA 2M0OA 1M90C 4HCBA 5C6SA 3JCMJ 1VQKT 2VGMA 3GP8A 4M7AF 2R5AA 2YHTA 3OYBA 2LNVA 4ELYC 5CO7A 3P8DA 5CKBA 5IN1A 4O5VA 2DXCA 1YJ9A 2EQUA 4XU0A 3KBGA 4PLLA 4A4KA 1N9SA 2FB7A 2LT4A 3A8MB 3VYHB 2DXBA 5GAN3 4B9XA 3OYGA 3CMET 4C92F 1YJNA 1I5LA 1YIJT 3V8LA 1GXIE 3TU4K 4XU1A 3UWNA 2VUBA 4B9WA 2YRVA 4M78F 2JZ2A 3EAEA 2XDDA 1P92A 2MI6A 4BUGA 4C0FA 4IUQA 4Z02A 3PMIA 4GLKA 3PTAA 2XI9A 3G4ST 1Q86C 4O6JA 1U1SA 3S6WA 3V7CA 3M53A 5GAOm 4M7AB 1X6OA 2RJEA 2EQMA 2LX9A 4OF1A 1OI1A 5GAN5 4C8QF 3PNWC 3HKSA 2LT1A 3JCMb 2IG0A 2ZCFB 4R55A 4BDYA 3I56A 2F69A 2PVOB 4N4HA 3MO8A 1NPPA 4QQ6A 3I55A 4ZN1A 1XTDA 3M9QA 3S3MA 4LDXA 3TCJA 1VQNT 2BIVA 3VKIA 4L5GA 4JRIA 3MCAB 2FHDA 3LH0A 3L2RA 4HA8A 2EIFA 4J83A 4IURA 2RHIA 4OB1B 2L3RA 4MDXA 1LJOA 4C92C 4FL6A 3TEEA 1VQ7A 4XTVA 2JNGA 2MMPA 4GY5A 4RCBA 4VUBA 1D3BA 4M75F 5CKFA 3JCMe 4OB0B 1WGSA 4PJOA 4M78C 2ZPFB 4NS5A 2K57A 3HPWA 1Y07A 2VXFA 3N5BB 1V29B 3HRTA 2BUDA 2BKDN 4LDUA 4BDZA 1X75C 5GMKi 2DK3A 4NOYA 4FIBA 5LJ3e 3CXCS 2CZ0B 2RI3A 3CCLT 2RHUA 3OBWA 4M77F 5GAOl 4HKEA 4OMFB 3MEUA 5FU7B 3ZFJA 4C5GA 4F7UE 3GLXA 5LJ5g 2VV5A 2DKGA 1KQSA 5CK9A 2VC8A 1M1GA 4C8QC 1U8RA 2YLCA 1FX7A 3MEAA 4OVAA 3CCVA 1FWZA 2KAFA 2KK4A 1KD1U 2DO3A 2OTJT 3SDZA 1HK9A 1VQOA 3M58A 3OS1A 1XQHA 2QQAA 4KBMB 3E9FA 3QIIA 1VQ8T 4M75B 3CPFA 3CC7A 4XU2A 4PJOG 1ZBXA 2D9TA 4L59A 3SWNA 1VQ4A 3CPWA 2CGHA 1KQ2A 4M7AD 4QQGA 5DLOA 4JUVA 3MP1A 2M9UA 1QP2A 4PJOF 3HRUA 5LJ5h 4C5IA 4NL3A 3JB9G 2LRQA 1YITA 3M59A 2XU8A 3NTKA 3CC4T 1VQLT 1RI0A 4M7DE 3X20B 1M1FA 5IAYA 3OYMA 2OTLT 2RHZA 4LDWA 2XG8D 3BDLA 4M75C 4C92D 3WVEB 1BI2A 3OYIA 1FXXA 3JCMW 2EQKA 3HFOA 2DIGA 2X35A 3RMQA 5KCHA 3CCMT 3CCRA 1H3ZA 1VQ5T 3C4SA 2B8AA 4M78D 1NPRA 3CMAA 4JRQA 2NLUA 1VQ9T 2XIDA 3S3NA 4M77C 3OYAA 3OS0A 4N0AA 4ZN3A 5A0DA 1IZ6A 4FSXA 3HL8A 4JDSA 2CZ7B 1X01A 2RD1A 5LJ5e 1PSEA 3NTHA 5GAMg 3DLLA 1D3BB 2WSFE 3T9NA 5LJ3j 4PJOB 3QZ9B 3GIBA 1Y7XA 4DOWA 4C8QD 1YI2T 1YJWT 2G3RA 1VQ6T 4D6WA 3SD4A 1N27A 1WNLA 3OY9A 1N6AA 2K5IA 2L5QA 3VUBA 1QP3A 4FU6A 5CCAA 3WVDB 3OYHA 2RK1A 2HQXA 1MGQA 3FC3A 3G7ZA 2EYQA 4EMGA 1Q7YU 1UGPB 4C0DB 4JRKA 3CD6T 1JRIA 1YJ9T 2P0QA 5GAN7 5C0MA 4X9DA 2K4YA 2YLBA 4MZTA 4LDYA 3CCJA 1YBYA 2V8IA 4FT2A 2MWOA 3OS5A 5GAMh 4RG8A 1VQMA 3JCMd 5LJ5f 3M56A 1SSFA 3L2QA 2LQKA 4M75D 3PFSA 5FU6B 3JCMV 3CCUT 1G3SA 1G5VA 2FL7A 4EDUA 5GMKh 2M1HA 3SWNB 5LJ3d 5CKEA 3VUZA 2PUKB 3CCET 4CRIA 2XK0A 2QA4A 5EG2A 3JB9J 1BI0A 2RB6A 3L2VA 5I2MA 2HAXA 4J8OA 5GAOn 4M77D 2E6NA 3NFCA 5AYFA 4OGEA 4XTYA 4BI8B 5GMKl 3J81E 3ME9A 3OYJA 4BE2A 4E7KA 4P5NA 3RIRA 2GFAA 1JBMA 3V8KA 3CCSA 5GANg 4OB3B 3I56T 3JCMc 1QVPA 2JTMA 4JJNK 3NTIA 3QHSA 3L2UA 2KY9A 4KUDK 4C92E 5CKHA 3CCQT 1VQKA 1KQ1A 3INZA 3LW5E 2FYKA 3VJPA 3GF5A 4HCZA 3X28B 2FVUA 2CKKA 1KHCA 4M78E 5KH6A 3PT9A 4F7UA 1K8AU 4OB2B 2PVDB 2CZ1B 4X9CA 4LD9K 2H3JA 3HSBA 1Y96A 2WSCE 1EIFA 2JVVA 3QYHB 2HQEA 5DLQE 4M7AC 4PJOD 2XICA 2ZPEB 2R57A 3OSVA 4FM4B 4BD3A 5GANh 1YHQA 2MWPA 1Q7YC 5CVIA 3OYDA 3G4SA 2RI2A 2DXTA 2LCCA 5CAIA 5GAMf 4JRPA 4BACA 3JB9D 1G3WA 1LOJA 2O01E 2ZZDA 4C8QE 5HK3A 2DJZA 1XOVA 2X4XA 3FRNA 3LGFA 4C0GA 3QXEB 1QVGA 1WPYA 2LCLA 2QDYB 1OZ3A 4XU3A 3VU3C 5LJ5d 4QQDA 2V8JA 2RJFA 2V8KA 4A4FA 1O75A 5FRMA 1UGSB 2M16A 3RUXA 5FROA 1KC8C 4M7DA 1M1KU 2E5QA 3META 4F7UG 3X24B 4RG2A 1VQPA 4MMLA 2PU9B 2WACA 1VQOT 1ZQ1A 1YCYA 3QO3A 2R5MA 3OQ5A 4F7UF 4PNOA 3GOXA 2HBPA 3C95A 1KQSS 3JAME 1VQ4T 1RL2A 2EKOA 4YTLA 4M75E 4TVRA 3X26B 3PMTA 4J7FA 2K5LA 1QW1A 2RO0A 3RKXA 3MEVA 5GAN2 2KVQG 1JB0E 1YITT 2ZPBB 1U1TA 5FU7C 2Y90A 2E1HA 1VIEA 1BIAA 1JJ2A 2XD0A 2XKOC 4BI3A 1WQWA 3M5AA 2GFUA 4M77E 3CPWS 1W2BA 4HCCA 4M7DG 3KXTA 3BW1A 1K8AC 1B34A 4J7IA 5J39A 1OZ2A 3SFMA 2GCXA 3OYFA 2DD4A 3QPHA 2D6FA 4ATOA 5GANf 3SB2A 4M7DF 5GAOq 2IVWA 2E6ZA 4F7UB 1H641 3CCLA 3RKWA 1Y96B 4QVCA 2C06A 2X4WA 1S72A 1NE8A 1PSFA 4N4GA 1BKBA 4E47A 1WQ7A 3G71A 1M9SA 2QEXA 3QG1A 4HT9A 4A54A 3CBOA 1WJRA 4EMKA 3UT1A 4RKUE 3S3OA 4UC4A 4IUTA 3RKYA 2EJ9A 3JRZA 2CZ6B 4X34A 4DQ2A 4IUUA 4Q5WA 3OSSC 1VQ8A 2ZPIB 4ZGEB 2RI5A 2ZPHB 3C12A 2HD0A 4PL6A 2EAYA 3EFSA 4R56A 3L1AA 3FEOA 3O8VA 2XDPA 3CBMA 2WSEE 3A8LB 4OP0A 2GQVA 5KE2A 3OA6A 2DZ9A 3JSCA 1W4SA 3E19A 4M7DB 2DTIA 3CCJT 3L2WA 2CYZB 3G6EA 1VQMT 2LTOA 4II1A 3BY7A 4XQ3A 2XDBA 4J5YA 5I2SA 5DM7R 3PIPA 1MHNA 2L89A 3ER0A 3DB4A 4JS4A 4PJOC 2P0KA 3CCEA 5D6WA 1KHIA 5A2QE 5GAN6 1N8RU 3CC2A 4PKCC 2E10A 2EWNA 1KG1A 1YJNT 3VV0A 4C92A 3GNGA 2DPPB 2QA4T 5A0GA 4M7DC 5GAOr 2K3XA 5CIUA 1BI1A 2QQ9A 1I81A 2VXEA 3A8GB 1VQ9A 2K2VA 1Q81U 1UB4A 4M78A 4HT8A 4A4GA 3OW2A 3OYNA 4C0DC 1ZHIA 1UGQB 2JOYA 3LLRA 4XTZA 3WXMB 3GNFB 4E7HA 5HKCA 1KC8U 2RM4A 4C5HA 3CCST 3OBYA 2RHYA 5M9OA 5GANd 5LL6S 