5GAN3

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
77
structure length
77
Chain Sequence
b'TPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 10
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan300
4J6YA 4EMHA 3SB2A 4F7UA 1WQ7A 2YHTA 5GANe 3V7SA 3L1AA 5LJ5g 4M78G 2YLBA 4M77G 3JCMh 3JCMf 1MGQA 3QO3A 1LOJA 5LJ3h 3JCMQ 5LJ3f 5GAMd 5GAN5 4MMKA 5LJ5d 1Y96B 3V7CA 4RCBA 4M75D 4M77B 4X9CA 4Y91A 4M78F 4M7AC 4M77F 4C8QD 1LNXA 4A54A 4DQ2A 4PJOC 4M7AA 5DY9A 2DTHA 4XQ3A 5GANj 2E10A 3BY7A 2E65A 4PJOA 3BW1A 3QHSA 4PJOG 2DXUA 3JCMg 3JCMW 5LJ3g 5GAMe 4EMKB 1YCYA 3QSUA 4M7DB 3BDUA 3JCMd 2E41A 4J6XA 4M78E 4WF2A 4M77E 4XTZA 4XTVA 4PJOF 5LJ3d 1M8VA 4HT9A 5GAOl 3JB9G 2RM4A 2JN0A 2EJ9A 5LJ5j 3JCMX 4M78C 4M77C 3JB9F 5GMKh 3JCMJ 1B34B 3RIRA 4PJOE 1KQ1A 4M78A 4M77A 4OP0A 3EFRA 3INZA 3JB9I 4QVDA 3HFNA 2Y90A 5GAOn 2DZCA 1WPYA 4M75B 2EAYA 4XTWA 5GAOm 4C8QB 4XTUA 5GAN6 4M7AD 3JCMc 5LJ3j 5GAOr 4PJOD 4M7DG 2QTXA 4X9DA 4XU3A 2VXFA 5GMKl 5LJ5e 5GAOp 3PGGA 4M7DF 2YLCA 1N9RA 1LJOA 3RKXA 3V8KA 1N9SA 4C92G 4N0AC 1I8FA 1HXDA 1BIAA 1WNLA 4A53A 1U1TA 1D3BB 1B34A 5GAN8 4JLIA 3RUXA 4N0AA 3RESA 3JCMV 4C92B 4C92F 2RB6A 3EFSA 5GANh 3JCMb 3JCMe 5I21A 5GANf 4M7DE 4F7UB 1JBMA 2EJFA 2DXTA 3QUIA 1Y96A 3FIFA 3FJPA 4M77D 4M78D 4M75G 4PNOA 5LJ3e 5GMKm 5GAN3 4C8QG 5GMKj 2E1HA 3FB9A 4JUVA 4QVCA 1KQ2A 4XTXA 4V2SA 4EMKC 1U1SA 4M75F 4C92E 4M7DC 3V7RA 4C8QF 4NOYA 1BIBA 1X01A 4EMKA 1H641 4M7DA 1WQWA 2EWNA 5GAMh 2DEQA 5GAMf 2EJGA 2FYKA 2I2LA 3BFMA 2DKGA 2RA2A 5GAN2 5GAMg 1TH7A 5GAN7 2RD1A 1M5Q1 2ZGWA 4RCCA 4C92C 5GAOq 4J5YA 4HA8A 4M75E 2FB7A 1D3BA 3SWNB 4C8QE 4C92A 3JB9D 3M4GA 2DZ9A 3RKWA 2DVEA 3V8JA 1I81A 4NL2A 3AHUA 4F7UG 3GIBA 4EMGA 5GMKe 1I4K1 2K57A 3L2ZA 4M75C 4XTYA 4C8QC 3HFOA 4M78B 4F7UF 4M75A 3HSBA 3JB9J 1HK9A 4XU1A 4C8QA 3JB9H 2DJZA 4MMLA 4M7AG 4XU0A 3VU3C 1I5LA 2DTOA 5CAIA 3RKYA 4M7AB 5GANg 5GMKi 4M7AF 2DTIA 3SWNC 4M7DD 2VC8A 4J6WA 3V8LA 4F7UE 2HNIA 4NL3A 3JCMP 3RERA 5GANd 4PJOB 3SWNA 5LJ5h 5LJ5f 2CGHA 4JRKA 2VXEA 4JRIA 5GAN4 4XU2A 5GAMj 4HT8A 4C92D 2E64A 1JRIA 4M7AE
chains in the Genus database with same CATH superfamily
2EGCA 4BE1A 4PKCC 2YHTA 1W2BA 1U8RA 4M78F 3EHQA 1ZSGA 4RMOA 2LT4A 3QYHB 3LH0A 5KYXA 1RLPC 2K79A 4C0DC 2L3PA 3SDZA 4C5EA 3L2UA 2P0KA 4Z89A 2K9GA 3OYYA 4M78C 2MK5A 1YITA 2IG0A 2E6NA 2RH2A 1WDXA 1XJWB 3X20B 4RUGA 5GAOm 1YI2T 2R5AA 1UE9A 1PRMC 4IUPA 1VQ6A 2MIOA 3NPFA 3EG2A 3CD6A 3EGXA 3PVQA 2GTOA 1KHCA 2CS7A 1BI1A 1GCQA 2RB6A 3JCMe 2D8HA 5FW9A 1Y96A 3GF5A 4RTVA 4HVWA 2DL4A 2EQIA 4ELYC 2DVJA 2HQHA 5KYWB 2E3IA 5FLXE 4J5YA 5KYUB 2XK0A 5HY6A 4C92A 4DBHA 1Q7YR 1IGUA 1SF9A 3RKWA 2YXYA 3CPWS 1YIJA 1OZ3A 4QQGA 2LCLA 1VQ7Q 1ARKA 2C0IA 4OB1B 2M16A 1K9MR 3OSVA 1VQ7T 2FZCB 4ZTJA 2BE9B 1QW1A 8ATCB 2EVRA 2XHCA 1MV0B 2EYXA 2RF0A 3S3NA 2MOXA 1QQJA 4AG1C 3UA7A 