5GAN3

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
77
structure length
77
Chain Sequence
TPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords U4 snRNA
total genus 10
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan300
2VXFA 4XTYA 2K57A 4M75F 3RKXA 1LJOA 4M75B 5GAMd 4PJOB 2RB6A 4PJOF 3JCMb 1Y96A 4M75D 1JRIA 4PJOC 4N0AC 3V8KA 3JCMe 3RERA 3FB9A 3RESA 3HSBA 3JB9D 3QO3A 1LOJA 4J5YA 3FJPA 3JB9F 4HT9A 3L2ZA 3M4GA 4RCCA 4J6YA 4M78E 4PJOG 1B34A 2DTIA 3RKWA 4JLIA 2DVEA 2EWNA 4M75C 3JCMg 1M5Q1 4A53A 2E41A 1I5LA 4M7AD 5GAMe 4M7AB 4EMKC 4WF2A 3JCMc 4M7DB 3VU3C 3JB9G 4X9CA 4V2SA 4RCBA 3JCMh 5GAN3 1M8VA 4J6WA 3JCMJ 4C8QG 5I21A 5GAMj 4C8QE 3QSUA 4PJOA 1LNXA 4M77E 5GANd 1I81A 1MGQA 5GMKe 3HFOA 3SB2A 3RIRA 1B34B 3JCMW 4NOYA 3V7RA 3GIBA 4XTWA 4M75E 4XU0A 4C8QB 5LJ5f 1X01A 2I2LA 4MMLA 2EJGA 4C8QF 4C92C 5LJ3g 5LJ3h 4C8QD 4X9DA 4M78G 5GMKj 4PJOE 2E64A 4F7UG 4Y91A 5GAN7 4JUVA 2E65A 3RUXA 1YCYA 1WNLA 3BW1A 4EMKA 5GAN4 4M77A 4C92E 1HK9A 2DKGA 4A54A 5LJ3e 3JB9I 4M75A 4M7AF 4M78B 4M77B 2Y90A 1WQ7A 4M7DF 4M78F 2FYKA 4F7UF 2E1HA 1JBMA 2ZGWA 4JRIA 4C92D 5GAN6 3RKYA 5GAOp 4XTUA 4XU2A 2DJZA 3SWNA 1KQ2A 2VXEA 4MMKA 4M7DE 1BIBA 4N0AA 4M7AG 3PGGA 4J6XA 4EMHA 5GANf 4M7AE 2DZ9A 5GMKm 4M7DG 4M7DA 4NL2A 5GAN8 3EFSA 4QVCA 5GANj 3BFMA 4PJOD 4JRKA 5GAOm 2FB7A 5LJ3j 5LJ5h 4DQ2A 4C92A 3SWNB 4HA8A 2CGHA 3JB9H 1N9SA 1WQWA 3QUIA 3JCMV 5LJ3f 2YLCA 4XTZA 1U1SA 3V8JA 3BDUA 5GAOl 1KQ1A 5GMKi 2DZCA 2DTOA 4M7AA 4M77C 5GAN2 2DTHA 2YHTA 5LJ5d 1U1TA 5GMKl 3L1AA 4M77F 4M7DD 3SWNC 4F7UB 2DXTA 3JB9J 1I8FA 3V7SA 2HNIA 2RD1A 1WPYA 2EJ9A 5LJ5j 4EMGA 4PNOA 5GANe 4XU1A 2EAYA 3EFRA 5GAMf 2YLBA 3QHSA 4M77G 5GAN5 5DY9A 5GAOq 4NL3A 5LJ5g 1H641 3INZA 5GAMg 5GANh 2VC8A 4HT8A 4M7DC 5GANg 4EMKB 2EJFA 2RA2A 2E10A 1HXDA 4C92G 3AHUA 4M78C 4F7UA 4M78A 1D3BA 3FIFA 3JCMf 4C8QC 5LJ3d 3BY7A 4C8QA 3JCMP 5GAOr 2QTXA 3HFNA 4XTXA 4F7UE 5GAMh 5CAIA 3V7CA 3V8LA 1TH7A 2DEQA 4XTVA 5LJ5e 4M7AC 4M77D 4XU3A 4M75G 1I4K1 1N9RA 3JCMd 4C92F 3JCMQ 1Y96B 3JCMX 2JN0A 4C92B 4QVDA 2DXUA 4M78D 4OP0A 2RM4A 4XQ3A 5GAOn 5GMKh 1BIAA 1D3BB
chains in the Genus database with same CATH superfamily
4PKCC 4BI8B 1OOTA 3P8HA 1AZGB 2ZAEA 2YWWA 1YITT 1Y96A 4BD3A 2K4YA 3TEEA 5I2MA 4O6JA 1Q86U 2ROLA 3CEYA 5CKEA 3HRTA 1N5ZA 3IQLA 1KC8R 2EQIA 3FJPA 1ZA2B 3TQ7P 1D09B 3JCMg 1QKXA 4A4GA 3J81E 4OB3B 3DKMA 3LLRA 5FU7B 4HCCA 1M4ZA 1WHHA 5I21A 1VQKA 1KK7A 2HAXA 1GFDA 1MV0B 3RIRA 3OYFA 2RPNA 2LMJA 4XTWA 2D8HA 1RAEB 1R0CB 4UC4A 2F1LA 5FROA 4C92C 5LJ3g 2M16A 5GMKj 1RABB 2VGNA 2LC4A 3L2VA 3CMEA 1ZLMA 3CCSA 3RDVA 1HK9A 4RTTA 3GPLA 3CCQA 4M78F 2L89A 4JRIA 2PVGB 2VB6A 4XTUA 1VQOQ 2D6FA 2PVOB 2QG9B 4BY6C 1BIBA 1JJ2A 4NL2A 5KYYB 3NGPA 4LD6A 1YITA 2ZPBB 4QQDA 2LP5A 5LJ5h 1KC8U 2GQVA 2CGHA 1N27A 2AHJB 2V8KA 1HSQA 5CR2A 2DK3A 2NUPB 3CC2Q 2JOYA 2DTHA 2E3HA 4KGVB 1IO6A 1VQOT 3JSCA 3R6OA 4RKUE 1QWFA 1YHQA 3CBMA 1NBEB 3E1SA 2QK0A 1UTIA 2BZ8A 4Y28E 4N4IA 2EYWA 2QASA 1OPLA 5GANg 2DF6A 1QCOA 4NS5A 1HXDA 4LDUA 5CKBA 1W70A 5IXFA 3FIFA 4AG1C 3CCMQ 1QCNA 3A1PA 1QVFA 2LJ0A 3M0UA 2RQRA 1S1NA 3GOXA 2KT1A 2VXFA 4FM4B 1X6GA 1Q81U 1VA7A 3REBB 3VUBA 2ABLA 1C1AA 3QJYA 4IUVA 1YJ9Q 3MP6A 3SD4A 2JTEA 4DBQA 2CP2A 1M30A 3L2ZA 5CQYA 1VQMA 2ED1A 3L2RA 2XIDA 5HKCA 3MCAB 3N5BB 4VUBA 3UT1A 1FWZA 4LD9K 3VS6A 2MIOA 2KR3A 1JEGA 3HFOA 3HHTB 1WJQA 4IUTA 1BI1A 2DIGA 1QLYA 3FC3A 5GAN7 4FT4A 5I2SA 3I9QA 1XJWB 3OYCA 1M27C 2JS0A 2FEIA 1N8RU 3PMIA 1K9MC 1V76A 3SDZA 1QVGS 2QA4T 1G8XA 4E7IA 4J6XA 1G83A 2D8JA 2GGRA 4MDXA 3G6EQ 5GAN8 2HBPA 2NUTB 1GCQA 5GAOm 2FB7A 1H3HA 4QQGA 5J26A 4HVUA 4OMPA 2K6DA 4XTZA 2RNAA 4KGZB 4OF1A 1NYGA 2O2OA 4JJCA 3L1AA 4C0GA 5FRMA 1K9MU 2HNIA 2CS7A 2GQIA 1M1KC 4RTYA 2KMTA 2OTLT 3M0PA 1WHMA 1WJRA 5GAMf 2J7IA 3GNGA 2VC8A 2RQVA 2HQHA 2P0PA 1ZSGA 3AHUA 4JJNK 1Q82U 2PUOB 2OAWA 3X20B 3E19A 1D0XA 2MOXA 2QDYB 4M77D 3H9NA 2V8JA 5IHKA 1OULA 3PVLA 3CD6Q 1YIJA 1LJOA 1Z9QA 4PJOC 3REAB 1KG1A 1RUWA 3GBQA 2XU8A 3CCRA 3ME9A 4J6YA 2OJ2A 2O9SA 2RJFA 3KFVA 3FLGA 4WF2A 1X6OA 2QYZA 2BKDN 2DM1A 2FZGB 2M1HA 1VQPQ 4B9XA 1NEGA 3QSUA 3PE0A 4JZ3A 2QXFA 4IIMA 3JV3A 3J80E 1SRMA 2RK2A 3UF4A 2D1XA 3HRUA 4C8QB 4DOVA 2X51A 4GLKA 3MKDA 1Y71A 5LJ3h 1KFZA 4PL6A 1UGPB 1X2QA 3M0QA 1WNLA 1UEBA 5FU6B 2JM9A 2QGFB 3X26B 2K3BA 4L5GA 1ZQ1A 1PRLC 3OBWA 3VS1A 3M57A 4C92D 1KQ2A 1NG2A 4M7AE 2DBMA 3QZ5B 1GBQA 1O9SA 1G2BA 1UFFA 3LX7A 4K11A 2MF2A 3ZEHA 1PC0A 1YNZA 1JJ2S 2HBWA 2JT4A 3VKIA 5GAN2 3H0IA 1D1CA 1OI1A 1W4SA 5A0GA 2C0TA 4XU1A 2FRWA 1YHQQ 3UA6A 2X4WA 1H3ZA 2KXDA 2RHIA 1VIEA 2EGEA 4M7DC 4ZN1A 4EMKB 2ZCFB 1JO8A 1UGVA 5IT9E 3CMET 4JS4A 2CZ6B 1KD1R 2E70A 5I11A 3CC7A 4AT1B 2D9TA 3MHXA 2KEAA 2QI2A 4N4GA 2M9UA 5FU7C 3E9GA 2VASA 1BK2A 2RB6A 4Q5WA 2O88A 1PSFA 4KH0B 3GLXA 1Y7XA 3V8KA 2QTVA 3JB9D 1VOMA 1N8RC 3CCVA 2V1QA 4M78E 2DTIA 1AEYA 3HRSA 4E7KA 1W2BP 4M7AB 2EW3A 2CP6A 3NTHA 1ARKA 1G3YA 3VS3A 1K76A 1TOVA 2JZ2A 1R77A 1SEMA 2RJEA 4AFZC 2F2VA 4RTXA 1NJIC 1OU8A 4R0KA 2LCSA 1X43A 4QQ6A 2RF0A 1X01A 3LH0A 3U23A 3RUXA 2VYTA 2RQUA 2PQWA 1CKBA 1UGQB 3H6ZA 4LUEA 1NJIU 2EKOA 4EPCA 1XOVA 3VV0A 1RI9A 1UJ0A 4M7DE 2D0NA 2KK4A 4E2FB 2MCNA 1Q81C 4J9EA 1T3SA 1N9SA 4B6MA 4JLGA 3I56T 2O4XA 3QZ9B 3JB9J 1R0BG 3G71A 2R58A 1TU0B 2RD1A 3OW2S 2OTJA 5LJ5j 3LWHA 2CYZB 2EAYA 1EIFA 3O5ZA 4LE9A 3VS5A 4QVZA 1NEBA 2GFAA 1VQOA 3P8DA 2CUBA 2RA2A 2V1RA 4OB1B 1D3BA 3OY9A 3BY7A 3OS5A 4DA4A 2PU9B 3UPUA 1WHLA 4CC2A 2K5LA 4QT7A 3TVTA 1N9RA 3JCMQ 1N6AA 3G4ST 2JMCA 2DRMA 3CCET 2COWA 2FO0A 2QQAA 2FPEA 1VQKQ 1ZUKA 3QXEB 4PJOF 4LDXA 1WHKA 4N0AC 3BE3A 3VS4A 2DL4A 2ZPEB 4E7LA 3RESA 2HDAA 2COZA 2KBTA 1VQMQ 1AVZC 1YI2T 3GNFB 1RAIB 4QW2A 1XTDA 2BZXA 3MEVA 2EWNA 4MDWA 2RN8A 3LGLA 4EMKC 2LX9A 1KIKA 5EG2A 1VQKT 1WZOA 4BACA 2CH4A 2HKNA 2FL7A 4AG2C 3CCMT 3DB3A 1VQ9Q 1FXXA 4XU0A 2V8IA 1BI0A 2I2LA 3A8OB 1UUEA 1Y0MA 4JRPA 4Y91A 2F5TX 3I55T 1YJWT 1MHNA 2XI9A 3CMAT 4J9BA 3HP9A 1PG5B 1VQ7T 5HCKA 1VQ8Q 3VRZA 2F2XA 5GAN6 1K1ZA 2XG8D 4R56A 1YJ9T 2BIVA 3I35A 3PGGA 2DL3A 1TTHB 4B9WA 3OYDA 3NTIA 2BUDA 4ELYC 3NHNA 4DBHA 1AT1B 2E3IA 4C92A 3JB9H 3QUIA 5LJ3f 2KSSA 2CDTA 2RHXA 4GY5A 4Z02A 2OTLQ 2E6NA 1K73C 3I5RA 1PD1A 2PUKB 3UA7A 2CREA 1BCOA 2YLBA 4X1VA 3VS7A 5M9OA 3X24B 1YWPA 2KAFA 1XQHA 1X27A 4RTZA 4OB0B 1S72A 5GAMh 3I55A 1YJNQ 4JJDA 1Y96B 3DB4A 1WFWA 4XQ3A 2FZCB 6AT1B 4XTYA 2DXCA 4PJLA 4M75F 1RACB 2KRMA 4PJMA 1VQNT 3WVEB 1TUGB 1IHVA 2E5QA 4GLMA 4HT9A 5GAOp 2YRCA 3X25B 3META 4X9CA 5KE3A 2EFIA 3M58A 4C8QE 2ESWA 5ECAA 2E6ZA 2GCXA 1IZ6A 2OTJQ 2H8HA 3CCLT 2DBKA 3OS0A 1OX9A 1BU1A 4MMLA 3OSVA 4F04B 4HCKA 3WVDB 4JPBW 4AFUC 1K0XA 5CCAA 4A54A 4M75A 1FMKA 1X69A 3RNJA 3QDRB 2DL7A 4RMOA 4XK8E 3CCLQ 1W1FA 2LVMA 3KBGA 3CXCS 5GANj 4FCYA 5HK0A 1M2VA 2RK1A 3NMZC 5FW9A 1X6BA 3VUZA 