1WJQA 2RK2A 1B34B 1YJWA 1VQ6A 4MMKA 5GAN8 2D0QB 2VGNA 4BY6B 3OYCA 3UPUA 5FU6C 4MZMA 4M7AE 3LYIA 1K9MU 3H6ZA 3CBPA 4C8QA 5DY9A 3JCMX 3SWNC 2X4JA 3BFMA 5GAMe 3F70A 3LWHA 1M8VA 4C92G 3M4YA 2DEQA 5CQXA 3RESA 3FB9A 2DXUA 2RHXA 3I55T 3CD6A 3DKMA 5LJ5j 2A7YA 4XTXA 4E7LA 4BY6C 4M78G 5GMKe 2L8DA 3QJYA 2PQWA 4EMKB 1G3TA 3JCMg 2E64A 1YHQT 1R8OB 2QQBA 2E70A 1QVFA 1BIBA 2LQ8A 4IUPA 3JCMQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DTO A;  1I8F A;  4M75 C;  2QTX A;  1YCY A;  4RCC A;  3QO3 A;  2EJF A;  4C92 D;  5I21 A;  4Y91 A;  3JCM W;  3JB9 F;  3HFO A;  4F7U F;  3V7S A;  4PNO A;  5LJ3 g;  2DVE A;  4M7A G;  4M75 A;  2I2L A;  4M78 D;  4M7D D;  3QUI A;  4EMK C;  4M75 E;  4N0A C;  4EMH A;  4C8Q G;  3RKX A;  3JCM J;  5GAN 2;  2EJG A;  4M77 C;  4M7A F;  1I4K 1;  2YHT A;  4N0A A;  1U1T A;  2JN0 A;  2Y90 A;  3JCM h;  2E1H A;  1X01 A;  1BIA A;  2RD1 A;  4M77 A;  5LJ5 e;  4XU0 A;  3V8J A;  5GAM g;  1D3B B;  1WQW A;  1N9S A;  2FB7 A;  4M77 E;  5LJ3 j;  5GAN 3;  4C92 B;  3GIB A;  4PJO B;  2E65 A;  4C92 F;  4C8Q D;  4M7D G;  3BW1 A;  1I5L A;  5LJ3 h;  1B34 A;  1WNL A;  2HNI A;  3V8L A;  2ZGW A;  4M78 B;  4XU1 A;  5GAN f;  4M78 F;  3SB2 A;  4M7D F;  5GAO q;  1MGQ A;  3HFN A;  4J6X A;  5GAN e;  4F7U B;  1H64 1;  4WF2 A;  4M75 G;  4EMG A;  4QVD A;  3RKW A;  1Y96 B;  4QVC A;  4JRK A;  1JRI A;  1U1S A;  5GAM j;  5GAN 7;  1WQ7 A;  3V7C A;  4X9D A;  5GAO m;  2YLB A;  3FIF A;  4M7A B;  4HT9 A;  4A54 A;  5GAM h;  4EMK A;  3JCM d;  4C8Q B;  5LJ5 f;  3RKY A;  2EJ9 A;  4M77 G;  4C8Q F;  5GAN 5;  5GMK j;  3RER A;  4M75 D;  3JCM V;  4DQ2 A;  3JCM b;  5GMK h;  3SWN B;  2EAY A;  3EFS A;  4XTW A;  5LJ3 d;  3L1A A;  4J6Y A;  3PGG A;  1LNX A;  3JB9 J;  3BDU A;  2RB6 A;  4OP0 A;  2DZ9 A;  5GAN 4;  4M7D B;  4JRI A;  2DTI A;  2DTH A;  5GAO n;  4M77 D;  4HA8 A;  1N9R A;  4XQ3 A;  3BY7 A;  5GMK l;  4XTY A;  4J5Y A;  3M4G A;  3RIR A;  3L2Z A;  3JB9 H;  1LJO A;  4C92 C;  1JBM A;  4PJO C;  3V8K A;  4XTV A;  4RCB A;  5GAN g;  3JCM f;  5GAM d;  3JCM c;  5GAN 6;  1D3B A;  4M75 F;  2E10 A;  2EWN A;  3JCM e;  4C92 A;  3QHS A;  4M78 C;  4PJO A;  1HXD A;  2K57 A;  4M7D C;  2VXF A;  5GAO r;  2VXE A;  4C92 E;  1I81 A;  2E41 A;  4PJO E;  3QSU A;  1KQ1 A;  5LJ3 f;  3INZ A;  4M78 A;  2FYK A;  4HT8 A;  5GMK i;  4NOY A;  1TH7 A;  4JLI A;  4M78 E;  5LJ3 e;  4M77 B;  4F7U A;  4XTZ A;  4X9C A;  4M77 F;  3JCM Q;  5GAO l;  2RM4 A;  5GAO p;  3HSB A;  1M5Q 1;  1Y96 A;  4F7U E;  5LJ5 g;  4M7A C;  4PJO D;  5GAN j;  2DKG A;  4NL2 A;  5GAN d;  2VC8 A;  2RA2 A;  1B34 B;  3V7R A;  4C8Q C;  2YLC A;  5GAN h;  4J6W A;  4MMK A;  5GAN 8;  4M7A A;  4XTU A;  5CAI A;  2DXT A;  3JB9 D;  4M7A E;  5GAM f;  4V2S A;  4C8Q A;  1HK9 A;  5DY9 A;  3JCM X;  1LOJ A;  3SWN C;  4A53 A;  3BFM A;  1M8V A;  5GAM e;  4C8Q E;  3JB9 I;  2DJZ A;  4M75 B;  4XU2 A;  4PJO G;  2DEQ A;  4C92 G;  3RES A;  3FB9 A;  2DXU A;  3SWN A;  1WPY A;  3FJP A;  2CGH A;  5GMK m;  4XU3 A;  5LJ5 j;  1KQ2 A;  4M7A D;  3VU3 C;  5LJ5 d;  4JUV A;  2DZC A;  4XTX A;  3AHU A;  4M78 G;  3EFR A;  5GMK e;  5LJ5 h;  4PJO F;  4EMK B;  4NL3 A;  3JCM g;  3JCM P;  2E64 A;  3RUX A;  4M7D A;  3JB9 G;  4F7U G;  1BIB A;  4M7D E;  4MML A; 
#chains in the Genus database with same CATH topology
 2RJD A;  1IRX A;  5LJ3 g;  1UGV A;  4M7D D;  3KUF A;  4N0A C;  1T0J A;  4N4I A;  2JN0 A;  1OPK A;  2PNI A;  4CI0 C;  5KCO A;  3ZEH A;  4JS5 A;  2YXY A;  3CCV T;  1D1C A;  1H92 A;  3VS0 A;  3HFN A;  5GAN e;  4ORZ A;  1IRE B;  1K9M C;  2JMA A;  3OW2 P;  1PD1 A;  4QT7 A;  5IHI A;  1U5S A;  5CR2 A;  2RMO A;  4C8Q B;  5AT1 B;  5GMK j;  2JUF A;  3CXC A;  2M02 A;  1JJ2 S;  3JV3 A;  2M0Y A;  1W2B S;  1VQL Q;  3VS5 A;  1B3Q A;  3CC4 Q;  4D8K A;  3G71 T;  1VA7 A;  4E7Z A;  1RAF B;  1JU5 C;  4LDV A;  3CCM Q;  1RI9 A;  1WX6 A;  3M4G A;  3L2Z A;  3JB9 H;  2X3X D;  4Y28 E;  4KUI A;  1NJI R;  1JEG A;  1NZ9 A;  1UGR B;  3A8O B;  2CP5 A;  4ZTJ A;  2OTJ A;  2E41 A;  3EFO A;  1ZLM A;  3MKD A;  3QKJ A;  1BI3 A;  1YI2 Q;  3TRE A;  3H8Z A;  3LWI A;  1WHH A;  3Q1J A;  3NPF A;  2JM9 A;  4DOV A;  3OMG A;  4M7A A;  3OYY A;  2OTL A;  2HQH A;  2ROT A;  4RUG A;  1XNI A;  3HRS A;  2GNC A;  3RMS A;  3FJP A;  3URG A;  5GMK m;  4E7I A;  1VUB A;  2DZC A;  3P8H A;  1K0X A;  2ED1 A;  2X4Y A;  1HD3 A;  2HBW A;  4HVU A;  3L42 A;  3QYG B;  7AT1 B;  3GPL A;  1Y57 A;  2QQR A;  2LVM A;  3V7S A;  2DVE A;  4M7A G;  2HSE B;  2OX7 A;  2M0O A;  1D1A A;  4HCB A;  1ZSZ A;  1WA7 A;  4M7A F;  3I56 Q;  2R5A A;  2YHT A;  5GJV B;  2LNV A;  5CO7 A;  3AT1 B;  4O5V A;  2DXC A;  1YJ9 A;  2EQU A;  3KBG