2A3LA 5GAN4 4JDSA 2DXBA 1JRIA 3CCUQ 3M56A 1R8OB 2J06A 2JS2A 5GANe 5J39A 4KT0E 5LJ5g 4DOWA 3CCUT 3H0FA 2JW4A 4X9CA 3SHWA 2DIGA 2ROTA 3LLRA 1VQKA 2A36A 3BY7A 3VS2A 3CCMA 4PJOG 4QT7A 2K2MA 1K8AR 3OQ5A 4M78E 4E2FB 1M8VA 2DO3A 4FYYB 1UFFA 1M3CA 3G4SA 3X26B 2VUBA 3WVDB 2EYWA 1YNZA 5CKEA 2KI7A 3C94A 4HCKA 1BU1A 2DZCA 1KIKA 2V1RA 5CK9A 1OX8A 1NLPC 2M51A 2FL7A 5KH6A 5CR2A 2L0AA 3A1PA 1VIEA 2LQ8A 4BD3A 4JPBW 2C06A 3M5AA 3ZFJA 3OY9A 3PTAA 5A0LA 1WHKA 2KT8A 2PUKB 2G3RA 3EG3A 1ZUUA 3GBQA 2EJFA 2DXTA 2V26A 3X25B 3FJPA 4M77D 4DBFA 4O6JA 5GMKj 1AZEA 2NUTA 3AT1B 3CCEA 2RMOA 4EMKA 1H641 2PVOB 3OYJA 5HK0A 1ACMB 1QLYA 4OMQA 3SWNB 2QQ9A 1M90C 2RQRA 1FMVA 1B3QA 5I2MA 1M2OA 5J26A 2BTTA 5GMKe 2D9TA 2O31A 4LDVA 1NJIR 1X27A 1G3SA 5DLOA 3LH5A 4HXJA 2DJZA 2DXCA 2F69A 3RKYA 1QKXA 4LD9K 2F2WA 2MMPA 3CMAA 4JLGA 1YHQT 3FC3A 1W1FA 3EFOA 1OX9A 2CZ1B 3CCRQ 3LGFA 5GAMg 5IHNA 3CCRT 4DBQA 1M90U 2X3WD 1D0YA 1LNXA 5DY9A 2BKDN 4DEXA 1JJ2A 2O4XA 2CT3A 1OPKA 2K7AA 2B86A 2AIRB 1V29B 3M0QA 2JOYA 4OB0B 1B34B 2RHUA 4AFQC 1QMCA 4PK4A 4M7AD 2QQSA 2LNVA 2J7IA 4GLKA 2QA4A 2VXFA 3NHNA 3CC7T 1TTHB 4F16A 1UEBA 4J9FA 1RAGB 5KCOA 5DLQE 5IT9E 3SEMA 1YJWT 3I55Q 4RG8A 2P4TA 1HSQA 2HSPA 2RK2A 2RHIA 3QUIA 2LQWA 3QZ9B 5GMKm 3I55T 1QVFS 4IIMA 4O5VA 1VQ8A 2AKLA 1TWBA 2PU9B 1HYOA 1D1AA 2KXDA 4NOYA 3MKDA 1GL5A 2EWNA 4D8KA 2K3BA 2I2LA 5C6SA 3CCVT 1WA7A 1TH7A 2P84A 3SFMA 2DL5A 1M1FA 2FB7A 3H0IA 3VUZA 3VRZA 1NZ9A 2QGGA 5CKBA 2AKKA 3O8VA 3OYHA 3SD4A 3EH1A 2KRSA 1KSWA 3M58A 1CSKA 4HVVA 5FU7B 4XU1A 2RNAA 1M3AA 2DTOA 1W2BS 2CP7A 1P92A 2QTVA 3SWNC 1PD0A 2K5IA 5LJ5h 2QGFB 1AD5A 4JRIA 2RQUA 1RUWA 2HBWA 1FMWA 3NGPA 5D6WA 5CQYA 3OYFA 2VASA 2KGTA 1VQ5A 2NUPB 1Y57A 1EX4A 3MJXA 4RCBA 2YWWA 3OYKA 4OB3B 1OV3A 4JJNK 1MV3A 3A8LB 3PMIA 4YTLA 4PJOA 1TUCA 1W6XA 2W10A 1YCYA 4M7DB 2WACA 3UT1A 4PJOF 2D8JA 1F1BB 2KT1A 3Q1JA 3OS0A 3OMCA 3EG9A 3VS1A 3I9QA 4M4ZA 1R0BG 3REBB 3M55A 1YWPA 4ME7A 2ZPBB 3UPUA 2OX7A 4TVRA 1JXOA 1B07A 4M75B 4XTUA 2RI3A 1Y07A 4J9IA 3HRUA 3VKIA 2WSEE 3A98A 1IGQA 2EQJA 3GOXA 2AZSA 3OYMA 1VQPQ 1ZBXA 1SHGA 3EGDB 4KH0B 3I5SA 5IXFA 4F7UB 1YJNQ 1ZUYA 1UGPB 2QG9B 2CP0A 2DM1A 2WSCE 5FWCA 2XIDA 3TVTA 1WQWA 1EIFA 1M2VB 3G6EQ 5GAMf 2JUFA 3CCLQ 5FU6B 2FHDA 4HCBA 4OMNA 2BIVA 2V8KA 2FPDA 3CCLT 3CCSQ 4N4HA 2J6KA 3HSBA 4JJDA 3CCJQ 3JB9H 3CCST 4J9DA 2HDAA 2RI5A 4MZTA 3UATA 2P4RA 2QQBA 2SRCA 2KAFA 5GJWB 4BB7A 1RABB 3P8HA 3S3OA 2FRWA 3CQTA 3HP9A 5FU7C 1Q7YC 6AT1B 4UC4A 2X4XA 2KYMA 4M77G 5LJ3f 5GAN5 3MPUB 4MMKA 1K9MC 2HCKA 2ZPIB 2EW3A 4JS5A 3OS5A 4LUDA 4LD6A 3JCMd 2DD4A 4J6XA 1YI2A 3A5ZB 2ZPHB 1T3LA 3A8GB 3R6OA 2RI2A 2RJCA 4JZ3A 4PJOE 2OAWA 2LCCA 4Z02A 2XG8D 1Q7YU 4C8QB 3U23A 3CCQQ 3LWIA 2D1XA 5GAOr 3LW5E 1X2KA 3TU4K 3CCQT 1K9MU 2HBPA 1K8AC 2HD0A 1SG5A 4AFZC 1WJQA 4XAXB 1VQNQ 1KD1R 3GLXA 2AHJB 1WNLA 4CRIA 4F04B 1D3BB 2X35A 