2P84A 5CO7A 2A7YA 3PVQA 2EYXA 3QWXX 4KBMB 4Z8AA 3OW2P 2EGAA 3V7SA 2OI3A 3PTAA 3QHSA 2RH2A 1WDXA 1D1BA 2GNCA 3M54A 1PM3A 4E7JA 4HCBA 2EVRA 2A36A 5KH6A 4XTXA 4F7UE 3GP8A 1K8AU 5FU6C 3C0CA 1K8AR 3CQTA 3CCUQ 4M75G 4PK4A 1BIAA 3L42A 1YIJT 2JS2A 3CBPA 3OYYA 1E7OA 2XKOC 4JJBA 2ECZA 3JRZA 2O9VA 5CKFA 2AZVA 1MNEA 2W0ZA 5AT1B 2OTLA 3G71Q 3M4GA 1M1FA 5D6WA 1GFCA 4OVAA 4M7AD 3OYEA 3X28B 3PFSA 5GAMj 5KYWB 3H8ZA 4DEXA 1TUCA 1M90R 1I5OB 4JS5A 1B34B 4DOWA 1Q86R 1IB8A 4C8QF 2QGGA 3MP8A 3NFCA 3OYBA 4ZN3A 1UB4A 3CC7T 2QEXT 2M0YA 3OYMA 4C92E 4M7AF 3LWIA 2Y90A 2NUTA 4A4EA 2JTMA 4F7UF 5DLQE 4BUGA 3BDLA 3M9QA 1VQ9T 1IXDA 5KYXB 3OYGA 1BI2A 4HVVA 2LTOA 2A3LA 2FHDA 2LQ8A 4JDSA 3CXCP 3EG1A 3M55A 2YDLA 2CH4W 2QEXQ 4KH1B 3CBOA 1PSEA 1UJYA 1QVGA 2DX1A 5GAOl 1Q86C 1T3LA 1U1TA 3CCSQ 4RTUA 2RQWA 1JXMA 2JJ9A 1C0MA 2DJQA 3QKJA 4J7IA 3QBYA 3C4SA 2EJFA 2RJCA 1RAFB 2A08A 4F7UA 1Q7YR 1YFNA 5GAOr 3CCST 2ZPFB 2W10A 3V7CA 2JXBA 4BB7A 4AFSC 5FWBA 4RG8A 4C5IA 2HD0A 1W6XA 2KROA 5CQXA 3JCMX 1EZZB 2EQUA 2J06A 3M5AA 1PKSA 3MEUA 3EGDA 1TUDA 2K57A 1U06A 2CP7A 1VQ6T 3AT1B 2XDBA 3S6WA 1B3QA 4IUUA 1D0ZA 1YBYA 1AHJB 1LOJA 4J5YA 4A4HA 4GBQA 4A53A 8AT1B 1MV3A 2GF7A 2KRNA 3QDFA 4P5NA 1FX7A 2CT3A 1SKUB 4O5VA 4PLLA 4C8QG 2IVWA 3M0RA 1M3BA 2J6OA 4JZ4A 1ZSZB 2VKNA 1JJ2P 1BCMA 2J6FA 2L3RA 8ATCB 1VQ4A 2X3XD 3G6EA 4PJOE 2E64A 2P4TA 2WSEE 1VUBA 3BW1A 1MUZA 5D6XA 2DL5A 4M77A 5LJ3e 2DKGA 2WSCE 3MPUB 3QWYA 1JBMA 2C0OA 2CZ1B 1JB0E 4FYVB 4RTVA 2VXEA 2LQWA 4EMHA 3CPWS 3P8BB 3M0TA 5LL6S 4PJOD 5CKDA 4JRKA 2GTOA 5HK3A 4RG2A 3SWNB 1WQWA 3V8JA 1M3AA 2KY9A 2DXBA 2LZ6B 2L8DA 3CC2T 2B8AA 4FSXA 1YJNA 1E6GA 4PNOA 5KYNA 3EAEA 5GAOq 3CCLA 2DAQA 3OW2A 5GAMg 1NE8A 5FWCA 4FL6A 2BTTA 3CD6A 2L3QA 4ELZC 3CMAQ 4M78C 2ZZDA 1VQ7Q 3V8LA 1LCKA 2P0QA 5LJ5e 1M2OA 4RUGA 4C5EA 4C5GA 4C0DB 4C92B 4M78D 2XK0A 1K9MR 1IREB 3KXTA 2AKLA 3CCQT 3JCMb 1W2BA 1WHGA 2HZYA 1RAAB 4M75D 1JRIA 3MEAA 2J05A 2RMOA 5IXBA 2RO0A 3TU4K 2KNBB 1JU5C 1RI0A 2R5MA 1B34A 3TCJA 3D7SB 4L6V5 5FLXE 3JCMc 3DLLA 1FMVA 1YJWQ 4DEYA 3CCQQ 2HSPA 4FW1A 4PJOA 2DA9A 1ABQA 2BZYA 3M53A 3V7RA 2ZPHB 2AT1B 2XICA 3CCVQ 2OX7A 3CCRQ 2SEMA 1V1CA 3CCEA 1S72T 1UDLA 1Z9ZA 3HL8A 3GF5A 3EG9A 2O31A 2HL5C 1PWTA 2JUFA 3FDRA 3OB9A 2X4JA 1NPPA 1PKTA 1ZSZA 1U3OA 3EFSA 2V26A 1PD0A 3S3OA 2EQKA 1G3WA 3BDUA 3G1JA 5GMKi 3I56A 1K8AC 2KDSA 1TS9A 1I8FA 4ESRA 1HYOA 3FRNA 2VUBA 2LJ3A 4PLIA 3EFRA 2DETA 1O75A 3LYIA 5LJ5g 1Q81R 3THKA 2DFUA 3CMAA 2FRYA 3H41A 4BDZA 1HD3A 5LJ3d 5GJWB 3HFNA 3A98A 4M7AC 4PFPA 2DLPA 2JN0A 2KYBA 4QVDA 1H92A 2X9HA 4FYXB 4ZTFA 2MI6A 4ZGJB 2KXCA 1RADB 1WXTA 2A28A 1YN8A 1MMDA 1SSHA 3DLMA 5KCHA 3JCMe 1ABOA 3LW5E 3OBYA 4OMQA 1IHWA 3UATA 3PT9A 1QCFA 1QVFP 2C06A 3QIIA 2YRDA 3TSWA 1VQ6Q 1UGRB 3RMSA 3JCMh 5GAN3 2RHZA 1LNXA 4MZTA 2G6FX 3OS2A 1GRIA 3GIBA 2GTJA 2K3YA 1YHQT 4X9DA 4M78G 3VJPA 4WCIA 2EYZA 1Q7YU 3MJXA 2KE9A 2R57A 4BDYA 3R6NA 3CMEQ 1IRXA 2QA4A 4LXCA 2MMPA 4N0AA 1AWWA 1M9SA 2EPDA 3ZL7C 2JVVA 1ZBJA 3WXMB 1FMWA 3URGA 2CP5A 2O01E 1U1SA 3M56A 3CPWA 2LX7A 4M7AA 4CRIA 2YUQA 2CZ7B 2YXYA 1NJIR 4F7UB 2J6KA 2DD4A 4HKEA 1RAGB 1KQSS 2QDLA 2EGCA 4NL3A 4CC3A 1H641 4J9CA 3EG3A 2KT8A 3JAME 4R55A 3PIPA 1AZEA 3EG2A 2JTFA 4TVRA 1PHTA 2RI5A 1T0JA 3HKSA 4OP0A 4YTLA 2RM4A 4IKFA 2WACA 2L2PA 2XD0A 4PJOB 4LUDA 1NLOC 1R8OB 2O4XB 1BKBA 3FB9A 5CIUA 3ER0A 4WTOB 1IGQA 1OZ2A 1M5Q1 3VYHB 4ZGEB 4PJJA 5GAMe 3I55Q 4J9DA 3CXCA 2MWOA 4M7DB 3EHQA 4FYYB 4V2SA 1WX6A 1NPRA 3JCMJ 1FYNA 1WHJA 4E47A 3EH2A 2M51A 5KCOA 1Y07A 4FIBA 2CSIA 1VQPA 2YRVA 4BI4A 2VWFA 2L3SA 5L23A 1YP5A 2AIRB 4XU2A 2D0QB 4LN2A 2HMAA 3CCRT 3G4SQ 2CSQA 2KQWA 3OMGA 2ATCB 4ME7A 3A5ZB 1KD1C 1AOJA 4Z89A 5KYWA 4LNPA 3QYHB 3OSSC 1PRMC 4J8OA 2DNUA 2KI7A 3RR6A 1GL5A 1VQMT 3SWNC 2Z0WA 1YI2Q 1BYMA 2I0NA 2EJ9A 2SRCA 3T9NA 4CC4B 2LT4A 2XMFA 3Q1JA 3EG0A 4J9IA 2RJDA 2K7AA 2DYIA 3H0FA 3E2UA 1Q95G 4C8QC 4EDUA 3JCMP 4C8QA 1LPLA 4PFZA 5GJVB 9ATCB 2QA4Q 4XU3A 1AD5A 4X34A 4ORZA 5C0MA 4CI0C 5GAOn 1VQNA 5DY9A 1U8RA 3OYKA 1ZSZC 2FVUA 1OQKA 2CZ0B 2ZPGB 1VQ8T 3A8GB 1EFNA 4C0DC 1VQ5A 2LJ1A 4Y92A 1VQLQ 1NZ9A 3RERA 3LGFA 3SFMA 4KUIA 4DBFA 4BE2A 4E7HA 1SG5A 3G7ZA 1VQ4Q 4ZNXA 4PJOG 4IURA 3HSBA 2HQXA 4JLIA 3CCJT 1I07A 4RCBA 1M90U 1WXUA 4LDWA 5GANd 4KRTA 5GMKe 1WA7A 4NOYA 1VQ4T 1BB9A 4C8QD 3MEWA 4JUVA 2RQTA 2YUNA 4FW2A 3CCMA 2HSEB 2LNHB 3NPFA 3PIOA 2FYKA 2FPDA 2HKQB 1WYXA 1OV3A 1MNDA 4A4KA 1OZ3A 4OMFB 1TSFA 3BFMA 3EH1A 2MAMA 3OYIA 2EIFA 4D8KA 3OA6A 1OPKA 1VIFA 2BE9B 2HL3A 1VQ5T 5LJ3j 1AWOA 4BY6B 2RHYA 1CSKA 3OYHA 1SPKA 2YLCA 3L2QA 2CKKA 5KYYA 2YHTA 5L8RE 2B86A 1ZHIA 1RLPC 3G6ET 3SEMA 1C6VX 1G3SA 2A0FB 1MMNA 4M77G 1VQ5Q 1ZUYA 1VQLA 1PCXA 4AMCA 4HT8A 4BI3A 2E5KA 1QKWA 1KQSA 1TWBA 2DILA 4OMLA 2EKHA 3EG9B 5KYUA 1ZUUA 3JCMf 2QTXA 2PZ1A 1RAHB 1TH7A 1TXQA 1T0HA 3CC4T 3O8VA 1I4K1 2E12A 3JCMd 1F1BB 1SRLA 1VYTA 2QAZA 2RI2A 5GMKh 1KJWA 1GBRA 1YWOA 3OYAA 1K73U 2K9GA 2K79A 4FSSA 2MK5A 4FT2A 5HY6A 2XHCA 1M1GA 1DJ7B 1W2BS 5IAYA 5KYUB 1QWEA 1OX8A 3I5SA 2GFUA 3CCJA 3CC7Q 3VRYA 3VU3C 3CD6T 3EGXA 2LNVA 3OS1A 1M8VA 4HCZA 3VYGA 2M0OA 3ZFJA 2PNIA 2EQJA 5C6SA 1MGQA 3M0SA 2G3RA 3L2WA 2X4YA 1VYUA 1LVKA 4HVWA 2OTJT 1WGSA 1MMGA 3E9FA 3A8LB 4J83A 2AK5A 1YCYA 3CPWP 1YJWA 3JB9I 3PNWC 2QQ9A 2A37A 4M78B 3OYJA 2DE0X 2CP0A 1U5SA 2E1HA 3QPHA 2FZKB 1Y57A 3SWNA 1M1KR 2NUZA 3H0HA 4MZMA 4D6WA 5DM7R 3FEOA 4E6RA 2DZ9A 4KUDK 4M7DG 4E7ZA 1QVPA 1G5VA 1GCQC 3G4SA 5IH2A 1VQ9A 2X3WD 3I56Q 2QQBA 4N4HA 2DTOA 3HTRA 1OYXA 1QQJA 4M77F 1WPYA 1N8RR 4OMMA 2VGMA 5D7UA 5GANe 2ENMA 3PMTA 4ATOA 3UDCA 5GAN5 1I1JA 3S3MA 2COYA 5A0LA 2DL8A 1QVFS 2E10A 1GCPA 2M02A 2EQMA 2BE7D 5A2QE 3C95A 2QEXA 4XAXB 1UHCA 3RBBB 3EFOA 4LDYA 3CCEQ 4F17A 1YCSB 2F2WA 4ZGDB 5KYXA 4JRQA 1SSFA 4OB2B 2CP3A 1B07A 5GAMd 4QKUA 5CKHA 4KT0E 3TSZA 1YIJQ 1WLPB 2P0KA 2R5AA 1UHFA 3QO3A 4RCCA 1UECA 4EMGA 2FG0A 2DVEA 5KE2A 1SHFA 1HJDA 2CUDA 3ULRB 1ZBXA 3SHWA 1NYFA 1QVGP 4AFQC 1SHGA 2EJGA 2K5FA 2ROTA 2DERA 1Q7YC 1TG0A 1K4US 4PJNA 2KRSA 4OGEA 2DRKA 4M7DF 2ZGWA 3RKYA 2JMAA 1CKAA 2LT1A 1X75C 4J9GA 2EYQA 2DIQA 4M7AG 3ASKA 4PFOA 2LRQA 5GMKm 7AT1B 1KQSP 4HA8A 5AYFA 1M2VB 1UG1A 4Z88A 3KUFA 3C12A 5GMKl 1QP2A 2DPPB 2K2VA 2L0AA 2NWMA 5IN1A 1M3CA 2NYSA 3INZA 4A4FA 1QMCA 2YT6A 5D6YA 1KHCA 3VS0A 4LDVA 3A8HB 1EX4A 2LQNA 3MO8A 4C0FA 4ZTJA 1YITQ 1KSWA 2NUPA 2XDPA 2DEQA 3RMQA 4KGXB 3M59A 4E7SA 1ZX6A 4C92F 1M90C 4IUPA 3LH5A 3EHRA 1KC8C 2DMOA 1G3TA 2CT4A 3EGXB 2KYMA 3MP1A 2P4RA 1YJ9A 3RKXA 1QP3A 1VQNQ 2DEUA 4L59A 2K3XA 2XDDA 1WIEA 2HCKA 1P92A 4CC7A 3CCVT 3RKWA 4M75C 3EFOB 3CC2A 2YUPA 3VS2A 3JB9G 1MMAA 2L5QA 2AZSA 4J6WA 2IG0A 1ACMB 1UGSB 2F5KA 4M77E 3QG1A 3SB2A 4HXJA 4DBRA 1M8MA 1A0NB 5LJ5f 2EYYA 4BE0A 1VQ7A 1KHIA 3HPWA 1XNIA 3NTKA 3CCUA 1E6HA 3UWNA 1OEBA 2E65A 2EBPA 4IIOA 4RTWA 1VQPT 