A;  4PLL A;  4A4K A;  2DXB A;  3OYG A;  1YCS B;  4C92 F;  2D8H A;  2F2V A;  1YJN A;  1YIJ T;  3V8L A;  1WDX A;  2QGG A;  2JZ2 A;  4Z02 A;  4GLK A;  2C0T A;  3PTA A;  1Q86 C;  2KNB B;  3S6W A;  1NYF A;  2A36 A;  3PNW C;  3JCM b;  3MO8 A;  1QCN A;  4LDX A;  3CCV Q;  1XTD A;  3VKI A;  2CDT A;  2COY A;  3RBB B;  3MCA B;  3LH0 A;  3L2R A;  4HA8 A;  2NUT B;  2EIF A;  2RHI A;  4J9F A;  4C92 C;  4R0K A;  4XTV A;  2LZ6 B;  4RCB A;  2K3B A;  3VS3 A;  1D3B A;  1WGS A;  4OMP A;  1YIT Q;  2ZPF B;  5IXB A;  4E7S A;  1CSK A;  2BKD N;  3PVQ A;  5LJ3 e;  1RAB B;  2RI3 A;  1RAD B;  4OMF B;  1I07 A;  5LJ5 g;  2NUZ A;  1QMC A;  2DKG A;  5CK9 A;  2QGF B;  1PRL C;  3C0C A;  1U8R A;  1FX7 A;  1WHG A;  2KK4 A;  3SDZ A;  2A0F B;  2P4R A;  1QQJ A;  3CC7 A;  4L59 A;  4QQG A;  1NLO C;  3M0T A;  1H3H A;  4NL3 A;  1SEM A;  2LRQ A;  5I11 A;  3M59 A;  2F2X A;  4LDW A;  3EGU A;  3WVE B;  3UA6 A;  3M0S A;  1FXX A;  3JCM W;  3RMQ A;  2JM8 A;  1VQM Q;  1VQ5 T;  2B8A A;  4M78 D;  1RAG B;  1BK2 A;  3UAT A;  3OS0 A;  4ZNX A;  5A0D A;  1IZ6 A;  2YUN A;  3HL8 A;  1WYX A;  2EVR A;  2CZ7 B;  1X01 A;  1IHW A;  4Z88 A;  2DRM A;  3T9N A;  2AZV A;  1AT1 B;  4PJO B;  4AT1 B;  2DL3 A;  2CP0 A;  3SD4 A;  2K5I A;  2L5Q A;  2KRO A;  4FU6 A;  3FC3 A;  3CCS Q;  1MV3 A;  2HQX A;  1MGQ A;  4Z8A A;  2EYQ A;  1UGP B;  1QCF A;  5GAN 7;  5C0M A;  1X27 A;  1SHF A;  2MWO A;  1KD1 R;  5D7U A;  5FU6 B;  4EDU A;  1E6G A;  2PUK B;  2XK0 A;  4JJB A;  2QA4 A;  3G4S Q;  2ED0 A;  1WI7 A;  2RB6 A;  3L2V A;  2BZ8 A;  5GAO n;  1NBE B;  1Z9Z A;  2E6N A;  4JPB W;  4BE2 A;  3OYJ A;  1WFW A;  3RIR A;  1E6H A;  2GFA A;  4KH0 B;  3V8K A;  2LX7 A;  4OB3 B;  1WIE A;  3U23 A;  3L2U A;  1ZUY A;  2KY9 A;  4KUD K;  1VQP Q;  5KYX A;  5CKH A;  1VQK A;  3LW5 E;  4HVW A;  2CSQ A;  4ANJ A;  3X28 B;  4OB2 B;  1PD0 A;  2H3J A;  2WSC E;  3BE3 A;  2ZPE B;  1YHQ A;  1Q7Y C;  5CVI A;  1WHL A;  3OYD A;  1BBZ A;  5CAI A;  2LCC A;  3JB9 D;  5GAM f;  2QG9 B;  2KXC A;  4C8Q E;  2EW3 A;  3LGF A;  4C0G A;  1IGQ A;  2QDY B;  2LJ3 A;  5LJ5 d;  4QQD A;  2V8J A;  2RJF A;  2V8K A;  2M16 A;  4AFU C;  4M7D A;  5FRO A;  2DL4 A;  2DBK A;  3X24 B;  2NUP B;  4RG2 A;  2PU9 B;  4DBF A;  4DBQ A;  2QEX Q;  3JAM E;  2CP7 A;  4X1V A;  4M75 E;  3RKX A;  1MMD A;  1B7T A;  2RQW A;  3I5R A;  3CPW S;  1WQW A;  2E3H A;  3G6E Q;  4M7D G;  1NEG A;  1OZ2 A;  1RUW A;  4AFQ C;  2D6F A;  2DD4 A;  5GAN f;  3SB2 A;  4M7D F;  5GAO q;  2VAS A;  2DNU A;  4QVC A;  2D1X A;  1S72 A;  3QWY A;  5KYU A;  4IUT A;  1MUZ A;  3JRZ A;  4X34 A;  4IUU A;  3R6N A;  3OSS C;  4ZGE B;  2YUP A;  3O8V A;  2GTJ A;  3VRZ A;  3CBM A;  1KSW A;  3A8L B;  5KE2 A;  3CCJ T;  4II1 A;  3BY7 A;  2XDB A;  3I5S A;  5DM7 R;  2L89 A;  1OPL A;  2P0K A;  4WTO B;  2EYW A;  1VQK Q;  2O9V A;  1KG1 A;  2DPP B;  5A0G A;  4M7D C;  5GAO r;  4E6R A;  3O5Z A;  4AG2 C;  2K2V A;  1WZO A;  4A4G A;  4RTW A;  1UGQ B;  4E7H A;  3LLR A;  1GFC A;  3GNF B;  2V1R A;  1D1B A;  2DL8 A;  4MMK A;  5GAN 8;  2VGN A;  2RQT A;  1JJ2 P;  9ATC B;  4MZM A;  2EBP A;  3LYI A;  3H6Z A;  2BZY A;  3JCM X;  1C6V X;  3EG0 A;  5CQX A;  4J9H A;  2RHX A;  4BY6 C;  5GMK e;  4EMK B;  1Q95 G;  3JCM g;  2E64 A;  2W0Z A;  1R8O B;  2E70 A;  2LQ8 A;  4XAX B;  4ME7 A;  1VQN Q;  3OYE A;  5I21 A;  3CCU A;  2EYZ A;  1NJI U;  2RQU A;  1RLQ C;  2KSS A;  3CME A;  2JXB A;  3QUI A;  4ZGD B;  2DAQ A;  3ZBD A;  2J6F A;  3SHW A;  4JJC A;  3R6O A;  5HK0 A;  4M77 A;  3V8J A;  2JTF A;  6AT1 B;  1QVG S;  4C92 B;  2L2P A;  4A4E A;  1KFZ A;  2D0N A;  2PZ1 A;  2RQR A;  1MV0 B;  3A8H B;  4LD6 A;  4J6X A;  3FDR A;  1CKB A;  2XHC A;  4DA4 A;  3EG3 A;  2DYB A;  3FIF A;  1OU9 A;  2K6D A;  4AG1 C;  1K9M R;  1YFN A;  4M77 G;  1M2V B;  2E12 A;  4BE0 A;  1SKU B;  4OMO A;  2GF7 A;  5KYW A;  5D6Y A;  3PGG A;  1ARK A;  2FPF A;  3CMA T;  4J9C A;  5GAN 4;  2DTH A;  3EG1 A;  2KEA A;  1Y0M A;  2CUB A;  4A4H A;  4OML A;  1ZX6 A;  1I0C A;  5GAM d;  1Q82 C;  1QVF P;  2ZPG B;  3X25 B;  4B6M A;  2F5K A;  4E2F B;  3VYG A;  4PJO E;  1VYT A;  2LP5 A;  4AMC A;  3QSU A;  5LJ3 f;  1HSQ A;  3OS2 A;  1SF9 A;  2O4X B;  2R58 A;  5J26 A;  5IT9 E;  5A0L A;  2ECZ A;  1TUG B;  2COW A;  4NL2 A;  3CC2 T;  3V7R A;  5FRN A;  2QQS A;  2OJ2 A;  1VQL A;  3CC4 A;  2F5T X;  2QK0 A;  2EFI A;  3M0P A;  3QJ6 A;  3JB9 I;  2VVK A;  3CCM A;  4PJJ A;  1J3T A;  2YRD A;  3C94 A;  1K73 C;  3H0I A;  3LGL A;  1OX9 A;  1GFD A;  4A63 B;  3JCM P;  4KUL A;  1QCO A;  3M54 A;  3CEY A;  3REB B;  5L8R E;  3RNJ A;  1YI2 A;  2I2L A;  4C0Z A;  1M90 C;  3JCM J;  4DBR A;  3NGP A;  1TG0 A;  1N9S A;  3VYH