3JV3A 1VQNT 4QQ6A 4EPCA 2L3SA 3M0RA 2LTOA 5FROA 4V2SA 1VQMQ 4B9WA 1MMNA 2HSEB 1PSFA 2LP5A 2J05A 1ZLMA 1VQ7A 5GAN7 3ER0A 2RD1A 2DF6A 2OTLT 1G3YA 2ESWA 2DVEA 3M0UA 2L89A 1K8AU 2FZKB 1VIFA 2L2PA 1M30A 3WXMB 5A2QE 3JB9J 1HK9A 1CKAA 1QCFA 3VUBA 4M7AG 1UG1A 3CCUA 2LNHB 2LMJA 2R58A 4M7DD 2QAZA 3MP1A 2D0QB 2EGEA 3EGXB 1JJ2S 2R5MA 3A8HB 4IUQA 3TSWA 2E3HA 4ZN1A 4EMHA 2E6ZA 1UGVA 3H6ZA 2IIMA 4BUGA 1NJIC 1FXXA 4FW1A 1Y96B 4M75D 4M77B 4A54A 2A28A 3META 1I07A 3JCMW 1JU5C 3LGLA 4BI4A 4C0FA 3QSUA 1Y7XA 3BDLA 3L2RA 4X34A 5IHKA 1PC0A 3JCMJ 2R57A 1VUBA 4M78A 1S72Q 4OP0A 3INZA 3J80E 1IO6A 2DD5A 4QW2A 2XDDA 4XTWA 1S72T 3DB4A 1NJIU 4E7ZA 5CCAA 4DA4A 1E6HA 2QTXA 4MZMA 4BY6B 3CC2Q 1XOVA 4ZGEB 1SEMA 3PGGA 3URGA 5D6XA 1YWOA 1LJOA 2E4HA 3CC2T 5CQXA 4F14A 1NBEB 2YT6A 3JSCA 4IUTA 2EQKA 4BI3A 2B8AA 3VV0A 1O9SA 4PFPA 1BCOA 4QKUA 1KQ2A 1VQ9A 4GBQA 1TU0B 1K73R 3V7RA 2HMAA 4J83A 2VV5A 2RQVA 3OW2P 1WHJA 1VQOQ 5KYYB 1WXBA 3MEWA 1W70A 3UF4A 3QXEB 2FPFA 1ZBJA 1VQOT 2BZXA 5A0DA 1T3SA 4EMGA 2JS0A 1YHQA 2K57A 3L2ZA 4DEYA 4WTOB 4BI8B 2C0OA 2D0NA 2LZ6B 1X6GA 4R55A 1G3WA 2PVGB 4LE9A 2X4WA 1K76A 3CCRA 3C4SA 4E7SA 2GFUA 3CXCP 4M7AB 2JNGA 3V8LA 3JCMP 1C6VX 1RAHB 3OBYA 3QZ5B 4JRKA 2VXEA 4FCYA 3A8OB 5GAMj 1GFCA 3S3MA 2E64A 3KXTA 1N8RR 5HCKA 3SB2A 3TEEA 3KBGA 2NLUA 4E7HA 2IVWA 1QVGP 3V7CA 3VS0A 4M77F 4C8QD 4RG2A 2ATCB 2A0FB 5GANj 3G7ZA 2ED0A 1WHMA 2NUTB 2DXUA 3M0PA 4JJBA 2QI2A 4EMKB 5GAMe 2E5QA 4XTVA 2K5FA 4OGCA 1ZX6A 1VYTA 3CC7A 3QPHA 5AT1B 4M77C 4C0GA 3EFRA 1YJWA 1TXQA 1G5VA 2ZPGB 4DOVA 5LJ3j 3I55A 1E6GA 4ATOA 3RMSA 1WJRA 2JZ2A 4OVAA 1PG5B 5IN1A 3TQ7P 1KK7A 3RR6A 3PIOA 1HXDA 3EFOB 4FM4B 4X1VA 3CCVA 1WXUA 1RAAB 1RI9A 2CKKA 5LJ3e 1WGSA 4LN2A 2JTMA 3GNFB 5L23A 1K0SA 4KBMB 2I0NA 1FX7A 1X01A 2COZA 2O4XB 1UHCA 2ECZA 1M5Q1 4RTZA 4MZPA 2EKOA 2DZ9A 1M1KR 2JTFA 1TS9A 1B7TA 3ZL7C 4CC4B 4Y92A 4OGEA 3ASKA 5ECAA 2CP3A 1MMAA 1EZZB 1LVKA 4J9GA 2COWA 2RHYA 2L3RA 1UHFA 2YRVA 2OTJQ 4M7AF 1GXIE 2LC4A 2OTJT 4PLLA 2CGHA 1ZA1B 2K3YA 1NYGA 4C92D 1SHFA 1YP5A 5FWBA 5IAYA 2X51A 4M7AC 1VQ4Q 1GBRA 2LJ3A 2M02A 4CC2A 1VQ4T 3JCMg 4OB2B 2DL8A 2GGRA 1NPRA 2ZAEA 4M77E 3CBMA 2V1QA 1RAEB 3MEVA 4A63B 2GQIA 3JCMX 4F17A 3RIRA 3CD6Q 3JB9I 3HFNA 1Z9QA 2DJQA 1VYVA 3HKSA 1PD1A 2GNCA 4M7DG 2LDMA 1Z9ZA 4L6V5 1WHHA 1XTDA 2VB6A 4N0AC 1AOJA 1U1TA 2YRCA 3WVEB 1RACB 2JMAA 2ZPFB 4JZ4A 2EYQA 4P5NA 2QDLA 4M75G 2RO0A 1JEGA 1K1ZA 3CBOA 2LJ1A 4XTXA 1KG1A 1YIJQ 1QCNA 2KEAA 1OU8A 3CCSA 2X4YA 2V8IA 2BZYA 4QVZA 1PM3A 1ZSZB 2JM9A 3HL8A 4LNPA 3EG9B 1KD1C 3TCJA 4F7UG 1QCOA 4VUBA 3RDVA 4C5IA 4ORZA 2QDYB 4PJMA 2ED1A 5CKFA 3PVLA 4L5GA 3OW2A 2HNIA 1TUGB 3SWNA 5LJ5f 1KC8R 4RKUE 1D0ZA 4ESRA 1D09B 1T0HA 4M7AE 2ABLA 2CYZB 4J6YA 1WQ7A 2JT4A 3M4YA 3NTHA 3LWHA 2AT1B 3ME9A 3RBBB 2J6FA 5A0GA 2DTHA 1YFNA 3BE3A 1OEBA 3TREA 2QEXA 4IURA 3OYIA 1JO8A 3CXCA 