1NM7A 2ED0A 3CC4A 1BI3A 2QQSA 4J7FA 5CVIA 2X4XA 3OMCA 5J3BA 1I0CA 4J9FA 3J7AF 4MMKA 1OU9A 2DVJA 4C5HA 4M7DA 2IPOB 3L2UA 4QVCA 5IHIA 2Y4YA 1QW1A 4EIKA 4DQ2A 1RLQC 1JXOA 4OMOA 1KD1U 3EGUA 2YSQA 3CCJQ 3QJ6A 4M77C 4M4ZA 1D0YA 2X35A 2DXTA 2C0IA 2MYSA 3FJ5A 2PTKA 4IUQA 5GANh 2NLUA 2KGTA 2LQKA 5IHNA 3OYNA 4C92G 1JQQA 1NLPC 1GXIE 1J3TA 2VV5A 1Q82C 3CC4Q 1K9AA 1VQLT 5EC7A 4A63B 1B7TA 2DXUA 1BBZA 1D3BB 2QQRA 3C94A 3A8MB 1M1KU 1AWXA 1VQ8A 4M75B 3S3NA 4OMNA 2K2MA 3G71T 2YUOA 4BE1A 1YJNT 3JB9F 1K0SA 1YI2A 2E4HA 2FPFA 1D1AA 1I5LA 2E41A 1SF9A 2HQEA 4FYWB 3ZBDA 4D8DA 3OYLA 5CK9A 2LDMA 1WI7A 5J39A 4F14A 5I22A 2DO3A 1I81A 2RHUA 4FU6A 4OGCA 3JCMW 2GBQA 3TREA 4M75E 2H3EB 3CCUT 2PVDB 4F7UG 2KVQG 2ZPIB 5GAN4 4EMKA 1AWJA 3QYGB 1S72Q 4J9HA 1VQ6A 4M77B 1WQ7A 2OAUA 2JNGA 2MPXC 4ANJA 1K73R 2DJZA 2DD5A 3CPFA 1PNJA 2IIMA 5GANf 3EGDB 3M4YA 1IGUA 1H8KA 2F69A 4C0ZA 3JCMV 2L3PA 2WSFE 1KQ1A 1V29B 2DZCA 5LJ5d 4M7DD 5A0DA 4F16A 5DLOA 2HEQA 2JM8A 2MWPA 2AKKA 1WXBA 2H3JA 2LCLA 2RI3A 3F70A 2Y4XA 2DYBA 3OQ5A 1UE9A 2LCCA 2VVKA 1X2KA 1Q82R 5FRNA 4M78A 1VYVA 5CAIA 2JW4A 4XTVA 1ZA1B 1WJSA 4KULA 2K5IA 4MZPA 1RL2A 4II1A
chains in the Genus database with same CATH topology
4PKCC 1IREB 2QQAA 4BI8B 3OYAA 1K73U 3KXTA 3CCQT 3P8HA 3QXEB 4PJOF 3JCMb 1W2BA 1YITT 1Y96A 4M75D 4BD3A 1JRIA 4LDXA 2K4YA 3MEAA 4N0AC 3TEEA 5I2MA 4O6JA 1Q86U 4FT2A 2ZPEB 3CEYA 3HRTA 2RO0A 5CKEA 5HY6A 3RESA 4E7LA 2XHCA 1M1GA 3FJPA 3TU4K 1YI2T 1DJ7B 1W2BS 3GNFB 5IAYA 1RI0A 2R5MA 1B34A 1XTDA 4QW2A 3JCMg 3MEVA 2EWNA 4MDWA 3TCJA 3LGLA 4A4GA 3J81E 4OB3B 2GFUA 3DKMA 4L6V5 3LLRA 3JCMc 5FLXE 4EMKC 5FU7B 3CCJA 3VU3C 2LX9A 3CD6T 3DLLA 4HCCA 1M4ZA 5EG2A 2LNVA 3OS1A 1VQKT 1M8VA 4HCZA 4BACA 3VYGA 2M0OA 5I21A 1VQKA 4PJOA 3ZFJA 2HAXA 2EQJA 2FL7A 5C6SA 1MGQA 2G3RA 3RIRA 3OYFA 3M53A 3DB3A 3L2WA 3CCMT 3V7RA 1FXXA 2X4YA 2ZPHB 4XTWA 4XU0A 2V8IA 1BI0A 2I2LA 2XICA 5LJ3g 4UC4A 3A8OB 5FROA 4C92C 3JCMQ 2OTJT 1WGSA 2M16A 5GMKj 3CCEA 4JRPA 3E9FA 3A8LB 2VGNA 4Y91A 1S72T 2F5TX 2LC4A 4J83A 3L2VA 3I55T 1YCYA 3CMEA 3HL8A 1YJWT 3CCSA 1HK9A 1YJWA 1MHNA 3PNWC 2QQ9A 2XI9A 3JB9I 3CCQA 3GF5A 3GPLA 3CMAT 3HP9A 4M78B 3OYJA 1VQ7T 4M78F 2L89A 2E1HA 3QPHA 4JRIA 5GAN6 2PVGB 4XTUA 2JUFA 3SWNA 2D6FA 2XG8D 3FDRA 4R56A 5DM7R 2PVOB 3OB9A 4MZMA 4BY6C 1BIBA 2BIVA 2X4JA 3FEOA 4D6WA 3PGGA 1NPPA 4B9WA 1JJ2A 2DZ9A 4KUDK 4M7DG 3OYDA 3NTIA 4NL2A 1QVPA 1G5VA 3EFSA 3G4SA 2BUDA 4LD6A 4ELYC 1YITA 2ZPBB 4PJOD 4QQDA 1VQ9A 5LJ5h 1KC8U 2GQVA 4C92A 3S3OA 3JB9H 2CGHA 1N27A 3QUIA 2AHJB 5LJ3f 2EQKA 2QQBA 2V8KA 1G3WA 2KSSA 3BDUA 5CR2A 4N4HA 2DK3A 5GMKi 2DTOA 2RHXA 3I56A 4GY5A 1OYXA 2DTHA 2JOYA 1K8AC 4M77F 4Z02A 1VQOT 2KDSA 3JSCA 1I8FA 2E6NA 3R6OA 4RKUE 1K73C 1WPYA 1YHQA 2VGMA 2PUKB 3CBMA 3E1SA 5GANe 3FRNA 2VUBA 4PLIA 3PMTA 3EFRA 4ATOA 2YLBA 3UDCA 5GAN5 4Y28E 1O75A 3LYIA 4N4IA 5LJ5g 3S3MA 5M9OA 5A0LA 5GANg 3CMAA 3X24B 2KAFA 1XQHA 1QVFS 2E10A 4NS5A 1HXDA 4BDZA 4LDUA 2EQMA 5CKBA 4OB0B 5A2QE 3FIFA 3C95A 5LJ3d 2QEXA 1S72A 3HFNA 4XAXB 5GAMh 3I55A 4M7AC 1QVFA 4LDYA 4ZGDB 1Y96B 3DB4A 2JN0A 4QVDA 4XQ3A 4ZTFA 4JRQA 3GOXA 1SSFA 2MI6A 4ZGJB 2VXFA 4FM4B 4OB2B 4XTYA 2DXCA 1Q81U 4M75F 4F7UF 3VUBA 5GAMd 5CKHA 4KT0E 3DLMA 3QJYA 4IUVA 5KCHA 2P0KA 3MP6A 3JCMe 1VQNT 3LW5E 2R5AA 3SD4A 3OBYA 3WVEB 3QO3A 2E5QA 4HT9A 3L2ZA 4RCCA 3PT9A 5CQYA 4EMGA 2DVEA 5GAOp 1VQMA 5KE2A 2C06A 3X25B 3QIIA 1YJ9T 3L2RA 3META 4X9CA 2XIDA 5HKCA 5KE3A 3MCAB 1UGRB 3N5BB 4VUBA 3RMSA 2EFIA 1ZBXA 2RHZA 3JCMh 3UT1A 5GAN3 3M58A 1FWZA 4C8QE 4LD9K 1LNXA 4MZTA 5GMKh 2E6ZA 2GCXA 1IZ6A 3HFOA 3CCLT 3HHTB 1WJQA 4IUTA 3OS0A 1BI1A 3OS2A 3GIBA 1YHQT 2K3YA 2DIGA 4MMLA 3OSVA 2EJGA 2K5FA 3FC3A 4X9DA 4M78G 3VJPA 1Q7YC 5GAN7 3WVDB 1Q7YU 4FT4A 5I2SA 5CCAA 3OYCA 4OGEA 2R57A 4A54A 4M75A 4BDYA 4M7DF 1N8RU 3PMIA 3QDRB 2ZGWA 4RMOA 4XK8E 2QA4A 3RKYA 1K9MC 2MMPA 3SDZA 1QVGS 2QA4T 2LT1A 1X75C 2LVMA 2EYQA 2DIQA 4E7IA 4N0AA 3KBGA 1M9SA 4J6XA 4M7AG 3CXCS 3ASKA 4MDXA 2LRQA 5GMKm 5GAN8 2HBPA 5GANj 2JVVA 5HK0A 5GAOm 2FB7A 4QQGA 2RK1A 3WXMB 5J26A 3URGA 4HA8A 5AYFA 2O01E 4XTZA 4OF1A 1U1SA 3VUZA 3M56A 3CPWA 5CO7A 2A7YA 4M7AA 4KBMB 4CRIA 3KUFA 2CZ7B 3C12A 5GMKl 3L1AA 1QP2A 4C0GA 4F7UB 5FRMA 1K9MU 2DD4A 4HKEA 2HNIA 3V7SA 2CS7A 2DPPB 1M1KC 1KQSS 2KMTA 2OTLT 2K2VA 1WJRA 3PTAA 5IN1A 5GAMf 3QHSA 4NL3A 1H641 2RH2A 3INZA 3GNGA 2VC8A 4A4FA 3M54A 5D6YA 2P0PA 1KHCA 3JAME 4LDVA 4E7JA 4HCBA 3A8HB 3MO8A 4R55A 3PIPA 4JJNK 3AHUA 1Q82U 4C0FA 4ZTJA 2PUOB 3X20B 4XTXA 5KH6A 3E19A 4F7UE 3GP8A 2JTFA 5FU6C 1K8AU 2XDPA 2DEQA 4TVRA 3RMQA 2QDYB 4M77D 3M59A 4M75G 2RI5A 4C92F 2V8JA 3HKSA 1M90C 4IUPA 4OP0A 4YTLA 2RM4A 4IKFA 1KC8C 1BIAA 1G3TA 3L42A 2WACA 3MP1A 1YIJT 1YJ9A 3RKXA 3CBPA 3OYYA 1LJOA 1QP3A 1YIJA 2XD0A 4PJOB 2XKOC 1R8OB 3JRZA 4PJOC 2O4XB 1BKBA 4L59A 2K3XA 2XDDA 5CKFA 1KG1A 3FB9A 5CIUA 3ER0A 2XU8A 1P92A 3CCRA 2OTLA 3ME9A 3CCVT 3M4GA 4J6YA 1M1FA 5D6WA 3RKWA 1OZ2A 4M75C 1M5Q1 4OVAA 4M7AD 3VYHB 2RJFA 4ZGEB 5GAMe 3FLGA 3CC2A 4WF2A 3X28B 1X6OA 2MWOA 3OYEA 3CXCA 4M7DB 2BKDN 3JB9G 2L5QA 2M1HA 4V2SA 4B9XA 4J6WA 1NPRA 3JCMJ 2IG0A 3PFSA 5GAMj 3H8ZA 3QSUA 1UGSB 2F5KA 2QXFA 4M77E 4E47A 3QG1A 3SB2A 4JS5A 3J80E 1B34B 4DOWA 2RK2A 5KCOA 3HRUA 5LJ5f 4C8QB 1Y07A 4DOVA 4BE0A 4FIBA 4GLKA 4C8QF 1KHIA 1Y71A 3MP8A 5LJ3h 3NFCA 3HPWA 1XNIA 1VQ7A 4PL6A 3NTKA 3CCUA 3UWNA 1UGPB 2E65A 4ZN3A 1UB4A 3OYBA 3CC7T 1WNLA 1UEBA 5FU6B 2QEXT 3OYMA 1VQPT 3CC4A 4C92E 1VQPA 1BI3A 2QQSA 3X26B 4L5GA 1ZQ1A 3OBWA 4J7FA 5CVIA 4M7AF 2X4XA 3LWIA 2Y90A 4A4EA 2JTMA 3M57A 2YRVA 3OMCA 5DLQE 5J3BA 4BI4A 4BUGA 3BDLA 4C92D 3M9QA 1VQ9T 4XU2A 1KQ2A 3J7AF 2D0QB 1BI2A 4MMKA 3OYGA 2LTOA 3CCRT 4M7AE 4C5HA 2KQWA 3OMGA 4M7DA 2A3LA 4ME7A 3QZ5B 3A5ZB 3L2UA 4QVCA 2FHDA 1KD1C 1O9SA 2LQ8A 4JDSA 3M55A 2Y4YA 3LX7A 1QW1A 4DQ2A 2MF2A 3CBOA 3ZEHA 1PSEA 3QYHB 3OSSC 1KD1U 1QVGA 4J8OA 1JJ2S 5GAOl 1Q86C 3QJ6A 3VKIA 4M77C 5GAN2 1U1TA 1VQMT 3SWNC 2X35A 2DXTA 1BYMA 2EJ9A 1W4SA 1OI1A 3T9NA 5A0GA 2LT4A 4XU1A 3Q1JA 2X4WA 1H3ZA 2RHIA 1VIEA 3QKJA 4IUQA 5GANh 2RJDA 4J7IA 4M7DC 4ZN1A 3QBYA 4EMKB 2ZCFB 2NLUA 3C4SA 2EJFA 2LQKA 2RJCA 3OYNA 4C92G 4F7UA 1GXIE 2VV5A 5GAOr 4C8QC 4EDUA 3CMET 5IT9E 4C8QA 4JS4A 3JCMP 2CZ6B 1Q82C 3CCST 2E70A 1VQLT 2ZPFB 3V7CA 3CC7A 4BB7A 4C5IA 4RG8A 2HD0A 4XU3A 2D9TA 3MHXA 4X34A 5CQXA 5C0MA 3JCMX 4CI0C 2QI2A 2DXUA 2EQUA 4N4GA 2M9UA 5GAOn 1VQNA 2QQRA 1D3BB 5DY9A 1U8RA 3C94A 3A8MB 3OYKA 3M5AA 5FU7C 3E9GA 3MEUA 2FVUA 1M1KU 2K57A 1VQ8A 2CZ0B 2ZPGB 1VQ8T 3A8GB 4M75B 3S3NA 2RB6A 4Q5WA 1VQ6T 2XDBA 4C0DC 1PSFA 3S6WA 1VQ5A 1NZ9A 3GLXA 1Y7XA 4IUUA 3V8KA 1YBYA 3LGFA 3G71T 3SFMA 3RERA 4KUIA 4BE2A 3JB9D 1AHJB 1LOJA 4BE1A 4E7HA 4J5YA 1YJNT 1N8RC 3G7ZA 3JB9F 3CCVA 1YI2A 4A4HA 4PJOG 4IURA 4M78E 3HSBA 2DTIA 2HQXA 4JLIA 4A53A 1I5LA 3HRSA 2GF7A 2E41A 