B;  4B9X A;  3TU4 K;  4M78 F;  3EAE A;  1TXQ A;  2XDD A;  1B07 A;  1FMW A;  1G2B A;  3VS7 A;  1U1S A;  5GAO m;  4PK4 A;  1X6O A;  2EQM A;  5KYN A;  1Q86 R;  2DIL A;  1PNJ A;  1OX8 A;  2F69 A;  2PVO B;  3I56 A;  1M1K U;  4ZN1 A;  3S3M A;  4KGZ B;  3TCJ A;  4CC3 A;  4AFZ C;  1VQO Q;  4L5G A;  4JRI A;  3THK A;  1UUE A;  4IUR A;  1WXB A;  1VQ4 Q;  2L3R A;  2BE7 D;  4MDX A;  1LJO A;  4FL6 A;  3TEE A;  2H8H A;  2MMP A;  3H41 A;  4VUB A;  1MMG A;  3JCM e;  4M78 C;  1Y07 A;  2VXF A;  2YWW A;  2DER A;  1TS9 A;  4LDU A;  4BDZ A;  1X75 C;  2DK3 A;  2DM1 A;  4NOY A;  4FIB A;  3CXC S;  2CZ0 B;  3CCL T;  2RHU A;  1ZA1 B;  3OBW A;  5GAO l;  3ZFJ A;  4ESR A;  1D09 B;  2O2O A;  2VV5 A;  1KQS A;  2VC8 A;  2HKN A;  1M1G A;  3MEA A;  3CCV A;  1FWZ A;  2GTO A;  1KD1 U;  2OTJ T;  2A28 A;  2DF6 A;  4KBM B;  5FWB A;  1VQ8 T;  3QII A;  4M75 B;  1ZBX A;  1U3O A;  3SWN A;  2CGH A;  2BTT A;  2M9U A;  3HRU A;  1V1C A;  1W6X A;  2NWM A;  4C5I A;  2HCK A;  3JB9 G;  4KRT A;  1YIT A;  3E2U A;  2CT3 A;  3X20 B;  2OTL T;  3OYM A;  2GGR A;  4J9I A;  2XG8 D;  3JB9 F;  5KCH A;  2ESW A;  2DIG A;  2X35 A;  3HFO A;  2CP3 A;  1H3Z A;  3TVT A;  5IHN A;  3C4S A;  2XMF A;  1VQ9 T;  1GL5 A;  3OYA A;  4ZN3 A;  4J9E A;  2CSI A;  1T3S A;  4FSX A;  4LUE A;  3DLL A;  1YJW T;  3EH1 A;  1VQ6 T;  8AT1 B;  3H0H A;  1N27 A;  1WNL A;  3GBQ A;  2RK1 A;  1YJ9 T;  4X9D A;  1BB9 A;  2YLB A;  1YBY A;  5GAM h;  1VQM A;  5LJ5 f;  1SSF A;  3PFS A;  1G3S A;  2M1H A;  5LJ3 d;  1MMA A;  3MJX A;  5CKE A;  2RN8 A;  4FYV B;  1ABO A;  4CRI A;  5EG2 A;  1BI0 A;  4J8O A;  4M77 D;  5GMK l;  4OGE A;  4XTY A;  4BI8 B;  1PKT A;  2KYM A;  1X2Q A;  1BU1 A;  3CCS A;  1PWT A;  3NTI A;  3QHS A;  4C92 E;  3CCQ T;  1OUL A;  3VJP A;  2FVU A;  2ATC B;  3PT9 A;  2JS2 A;  2CP6 A;  3EG9 B;  4PJO D;  1AZE A;  4M7A C;  1R77 A;  4BD3 A;  5GAN h;  2FG0 A;  3G4S A;  2DXT A;  1G3W A;  2DJZ A;  1XOV A;  1Q7Y R;  3UF4 A;  5KYY B;  4HVV A;  1OZ3 A;  4XU3 A;  3VU3 C;  3A98 A;  3EHQ A;  4A4F A;  1UGS B;  3RUX A;  1VQP A;  4FSS A;  1FMV A;  2WAC A;  1ZQ1 A;  2W10 A;  3M0Q A;  3QO3 A;  1UJY A;  3G71 Q;  3OQ5 A;  2KI7 A;  1WHJ A;  1LVK A;  5GJW B;  4PNO A;  2SRC A;  1PM3 A;  1ZSZ C;  3GOX A;  2YUQ A;  1RL2 A;  2L3Q A;  2QAZ A;  3PMT A;  4J7F A;  2K5L A;  2RO0 A;  5GAN 2;  1D0Z A;  2KVQ G;  3EGD A;  1U1T A;  5FU7 C;  2Y90 A;  3M0R A;  1X69 A;  1BIA A;  2XD0 A;  2J6O A;  1AWJ A;  4RTT A;  1IXD A;  1K8A C;  5J39 A;  3QPH A;  4F7U B;  1H64 1;  1M3C A;  1Y96 B;  1VQ9 Q;  3D7S B;  1XJW B;  1BKB A;  1WQ7 A;  2QEX A;  4HT9 A;  4A54 A;  2IIM A;  4RKU E;  3S3O A;  4UC4 A;  2YDL A;  1AD5 A;  2CZ6 B;  4DQ2 A;  2DJQ A;  2DL5 A;  3QWX X;  3C12 A;  1YJW Q;  2EYY A;  2EAY A;  2K79 A;  1VQ6 Q;  4R56 A;  4RTY A;  2GQV A;  1W4S A;  2EKH A;  4RTX A;  3G6E A;  1MND A;  2LTO A;  2DA9 A;  1ZBJ A;  3KFV A;  1KHI A;  5A2Q E;  4PKC C;  3VV0 A;  1SRM A;  2QA4 T;  4PFP A;  5CIU A;  2VXE A;  2QQ9 A;  3A8G B;  4HT8 A;  3OW2 A;  3OYN A;  1GCQ A;  4XTZ A;  1YIJ Q;  4C5H A;  3OBY A;  1EZZ B;  5M9O A;  1WJQ A;  2RK2 A;  1B34 B;  1S1N A;  2D0Q B;  4RTZ A;  1VOM A;  1K9M U;  3CBP A;  4C8Q A;  5DY9 A;  2DEQ A;  3I55 T;  3FB9 A;  2A7Y A;  2L8D A;  2KGT A;  1YHQ T;  2FO0 A;  2DE0 X;  3NTH A;  1BIB A;  3JCM Q;  1UE9 A;  2D8J A;  4FCY A;  2EJF A;  2HL5 C;  3M57 A;  1VQ7 T;  2Y4X A;  2EQJ A;  2RH2 A;  2O9S A;  4QW2 A;  4M75 A;  2PVG B;  2HMA A;  2KDS A;  2Y4Y A;  4C8Q G;  4ZTF A;  4ELZ C;  2EJG A;  1N8R C;  2MF2 A;  1G3Y A;  1K4U S;  1UFF A;  1Q81 C;  2E65 A;  1X43 A;  5LJ3 h;  3HHT B;  2KMT A;  2ZGW A;  4M78 B;  2HEQ A;  5CKD A;  2RJC A;  4M75 G;  1KC8 R;  2MAM A;  1VQN A;  3OB9 A;  3RR6 A;  4LNP A;  3QZ5 B;  2J7I A;  3RER A;  4F04 B;  2CP2 A;  3DLM A;  4EPC A;  3CCR T;  4J6Y A;  2KT8 A;  2X3W D;  1S72 T;  2DET A;  2VWF A;  2K5F A;  2V26 A;  2P0P A;  1VQ5 Q;  4Y92 A;  3FJ5 A;  3OYL A;  2HL3 A;  2AIR B;  4L6V 5;  5HY6 A;  3JCM f;  1DJ7 B;  3VRY A;  1HXD A;  4JZ3 A;  2AHJ B;  1Q82 R;  1M1K C;  4OMN A;  4JLI A;  3QBY A;  4MDW A;  1F1B B;  2PUO B;  3ASK A;  3MHX A;  1MNE A;  2CS7 A;  1M5Q 1;  2FRY A;  3ULR B;  4GBQ A;  4KH1 B;  2JT4 A;  2RA2 A;  2EYX A;  2DD5 A;  2LDM A;  4XTU A;  1KIK A;  2QXF A;  3E9G A;  1YWP A;  1M4Z A;  3LX7 A;  1Q86 U;  5FLX E;  3PIO A;  4MZP A;  1SRL A;  1ZUU A;  2KBT A;  4FT4 A;  4XK8 E;  4CC7 A;  1OV3 A;  3EFR A;  1IHV A;  2YSQ A;  2EPD A;  4D8D A;  4KT0 E;  3QDR B;  2FZK B;  4BI4 A;  2JW4 A;  2OAW A;  2NUT A;  2DTO A;  1K73 R;  2QTX A;  4RCC A;  4OGC A;  3I9Q A;  1KD1 C;  3PE0 A;  3CXC P;  4HXJ A;  3EG2 A;  1W2B P;  