1G8XA 3JRZA 3N5BB 3ULRB 3E1SA 4B6MA 3NTKA 2A37A 1OOTA 2XMFA 1WHLA 4CI0C 4E7IA 3UDCA 2P0QA 1OPLA 4D8DA 1Q81R 4FSXA 4C0ZA 1QVGA 5FRMA 4HVUA 4AFUC 2HKNA 2DMOA 2RJEA 4MDXA 1NYFA 4Q5WA 3LYIA 4J9CA 4FYWB 1X6OA 2YLCA 2KSSA 1N9SA 2NYSA 2HKQB 1I8FA 3CCEQ 1B34A 2DILA 1C0MA 4J9HA 1M4ZA 3RMQA 5CVIA 2OTLA 2FPEA 1G83A 4C8QG 2GTJA 4R0KA 5KE3A 5HKCA 4A4GA 2MCNA 2VKNA 4N4IA 2K6DA 3I35A 2DKGA 1WLPB 3VYHB 8AT1B 4KGZB 5I22A 4BE2A 3JB9D 1WJSA 2QXFA 3OMGA 3M9QA 3GIBA 4FYXB 1YJ9Q 2RQWA 1YN8A 2YUOA 3CMAQ 1YJ9T 1VQPT 2CP5A 4E7KA 3CMAT 3VU3C 4BE0A 1YJNT 1N6AA 1UTIA 1ZSZC 1K73C 1PKSA 4PJNA 3C95A 4FU6A 3LX7A 3G6ET 4CC7A 4HT8A 4IKFA 3CPFA 2DRMA 3CMEA 1AEYA 5EG2A 3V7SA 1TG0A 3JCMh 2EKHA 2KK4A 1AHJB 1UGSB 1GCPA 2AZVA 1MNDA 3CCJT 3QHSA 3FEOA 3C0CA 1SSHA 1U5SA 2Z0WA 4AMCA 4IUUA 1RAFB 3QDFA 1PHTA 2PQWA 3VS7A 5LL6S 4C5HA 2FG0A 2FO0A 2M0OA 1N8RC 1KQ1A 2LX9A 4ZTFA 3EAEA 2CP6A 2Y90A 3VYGA 1KQSP 2LCSA 4FT2A 3UA6A 1FMKA 4PJOD 2JM8A 3DLLA 2LQNA 5IXBA 2EGAA 4M7DF 4LDUA 2DE0X 3RKXA 1VQ8Q 1QWEA 4C92G 1RL2A 1BIAA 3RESA 1SRLA 5GANh 2JXBA 3E2UA 1VQOA 2EBPA 3MCAB 4RTUA 5EC7A 4R56A 1U1SA 4M75F 4E7LA 1N8RU 3VJPA 4M7DC 1GFDA 4OMOA 2Y4XA 2BE7D 4LDWA 3G71Q 2MWOA 1NG2A 2XI9A 5GAN2 2RA2A 4HT9A 3HRTA 3G71T 2KRMA 2V8JA 5GJVB 2RPNA 2DA9A 5KYNA 1SPKA 1PWTA 4KULA 1MNEA 3V8JA 2MPXC 3FDRA 1WFWA 2YDLA 4BDYA 1I4K1 4JJCA 4M75C 2EQMA 4M78B 2KE9A 4F7UF 3M57A 2O88A 4LUEA 2O9VA 1M2VA 1I5LA 2D6FA 5L8RE 2XD0A 4J6WA 1VQMT 3C12A 2HZYA 1R0CB 3ZBDA 5GANd 4PFZA 1VQ5Q 2KXCA 5KYXB 2RN8A 4OMLA 3UWNA 2PVDB 1DJ7B 2CT4A 1S1NA 1M1KC 3CEYA 1MGQA 4XK8E 1KHIA 2ROLA 3KFVA 1ZQ1A 2K5LA 2E10A 2E65A 4A4HA 3BW1A 4HCCA 2LX7A 3MO8A 3FRNA 4J7FA 3VS3A 5FU6C 5LJ3d 1H8KA 3PE0A 3JAME 5LJ5j 1AZGB 2CDTA 1LPLA 5GMKh 1AWJA 1UGQB 3H41A 2K3XA 2MAMA 2HL3A 2AK5A 5GAOn 1M8MA 2K4YA 1M1KU 2DX1A 1Y71A 1X75C 4KUDK 5LJ5e 2WSFE 2ZPEB 3P8DA 4E47A 4FYVB 3OYEA 2KYBA 1QVFA 1Q95G 2CZ7B 4FW2A 1W4SA 2KDSA 4C92B 3MEUA 3OB9A 1QVPA 4M7DE 1NEBA 5D7UA 3X28B 3QYGB 1BI0A 2DRKA 5GAN3 3PMTA 1H92A 3T9NA 2DNUA 4C8QF 2YUPA 1I5OB 3QWYA 1ZHIA 3PIPA 1WIEA 2F5TX 4M75E 1D3BA 3REAB 2BUDA 2OTJA 3OW2S 3P8BB 5CKHA 3G1JA 4ANJA 4C8QC 1WI7A 2CH4W 4C5GA 1NLOC 1C1AA 2G6FX 3CC4Q 3A8MB 4MDWA 2VC8A 4F7UE 3CC4T 4EDUA 1V1CA 4NS5A 1VQ4A 3QWXX 2SEMA 3MHXA 3CXCS 2EYYA 2KY9A 3FLGA 4KGVB 1YI2Q 1BI2A 4ELZC 1AVZC 1D1BA 5M9OA 3IQLA 4PJJA 4JRQA 3L2WA 2O9SA 1QVGS 2MYSA 2CSIA 3JB9G 2X3XD 2RM4A 4II1A 3HTRA 1KC8C 2M9UA 4QQDA 3QDRB 2FEIA 4M77A 1MUZA 3OYAA 3H0HA 3JCMc 2BZ8A 3GP8A 4X9DA 4PLIA 1WZOA 3D7SB 1N9RA 1WXTA 4E6RA 4A53A 1GCQC 2QQAA 4L59A 4JLIA 4C92F 1NM7A 2L3QA 2HQXA 3JCMb 2LVMA 4M78D 1SSFA 3THKA 1KC8U 3I56Q 1VQLQ 1YCSB 1Q81C 1OYXA 1KQSA 3I56T 4RTWA 1VQLT 3M0TA 3CPWP 1BKBA 2CSQA 3BFMA 3VS5A 2KBTA 2OJ2A 4RCCA 4C92C 2HAXA 4C8QE 1TUDA 1I81A 3AHUA 2PNIA 2DETA 1PSEA 1X2QA 2H8HA 4MMLA 1Q82R 