4E7KA 2HQEA 4P5NA 1FX7A 4M7AB 3ZBDA 4O5VA 3NTHA 3OYLA 3CCJT 5CK9A 1G3YA 2LDMA 4RCBA 5J39A 1M90U 2JZ2A 4PLLA 4C8QG 2IVWA 2RJEA 4LDWA 5GANd 2DO3A 1I81A 5GMKe 2RHUA 1NJIC 4FU6A 4OGCA 3JCMW 4NOYA 4QQ6A 3TREA 4M75E 1VQ4T 1X01A 2L3RA 3LH0A 1VQ4A 3CCUT 4C8QD 3G6EA 4PJOE 2E64A 2PVDB 4F7UG 2P4TA 2WSEE 3MEWA 1VUBA 2KVQG 2ZPIB 4JUVA 3RUXA 2VYTA 3BW1A 4EMKA 5GAN4 5D6XA 3QYGB 4M77A 2PQWA 5LJ3e 2DKGA 2WSCE 3CCMA 1UGQB 3H6ZA 3PIOA 1VQ6A 4M77B 1WQ7A 1NJIU 2OAUA 2FYKA 2EKOA 4EPCA 2JNGA 1JBMA 2CZ1B 1XOVA 3VV0A 1JB0E 2DJZA 2DD5A 3CPFA 2VXEA 4M7DE 4A4KA 4EMHA 2KK4A 5GANf 3CPWS 1OZ3A 3P8BB 4OMFB 5LL6S 3BFMA 1Q81C 5CKDA 2MAMA 3M4YA 2EIFA 4JRKA 3OYIA 3OA6A 1VIFA 1VQ5T 5HK3A 5LJ3j 2F69A 2RHYA 4BY6B 4RG2A 3SWNB 4C0ZA 3OYHA 1N9SA 1WQWA 3JCMV 2YLCA 3V8JA 2WSFE 1KQ1A 3L2QA 1V29B 2CKKA 2DZCA 2KY9A 2YHTA 4JLGA 5LJ5d 3I56T 2O4XA 3QZ9B 4M7DD 2DXBA 2L8DA 5A0DA 3G71A 3JB9J 2R58A 5L8RE 2RD1A 5DLOA 3OW2S 2B8AA 4FSXA 3CC2T 2MWPA 1YJNA 1ZHIA 2OTJA 5LJ5j 3LWHA 4PNOA 2CYZB 2H3JA 2LCLA 2RI3A 3F70A 3G6ET 2Y4XA 1G3SA 2EAYA 1EIFA 4M77G 4QVZA 3EAEA 5GAOq 1VQLA 3OQ5A 3CCLA 2DAQA 2GFAA 2LCCA 5GAMg 1NE8A 3P8DA 3OW2A 1VQOA 4HT8A 4FL6A 4BI3A 3CD6A 2RA2A 1KQSA 4ELZC 4OB1B 4M78C 5FRNA 4M78A 1D3BA 2ZZDA 3JCMf 3OY9A 3BY7A 3OS5A 2QTXA 4DA4A 2PU9B 3UPUA 5CAIA 3V8LA 1TH7A 4XTVA 2K5LA 2P0QA 5LJ5e 1WJSA 3CC4T 3O8VA 4KULA 1I4K1 1N9RA 2E12A 2K5IA 1N6AA 4MZPA 4C5EA 4C0DB 4C5GA 4C92B 3JCMd 3G4ST 4M78D 1RL2A 2RI2A 4II1A 3CCET 2XK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VXF A;  4XTY A;  2K57 A;  4M75 F;  3RKX A;  1LJO A;  4M75 B;  5GAM d;  4PJO B;  2RB6 A;  4PJO F;  3JCM b;  1Y96 A;  4M75 D;  1JRI A;  4PJO C;  4N0A C;  3V8K A;  3JCM e;  3RER A;  3FB9 A;  3RES A;  3HSB A;  3JB9 D;  3QO3 A;  1LOJ A;  4J5Y A;  3FJP A;  3JB9 F;  4HT9 A;  3L2Z A;  3M4G A;  4RCC A;  4J6Y A;  4M78 E;  4PJO G;  1B34 A;  2DTI A;  3RKW A;  4JLI A;  2DVE A;  2EWN A;  4M75 C;  3JCM g;  1M5Q 1;  4A53 A;  2E41 A;  1I5L A;  4M7A D;  5GAM e;  4M7A B;  4EMK C;  4WF2 A;  3JCM c;  4M7D B;  3VU3 C;  3JB9 G;  4X9C A;  4V2S A;  4RCB A;  3JCM h;  5GAN 3;  1M8V A;  4J6W A;  3JCM J;  4C8Q G;  5I21 A;  5GAM j;  4C8Q E;  3QSU A;  4PJO A;  1LNX A;  4M77 E;  5GAN d;  1I81 A;  1MGQ A;  5GMK e;  3HFO A;  3SB2 A;  3RIR A;  1B34 B;  3JCM W;  4NOY A;  3V7R A;  3GIB A;  4XTW A;  4M75 E;  4XU0 A;  4C8Q B;  5LJ5 f;  1X01 A;  2I2L A;  4MML A;  2EJG A;  4C8Q F;  4C92 C;  5LJ3 g;  5LJ3 h;  4C8Q D;  4X9D A;  4M78 G;  5GMK j;  4PJO E;  2E64 A;  4F7U G;  4Y91 A;  5GAN 7;  4JUV A;  2E65 A;  3RUX A;  1YCY A;  1WNL A;  3BW1 A;  4EMK A;  5GAN 4;  4M77 A;  4C92 E;  1HK9 A;  2DKG A;  4A54 A;  5LJ3 e;  3JB9 I;  4M75 A;  4M7A F;  4M78 B;  4M77 B;  2Y90 A;  1WQ7 A;  4M7D F;  4M78 F;  2FYK A;  4F7U F;  2E1H A;  1JBM A;  2ZGW A;  4JRI A;  4C92 D;  5GAN 6;  3RKY A;  5GAO p;  4XTU A;  4XU2 A;  2DJZ A;  3SWN A;  1KQ2 A;  2VXE A;  4MMK A;  4M7D E;  1BIB A;  4N0A A;  4M7A G;  3PGG A;  4J6X A;  4EMH A;  5GAN f;  4M7A E;  2DZ9 A;  5GMK m;  4M7D G;  4M7D A;  4NL2 A;  5GAN 8;  3EFS A;  4QVC A;  5GAN j;  3BFM A;  4PJO D;  4JRK A;  5GAO m;  2FB7 A;  5LJ3 j;  5LJ5 h;  4DQ2 A;  4C92 A;  3SWN B;  4HA8 A;  2CGH A;  3JB9 H;  1N9S A;  1WQW A;  3QUI A;  3JCM V;  5LJ3 f;  2YLC A;  4XTZ A;  1U1S A;  3V8J A;  3BDU A;  5GAO l;  1KQ1 A;  5GMK i;  2DZC A;  2DTO A;  4M7A A;  4M77 C;  5GAN 2;  2DTH A;  2YHT A;  5LJ5 d;  1U1T A;  5GMK l;  3L1A A;  4M77 F;  4M7D D;  3SWN C;  4F7U B;  2DXT A;  3JB9 J;  1I8F A;  3V7S A;  2HNI A;  2RD1 A;  1WPY A;  2EJ9 A;  5LJ5 j;  4EMG A;  4PNO A;  5GAN e;  4XU1 A;  2EAY A;  3EFR A;  5GAM f;  2YLB A;  3QHS A;  4M77 G;  5GAN 5;  5DY9 A;  5GAO q;  4NL3 A;  5LJ5 g;  1H64 1;  3INZ A;  5GAM g;  5GAN h;  2VC8 A;  4HT8 A;  4M7D C;  5GAN g;  4EMK B;  2EJF A;  2RA2 A;  2E10 A;  1HXD A;  4C92 G;  3AHU A;  4M78 C;  4F7U A;  4M78 A;  1D3B A;  3FIF A;  3JCM f;  4C8Q C;  5LJ3 d;  3BY7 A;  4C8Q A;  3JCM P;  5GAO r;  2QTX A;  3HFN A;  4XTX A;  4F7U E;  5GAM h;  5CAI A;  3V7C A;  3V8L A;  1TH7 A;  2DEQ A;  4XTV A;  5LJ5 e;  4M7A C;  4M77 D;  4XU3 A;  4M75 G;  1I4K 1;  1N9R A;  3JCM d;  4C92 F;  3JCM Q;  1Y96 B;  3JCM X;  2JN0 A;  4C92 B;  4QVD A;  2DXU A;  4M78 D;  4OP0 A;  2RM4 A;  4XQ3 A;  5GAO n;  5GMK h;  1BIA A;  1D3B B; 
#chains in the Genus database with same CATH topology
 4PKC C;  4BI8 B;  1OOT A;  3P8H A;  1AZG B;  2ZAE A;  2YWW A;  1YIT T;  1Y96 A;  4BD3 A;  2K4Y A;  3TEE A;  5I2M A;  4O6J A;  1Q86 U;  2ROL A;  3CEY A;  5CKE A;  3HRT A;  1N5Z A;  3IQL A;  1KC8 R;  2EQI A;  3FJP A;  1ZA2 B;  3TQ7 P;  1D09 B;  3JCM g;  1QKX A;  4A4G A;  3J81 E;  4OB3 B;  3DKM A;  3LLR A;  5FU7 B;  4HCC A;  1M4Z A;  1WHH A;  5I21 A;  1VQK A;  1KK7 A;  2HAX A;  1GFD A;  1MV0 B;  3RIR A;  3OYF A;  2RPN A;  2LMJ A;  4XTW A;  2D8H A;  1RAE B;  1R0C B;  4UC4 A;  2F1L A;  5FRO A;  4C92 C;  5LJ3 g;  2M16 A;  5GMK j;  1RAB B;  2VGN A;  2LC4 A;  3L2V A;  3CME A;  1ZLM A;  3CCS A;  3RDV A;  1HK9 A;  4RTT A;  3GPL A;  3CCQ A;  4M78 F;  2L89 A;  4JRI A;  2PVG B;  2VB6 A;  4XTU A;  1VQO Q;  2D6F A;  2PVO B;  2QG9 B;  4BY6 C;  1BIB A;  1JJ2 A;  4NL2 A;  5KYY B;  3NGP A;  4LD6 A;  1YIT A;  2ZPB B;  4QQD A;  2LP5 A;  5LJ5 h;  1KC8 U;  2GQV A;  2CGH A;  1N27 A;  2AHJ B;  2V8K A;  1HSQ A;  5CR2 A;  2DK3 A;  2NUP B;  3CC2 Q;  2JOY A;  2DTH A;  2E3H A;  4KGV B;  1IO6 A;  1VQO T;  3JSC A;  3R6O A;  4RKU E;  1QWF A;  1YHQ A;  3CBM A;  1NBE B;  3E1S A;  2QK0 A;  1UTI A;  2BZ8 A;  4Y28 E;  4N4I A;  2EYW A;  2QAS A;  1OPL A;  5GAN g;  2DF6 A;  1QCO A;  4NS5 A;  1HXD A;  4LDU A;  5CKB A;  1W70 A;  5IXF A;  3FIF A;  4AG1 C;  3CCM Q;  1QCN A;  3A1P A;  1QVF A;  2LJ0 A;  3M0U A;  2RQR A;  1S1N A;  3GOX A;  2KT1 A;  2VXF A;  4FM4 B;  1X6G A;  1Q81 U;  1VA7 A;  3REB B;  3VUB A;  2ABL A;  1C1A A;  3QJY A;  4IUV A;  1YJ9 Q;  3MP6 A;  3SD4 A;  2JTE A;  4DBQ A;  2CP2 A;  1M30 A;  3L2Z A;  5CQY A;  1VQM A;  2ED1 A;  3L2R A;  2XID A;  5HKC A;  3MCA B;  3N5B B;  4VUB A;  3UT1 A;  1FWZ A;  4LD9 K;  3VS6 A;  2MIO A;  2KR3 A;  1JEG A;  3HFO A;  3HHT B;  1WJQ A;  4IUT A;  1BI1 A;  2DIG A;  1QLY A;  3FC3 A;  5GAN 7;  4FT4 A;  5I2S A;  3I9Q A;  1XJW B;  3OYC A;  1M27 C;  2JS0 A;  2FEI A;  1N8R U;  3PMI A;  1K9M C;  1V76 A;  3SDZ A;  1QVG S;  2QA4 T;  1G8X A;  4E7I A;  4J6X A;  1G83 A;  2D8J A;  2GGR A;  4MDX A;  3G6E Q;  5GAN 8;  2HBP A;  2NUT B;  1GCQ A;  5GAO m;  2FB7 A;  1H3H A;  4QQG A;  5J26 A;  4HVU A;  4OMP A;  2K6D A;  4XTZ A;  2RNA A;  4KGZ B;  4OF1 A;  1NYG A;  2O2O A;  4JJC A;  3L1A A;  4C0G A;  5FRM A;  1K9M U;  2HNI A;  2CS7 A;  2GQI A;  1M1K C;  4RTY A;  2KMT A;  2OTL T;  3M0P A;  1WHM