2VGM A;  3GP8 A;  2JTE A;  3OYB A;  3I55 Q;  3P8D A;  2O88 A;  5IN1 A;  1M90 R;  2CT4 A;  4CC2 A;  5GAN 3;  2OI3 A;  3CME T;  1C1A A;  4DEY A;  3EFO B;  1TUD A;  4XU1 A;  2VUB A;  2YRV A;  1VQ7 Q;  1P92 A;  4BUG A;  4C0F A;  4IUQ A;  3PMI A;  2NYS A;  2K7A A;  2J05 A;  2XI9 A;  1AZG B;  1R0B G;  4O6J A;  1D0Y A;  4WCI A;  3M53 A;  4M7A B;  2MIO A;  1RAH B;  2LX9 A;  4OF1 A;  1OI1 A;  1LCK A;  2LT1 A;  2IG0 A;  2ZCF B;  8ATC B;  4R55 A;  4BDY A;  1T0H A;  4QQ6 A;  4N4H A;  3M9Q A;  5EC7 A;  1NYG A;  4AFS C;  2A08 A;  4LXC A;  1RAA B;  4J83 A;  4CC4 B;  4OB1 B;  5I22 A;  5IXF A;  2RQV A;  4GY5 A;  4F17 A;  1K0S A;  4FYY B;  4OB0 B;  4PJO A;  1HYO A;  3HPW A;  1ZSZ B;  3N5B B;  1U06 A;  2LQW A;  2FZC B;  4M77 F;  5FU7 B;  3MEU A;  4F7U E;  3GLX A;  2EGE A;  4DEX A;  3ZL7 C;  2YLC A;  2KAF A;  2E5K A;  3M0U A;  1VQO A;  2DL7 A;  3M58 A;  3OS1 A;  1XQH A;  3E9F A;  4PJO G;  1FMK A;  4OMM A;  1VQ4 A;  3MP1 A;  5LJ5 h;  4PJO F;  4PFZ A;  1AEY A;  1VQL T;  3CC4 T;  1OU8 A;  1RI0 A;  1TU0 B;  1M1F A;  3EH2 A;  5IAY A;  2RHZ A;  1AVZ C;  1OEB A;  2AKK A;  1BI2 A;  3OYI A;  3CCE T;  3CCJ Q;  3CCM T;  1AWW A;  2KRN A;  3CMA A;  4KGX B;  2XID A;  3S3N A;  4M77 C;  4N0A A;  4JDS A;  1M8M A;  3MPU B;  2COZ A;  1D3B B;  3QZ9 B;  3GIB A;  4DOW A;  4C8Q D;  1YI2 T;  4D6W A;  1N6A A;  1UJ0 A;  5FW9 A;  5CCA A;  1GBQ A;  3WVD B;  3OYH A;  1WXU A;  1M27 C;  4J9B A;  1Q7Y U;  2KE9 A;  3CD6 T;  2CH4 A;  1LPL A;  2P0Q A;  1VYV A;  4LDY A;  2V8I A;  4FT2 A;  3JCM d;  2KT1 A;  1QLY A;  3M56 A;  2NUP A;  1Z9Q A;  4M75 D;  5GMK h;  1A0N B;  1G8X A;  2FRW A;  5AYF A;  2DEU A;  3ME9 A;  4E7K A;  1JBM A;  1TOV A;  3I56 T;  3JCM c;  2JTM A;  4JJN K;  2RF0 A;  1TSF A;  3INZ A;  1UTI A;  4FW2 A;  3GF5 A;  1KHC A;  2AKL A;  1YNZ A;  4J9G A;  4M78 E;  3QYH B;  1EIF A;  2JVV A;  5DLQ E;  2CH4 W;  2HQE A;  1N5Z A;  2XIC A;  2R57 A;  1PKS A;  2RI2 A;  4BAC A;  4JRP A;  2E4H A;  1LOJ A;  4PJL A;  4IIM A;  5HK3 A;  2X4X A;  3MET A;  3VS1 A;  1YP5 A;  1HJD A;  4MML A;  3CMA Q;  2R5M A;  2GBQ A;  2HBP A;  1KQS S;  2EKO A;  3X26 B;  3PVL A;  1JB0 E;  2DMO A;  1RLP C;  1YIT T;  2V1Q A;  2E1H A;  1VIE A;  1JJ2 A;  2XKO C;  2YRC A;  4BI3 A;  1W2B A;  4HCC A;  5KYX B;  2CUD A;  4F16 A;  3OYF A;  2IVW A;  3CCE Q;  1NLP C;  3CC2 Q;  1K8A R;  3CCL A;  1WLP B;  2C06 A;  1NE8 A;  4N4G A;  3G71 A;  4E47 A;  1W1F A;  1M9S A;  2C0O A;  3QG1 A;  3CBO A;  1WJR A;  2AK5 A;  4EMK A;  2KYB A;  3UT1 A;  2X9H A;  1ACM B;  2EJ9 A;  3RKY A;  2YT6 A;  5FWC A;  3TQ7 P;  4Q5W A;  1VQ8 A;  2ZPI B;  2RI5 A;  3EFS A;  3L1A A;  3FEO A;  2DZ9 A;  3E19 A;  4M7D B;  2CYZ B;  3NMZ C;  1VQM T;  3UA7 A;  2DRK A;  3CD6 Q;  5I2S A;  2LJ0 A;  3ER0 A;  3DB4 A;  5D6W A;  1VYU A;  1YJN T;  4C92 A;  2K3X A;  1VQ9 A;  1BI1 A;  2RPN A;  4RTV A;  4C0D C;  4LE9 A;  1ZHI A;  2DYI A;  1KC8 U;  3WXM B;  2RM4 A;  4K11 A;  3CCS T;  1C0M A;  2RHY A;  1YJW A;  1VQ6 A;  3CPW P;  4BY6 B;  4FYW B;  4M7A E;  2VB6 A;  1BCM A;  1YN8 A;  3SWN C;  2X4J A;  1M8V A;  1M2V A;  2BZX A;  4C92 G;  3J7A F;  4LUD A;  3DKM A;  1TWB A;  4XTX A;  4F14 A;  3QJY A;  2PQW A;  5KYU B;  4LN2 A;  4PJN A;  1ZA2 B;  1QVF A;  3G4S T;  3OYK A;  3I35 A;  1QVF S;  1I8F A;  4IUV A;  4RMO A;  4Y91 A;  3J80 E;  3MEW A;  2F2W A;  1YIJ A;  4EMK C;  2VYT A;  4C5E A;  4EMH A;  3MP6 A;  4PLI A;  1Q82 U;  1I4K 1;  2M51 A;  4E7J A;  2O31 A;  2O4X A;  3JCM h;  3IQL A;  1VQP T;  1BCO A;  1K9A A;  2K3Y A;  3OMC A;  3H9N A;  3EGX B;  4IIO A;  1N8R R;  3HP9 A;  4Z89 A;  4JZ4 A;  4M4Z A;  2HNI A;  3CCL Q;  3CCQ A;  3DB3 A;  1Q81 R;  5CQY A;  5D6X A;  3RDV A;  4WF2 A;  1PC0 A;  4QVD A;  3CC7 T;  2OTJ Q;  4BE1 A;  2KQW A;  4GLM A;  5GAM j;  1UDL A;  2LCS A;  4ZGJ B;  1VIF A;  1VQ8 Q;  3E1S A;  4QVZ A;  2B86 A;  1K73 U;  1WJS A;  3M55 A;  3NHN A;  1QKW A;  4XTW A;  2A3L A;  1LNX A;  2OTL Q;  3BDU A;  2QEX T;  1NJI C;  4FYX B;  3A5Z B;  1N9R A;  2P4T A;  1E7O A;  1AWO A;  2MOX A;  1M90 U;  4RTU A;  2PTK A;  1AHJ B;  5J3B A;  1QWF A;  2MPX C;  2DIQ A;  4IKF A;  3G6E T;  1TH7 A;  1TUC A;  1CKA A;  3MP8 A;  4M77 B;  5KE3 A;  5GAO p;  5GAN j;  1M1K R;  4BB7 A;  4JLG A;  1QVG P;  4J6W A;  2LQN A;  3FLG A;  2QI2 A;  3OA6 A;  1UEB A;  4V2S A;  1YJ9 Q;  1EFN A;  4QKU A;  1Y71 A;  4A53 A;  2ZAE A;  1NEB A;  1YJN Q;  2JS0 A;  1UG1 A;  1VQ5 A;  2OAU A;  1BYM A;  3AHU A;  2VKN A;  3OW2 S;  2DX1 A;  3P8B B;  1UHF A;  2QAS A;  2P84 A;  2LC4 A;  1O9S A;  2YUO A;  5KYW B;  3UDC A;  2E3I A;  1OYX A;  1W70 A;  2BE9 B;  2I0N A;  5C6S A;  1VQK T;  4JJD A;  2L3S