4BY6C 3J81E 2CP2A 4PFOA 1JB0E 1OZ2A 5KYYA 3VS6A 1Q81U 1QP3A 4CC3A 3NFCA 2NWMA 5D6YA 4XU2A 2X4JA 5KCHA 2CZ6B 2YLBA 1AT1B 3QO3A 1LOJA 1NPPA 1R77A 3X24B 4M7AA 1WHGA 1WYXA 4AFSC 4DBRA 2YUNA 3BDUA 5KYWA 1J3TA 5KYUA 1BB9A 4D6WA 4KH1B 1TSFA 5KE2A 1OU9A 1Q86R 1GRIA 4A4EA 1BYMA 4FSSA 1T0JA 2DYIA 2CUBA 3KUFA 2GF7A 3OYCA 1X69A 2GCXA 3J7AF 1XNIA 1K9AA 3VS4A 2JTEA 4XU3A 4AT1B 1YITQ 2ZZDA 1VQ9Q 1YITT 3V8KA 1RLQC 2H3EB 1IHVA 1VQ9T 4N0AA 2XKOC 4KRTA 1VQ6Q 3OS1A 1I1JA 5I2SA 2EFIA 2C0TA 1VQ6T 4ZN3A 4QVCA 1EFNA 3CD6T 4EMKC 2DIQA 4C92E 2O2OA 1BIBA 1YHQQ 1VQPA 1YJ9A 4A4FA 2DEQA 2PTKA 2KNBB 2DL3A 2ZGWA 4BACA 1YJNA 2CUDA 2L5QA 4OF1A 3OYBA 2DFUA 3MP8A 4KGXB 2VWFA 3G6EA 3GPLA 9ATCB 3HFOA 4FIBA 3CCLA 2VYTA 5GANg 2Y4YA 1VA7A 2DTIA 1UJYA 4PJOB 3DB3A 1YIJT 2EYZA 3CCJA 2VGMA 4PJLA 2GQVA 3L1AA 4OMFB 3QKJA 1PNJA 4ZNXA 3FJ5A 3RNJA 1QKWA 1G2BA 1I0CA 2FVUA 3CC7Q 1MMGA 1BI3A 4FT4A 5IH2A 5LJ3g 2HEQA 3OS2A 1YBYA 2F1LA 2JJ9A 1YJWQ 2RJDA 1V76A 5GAOl 2O01E 1VQKQ 2OI3A 4K11A 3H9NA 2MI6A 3CCMQ 1JXMA 2EQUA 2F5KA 3JB9F 1VQKT 3CCMT 4QVDA 5CO7A 4AG2C 1WPYA 4IIOA 2DLPA 1D1CA 2F2VA 1KD1U 1H3ZA 5GAN6 3CCVQ 1WX6A 3G4SQ 2RHZA 2J6OA 1ABQA 3OYDA 2PZ1A 3G4ST 2DK3A 5AYFA 2XDBA 1MHNA 1O75A 2KMTA 1QVFP 3QBYA 4RTTA 2E70A 5GAN8 3CCQA 1XQHA 3JCMV 3L2QA 3G71A 3EFSA 1ABOA 2QASA 2DPPB 4PNOA 3OYGA 2HQEA 1OQKA 2LQKA 3FB9A 3QG1A 1VQNA 3MEAA 1D0XA 3HPWA 2EJGA 2FYKA 4J7IA 3OBWA 2QK0A 5GAOq 3E9FA 5CIUA 1U3OA 2ZCFB 3EH2A 1OULA 3H8ZA 1VQMA 3M4GA 2EIFA 1W2BP 2KQWA 3QIIA 1IREB 3CCET 3OYNA 4Z88A 1AWXA 3MP6A 2FZGB 2CH4A 2PUOB 1AWWA 1ZSZA 2DL7A 2F2XA 1UDLA 3QJYA 3CPWA 3RERA 4PL6A 3M59A 4EIKA 4J9EA 1K4US 1HD3A 2W0ZA 3EHRA 3NMZC 5IHIA 4M78G 5CKDA 5HK3A 3JCMf 2A7YA 4HCZA 1A0NB 5LJ5d 4Y91A 1UECA 1PCXA 2E12A 4DQ2A 4PJOC 5DM7R 4XQ3A 3DLMA 2KR3A 2MF2A 4ZGJB 1KJWA 3PFSA 4WF2A 3GNGA 1RADB 2GBQA 3PNWC 4N4GA 4J8OA 3OA6A 2EJ9A 1UUEA 4OMPA 1IRXA 3OYLA 2VVKA 3OSSC 2EAYA 2E5KA 3ZEHA 4IUVA 3HRSA 1U06A 1X43A 1AWOA 2L8DA 1S72A 1KQSS 2JVVA 1QP2A 1UJ0A 1IXDA 2KRNA 2FRYA 1G3TA 2RK1A 1K73U 1M90R 3RUXA 1SKUB 1X6BA 5GANf 2QA4Q 5I21A 2NUPA 3CC2A 2H3JA 2IPOB 2YRDA 1H3HA 1IB8A 2QA4T 1M1GA 4JUVA 1BBZA 2KROA 3PT9A 4Z8AA 4M7DA 4JS4A 5FRNA 5GAMh 2YSQA 3VRYA 2RJFA 1PKTA 1RI0A 3CC4A 3L2VA 2QYZA 2NUZA 1VQ8T 2DBKA 2DAQA 1FYNA 4XTYA 3HHTB 2X9HA 3E19A 1OI1A 4M75A 3L42A 4LDYA 7AT1B 4XU0A 3M53A 5GMKi 1ZA2B 4NL3A 2KVQG 2DYBA 2MWPA 2XDPA 2DERA 3EGUA 1N27A 4C0DB 2A08A 2QEXQ 3EGDA 1HJDA 1M3BA 4HKEA 4F7UA 2XICA 4RTYA 3TSZA 2QEXT 5LJ3h 3JCMQ 5GAMd 3E9GA 1NEGA 1IZ6A 1Q82C 2CREA 2ENMA 1JQQA 2K2VA 4B9XA 2EPDA 1PRLC 2CZ0B 2E41A 3EG0A 4RTXA 4XTZA 1FWZA 1K0XA 4LXCA 2VGNA 2JN0A 1VQ5T 2OAUA 3DKMA 1VYUA 4FL6A 5I11A 4J9BA 1M27C 3EG1A 2COYA 2M1HA 3R6NA 4GLMA 2LJ0A 4KUIA 2RQTA 1UB4A 1UGRB 3S6WA 1CKBA 4JRPA 3CBPA 2HL5C 1SRMA 2OTLQ 5GMKl 2JMCA 5GAOp 3NTIA 1IHWA 3I56A 1VQLA 1Q82U 1VOMA 2M0YA 2LT1A 1TOVA 1QWFA 3I5RA 2RHXA 1ZUKA 1JBMA 4GY5A 2P0PA 1Q86C 3FIFA 4ZGDB 2DBMA 2E1HA 1MMDA 3QJ6A 1Y0MA 2QQRA 1KFZA 1RAIB 2GFAA 4BDZA 2XU8A 4A4KA 1BK2A 4HA8A 1E7OA 1BCMA 4NL2A 5J3BA 4OMMA 2LRQA 1M9SA 1GBQA 4WCIA 4C8QA 4Y28E 1JJ2P 3M0SA 3CMEQ 1Q86U 5CAIA 5C0MA 1LCKA 3O5ZA 1NE8A 3CMET 4LDXA 1N5ZA 3F70A 2YUQA 3M54A 4E7JA 2DEUA