A;  1WJR A;  5GAM f;  2J7I A;  3GNG A;  2VC8 A;  2RQV A;  2HQH A;  2P0P A;  1ZSG A;  3AHU A;  4JJN K;  1Q82 U;  2PUO B;  2OAW A;  3X20 B;  3E19 A;  1D0X A;  2MOX A;  2QDY B;  4M77 D;  3H9N A;  2V8J A;  5IHK A;  1OUL A;  3PVL A;  3CD6 Q;  1YIJ A;  1LJO A;  1Z9Q A;  4PJO C;  3REA B;  1KG1 A;  1RUW A;  3GBQ A;  2XU8 A;  3CCR A;  3ME9 A;  4J6Y A;  2OJ2 A;  2O9S A;  2RJF A;  3KFV A;  3FLG A;  4WF2 A;  1X6O A;  2QYZ A;  2BKD N;  2DM1 A;  2FZG B;  2M1H A;  1VQP Q;  4B9X A;  1NEG A;  3QSU A;  3PE0 A;  4JZ3 A;  2QXF A;  4IIM A;  3JV3 A;  3J80 E;  1SRM A;  2RK2 A;  3UF4 A;  2D1X A;  3HRU A;  4C8Q B;  4DOV A;  2X51 A;  4GLK A;  3MKD A;  1Y71 A;  5LJ3 h;  1KFZ A;  4PL6 A;  1UGP B;  1X2Q A;  3M0Q A;  1WNL A;  1UEB A;  5FU6 B;  2JM9 A;  2QGF B;  3X26 B;  2K3B A;  4L5G A;  1ZQ1 A;  1PRL C;  3OBW A;  3VS1 A;  3M57 A;  4C92 D;  1KQ2 A;  1NG2 A;  4M7A E;  2DBM A;  3QZ5 B;  1GBQ A;  1O9S A;  1G2B A;  1UFF A;  3LX7 A;  4K11 A;  2MF2 A;  3ZEH A;  1PC0 A;  1YNZ A;  1JJ2 S;  2HBW A;  2JT4 A;  3VKI A;  5GAN 2;  3H0I A;  1D1C A;  1OI1 A;  1W4S A;  5A0G A;  2C0T A;  4XU1 A;  2FRW A;  1YHQ Q;  3UA6 A;  2X4W A;  1H3Z A;  2KXD A;  2RHI A;  1VIE A;  2EGE A;  4M7D C;  4ZN1 A;  4EMK B;  2ZCF B;  1JO8 A;  1UGV A;  5IT9 E;  3CME T;  4JS4 A;  2CZ6 B;  1KD1 R;  2E70 A;  5I11 A;  3CC7 A;  4AT1 B;  2D9T A;  3MHX A;  2KEA A;  2QI2 A;  4N4G A;  2M9U A;  5FU7 C;  3E9G A;  2VAS A;  1BK2 A;  2RB6 A;  4Q5W A;  2O88 A;  1PSF A;  4KH0 B;  3GLX A;  1Y7X A;  3V8K A;  2QTV A;  3JB9 D;  1VOM A;  1N8R C;  3CCV A;  2V1Q A;  4M78 E;  2DTI A;  1AEY A;  3HRS A;  4E7K A;  1W2B P;  4M7A B;  2EW3 A;  2CP6 A;  3NTH A;  1ARK A;  1G3Y A;  3VS3 A;  1K76 A;  1TOV A;  2JZ2 A;  1R77 A;  1SEM A;  2RJE A;  4AFZ C;  2F2V A;  4RTX A;  1NJI C;  1OU8 A;  4R0K A;  2LCS A;  1X43 A;  4QQ6 A;  2RF0 A;  1X01 A;  3LH0 A;  3U23 A;  3RUX A;  2VYT A;  2RQU A;  2PQW A;  1CKB A;  1UGQ B;  3H6Z A;  4LUE A;  1NJI U;  2EKO A;  4EPC A;  1XOV A;  3VV0 A;  1RI9 A;  1UJ0 A;  4M7D E;  2D0N A;  2KK4 A;  4E2F B;  2MCN A;  1Q81 C;  4J9E A;  1T3S A;  1N9S A;  4B6M A;  4JLG A;  3I56 T;  2O4X A;  3QZ9 B;  3JB9 J;  1R0B G;  3G71 A;  2R58 A;  1TU0 B;  2RD1 A;  3OW2 S;  2OTJ A;  5LJ5 j;  3LWH A;  2CYZ B;  2EAY A;  1EIF A;  3O5Z A;  4LE9 A;  3VS5 A;  4QVZ A;  1NEB A;  2GFA A;  1VQO A;  3P8D A;  2CUB A;  2RA2 A;  2V1R A;  4OB1 B;  1D3B A;  3OY9 A;  3BY7 A;  3OS5 A;  4DA4 A;  2PU9 B;  3UPU A;  1WHL A;  4CC2 A;  2K5L A;  4QT7 A;  3TVT A;  1N9R A;  3JCM Q;  1N6A A;  3G4S T;  2JMC A;  2DRM A;  3CCE T;  2COW A;  2FO0 A;  2QQA A;  2FPE A;  1VQK Q;  1ZUK A;  3QXE B;  4PJO F;  4LDX A;  1WHK A;  4N0A C;  3BE3 A;  3VS4 A;  2DL4 A;  2ZPE B;  4E7L A;  3RES A;  2HDA A;  2COZ A;  2KBT A;  1VQM Q;  1AVZ C;  1YI2 T;  3GNF B;  1RAI B;  4QW2 A;  1XTD A;  2BZX A;  3MEV A;  2EWN A;  4MDW A;  2RN8 A;  3LGL A;  4EMK C;  2LX9 A;  1KIK A;  5EG2 A;  1VQK T;  1WZO A;  4BAC A;  2CH4 A;  2HKN A;  2FL7 A;  4AG2 C;  3CCM T;  3DB3 A;  1VQ9 Q;  1FXX A;  4XU0 A;  2V8I A;  1BI0 A;  2I2L A;  3A8O B;  1UUE A;  1Y0M A;  4JRP A;  4Y91 A;  2F5T X;  3I55 T;  1YJW T;  1MHN A;  2XI9 A;  3CMA T;  4J9B A;  3HP9 A;  1PG5 B;  1VQ7 T;  5HCK A;  1VQ8 Q;  3VRZ A;  2F2X A;  5GAN 6;  1K1Z A;  2XG8 D;  4R56 A;  1YJ9 T;  2BIV A;  3I35 A;  3PGG A;  2DL3 A;  1TTH B;  4B9W A;  3OYD A;  3NTI A;  2BUD A;  4ELY C;  3NHN A;  4DBH A;  1AT1 B;  2E3I A;  4C92 A;  3JB9 H;  3QUI A;  5LJ3 f;  2KSS A;  2CDT A;  2RHX A;  4GY5 A;  4Z02 A;  2OTL Q;  2E6N A;  1K73 C;  3I5R A;  1PD1 A;  2PUK B;  3UA7 A;  2CRE A;  1BCO A;  2YLB A;  4X1V A;  3VS7 A;  5M9O A;  3X24 B;  1YWP A;  2KAF A;  1XQH A;  1X27 A;  4RTZ A;  4OB0 B;  1S72 A;  5GAM h;  3I55 A;  1YJN Q;  4JJD A;  1Y96 B;  3DB4 A;  1WFW A;  4XQ3 A;  2FZC B;  6AT1 B;  4XTY A;  2DXC A;  4PJL A;  4M75 F;  1RAC B;  2KRM A;  4PJM A;  1VQN T;  3WVE B;  1TUG B;  1IHV A;  2E5Q A;  4GLM A;  4HT9 A;  5GAO p;  2YRC A;  3X25 B;  3MET A;  4X9C A;  5KE3 A;  2EFI A;  3M58 A;  4C8Q E;  2ESW A;  5ECA A;  2E6Z A;  2GCX A;  1IZ6 A;  2OTJ Q;  2H8H A;  3CCL T;  2DBK A;  3OS0 A;  1OX9 A;  1BU1 A;  4MML A;  3OSV A;  4F04 B;  4HCK A;  3WVD B;  4JPB W;  4AFU C;  1K0X A;  5CCA A;  4A54 A;  4M75 A;  1FMK A;  1X69 A;  3RNJ A;  3QDR B;  2DL7 A;  4RMO A;  4XK8 E;  3CCL Q;  1W1F A;  2LVM A;  3KBG A;  3CXC S;  5GAN j;  4FCY A;  5HK0 A;  1M2V A;  2RK1 A;  3NMZ C;  5FW9 A;  1X6B A;  3VUZ A;  2P84 A;  5CO7 A;  2A7Y A;  3PVQ A;  2EYX A;  3QWX X;  4KBM B;  4Z8A A;  3OW2 P;  2EGA A;  3V7S A;  2OI3 A;  3PTA A;  3QHS A;  2RH2 A;  1WDX A;  1D1B A;  2GNC A;  3M54 A;  1PM3 A;  4E7J A;  4HCB A;  2EVR A;  2A36 A;  5KH6 A;  4XTX A;  4F7U E;  3GP8 A;  1K8A U;  5FU6 C;  3C0C A;  1K8A R;  3CQT A;  3CCU Q;  4M75 G;  4PK4 A;  1BIA A;  3L42 A;  1YIJ T;  2JS2 A;  3CBP A;  3OYY A;  1E7O A;  2XKO C;  4JJB A;  2ECZ A;  3JRZ A;  2O9V A;  5CKF A;  2AZV A;  1MNE A;  2W0Z A;  5AT1 B;  2OTL A;  3G71 Q;  3M4G A;  1M1F A;  5D6W A;  1GFC A;  4OVA A;  4M7A D;  3OYE A;  3X28 B;  3PFS A;  5GAM j;  5KYW B;  3H8Z A;  4DEX A;  1TUC A;  1M90 R;  1I5O B;  4JS5 A;  1B34 B;  4DOW A;  1Q86 R;  1IB8 A;  4C8Q F;  2QGG A;  3MP8 A;  3NFC A;  3OYB A;  4ZN3 A;  1UB4 A;  3CC7 T;  2QEX T;  2M0Y A;  3OYM A;  4C92 E;  4M7A F;  3LWI A;  2Y90 A;  2NUT A;  4A4E A;  2JTM A;  4F7U F;  5DLQ E;  4BUG A;  3BDL A;  3M9Q A;  1VQ9 T;  1IXD A;  5KYX B;  3OYG A;  1BI2 A;  4HVV A;  2LTO A;  2A3L A;  2FHD A;  2LQ8 A;  4JDS A;  3CXC P;  3EG1 A;  3M55 A;  2YDL A;  2CH4 W;  2QEX Q;  4KH1 B;  3CBO A;  1PSE A;  1UJY A;  1QVG A;  2DX1 A;  5GAO l;  1Q86 C;  1T3L A;  1U1T A;  3CCS Q;  4RTU A;  2RQW A;  1JXM A;  2JJ9 A;  1C0M A;  2DJQ A;  3QKJ A;  4J7I A;  3QBY A;  3C4S A;  2EJF A;  2RJC A;  1RAF B;  2A08 A;  4F7U A;  1Q7Y R;  1YFN A;  5GAO r;  3CCS T;  2ZPF B;  2W10 A;  3V7C A;  2JXB A;  4BB7 A;  4AFS C;  5FWB A;  4RG8 A;  4C5I A;  2HD0 A;  1W6X A;  2KRO A;  5CQX A;  3JCM X;  1EZZ B;  2EQU A;  2J06 A;  3M5A A;  1PKS A;  3MEU A;  3EGD A;  1TUD A;  2K57 A;  1U06 A;  2CP7 A;  1VQ6 T;  3AT1 B;  2XDB A;  3S6W A;  1B3Q A;  4IUU A;  1D0Z A;  1YBY A;  1AHJ B;  1LOJ A;  4J5Y A;  4A4H A;  4GBQ A;  4A53 A;  8AT1 B;  1MV3 A;  2GF7 A;  2KRN A;  3QDF A;  4P5N A;  1FX7 A;  2CT3 A;  1SKU B;  4O5V A;  4PLL A;  4C8Q G;  2IVW A;  3M0R A;  1M3B A;  2J6O A;  4JZ4 A;  1ZSZ B;  2VKN A;  1JJ2 P;  1BCM A;  2J6F A;  2L3R A;  8ATC B;  1VQ4 A;  2X3X D;  3G6E A;  4PJO E;  2E64 A;  2P4T A;  2WSE E;  1VUB A;  3BW1 A;  1MUZ A;  5D6X A;  2DL5 A;  4M77 A;  5LJ3 e;  2DKG A;  2WSC E;  3MPU B;  3QWY A;  1JBM A;  2C0O A;  2CZ1 B;  1JB0 E;  4FYV B;  4RTV A;  2VXE A;  2LQW A;  