A;  1GRI A;  4ELY C;  5CKB A;  3SEM A;  1WHM A;  4XU0 A;  2QYZ A;  1NG2 A;  3CCQ Q;  2JMC A;  2LT4 A;  2FB7 A;  3A1P A;  3A8M B;  1I5L A;  3HTR A;  1GXI E;  3UWN A;  4B9W A;  2MI6 A;  1SG5 A;  1MMN A;  3V7C A;  2EQI A;  2KRS A;  2KRM A;  2RJE A;  2DBM A;  1KJW A;  5GAN 5;  4C8Q F;  1K76 A;  3HKS A;  5HCK A;  2H3E B;  1GCP A;  1NPP A;  3LH5 A;  2C0I A;  3I55 A;  1VQN T;  2BIV A;  2FHD A;  4J9D A;  3CC7 Q;  1X6G A;  2HDA A;  2AZS A;  5L23 A;  1VQ7 A;  2ABL A;  1UEC A;  2JNG A;  1IGU A;  4M75 F;  5CKF A;  4NS5 A;  2K57 A;  1GCQ C;  1V29 B;  3HRT A;  2BUD A;  5GMK i;  1JO8 A;  2AT1 B;  4HKE A;  4C5G A;  2SEM A;  4C8Q C;  4OVA A;  2LMJ A;  2DO3 A;  1EX4 A;  1HK9 A;  2QQA A;  1AWX A;  4FW1 A;  2F1L A;  3CPF A;  4XU2 A;  2D9T A;  3VS4 A;  3CPW A;  1KQ2 A;  4M7A D;  5DLO A;  4JUV A;  2HKQ B;  1M3B A;  1QP2 A;  2XU8 A;  3NTK A;  3QDF A;  4M7D E;  4M75 C;  3BDL A;  4C92 D;  2EQK A;  3CCR A;  2EGA A;  2A37 A;  1M30 A;  1H8K A;  1NPR A;  4JRQ A;  2NLU A;  3G1J A;  2FPD A;  1IO6 A;  4EIK A;  2QA4 Q;  2RD1 A;  5LJ5 e;  1PSE A;  5GAM g;  3EG9 A;  2WSF E;  5LJ3 j;  4HCK A;  1SPK A;  1Y7X A;  1YWO A;  1IB8 A;  2G3R A;  1TTH B;  1RAE B;  3OY9 A;  3VUB A;  1QP3 A;  1T3L A;  1QKX A;  3G7Z A;  1ZSG A;  4EMG A;  4C0D B;  4JRK A;  1JRI A;  5KYY A;  2MYS A;  2K4Y A;  4MZT A;  3CCJ A;  3EGX A;  3OS5 A;  2RNA A;  4RG8 A;  2MCN A;  1RAI B;  1I1J A;  1KQS P;  3L2Q A;  1PRM C;  2LQK A;  3JCM V;  2Z0W A;  3CCU T;  1G5V A;  2FL7 A;  3SWN B;  1YHQ Q;  3VUZ A;  3JB9 J;  1PHT A;  2FPE A;  5I2M A;  2HAX A;  3NFC A;  3J81 E;  4P5N A;  2J6K A;  5GAN g;  1QVP A;  1KK7 A;  3TSW A;  1PCX A;  1KQ1 A;  1X6B A;  4DBH A;  2FYK A;  3CQT A;  1WXT A;  4HCZ A;  2CKK A;  2FZG B;  1K1Z A;  5KH6 A;  4F7U A;  1K8A U;  4LD9 K;  2PVD B;  2CZ1 B;  4X9C A;  3HSB A;  1G83 A;  1Y96 A;  1OQK A;  4FM4 B;  3OSV A;  2DFU A;  1UHC A;  2MWP A;  1M3A A;  1M2O A;  2QTV A;  2KR3 A;  2O01 E;  2ZZD A;  1I5O B;  1GBR A;  2K2M A;  3FRN A;  1RAC B;  3QXE B;  1QVG A;  1WPY A;  2LCL A;  1O75 A;  5FRM A;  1KC8 C;  3CCR Q;  2E5Q A;  3VS2 A;  4F7U G;  1SHG A;  1S72 Q;  1VQO T;  1YCY A;  1V76 A;  1X2K A;  4F7U F;  3C95 A;  2LJ1 A;  1VQ4 T;  4YTL A;  4TVR A;  1QW1 A;  2IPO B;  3MEV A;  3REA B;  1QWE A;  2CRE A;  2DLP A;  2ROL A;  2ZPB B;  2GQI A;  2HSP A;  4M77 E;  1JQQ A;  1NM7 A;  2GFU A;  3M5A A;  2G6F X;  3KXT A;  1FYN A;  3BW1 A;  1B34 A;  1WHK A;  4J7I A;  3SFM A;  2GCX A;  4ATO A;  1SSH A;  1AOJ A;  2E6Z A;  2FEI A;  3RKW A;  3EHR A;  3TSZ A;  2X4W A;  1PSF A;  2KXD A;  4KGV B;  1ABQ A;  4PJM A;  4OMQ A;  1R0C B;  2ZPH B;  2HD0 A;  4PL6 A;  2QDL A;  2JJ9 A;  2XDP A;  2WSE E;  4OP0 A;  5IH2 A;  3JSC A;  2DTI A;  3L2W A;  1JXM A;  4PFO A;  4XQ3 A;  4J5Y A;  3PIP A;  1MHN A;  2ENM A;  4JS4 A;  1JXO A;  4PJO C;  3CCE A;  2LNH B;  1N8R U;  5GAN 6;  3CC2 A;  5ECA A;  2E10 A;  2EWN A;  3GNG A;  1I81 A;  1OOT A;  3CCU Q;  3EGD B;  1Q81 U;  1UB4 A;  4M78 A;  3CME Q;  2JOY A;  2DVJ A;  5HKC A;  1PG5 B;  2L0A A;  2EGC A;  3VS6 A;  2X51 A;  5GAN d;  5LL6 S;  2K9G A;  3OYC A;  3UPU A;  5FU6 C;  2MK5 A;  1ZUK A;  3BFM A;  5GAM e;  3F70 A;  3LWH A;  3H0F A;  3M4Y A;  3RES A;  3CD6 A;  2DXU A;  2J06 A;  5LJ5 j;  2HZY A;  4E7L A;  4M78 G;  1G3T A;  2L3P A;  1D0X A;  2QQB A;  5IHK A;  4IUP A; 
#chains in the Genus database with same CATH homology
 4XAX B;  4ME7 A;  3OYK A;  1QVF S;  1I8F A;  3OYE A;  4IUV A;  5I21 A;  4RMO A;  3CCU A;  2EJF A;  3M57 A;  2RJD A;  1VQ7 T;  4Y91 A;  2Y4X A;  3J80 E;  1NJI U;  5LJ3 g;  2EQJ A;  2RH2 A;  3MEW A;  4QW2 A;  2KSS A;  3CME A;  4M75 A;  2PVG B;  2KDS A;  1YIJ A;  3KUF A;  2VYT A;  3QUI A;  2Y4Y A;  4N0A C;  4C5E A;  4EMH A;  4C8Q G;  4EMK C;  4ELZ C;  4ZGD B;  2DAQ A;  3ZBD A;  4ZTF A;  3MP6 A;  4PLI A;  2EJG A;  1Q82 U;  1N8R C;  1I4K 1;  4N4I A;  4E7J A;  2MF2 A;  1G3Y A;  2JN0 A;  2O4X A;  3JCM h;  3R6O A;  1VQP T;  4CI0 C;  5HK0 A;  4M77 A;  5KCO A;  3V8J A;  2JTF A;  1QVG S;  1Q81 C;  2K3Y A;  3OMC A;  3ZEH A;  4C92 B;  4JS5 A;  2E65 A;  4A4E A;  3HP9 A;  3CCV T;  5LJ3 h;  3HHT B;  2KMT A;  2HNI A;  2ZGW A;  3CCQ A;  4M78 B;  3DB3 A;  3CC4 A;  5CQY A;  3A8H B;  3HFN A;  4LD6 A;  4J6X A;  5D6X A;  3FDR A;  5GAN e;  2XHC A;  5CKD A;  2RJC A;  4M75 G;  4WF2 A;  4QVD A;  3CC7 T;  1IRE B;  3J7A F;  4BE1 A;  1K9M C;  2MAM A;  2KQW A;  5GAM j;  4DA4 A;  1VQN A;  3OB9 A;  3JB9 F;  3FIF A;  5CR2 A;  4ZGJ B;  1VIF A;  4M7D D;  3E1S A;  4QVZ A;  3QZ5 B;  4C8Q B;  3RER A;  4M77 G;  5GMK j;  1K73 U;  2JUF A;  2E12 A;  3DLM A;  3CXC A;  1WJS A;  3M55 A;  4EPC