chains in the Genus database with same CATH topology
1Q7YC 2CYZB 2CZ6B 4J6YA 5KCHA 4BE1A 4PKCC 4UC4A 1WQ7A 2YHTA 2X4XA 2YLBA 4M77G 1W2BA 3M4YA 3NTHA 1LOJA 3QO3A 3LWHA 1NPPA 5LJ3f 5GAN5 4MMKA 1U8RA 3ME9A 3X24B 1K9MC 2ZPIB 4M78F 4JS5A 3OS5A 5A0GA 4M7AA 2DTHA 4RMOA 3TREA 2QEXA 2LT4A 4IURA 4LD6A 3QYHB 3LH0A 3OYIA 3BDUA 3CXCA 3JCMd 4C0DC 2DD4A 4J6XA 1YI2A 3SDZA 3JRZA 3N5BB 4C5EA 3L2UA 3E1SA 2P0KA 3A5ZB 4D6WA 3CC2A 2ZPHB 3NTKA 3A8GB 3R6OA 2RI2A 4CI0C 3OYYA 3UDCA 4M78C 5KE2A 4E7IA 2RJCA 4PJOE 1YITA 2IG0A 2E6NA 2P0QA 2RH2A 4A4EA 1BYMA 2LCCA 4Z02A 3X20B 2XG8D 3KUFA 1Q7YU 4FSXA 4C0ZA 2GF7A 5GAOm 1QVGA 4C8QB 3OYCA 1YI2T 4E7HA 5FRMA 2R5AA 3LWIA 2GCXA 3J7AF 2RJEA 5GAOr 3LW5E 4MDXA 1XNIA 4IUPA 4Q5WA 3LYIA 3TU4K 3CCQT 4XU3A 1K9MU 1VQ6A 2HBPA 2ZZDA 1X6OA 1K8AC 3CD6A 2HD0A 2YLCA 1WJQA 2KSSA 4XAXB 1YITT 3V8KA 1N9SA 1I8FA 3GLXA 2AHJB 1WNLA 4CRIA 1B34A 1D3BB 1VQ9T 4N0AA 2X35A 1KHCA 2XKOC 2CS7A 1VQNT 1BI1A 2RB6A 4QQ6A 1M4ZA 3JCMe 3RMQA 4EPCA 5CVIA 3OS1A 2OTLA 5I2SA 1Y96A 3GF5A 2EFIA 4C8QG 1VQ6T 2LTOA 5FROA 4ZN3A 5KE3A 4QVCA 5HKCA 4V2SA 4A4GA 4B9WA 4EMKC 3CD6T 2DIQA 4C92E 1PSFA 1BIBA 4N4IA 1VQPA 4A4FA 1YJ9A 1VQ7A 4ELYC 2DEQA 5GAN7 3ER0A 2DKGA 2RD1A 2ZGWA 4BACA 3VYHB 1YJNA 5FLXE 4J5YA 2L5QA 4OF1A 2XK0A 2OTLT 1G3YA 5HY6A 4C92A 3OYBA 4BE2A 3JB9D 1WJSA 3MP8A 3RKWA 2DVEA 2QXFA 3OMGA 2L89A 3CPWS 1K8AU 3M9QA 1YIJA 1OZ3A 3GIBA 4QQGA 1VIFA 2LCLA 3G6EA 3GPLA 4OB1B 2M16A 3WXMB 3HFOA 5A2QE 3JB9J 1HK9A 3OSVA 1YJ9T 1VQPT 4FIBA 1VQ7T 3VUBA 4E7KA 4M7AG 4ZTJA 3CMAT 1QW1A 3VU3C 4BE0A 1YJNT 1N6AA 2XHCA 3CCUA 3CCLA 2VYTA 1K73C 5GANg 2Y4YA 2DTIA 2R58A 4M7DD 4PJOB 3C95A 3DB3A 3S3NA 4FU6A 3MP1A 1YIJT 2D0QB 2A3LA 5GAN4 3CCJA 2VGMA 4JDSA 2R5MA 3LX7A 3A8HB 4IUQA 3G6ET 1JJ2S 2DXBA 4HT8A 1JRIA 4IKFA 4ZN1A 2GQVA 3CPFA 3M56A 1R8OB 4EMHA 3CMEA 5EG2A 5GANe 5J39A 3V7SA 2E6ZA 3L1AA 4KT0E 3H6ZA 4OMFB 3JCMh 4DOWA 5LJ5g 4BUGA 3CCUT 1NJIC 1FXXA 2KK4A 1AHJB 3QKJA 1UGSB 1Y96B 4M75D 4M77B 4X9CA 2DIGA 4A54A 3LLRA 2FVUA 1VQKA 3BY7A 3META 3CCMA 3CCJT 3QHSA 4PJOG 1BI3A 4FT4A 3JCMW 3FEOA 3LGLA 5LJ3g 4BI4A 4C0FA 3OS2A 1YBYA 3QSUA 3OQ5A 1Y7XA 3BDLA 4M78E 3L2RA 1M8VA 4X34A 2DO3A 2RJDA 5GAOl 4IUUA 2PQWA 2O01E 5LL6S 4C5HA 3G4SA 2MI6A 3X26B 2EQUA 2VUBA 2F5KA 3JB9F 2M0OA 1VQKT 3JCMJ 1N8RC 2R57A 1KQ1A 1VUBA 4M78A 4OP0A 3WVDB 3INZA 3J80E 2LX9A 4QVDA 3CCMT 3EAEA 4ZTFA 2Y90A 3C94A 5CKEA 2DD5A 4QW2A 2DZCA 5CO7A 1WPYA 3VYGA 2XDDA 4XTWA 1S72T 1KD1U 1H3ZA 4FT2A 5CK9A 