4EMH A;  3CPW S;  3P8B B;  3M0T A;  5LL6 S;  4PJO D;  5CKD A;  4JRK A;  2GTO A;  5HK3 A;  4RG2 A;  3SWN B;  1WQW A;  3V8J A;  1M3A A;  2KY9 A;  2DXB A;  2LZ6 B;  2L8D A;  3CC2 T;  2B8A A;  4FSX A;  1YJN A;  1E6G A;  4PNO A;  5KYN A;  3EAE A;  5GAO q;  3CCL A;  2DAQ A;  3OW2 A;  5GAM g;  1NE8 A;  5FWC A;  4FL6 A;  2BTT A;  3CD6 A;  2L3Q A;  4ELZ C;  3CMA Q;  4M78 C;  2ZZD A;  1VQ7 Q;  3V8L A;  1LCK A;  2P0Q A;  5LJ5 e;  1M2O A;  4RUG A;  4C5E A;  4C5G A;  4C0D B;  4C92 B;  4M78 D;  2XK0 A;  1K9M R;  1IRE B;  3KXT A;  2AKL A;  3CCQ T;  3JCM b;  1W2B A;  1WHG A;  2HZY A;  1RAA B;  4M75 D;  1JRI A;  3MEA A;  2J05 A;  2RMO A;  5IXB A;  2RO0 A;  3TU4 K;  2KNB B;  1JU5 C;  1RI0 A;  2R5M A;  1B34 A;  3TCJ A;  3D7S B;  4L6V 5;  5FLX E;  3JCM c;  3DLL A;  1FMV A;  1YJW Q;  4DEY A;  3CCQ Q;  2HSP A;  4FW1 A;  4PJO A;  2DA9 A;  1ABQ A;  2BZY A;  3M53 A;  3V7R A;  2ZPH B;  2AT1 B;  2XIC A;  3CCV Q;  2OX7 A;  3CCR Q;  2SEM A;  1V1C A;  3CCE A;  1S72 T;  1UDL A;  1Z9Z A;  3HL8 A;  3GF5 A;  3EG9 A;  2O31 A;  2HL5 C;  1PWT A;  2JUF A;  3FDR A;  3OB9 A;  2X4J A;  1NPP A;  1PKT A;  1ZSZ A;  1U3O A;  3EFS A;  2V26 A;  1PD0 A;  3S3O A;  2EQK A;  1G3W A;  3BDU A;  3G1J A;  5GMK i;  3I56 A;  1K8A C;  2KDS A;  1TS9 A;  1I8F A;  4ESR A;  1HYO A;  3FRN A;  2VUB A;  2LJ3 A;  4PLI A;  3EFR A;  2DET A;  1O75 A;  3LYI A;  5LJ5 g;  1Q81 R;  3THK A;  2DFU A;  3CMA A;  2FRY A;  3H41 A;  4BDZ A;  1HD3 A;  5LJ3 d;  5GJW B;  3HFN A;  3A98 A;  4M7A C;  4PFP A;  2DLP A;  2JN0 A;  2KYB A;  4QVD A;  1H92 A;  2X9H A;  4FYX B;  4ZTF A;  2MI6 A;  4ZGJ B;  2KXC A;  1RAD B;  1WXT A;  2A28 A;  1YN8 A;  1MMD A;  1SSH A;  3DLM A;  5KCH A;  3JCM e;  1ABO A;  3LW5 E;  3OBY A;  4OMQ A;  1IHW A;  3UAT A;  3PT9 A;  1QCF A;  1QVF P;  2C06 A;  3QII A;  2YRD A;  3TSW A;  1VQ6 Q;  1UGR B;  3RMS A;  3JCM h;  5GAN 3;  2RHZ A;  1LNX A;  4MZT A;  2G6F X;  3OS2 A;  1GRI A;  3GIB A;  2GTJ A;  2K3Y A;  1YHQ T;  4X9D A;  4M78 G;  3VJP A;  4WCI A;  2EYZ A;  1Q7Y U;  3MJX A;  2KE9 A;  2R57 A;  4BDY A;  3R6N A;  3CME Q;  1IRX A;  2QA4 A;  4LXC A;  2MMP A;  4N0A A;  1AWW A;  1M9S A;  2EPD A;  3ZL7 C;  2JVV A;  1ZBJ A;  3WXM B;  1FMW A;  3URG A;  2CP5 A;  2O01 E;  1U1S A;  3M56 A;  3CPW A;  2LX7 A;  4M7A A;  4CRI A;  2YUQ A;  2CZ7 B;  2YXY A;  1NJI R;  4F7U B;  2J6K A;  2DD4 A;  4HKE A;  1RAG B;  1KQS S;  2QDL A;  2EGC A;  4NL3 A;  4CC3 A;  1H64 1;  4J9C A;  3EG3 A;  2KT8 A;  3JAM E;  4R55 A;  3PIP A;  1AZE A;  3EG2 A;  2JTF A;  4TVR A;  1PHT A;  2RI5 A;  1T0J A;  3HKS A;  4OP0 A;  4YTL A;  2RM4 A;  4IKF A;  2WAC A;  2L2P A;  2XD0 A;  4PJO B;  4LUD A;  1NLO C;  1R8O B;  2O4X B;  1BKB A;  3FB9 A;  5CIU A;  3ER0 A;  4WTO B;  1IGQ A;  1OZ2 A;  1M5Q 1;  3VYH B;  4ZGE B;  4PJJ A;  5GAM e;  3I55 Q;  4J9D A;  3CXC A;  2MWO A;  4M7D B;  3EHQ A;  4FYY B;  4V2S A;  1WX6 A;  1NPR A;  3JCM J;  1FYN A;  1WHJ A;  4E47 A;  3EH2 A;  2M51 A;  5KCO A;  1Y07 A;  4FIB A;  2CSI A;  1VQP A;  2YRV A;  4BI4 A;  2VWF A;  2L3S A;  5L23 A;  1YP5 A;  2AIR B;  4XU2 A;  2D0Q B;  4LN2 A;  2HMA A;  3CCR T;  3G4S Q;  2CSQ A;  2KQW A;  3OMG A;  2ATC B;  4ME7 A;  3A5Z B;  1KD1 C;  1AOJ A;  4Z89 A;  5KYW A;  4LNP A;  3QYH B;  3OSS C;  1PRM C;  4J8O A;  2DNU A;  2KI7 A;  3RR6 A;  1GL5 A;  1VQM T;  3SWN C;  2Z0W A;  1YI2 Q;  1BYM A;  2I0N A;  2EJ9 A;  2SRC A;  3T9N A;  4CC4 B;  2LT4 A;  2XMF A;  3Q1J A;  3EG0 A;  4J9I A;  2RJD A;  2K7A A;  2DYI A;  3H0F A;  3E2U A;  1Q95 G;  4C8Q C;  4EDU A;  3JCM P;  4C8Q A;  1LPL A;  4PFZ A;  5GJV B;  9ATC B;  2QA4 Q;  4XU3 A;  1AD5 A;  4X34 A;  4ORZ A;  5C0M A;  4CI0 C;  5GAO n;  1VQN A;  5DY9 A;  1U8R A;  3OYK A;  1ZSZ C;  2FVU A;  1OQK A;  2CZ0 B;  2ZPG B;  1VQ8 T;  3A8G B;  1EFN A;  4C0D C;  1VQ5 A;  2LJ1 A;  4Y92 A;  1VQL Q;  1NZ9 A;  3RER A;  3LGF A;  3SFM A;  4KUI A;  4DBF A;  4BE2 A;  4E7H A;  1SG5 A;  3G7Z A;  1VQ4 Q;  4ZNX A;  4PJO G;  4IUR A;  3HSB A;  2HQX A;  4JLI A;  3CCJ T;  1I07 A;  4RCB A;  1M90 U;  1WXU A;  4LDW A;  5GAN d;  4KRT A;  5GMK e;  1WA7 A;  4NOY A;  1VQ4 T;  1BB9 A;  4C8Q D;  3MEW A;  4JUV A;  2RQT A;  2YUN A;  4FW2 A;  3CCM A;  2HSE B;  2LNH B;  3NPF A;  3PIO A;  2FYK A;  2FPD A;  2HKQ B;  1WYX A;  1OV3 A;  1MND A;  4A4K A;  1OZ3 A;  4OMF B;  1TSF A;  3BFM A;  3EH1 A;  2MAM A;  3OYI A;  2EIF A;  4D8K A;  3OA6 A;  1OPK A;  1VIF A;  2BE9 B;  2HL3 A;  1VQ5 T;  5LJ3 j;  1AWO A;  4BY6 B;  2RHY A;  1CSK A;  3OYH A;  1SPK A;  2YLC A;  3L2Q A;  2CKK A;  5KYY A;  2YHT A;  5L8R E;  2B86 A;  1ZHI A;  1RLP C;  3G6E T;  3SEM A;  1C6V X;  1G3S A;  2A0F B;  1MMN A;  4M77 G;  1VQ5 Q;  1ZUY A;  1VQL A;  1PCX A;  4AMC A;  4HT8 A;  4BI3 A;  2E5K A;  1QKW A;  1KQS A;  1TWB A;  2DIL A;  4OML A;  2EKH A;  3EG9 B;  5KYU A;  1ZUU A;  3JCM f;  2QTX A;  2PZ1 A;  1RAH B;  1TH7 A;  1TXQ A;  1T0H A;  3CC4 T;  3O8V A;  1I4K 1;  2E12 A;  3JCM d;  1F1B B;  1SRL A;  1VYT A;  2QAZ A;  2RI2 A;  5GMK h;  1KJW A;  1GBR A;  1YWO A;  3OYA A;  1K73 U;  2K9G A;  2K79 A;  4FSS A;  2MK5 A;  4FT2 A;  5HY6 A;  2XHC A;  1M1G A;  1DJ7 B;  1W2B S;  5IAY A;  5KYU B;  1QWE A;  1OX8 A;  3I5S A;  2GFU A;  3CCJ A;  3CC7 Q;  3VRY A;  3VU3 C;  3CD6 T;  3EGX A;  2LNV A;  3OS1 A;  1M8V A;  4HCZ A;  3VYG A;  2M0O A;  3ZFJ A;  2PNI A;  2EQJ A;  5C6S A;  1MGQ A;  3M0S A;  2G3R A;  3L2W A;  2X4Y A;  1VYU A;  1LVK A;  4HVW A;  2OTJ T;  1WGS A;  1MMG A;  3E9F A;  3A8L B;  4J83 A;  2AK5 A;  1YCY A;  3CPW P;  1YJW A;  3JB9 I;  3PNW C;  2QQ9 A;  2A37 A;  4M78 B;  3OYJ A;  2DE0 X;  2CP0 A;  1U5S A;  2E1H A;  3QPH A;  2FZK B;  1Y57 A;  3SWN A;  1M1K R;  2NUZ A;  3H0H A;  4MZM A;  4D6W A;  5DM7 R;  3FEO A;  4E6R A;  2DZ9 A;  4KUD K;  4M7D G;  4E7Z A;  1QVP A;  1G5V A;  1GCQ C;  3G4S A;  5IH2 A;  1VQ9 A;  2X3W D;  3I56 Q;  2QQB A;  4N4H A;  2DTO A;  3HTR A;  1OYX A;  1QQJ A;  4M77 F;  1WPY A;  1N8R R;  4OMM A;  2VGM A;  5D7U A;  5GAN e;  2ENM A;  3PMT A;  4ATO A;  3UDC A;  5GAN 5;  1I1J A;  3S3M A;  2COY A;  5A0L A;  2DL8 A;  1QVF S;  2E10 A;  1GCP A;  2M02 A;  2EQM A;  2BE7 D;  5A2Q E;  3C95 A;  2QEX A;  4XAX B;  1UHC A;  3RBB B;  3EFO A;  4LDY A;  3CCE Q;  4F17 A;  1YCS B;  2F2W A;  4ZGD B;  5KYX A;  4JRQ A;  1SSF A;  4OB2 B;  2CP3 A;  1B07 A;  5GAM d;  4QKU A;  5CKH A;  4KT0 E;  3TSZ A;  1YIJ Q;  1WLP B;  2P0K A;  2R5A A;  1UHF A;  3QO3 A;  4RCC A;  1UEC A;  4EMG A;  2FG0 A;  2DVE A;  5KE2 A;  1SHF A;  1HJD A;  2CUD A;  3ULR B;  1ZBX A;  3SHW A;  1NYF A;  1QVG P;  4AFQ C;  1SHG A;  2EJG A;  2K5F A;  2ROT A;  2DER A;  1Q7Y C;  1TG0 A;  1K4U S;  4PJN A;  2KRS A;  4OGE A;  2DRK A;  4M7D F;  2ZGW A;  3RKY A;  2JMA A;  1CKA A;  