A;  3CCR T;  1JJ2 S;  4BE0 A;  4XTW A;  2GF7 A;  1W2B S;  4J6Y A;  5D6Y A;  3PGG A;  1S72 T;  2A3L A;  3CMA T;  1LNX A;  3G71 T;  3BDU A;  2QEX T;  5GAN 4;  1NJI C;  2DTH A;  2K5F A;  3A5Z B;  1N9R A;  4LDV A;  2P4T A;  2P0P A;  3M4G A;  3OYL A;  3L2Z A;  4A4H A;  3JB9 H;  1M90 U;  4Y28 E;  4KUI A;  4L6V 5;  5HY6 A;  3JCM f;  1DJ7 B;  5GAM d;  1Q82 C;  1NZ9 A;  1UGR B;  3A8O B;  2ZPG B;  3X25 B;  4ZTJ A;  2F5K A;  1HXD A;  3VYG A;  2OTJ A;  1AHJ B;  4PJO E;  5J3B A;  2AHJ B;  2E41 A;  3QSU A;  2DIQ A;  5LJ3 f;  1M1K C;  4IKF A;  3G6E T;  3OS2 A;  2O4X B;  2R58 A;  1TH7 A;  3QBY A;  3QKJ A;  4JLI A;  1BI3 A;  4MDW A;  5J26 A;  2PUO B;  3MP8 A;  4M77 B;  5KE3 A;  5IT9 E;  3ASK A;  3MHX A;  5GAO p;  2CS7 A;  3TRE A;  1M5Q 1;  5A0L A;  3H8Z A;  3LWI A;  5GAN j;  3Q1J A;  4NL2 A;  2RA2 A;  3CC2 T;  3V7R A;  5FRN A;  2QQS A;  2DD5 A;  2LDM A;  4JLG A;  4J6W A;  4BB7 A;  4DOV A;  3OMG A;  1VQL A;  4M7A A;  4XTU A;  3FLG A;  2F5T X;  2QI2 A;  1UEB A;  2QXF A;  3E9G A;  1M4Z A;  3LX7 A;  3OYY A;  5FLX E;  3PIO A;  1Q86 U;  2EFI A;  4MZP A;  2OTL A;  4V2S A;  1Y71 A;  4A53 A;  3QJ6 A;  3JB9 I;  1XNI A;  3CCM A;  3HRS A;  1VQ5 A;  2OAU A;  3C94 A;  3FJP A;  3RMS A;  3URG A;  5GMK m;  1K73 C;  4FT4 A;  4E7I A;  4XK8 E;  1VUB A;  2DZC A;  3P8H A;  1BYM A;  3AHU A;  3LGL A;  3EFR A;  3JCM P;  4KT0 E;  2X4Y A;  4KUL A;  3QDR B;  4BI4 A;  3OW2 S;  3M54 A;  3P8B B;  3L42 A;  2DTO A;  3QYG B;  3GPL A;  2LC4 A;  2QTX A;  4RCC A;  2QQR A;  1O9S A;  2LVM A;  4OGC A;  3CEY A;  3V7S A;  3UDC A;  1KD1 C;  1OYX A;  2DVE A;  5L8R E;  1YI2 A;  4M7A G;  2I2L A;  4C0Z A;  2M0O A;  1M90 C;  4HCB A;  5C6S A;  3JCM J;  1VQK T;  2VGM A;  3GP8 A;  4M7A F;  2R5A A;  2YHT A;  3OYB A;  2LNV A;  4ELY C;  5CO7 A;  3P8D A;  5CKB A;  5IN1 A;  4O5V A;  2DXC A;  1YJ9 A;  2EQU A;  4XU0 A;  3KBG A;  4PLL A;  4A4K A;  1N9S A;  2FB7 A;  2LT4 A;  3A8M B;  3VYH B;  2DXB A;  5GAN 3;  4B9X A;  3OYG A;  3CME T;  4C92 F;  1YJN A;  1I5L A;  1YIJ T;  3V8L A;  1GXI E;  3TU4 K;  4XU1 A;  3UWN A;  2VUB A;  4B9W A;  2YRV A;  4M78 F;  2JZ2 A;  3EAE A;  2XDD A;  1P92 A;  2MI6 A;  4BUG A;  4C0F A;  4IUQ A;  4Z02 A;  3PMI A;  4GLK A;  3PTA A;  2XI9 A;  3G4S T;  1Q86 C;  4O6J A;  1U1S A;  3S6W A;  3V7C A;  3M53 A;  5GAO m;  4M7A B;  1X6O A;  2RJE A;  2EQM A;  2LX9 A;  4OF1 A;  1OI1 A;  5GAN 5;  4C8Q F;  3PNW C;  3HKS A;  2LT1 A;  3JCM b;  2IG0 A;  2ZCF B;  4R55 A;  4BDY A;  3I56 A;  2F69 A;  2PVO B;  4N4H A;  3MO8 A;  1NPP A;  4QQ6 A;  3I55 A;  4ZN1 A;  1XTD A;  3M9Q A;  3S3M A;  4LDX A;  3TCJ A;  1VQN T;  2BIV A;  3VKI A;  4L5G A;  4JRI A;  3MCA B;  2FHD A;  3LH0 A;  3L2R A;  4HA8 A;  2EIF A;  4J83 A;  4IUR A;  2RHI A;  4OB1 B;  2L3R A;  4MDX A;  1LJO A;  4C92 C;  4FL6 A;  3TEE A;  1VQ7 A;  4XTV A;  2JNG A;  2MMP A;  4GY5 A;  4RCB A;  4VUB A;  1D3B A;  4M75 F;  5CKF A;  3JCM e;  4OB0 B;  1WGS A;  4PJO A;  4M78 C;  2ZPF B;  4NS5 A;  2K57 A;  3HPW A;  1Y07 A;  2VXF A;  3N5B B;  1V29 B;  3HRT A;  2BUD A;  2BKD N;  4LDU A;  4BDZ A;  1X75 C;  5GMK i;  2DK3 A;  4NOY A;  4FIB A;  5LJ3 e;  3CXC S;  2CZ0 B;  2RI3 A;  3CCL T;  2RHU A;  3OBW A;  4M77 F;  5GAO l;  4HKE A;  4OMF B;  3MEU A;  5FU7 B;  3ZFJ A;  4C5G A;  4F7U E;  3GLX A;  5LJ5 g;  2VV5 A;  2DKG A;  1KQS A;  5CK9 A;  2VC8 A;  1M1G A;  4C8Q C;  1U8R A;  2YLC A;  1FX7 A;  3MEA A;  4OVA A;  3CCV A;  1FWZ A;  2KAF A;  2KK4 A;  1KD1 U;  2DO3 A;  2OTJ T;  3SDZ A;  1HK9 A;  1VQO A;  3M58 A;  3OS1 A;  1XQH A;  2QQA A;  4KBM B;  3E9F A;  3QII A;  1VQ8 T;  4M75 B;  3CPF A;  3CC7 A;  4XU2 A;  4PJO G;  1ZBX A;  2D9T A;  4L59 A;  3SWN A;  1VQ4 A;  3CPW A;  2CGH A;  1KQ2 A;  4M7A D;  4QQG A;  5DLO A;  4JUV A;  3MP1 A;  2M9U A;  1QP2 A;  4PJO F;  3HRU A;  5LJ5 h;  4C5I A;  4NL3 A;  3JB9 G;  2LRQ A;  1YIT A;  3M59 A;  2XU8 A;  3NTK A;  3CC4 T;  1VQL T;  1RI0 A;  4M7D E;  3X20 B;  1M1F A;  5IAY A;  3OYM A;  2OTL T;  2RHZ A;  4LDW A;  2XG8 D;  3BDL A;  4M75 C;  4C92 D;  3WVE B;  1BI2 A;  3OYI A;  1FXX A;  3JCM W;  2EQK A;  3HFO A;  2DIG A;  2X35 A;  3RMQ A;  5KCH A;  3CCM T;  3CCR A;  1H3Z A;  1VQ5 T;  3C4S A;  2B8A A;  4M78 D;  1NPR A;  3CMA A;  4JRQ A;  2NLU A;  1VQ9 T;  2XID A;  3S3N A;  4M77 C;  3OYA A;  3OS0 A;  4N0A A;  4ZN3 A;  5A0D A;  1IZ6 A;  4FSX A;  3HL8 A;  4JDS A;  2CZ7 B;  1X01 A;  2RD1 A;  5LJ5 e;  1PSE A;  3NTH A;  5GAM g;  3DLL A;  1D3B B;  2WSF E;  3T9N A;  5LJ3 j;  4PJO B;  3QZ9 B;  3GIB A;  1Y7X A;  4DOW A;  4C8Q D;  1YI2 T;  1YJW T;  2G3R A;  1VQ6 T;  4D6W A;  3SD4 A;  1N27 A;  1WNL A;  3OY9 A;  1N6A A;  