5GAN6 3DB4A 2RHZA 4PJOD 1NJIU 5CCAA 3OYDA 2FL7A 4DA4A 2QTXA 4MZMA 4BY6B 5KH6A 5CR2A 3DLLA 1VIEA 1XOVA 4ZGEB 3G4ST 3PGGA 2LQ8A 2DK3A 5AYFA 3URGA 4LDUA 4M7DF 2XDBA 1MHNA 1O75A 2KMTA 5D6XA 1LJOA 3QBYA 3RKXA 4BD3A 2C06A 3M5AA 4C92G 3CC2T 3ZFJA 2E70A 3OY9A 1RL2A 5CQXA 3PTAA 1BIAA 5A0LA 5GAN8 3CCQA 1XQHA 3RESA 3JCMV 3L2QA 3G71A 2PUKB 3EFSA 2G3RA 3JSCA 4IUTA 5GANh 2EQKA 4BI3A 2EJFA 2B8AA 2DXTA 3VV0A 2DPPB 1O9SA 3FJPA 4M77D 4PNOA 3X25B 3OYGA 2HQEA 1VQOA 4O6JA 3MCAB 2LQKA 3FB9A 5GMKj 3QG1A 1VQ9A 1KQ2A 4R56A 1VQNA 1U1SA 4M75F 4E7LA 1N8RU 3V7RA 3VJPA 4M7DC 3MEAA 4J83A 2VV5A 3CCEA 2Y4XA 3HPWA 4LDWA 4EMKA 1H641 2MWOA 2PVOB 3OYJA 2XI9A 2EJGA 2FYKA 4J7IA 5HK0A 5GAN2 2RA2A 4HT9A 3OBWA 3HRTA 3E9FA 5GAOq 5CIUA 3G71T 2V8JA 2ZCFB 3MEWA 3SWNB 3QXEB 2QQ9A 3H8ZA 1VQOT 4KULA 1VQMA 3M4GA 5A0DA 1M90C 3V8JA 5I2MA 5J26A 2EIFA 3FDRA 2KQWA 3QIIA 4EMGA 5GMKe 2D9TA 4LDVA 4BDYA 1I4K1 2K57A 3L2ZA 4M75C 1YHQA 1IREB 4BI8B 3CCET 2EQMA 1G3SA 4M78B 4F7UF 5DLOA 3OYNA 4R55A 3M57A 1G3WA 2DJZA 2DXCA 2PVGB 2X4WA 3MP6A 3CCRA 1I5LA 3C4SA 2F69A 2GFUA 2D6FA 2PUOB 4M7AB 3RKYA 5L8RE 2XD0A 4J6WA 4LD9K 2JNGA 3V8LA 3JCMP 1VQMT 3C12A 3QJYA 3ZBDA 5GANd 3CPWA 4PL6A 3RERA 2MMPA 3M59A 3CMAA 3OBYA 3QZ5B 4JRKA 2VXEA 4JLGA 1YHQT 3FC3A 3UWNA 3A8OB 5GAMj 3S3MA 2PVDB 2E64A 2CZ1B 1DJ7B 3KXTA 3LGFA 3SB2A 3TEEA 3KBGA 5GAMg 1M1KC 2NLUA 3CEYA 4M78G 5CKDA 3JCMf 5HK3A 2A7YA 1MGQA 2IVWA 4HCZA 4XK8E 3CCRT 5LJ5d 1KHIA 3V7CA 1M90U 4Y91A 4M77F 2E12A 1LNXA 4C8QD 4RG2A 4DQ2A 5DM7R 4PJOC 5DY9A 4XQ3A 5GANj 3G7ZA 1ZQ1A 2BKDN 2K5LA 2E10A 2E65A 3DLMA 3BW1A 4A4HA 1JJ2A 2DXUA 2O4XA 2MF2A 4HCCA 4ZGJB 5GAMe 2QI2A 4EMKB 3PFSA 3MO8A 3FRNA 4J7FA 5FU6C 4WF2A 3GNGA 2E5QA 4XTVA 5LJ3d 3PNWC 2K5FA 4OGCA 4N4GA 3JAME 1V29B 4J8OA 3OA6A 3QPHA 2EJ9A 5LJ5j 3CC7A 4M77C 5GMKh 2JOYA 4OB0B 1B34B 4C0GA 1UGQB 2K3XA 3EFRA 3OYLA 2MAMA 5GAOn 1YJWA 3OSSC 2RHUA 1G5VA 2EAYA 2K4YA 3ZEHA 4IUVA 1M1KU 2ZPGB 3HRSA 2QQSA 4DOVA 2LNVA 5LJ3j 4M7AD 4GLKA 3I55A 1Y71A 2L8DA 1X75C 2QA4A 3RMSA 4ATOA 1WJRA 4KUDK 2VXFA 3CC7T 2JZ2A 4OVAA 5LJ5e 1S72A 2WSFE 5IN1A 2ZPEB 3P8DA 4E47A 3OYEA 1KQSS 2JVVA 1QP2A 1UEBA 1QVFA 1G3TA 2RK1A 1K73U 5KCOA 3PIOA 1HXDA 2CZ7B 5DLQE 1W4SA 3CCVA 4FM4B 3RUXA 2KDSA 4C92B 5IT9E 3MEUA 4RG8A 2P4TA 3OB9A 1YJWT 1QVPA 5GANf 5I21A 4M7DE 2CKKA 2RK2A 3X28B 2RHIA 3QUIA 3QYGB 1BI0A 1WGSA 2H3JA 5LJ3e 5GAN3 3QZ9B 3PMTA 5GMKm 3I55T 1QVFS 2JTMA 3GNFB 3T9NA 2QA4T 4O5VA 1M1GA 4JUVA 1VQ8A 2PU9B 4KBMB 1FX7A 4C8QF 4NOYA 3PT9A 1X01A 4M7DA 4JS4A 2EWNA 5FRNA 5GAMh 2O4XB 5C6SA 2I2LA 1ZHIA 3CCVT 1TH7A 3PIPA 1M5Q1 3SFMA 2F5TX 4M75E 1M1FA 2FB7A 1D3BA 2RJFA 4MZPA 2EKOA 3VUZA 1RI0A 1NZ9A 2DZ9A 5CKBA 2BUDA 3O8VA 3OYHA 3P8BB 3L2VA 3OW2S 3CC4A 2JTFA 2OTJA 5CKHA 3SD4A 1VQ8T 2DAQA 4XTYA 3HHTB 4OGEA 4C8QC 3M58A 3ASKA 3E19A 1OI1A 5FU7B 4M75A 4XU1A 4C5GA 3L42A 4LDYA 