2LT1 A;  1X75 C;  4J9G A;  2EYQ A;  2DIQ A;  4M7A G;  3ASK A;  4PFO A;  2LRQ A;  5GMK m;  7AT1 B;  1KQS P;  4HA8 A;  5AYF A;  1M2V B;  1UG1 A;  4Z88 A;  3KUF A;  3C12 A;  5GMK l;  1QP2 A;  2DPP B;  2K2V A;  2L0A A;  2NWM A;  5IN1 A;  1M3C A;  2NYS A;  3INZ A;  4A4F A;  1QMC A;  2YT6 A;  5D6Y A;  1KHC A;  3VS0 A;  4LDV A;  3A8H B;  1EX4 A;  2LQN A;  3MO8 A;  4C0F A;  4ZTJ A;  1YIT Q;  1KSW A;  2NUP A;  2XDP A;  2DEQ A;  3RMQ A;  4KGX B;  3M59 A;  4E7S A;  1ZX6 A;  4C92 F;  1M90 C;  4IUP A;  3LH5 A;  3EHR A;  1KC8 C;  2DMO A;  1G3T A;  2CT4 A;  3EGX B;  2KYM A;  3MP1 A;  2P4R A;  1YJ9 A;  3RKX A;  1QP3 A;  1VQN Q;  2DEU A;  4L59 A;  2K3X A;  2XDD A;  1WIE A;  2HCK A;  1P92 A;  4CC7 A;  3CCV T;  3RKW A;  4M75 C;  3EFO B;  3CC2 A;  2YUP A;  3VS2 A;  3JB9 G;  1MMA A;  2L5Q A;  2AZS A;  4J6W A;  2IG0 A;  1ACM B;  1UGS B;  2F5K A;  4M77 E;  3QG1 A;  3SB2 A;  4HXJ A;  4DBR A;  1M8M A;  1A0N B;  5LJ5 f;  2EYY A;  4BE0 A;  1VQ7 A;  1KHI A;  3HPW A;  1XNI A;  3NTK A;  3CCU A;  1E6H A;  3UWN A;  1OEB A;  2E65 A;  2EBP A;  4IIO A;  4RTW A;  1VQP T;  1NM7 A;  2ED0 A;  3CC4 A;  1BI3 A;  2QQS A;  4J7F A;  5CVI A;  2X4X A;  3OMC A;  5J3B A;  1I0C A;  4J9F A;  3J7A F;  4MMK A;  1OU9 A;  2DVJ A;  4C5H A;  4M7D A;  2IPO B;  3L2U A;  4QVC A;  5IHI A;  2Y4Y A;  1QW1 A;  4EIK A;  4DQ2 A;  1RLQ C;  1JXO A;  4OMO A;  1KD1 U;  3EGU A;  2YSQ A;  3CCJ Q;  3QJ6 A;  4M77 C;  4M4Z A;  1D0Y A;  2X35 A;  2DXT A;  2C0I A;  2MYS A;  3FJ5 A;  2PTK A;  4IUQ A;  5GAN h;  2NLU A;  2KGT A;  2LQK A;  5IHN A;  3OYN A;  4C92 G;  1JQQ A;  1NLP C;  1GXI E;  1J3T A;  2VV5 A;  1Q82 C;  3CC4 Q;  1K9A A;  1VQL T;  5EC7 A;  4A63 B;  1B7T A;  2DXU A;  1BBZ A;  1D3B B;  2QQR A;  3C94 A;  3A8M B;  1M1K U;  1AWX A;  1VQ8 A;  4M75 B;  3S3N A;  4OMN A;  2K2M A;  3G71 T;  2YUO A;  4BE1 A;  1YJN T;  3JB9 F;  1K0S A;  1YI2 A;  2E4H A;  2FPF A;  1D1A A;  1I5L A;  2E41 A;  1SF9 A;  2HQE A;  4FYW B;  3ZBD A;  4D8D A;  3OYL A;  5CK9 A;  2LDM A;  1WI7 A;  5J39 A;  4F14 A;  5I22 A;  2DO3 A;  1I81 A;  2RHU A;  4FU6 A;  4OGC A;  3JCM W;  2GBQ A;  3TRE A;  4M75 E;  2H3E B;  3CCU T;  2PVD B;  4F7U G;  2KVQ G;  2ZPI B;  5GAN 4;  4EMK A;  1AWJ A;  3QYG B;  1S72 Q;  4J9H A;  1VQ6 A;  4M77 B;  1WQ7 A;  2OAU A;  2JNG A;  2MPX C;  4ANJ A;  1K73 R;  2DJZ A;  2DD5 A;  3CPF A;  1PNJ A;  2IIM A;  5GAN f;  3EGD B;  3M4Y A;  1IGU A;  1H8K A;  2F69 A;  4C0Z A;  3JCM V;  2L3P A;  2WSF E;  1KQ1 A;  1V29 B;  2DZC A;  5LJ5 d;  4M7D D;  5A0D A;  4F16 A;  5DLO A;  2HEQ A;  2JM8 A;  2MWP A;  2AKK A;  1WXB A;  2H3J A;  2LCL A;  2RI3 A;  3F70 A;  2Y4X A;  2DYB A;  3OQ5 A;  1UE9 A;  2LCC A;  2VVK A;  1X2K A;  1Q82 R;  5FRN A;  4M78 A;  1VYV A;  5CAI A;  2JW4 A;  4XTV A;  1ZA1 B;  1WJS A;  4KUL A;  2K5I A;  4MZP A;  1RL2 A;  4II1 A; 
#chains in the Genus database with same CATH homology
 4PKC C;  1IRE B;  2QQA A;  4BI8 B;  3OYA A;  1K73 U;  3KXT A;  3CCQ T;  3P8H A;  3QXE B;  4PJO F;  3JCM b;  1W2B A;  1YIT T;  1Y96 A;  4M75 D;  4BD3 A;  1JRI A;  4LDX A;  2K4Y A;  3MEA A;  4N0A C;  3TEE A;  5I2M A;  4O6J A;  1Q86 U;  4FT2 A;  2ZPE B;  3CEY A;  3HRT A;  2RO0 A;  5CKE A;  5HY6 A;  3RES A;  4E7L A;  2XHC A;  1M1G A;  3FJP A;  3TU4 K;  1YI2 T;  1DJ7 B;  1W2B S;  3GNF B;  5IAY A;  1RI0 A;  2R5M A;  1B34 A;  1XTD A;  4QW2 A;  3JCM g;  3MEV A;  2EWN A;  4MDW A;  3TCJ A;  3LGL A;  4A4G A;  3J81 E;  4OB3 B;  2GFU A;  3DKM A;  4L6V 5;  3LLR A;  3JCM c;  5FLX E;  4EMK C;  5FU7 B;  3CCJ A;  3VU3 C;  2LX9 A;  3CD6 T;  3DLL A;  4HCC A;  1M4Z A;  5EG2 A;  2LNV A;  3OS1 A;  1VQK T;  1M8V A;  4HCZ A;  4BAC A;  3VYG A;  2M0O A;  5I21 A;  1VQK A;  4PJO A;  3ZFJ A;  2HAX A;  2EQJ A;  2FL7 A;  5C6S A;  1MGQ A;  2G3R A;  3RIR A;  3OYF A;  3M53 A;  3DB3 A;  3L2W A;  3CCM T;  3V7R A;  1FXX A;  2X4Y A;  2ZPH B;  4XTW A;  4XU0 A;  2V8I A;  1BI0 A;  2I2L A;  2XIC A;  5LJ3 g;  4UC4 A;  3A8O B;  5FRO A;  4C92 C;  3JCM Q;  2OTJ T;  1WGS A;  2M16 A;  5GMK j;  3CCE A;  4JRP A;  3E9F A;  3A8L B;  2VGN A;  4Y91 A;  1S72 T;  2F5T X;  2LC4 A;  4J83 A;  3L2V A;  3I55 T;  1YCY A;  3CME A;  3HL8 A;  1YJW T;  3CCS A;  1HK9 A;  1YJW A;  1MHN A;  3PNW C;  2QQ9 A;  2XI9 A;  3JB9 I;  3CCQ A;  3GF5 A;  3GPL A;  3CMA T;  3HP9 A;  4M78 B;  3OYJ A;  1VQ7 T;  4M78 F;  2L89 A;  2E1H A;  3QPH A;  4JRI A;  5GAN 6;  2PVG B;  4XTU A;  2JUF A;  3SWN A;  2D6F A;  2XG8 D;  3FDR A;  4R56 A;  5DM7 R;  2PVO B;  3OB9 A;  4MZM A;  4BY6 C;  1BIB A;  2BIV A;  2X4J A;  3FEO A;  4D6W A;  3PGG A;  1NPP A;  4B9W A;  1JJ2 A;  2DZ9 A;  4KUD K;  4M7D G;  3OYD A;  3NTI A;  4NL2 A;  1QVP A;  1G5V A;  3EFS A;  3G4S A;  2BUD A;  4LD6 A;  4ELY C;  1YIT A;  2ZPB B;  4PJO D;  4QQD A;  1VQ9 A;  5LJ5 h;  1KC8 U;  2GQV A;  4C92 A;  3S3O A;  3JB9 H;  2CGH A;  1N27 A;  3QUI A;  2AHJ B;  5LJ3 f;  2EQK A;  2QQB A;  2V8K A;  1G3W A;  2KSS A;  3BDU A;  5CR2 A;  4N4H A;  2DK3 A;  5GMK i;  2DTO A;  2RHX A;  3I56 A;  4GY5 A;  1OYX A;  2DTH A;  2JOY A;  1K8A C;  4M77 F;  4Z02 A;  1VQO T;  2KDS A;  3JSC A;  1I8F A;  2E6N A;  3R6O A;  4RKU E;  1K73 C;  1WPY A;  1YHQ A;  2VGM A;  2PUK B;  3CBM A;  3E1S A;  5GAN e;  3FRN A;  2VUB A;  4PLI A;  3PMT A;  3EFR A;  4ATO A;  2YLB A;  3UDC A;  5GAN 5;  4Y28 E;  1O75 A;  3LYI A;  4N4I A;  5LJ5 g;  3S3M A;  5M9O A;  5A0L A;  5GAN g;  3CMA A;  3X24 B;  2KAF A;  1XQH A;  1QVF S;  2E10 A;  4NS5 A;  1HXD A;  4BDZ A;  4LDU A;  2EQM A;  5CKB A;  4OB0 B;  5A2Q E;  3FIF A;  3C95 A;  5LJ3 d;  2QEX A;  1S72 A;  3HFN A;  4XAX B;  5GAM h;  3I55 A;  4M7A C;  1QVF A;  4LDY A;  4ZGD B;  1Y96 B;  3DB4 A;  2JN0 A;  4QVD A;  4XQ3 A;  4ZTF A;  4JRQ A;  3GOX A;  1SSF A;  2MI6 A;  4ZGJ B;  2VXF A;  4FM4 B;  4OB2 B;  4XTY A;  2DXC A;  1Q81 U;  4M75 F;  4F7U F;  3VUB A;  5GAM d;  5CKH A;  4KT0 E;  3DLM A;  3QJY A;  4IUV A;  5KCH A;  2P0K A;  3MP6 A;  3JCM e;  1VQN T;  3LW5 E;  2R5A A;  3SD4 A;  3OBY A;  3WVE B;  3QO3 A;  2E5Q A;  4HT9 A;  3L2Z A;  4RCC A;  3PT9 A;  5CQY A;  4EMG A;  2DVE A;  5GAO p;  1VQM A;  5KE2 A;  2C06 A;  3X25 B;  3QII A;  1YJ9 T;  3L2R A;  3MET A;  4X9C A;  2XID A;  5HKC A;  5KE3 A;  3MCA B;  1UGR B;  3N5B B;  4VUB A;  3RMS A;  2EFI A;  1ZBX A;  2RHZ A;  3JCM h;  3UT1 A;  5GAN 3;  3M58 A;  1FWZ A;  4C8Q E;  4LD9 K;  1LNX A;  4MZT A;  5GMK h;  2E6Z A;  2GCX A;  1IZ6 A;  3HFO A;  3CCL T;  3HHT B;  1WJQ A;  4IUT A;  3OS0 A;  1BI1 A;  3OS2 A;  3GIB A;  1YHQ T;  2K3Y A;  2DIG A;  4MML A;  3OSV A;  2EJG A;  2K5F A;  3FC3 A;  4X9D A;  4M78 G;  3VJP A;  1Q7Y C;  5GAN 7;  3WVD B;  1Q7Y U;  4FT4 A;  5I2S A;  5CCA A;  3OYC A;  4OGE A;  2R57 A;  4A54 A;  4M75 A;  4BDY