2K5I A;  2L5Q A;  3VUB A;  1QP3 A;  4FU6 A;  5CCA A;  3WVD B;  3OYH A;  2RK1 A;  2HQX A;  1MGQ A;  3FC3 A;  3G7Z A;  2EYQ A;  4EMG A;  1Q7Y U;  1UGP B;  4C0D B;  4JRK A;  3CD6 T;  1JRI A;  1YJ9 T;  2P0Q A;  5GAN 7;  5C0M A;  4X9D A;  2K4Y A;  2YLB A;  4MZT A;  4LDY A;  3CCJ A;  1YBY A;  2V8I A;  4FT2 A;  2MWO A;  3OS5 A;  5GAM h;  4RG8 A;  1VQM A;  3JCM d;  5LJ5 f;  3M56 A;  1SSF A;  3L2Q A;  2LQK A;  4M75 D;  3PFS A;  5FU6 B;  3JCM V;  3CCU T;  1G3S A;  1G5V A;  2FL7 A;  4EDU A;  5GMK h;  2M1H A;  3SWN B;  5LJ3 d;  5CKE A;  3VUZ A;  2PUK B;  3CCE T;  4CRI A;  2XK0 A;  2QA4 A;  5EG2 A;  3JB9 J;  1BI0 A;  2RB6 A;  3L2V A;  5I2M A;  2HAX A;  4J8O A;  5GAO n;  4M77 D;  2E6N A;  3NFC A;  5AYF A;  4OGE A;  4XTY A;  4BI8 B;  5GMK l;  3J81 E;  3ME9 A;  3OYJ A;  4BE2 A;  4E7K A;  4P5N A;  3RIR A;  2GFA A;  1JBM A;  3V8K A;  3CCS A;  5GAN g;  4OB3 B;  3I56 T;  3JCM c;  1QVP A;  2JTM A;  4JJN K;  3NTI A;  3QHS A;  3L2U A;  2KY9 A;  4KUD K;  4C92 E;  5CKH A;  3CCQ T;  1VQK A;  1KQ1 A;  3INZ A;  3LW5 E;  2FYK A;  3VJP A;  3GF5 A;  4HCZ A;  3X28 B;  2FVU A;  2CKK A;  1KHC A;  4M78 E;  5KH6 A;  3PT9 A;  4F7U A;  1K8A U;  4OB2 B;  2PVD B;  2CZ1 B;  4X9C A;  4LD9 K;  2H3J A;  3HSB A;  1Y96 A;  2WSC E;  1EIF A;  2JVV A;  3QYH B;  2HQE A;  5DLQ E;  4M7A C;  4PJO D;  2XIC A;  2ZPE B;  2R57 A;  3OSV A;  4FM4 B;  4BD3 A;  5GAN h;  1YHQ A;  2MWP A;  1Q7Y C;  5CVI A;  3OYD A;  3G4S A;  2RI2 A;  2DXT A;  2LCC A;  5CAI A;  5GAM f;  4JRP A;  4BAC A;  3JB9 D;  1G3W A;  1LOJ A;  2O01 E;  2ZZD A;  4C8Q E;  5HK3 A;  2DJZ A;  1XOV A;  2X4X A;  3FRN A;  3LGF A;  4C0G A;  3QXE B;  1QVG A;  1WPY A;  2LCL A;  2QDY B;  1OZ3 A;  4XU3 A;  3VU3 C;  5LJ5 d;  4QQD A;  2V8J A;  2RJF A;  2V8K A;  4A4F A;  1O75 A;  5FRM A;  1UGS B;  2M16 A;  3RUX A;  5FRO A;  1KC8 C;  4M7D A;  1M1K U;  2E5Q A;  3MET A;  4F7U G;  3X24 B;  4RG2 A;  1VQP A;  4MML A;  2PU9 B;  2WAC A;  1VQO T;  1ZQ1 A;  1YCY A;  3QO3 A;  2R5M A;  3OQ5 A;  4F7U F;  4PNO A;  3GOX A;  2HBP A;  3C95 A;  1KQS S;  3JAM E;  1VQ4 T;  1RL2 A;  2EKO A;  4YTL A;  4M75 E;  4TVR A;  3X26 B;  3PMT A;  4J7F A;  2K5L A;  1QW1 A;  2RO0 A;  3RKX A;  3MEV A;  5GAN 2;  2KVQ G;  1JB0 E;  1YIT T;  2ZPB B;  1U1T A;  5FU7 C;  2Y90 A;  2E1H A;  1VIE A;  1BIA A;  1JJ2 A;  2XD0 A;  2XKO C;  4BI3 A;  1WQW A;  3M5A A;  2GFU A;  4M77 E;  3CPW S;  1W2B A;  4HCC A;  4M7D G;  3KXT A;  3BW1 A;  1K8A C;  1B34 A;  4J7I A;  5J39 A;  1OZ2 A;  3SFM A;  2GCX A;  3OYF A;  2DD4 A;  3QPH A;  2D6F A;  4ATO A;  5GAN f;  3SB2 A;  4M7D F;  5GAO q;  2IVW A;  2E6Z A;  4F7U B;  1H64 1;  3CCL A;  3RKW A;  1Y96 B;  4QVC A;  2C06 A;  2X4W A;  1S72 A;  1NE8 A;  1PSF A;  4N4G A;  1BKB A;  4E47 A;  1WQ7 A;  3G71 A;  1M9S A;  2QEX A;  3QG1 A;  4HT9 A;  4A54 A;  3CBO A;  1WJR A;  4EMK A;  3UT1 A;  4RKU E;  3S3O A;  4UC4 A;  4IUT A;  3RKY A;  2EJ9 A;  3JRZ A;  2CZ6 B;  4X34 A;  4DQ2 A;  4IUU A;  4Q5W A;  3OSS C;  1VQ8 A;  2ZPI B;  4ZGE B;  2RI5 A;  2ZPH B;  3C12 A;  2HD0 A;  4PL6 A;  2EAY A;  3EFS A;  4R56 A;  3L1A A;  3FEO A;  3O8V A;  2XDP A;  3CBM A;  2WSE E;  3A8L B;  4OP0 A;  2GQV A;  5KE2 A;  3OA6 A;  2DZ9 A;  3JSC A;  1W4S A;  3E19 A;  4M7D B;  2DTI A;  3CCJ T;  3L2W A;  2CYZ B;  3G6E A;  1VQM T;  2LTO A;  4II1 A;  3BY7 A;  4XQ3 A;  2XDB A;  4J5Y A;  5I2S A;  5DM7 R;  3PIP A;  1MHN A;  2L89 A;  3ER0 A;  3DB4 A;  4JS4 A;  4PJO C;  2P0K A;  3CCE A;  5D6W A;  1KHI A;  5A2Q E;  5GAN 6;  1N8R U;  3CC2 A;  4PKC C;  2E10 A;  2EWN A;  1KG1 A;  1YJN T;  3VV0 A;  4C92 A;  3GNG A;  2DPP B;  2QA4 T;  5A0G A;  4M7D C;  5GAO r;  2K3X A;  5CIU A;  1BI1 A;  2QQ9 A;  1I81 A;  2VXE A;  3A8G B;  1VQ9 A;  2K2V A;  1Q81 U;  1UB4 A;  4M78 A;  4HT8 A;  4A4G A;  3OW2 A;  3OYN A;  4C0D C;  1ZHI A;  1UGQ B;  2JOY A;  3LLR A;  4XTZ A;  3WXM B;  3GNF B;  4E7H A;  5HKC A;  1KC8 U;  2RM4 A;  4C5H A;  3CCS T;  3OBY A;  2RHY A;  5M9O A;  5GAN d;  5LL6 S;  1WJQ A;  2RK2 A;  1B34 B;  1YJW A;  1VQ6 A;  4MMK A;  5GAN 8;  2D0Q B;  2VGN A;  4BY6 B;  3OYC A;  3UPU A;  5FU6 C;  4MZM A;  4M7A E;  3LYI A;  1K9M U;  3H6Z A;  3CBP A;  4C8Q A;  5DY9 A;  3JCM X;  3SWN C;  2X4J A;  3BFM A;  5GAM e;  3F70 A;  3LWH A;  1M8V A;  4C92 G;  3M4Y A;  2DEQ A;  5CQX A;  3RES A;  3FB9 A;  2DXU A;  2RHX A;  3I55 T;  3CD6 A;  3DKM A;  5LJ5 j;  2A7Y A;  4XTX A;  4E7L A;  4BY6 C;  4M78 G;  5GMK e;  2L8D A;  3QJY A;  2PQW A;  4EMK B;  1G3T A;  3JCM g;  2E64 A;  1YHQ T;  1R8O B;  2QQB A;  2E70 A;  1QVF A;  1BIB A;  2LQ8 A;  4IUP A;  3JCM Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...