A;  4M7D F;  1N8R U;  3PMI A;  3QDR B;  2ZGW A;  4RMO A;  4XK8 E;  2QA4 A;  3RKY A;  1K9M C;  2MMP A;  3SDZ A;  1QVG S;  2QA4 T;  2LT1 A;  1X75 C;  2LVM A;  2EYQ A;  2DIQ A;  4E7I A;  4N0A A;  3KBG A;  1M9S A;  4J6X A;  4M7A G;  3CXC S;  3ASK A;  4MDX A;  2LRQ A;  5GMK m;  5GAN 8;  2HBP A;  5GAN j;  2JVV A;  5HK0 A;  5GAO m;  2FB7 A;  4QQG A;  2RK1 A;  3WXM B;  5J26 A;  3URG A;  4HA8 A;  5AYF A;  2O01 E;  4XTZ A;  4OF1 A;  1U1S A;  3VUZ A;  3M56 A;  3CPW A;  5CO7 A;  2A7Y A;  4M7A A;  4KBM B;  4CRI A;  3KUF A;  2CZ7 B;  3C12 A;  5GMK l;  3L1A A;  1QP2 A;  4C0G A;  4F7U B;  5FRM A;  1K9M U;  2DD4 A;  4HKE A;  2HNI A;  3V7S A;  2CS7 A;  2DPP B;  1M1K C;  1KQS S;  2KMT A;  2OTL T;  2K2V A;  1WJR A;  3PTA A;  5IN1 A;  5GAM f;  3QHS A;  4NL3 A;  1H64 1;  2RH2 A;  3INZ A;  3GNG A;  2VC8 A;  4A4F A;  3M54 A;  5D6Y A;  2P0P A;  1KHC A;  3JAM E;  4LDV A;  4E7J A;  4HCB A;  3A8H B;  3MO8 A;  4R55 A;  3PIP A;  4JJN K;  3AHU A;  1Q82 U;  4C0F A;  4ZTJ A;  2PUO B;  3X20 B;  4XTX A;  5KH6 A;  3E19 A;  4F7U E;  3GP8 A;  2JTF A;  5FU6 C;  1K8A U;  2XDP A;  2DEQ A;  4TVR A;  3RMQ A;  2QDY B;  4M77 D;  3M59 A;  4M75 G;  2RI5 A;  4C92 F;  2V8J A;  3HKS A;  1M90 C;  4IUP A;  4OP0 A;  4YTL A;  2RM4 A;  4IKF A;  1KC8 C;  1BIA A;  1G3T A;  3L42 A;  2WAC A;  3MP1 A;  1YIJ T;  1YJ9 A;  3RKX A;  3CBP A;  3OYY A;  1LJO A;  1QP3 A;  1YIJ A;  2XD0 A;  4PJO B;  2XKO C;  1R8O B;  3JRZ A;  4PJO C;  2O4X B;  1BKB A;  4L59 A;  2K3X A;  2XDD A;  5CKF A;  1KG1 A;  3FB9 A;  5CIU A;  3ER0 A;  2XU8 A;  1P92 A;  3CCR A;  2OTL A;  3ME9 A;  3CCV T;  3M4G A;  4J6Y A;  1M1F A;  5D6W A;  3RKW A;  1OZ2 A;  4M75 C;  1M5Q 1;  4OVA A;  4M7A D;  3VYH B;  2RJF A;  4ZGE B;  5GAM e;  3FLG A;  3CC2 A;  4WF2 A;  3X28 B;  1X6O A;  2MWO A;  3OYE A;  3CXC A;  4M7D B;  2BKD N;  3JB9 G;  2L5Q A;  2M1H A;  4V2S A;  4B9X A;  4J6W A;  1NPR A;  3JCM J;  2IG0 A;  3PFS A;  5GAM j;  3H8Z A;  3QSU A;  1UGS B;  2F5K A;  2QXF A;  4M77 E;  4E47 A;  3QG1 A;  3SB2 A;  4JS5 A;  3J80 E;  1B34 B;  4DOW A;  2RK2 A;  5KCO A;  3HRU A;  5LJ5 f;  4C8Q B;  1Y07 A;  4DOV A;  4BE0 A;  4FIB A;  4GLK A;  4C8Q F;  1KHI A;  1Y71 A;  3MP8 A;  5LJ3 h;  3NFC A;  3HPW A;  1XNI A;  1VQ7 A;  4PL6 A;  3NTK A;  3CCU A;  3UWN A;  1UGP B;  2E65 A;  4ZN3 A;  1UB4 A;  3OYB A;  3CC7 T;  1WNL A;  1UEB A;  5FU6 B;  2QEX T;  3OYM A;  1VQP T;  3CC4 A;  4C92 E;  1VQP A;  1BI3 A;  2QQS A;  3X26 B;  4L5G A;  1ZQ1 A;  3OBW A;  4J7F A;  5CVI A;  4M7A F;  2X4X A;  3LWI A;  2Y90 A;  4A4E A;  2JTM A;  3M57 A;  2YRV A;  3OMC A;  5DLQ E;  5J3B A;  4BI4 A;  4BUG A;  3BDL A;  4C92 D;  3M9Q A;  1VQ9 T;  4XU2 A;  1KQ2 A;  3J7A F;  2D0Q B;  1BI2 A;  4MMK A;  3OYG A;  2LTO A;  3CCR T;  4M7A E;  4C5H A;  2KQW A;  3OMG A;  4M7D A;  2A3L A;  4ME7 A;  3QZ5 B;  3A5Z B;  3L2U A;  4QVC A;  2FHD A;  1KD1 C;  1O9S A;  2LQ8 A;  4JDS A;  3M55 A;  2Y4Y A;  3LX7 A;  1QW1 A;  4DQ2 A;  2MF2 A;  3CBO A;  3ZEH A;  1PSE A;  3QYH B;  3OSS C;  1KD1 U;  1QVG A;  4J8O A;  1JJ2 S;  5GAO l;  1Q86 C;  3QJ6 A;  3VKI A;  4M77 C;  5GAN 2;  1U1T A;  1VQM T;  3SWN C;  2X35 A;  2DXT A;  1BYM A;  2EJ9 A;  1W4S A;  1OI1 A;  3T9N A;  5A0G A;  2LT4 A;  4XU1 A;  3Q1J A;  2X4W A;  1H3Z A;  2RHI A;  1VIE A;  3QKJ A;  4IUQ A;  5GAN h;  2RJD A;  4J7I A;  4M7D C;  4ZN1 A;  3QBY A;  4EMK B;  2ZCF B;  2NLU A;  3C4S A;  2EJF A;  2LQK A;  2RJC A;  3OYN A;  4C92 G;  4F7U A;  1GXI E;  2VV5 A;  5GAO r;  4C8Q C;  4EDU A;  3CME T;  5IT9 E;  4C8Q A;  4JS4 A;  3JCM P;  2CZ6 B;  1Q82 C;  3CCS T;  2E70 A;  1VQL T;  2ZPF B;  3V7C A;  3CC7 A;  4BB7 A;  4C5I A;  4RG8 A;  2HD0 A;  4XU3 A;  2D9T A;  3MHX A;  4X34 A;  5CQX A;  5C0M A;  3JCM X;  4CI0 C;  2QI2 A;  2DXU A;  2EQU A;  4N4G A;  2M9U A;  5GAO n;  1VQN A;  2QQR A;  1D3B B;  5DY9 A;  1U8R A;  3C94 A;  3A8M B;  3OYK A;  3M5A A;  5FU7 C;  3E9G A;  3MEU A;  2FVU A;  1M1K U;  2K57 A;  1VQ8 A;  2CZ0 B;  2ZPG B;  1VQ8 T;  3A8G B;  4M75 B;  3S3N A;  2RB6 A;  4Q5W A;  1VQ6 T;  2XDB A;  4C0D C;  1PSF A;  3S6W A;  1VQ5 A;  1NZ9 A;  3GLX A;  1Y7X A;  4IUU A;  3V8K A;  1YBY A;  3LGF A;  3G71 T;  3SFM A;  3RER A;  4KUI A;  4BE2 A;  3JB9 D;  1AHJ B;  1LOJ A;  4BE1 A;  4E7H A;  4J5Y A;  1YJN T;  1N8R C;  3G7Z A;  3JB9 F;  3CCV A;  1YI2 A;  4A4H A;  4PJO G;  4IUR A;  4M78 E;  3HSB A;  2DTI A;  2HQX A;  4JLI A;  4A53 A;  1I5L A;  3HRS A;  2GF7 A;  2E41 A;  4E7K A;  2HQE A;  4P5N A;  1FX7 A;  4M7A B;  3ZBD A;  4O5V A;  3NTH A;  3OYL A;  3CCJ T;  5CK9 A;  1G3Y A;  2LDM A;  4RCB A;  5J39 A;  1M90 U;  2JZ2 A;  4PLL A;  4C8Q G;  2IVW A;  2RJE A;  4LDW A;  5GAN d;  2DO3 A;  1I81 A;  5GMK e;  2RHU A;  1NJI C;  4FU6 A;  4OGC A;  3JCM W;  4NOY A;  4QQ6 A;  3TRE A;  4M75 E;  1VQ4 T;  1X01 A;  2L3R A;  3LH0 A;  1VQ4 A;  3CCU T;  4C8Q D;  3G6E A;  4PJO E;  2E64 A;  2PVD B;  4F7U G;  2P4T A;  2WSE E;  3MEW A;  1VUB A;  2KVQ G;  2ZPI B;  4JUV A;  3RUX A;  2VYT A;  3BW1 A;  4EMK A;  5GAN 4;  5D6X A;  3QYG B;  4M77 A;  2PQW A;  5LJ3 e;  2DKG A;  2WSC E;  3CCM A;  1UGQ B;  3H6Z A;  3PIO A;  1VQ6 A;  4M77 B;  1WQ7 A;  1NJI U;  2OAU A;  2FYK A;  2EKO A;  4EPC A;  2JNG A;  1JBM A;  2CZ1 B;  1XOV A;  3VV0 A;  1JB0 E;  2DJZ A;  2DD5 A;  3CPF A;  2VXE A;  4M7D E;  4A4K A;  4EMH A;  2KK4 A;  5GAN f;  3CPW S;  1OZ3 A;  3P8B B;  4OMF B;  5LL6 S;  3BFM A;  1Q81 C;  5CKD A;  2MAM A;  3M4Y A;  2EIF A;  4JRK A;  3OYI A;  3OA6 A;  1VIF A;  1VQ5 T;  5HK3 A;  5LJ3 j;  2F69 A;  2RHY A;  4BY6 B;  4RG2 A;  3SWN B;  4C0Z A;  3OYH A;  1N9S A;  1WQW A;  3JCM V;  2YLC A;  3V8J A;  2WSF E;  1KQ1 A;  3L2Q A;  1V29 B;  2CKK A;  2DZC A;  2KY9 A;  2YHT A;  4JLG A;  5LJ5 d;  3I56 T;  2O4X A;  3QZ9 B;  4M7D D;  2DXB A;  2L8D A;  5A0D A;  3G71 A;  3JB9 J;  2R58 A;  5L8R E;  2RD1 A;  5DLO A;  3OW2 S;  2B8A A;  4FSX A;  3CC2 T;  2MWP A;  1YJN A;  1ZHI A;  2OTJ A;  5LJ5 j;  3LWH A;  4PNO A;  2CYZ B;  2H3J A;  2LCL A;  2RI3 A;  3F70 A;  3G6E T;  2Y4X A;  1G3S A;  2EAY A;  1EIF A;  4M77 G;  4QVZ A;  3EAE A;  5GAO q;  1VQL A;  3OQ5 A;  3CCL A;  2DAQ A;  2GFA A;  2LCC A;  5GAM g;  1NE8 A;  3P8D A;  3OW2 A;  1VQO A;  4HT8 A;  4FL6 A;  4BI3 A;  3CD6 A;  2RA2 A;  1KQS A;  4ELZ C;  4OB1 B;  4M78 C;  5FRN A;  4M78 A;  1D3B A;  2ZZD A;  3JCM f;  3OY9 A;  3BY7 A;  3OS5 A;  2QTX A;  4DA4 A;  2PU9 B;  3UPU A;  5CAI A;  3V8L A;  1TH7 A;  4XTV A;  2K5L A;  2P0Q A;  5LJ5 e;  1WJS A;  3CC4 T;  3O8V A;  4KUL A;  1I4K 1;  1N9R A;  2E12 A;  2K5I A;  1N6A A;  4MZP A;  4C5E A;  4C0D B;  4C5G A;  4C92 B;  3JCM d;  3G4S T;  4M78 D;  1RL2 A;  2RI2 A;  4II1 A;  3CCE T;  2XK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...