4XU0A 2RHYA 2L3RA 2YRVA 2DTOA 3A8MB 3M53A 1W2BS 4MDWA 1P92A 5GMKi 4M7AF 3SWNC 2VC8A 4F7UE 2LC4A 4NL3A 1GXIE 2KVQG 2K5IA 3CC4T 4EDUA 2OTJT 4PLLA 5LJ5h 2MWPA 2XDPA 2CGHA 1N27A 4JRIA 4NS5A 1VQ4A 2K3YA 4C92D 4C0DB 3MHXA 3CXCS 2KY9A 4HKEA 4F7UA 2XICA 3FLGA 5D6WA 1BI2A 5CQYA 2QEXT 3OYFA 5LJ3h 3JCMQ 5GAMd 1VQ5A 5IAYA 3E9GA 4ELZC 4M7AC 4RCBA 3OYKA 4OB3B 4JJNK 3A8LB 1IZ6A 3PMIA 4YTLA 1Q82C 4PJOA 1VQ4T 3JCMg 5M9OA 2K2VA 4OB2B 4B9XA 1YCYA 4JRQA 3L2WA 4M7DB 1NPRA 2CZ0B 2WACA 2E41A 3UT1A 1QVGS 4PJOF 4M77E 4XTZA 3CBMA 1FWZA 3Q1JA 3OS0A 3OMCA 3JB9G 2RM4A 4II1A 1KC8C 2M9UA 2JN0A 2VGNA 3MEVA 1VQ5T 2OAUA 3DKMA 3JCMX 4QQDA 3QDRB 4FL6A 3M55A 3RIRA 4M77A 3JB9I 2M1HA 4ME7A 2ZPBB 3HFNA 3UPUA 4TVRA 4KUIA 3OYAA 1UB4A 1UGRB 4M75B 3HKSA 3S6WA 4XTUA 2RI3A 4JRPA 3JCMc 3CBPA 4M7DG 2LDMA 3GP8A 1Y07A 4X9DA 4PLIA 5GMKl 3HRUA 5GAOp 3NTIA 3VKIA 4L6V5 1N9RA 3I56A 1VQLA 2WSEE 1Q82U 1XTDA 4N0AC 2EQJA 2LT1A 4A53A 3GOXA 1U1TA 3OYMA 2QQAA 4L59A 4JLIA 1ZBXA 2RHXA 3WVEB 4C92F 2HQXA 2ZPFB 3JCMb 2LVMA 4F7UB 1JBMA 4GY5A 2P0PA 2EYQA 4P5NA 3FIFA 4M78D 1UGPB 1SSFA 4M75G 1Q86C 1KC8U 4ZGDB 2RO0A 2E1HA 3CBOA 1Q81C 3QJ6A 4XTXA 1OYXA 2QQRA 2WSCE 1KQSA 1KG1A 2GFAA 3I56T 1VQLT 2XIDA 1WQWA 1EIFA 1BKBA 5GAMf 2JUFA 3CCSA 2X4YA 3BFMA 2V8IA 4BDZA 2XU8A 4A4KA 4QVZA 4RCCA 4C92C 2HAXA 4HA8A 4C8QE 3HL8A 5FU6B 2FHDA 4HCBA 2BIVA 2V8KA 1I81A 4NL2A 3TCJA 1KD1C 4F7UG 3AHUA 5J3BA 3CCLT 1PSEA 4N4HA 4VUBA 4C5IA 2LRQA 3HSBA 1M9SA 4C8QA 2QDYB 3CCST 4Y28E 3JB9H 4MMLA 4BY6C 2RI5A 3J81E 4MZTA 1Q86U 5CAIA 5C0MA 5CKFA 4L5GA 1JB0E 1OZ2A 3OW2A 1NE8A 2HNIA 2QQBA 3CMET 1Q81U 4LDXA 3SWNA 3F70A 5LJ5f 1QP3A 3NFCA 3M54A 2KAFA 4RKUE 4E7JA 5D6YA 4BB7A 3P8HA 4XU2A 3S3OA 2X4JA 3HP9A 4M7AE 5FU7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J6Y A;  4EMH A;  3SB2 A;  4F7U A;  1WQ7 A;  2YHT A;  5GAN e;  3V7S A;  3L1A A;  5LJ5 g;  4M78 G;  2YLB A;  4M77 G;  3JCM h;  3JCM f;  1MGQ A;  3QO3 A;  1LOJ A;  5LJ3 h;  3JCM Q;  5LJ3 f;  5GAM d;  5GAN 5;  4MMK A;  5LJ5 d;  1Y96 B;  3V7C A;  4RCB A;  4M75 D;  4M77 B;  4X9C A;  4Y91 A;  4M78 F;  4M7A C;  4M77 F;  4C8Q D;  1LNX A;  4A54 A;  4DQ2 A;  4PJO C;  4M7A A;  5DY9 A;  2DTH A;  4XQ3 A;  5GAN j;  2E10 A;  3BY7 A;  2E65 A;  4PJO A;  3BW1 A;  3QHS A;  4PJO G;  2DXU A;  3JCM g;  3JCM W;  5LJ3 g;  5GAM e;  4EMK B;  1YCY A;  3QSU A;  4M7D B;  3BDU A;  3JCM d;  2E41 A;  4J6X A;  4M78 E;  4WF2 A;  4M77 E;  4XTZ A;  4XTV A;  4PJO F;  5LJ3 d;  1M8V A;  4HT9 A;  5GAO l;  3JB9 G;  2RM4 A;  2JN0 A;  2EJ9 A;  5LJ5 j;  3JCM X;  4M78 C;  4M77 C;  3JB9 F;  5GMK h;  3JCM J;  1B34 B;  3RIR A;  4PJO E;  1KQ1 A;  4M78 A;  4M77 A;  4OP0 A;  3EFR A;  3INZ A;  3JB9 I;  4QVD A;  3HFN A;  2Y90 A;  5GAO n;  2DZC A;  1WPY A;  4M75 B;  2EAY A;  4XTW A;  5GAO m;  4C8Q B;  4XTU A;  5GAN 6;  4M7A D;  3JCM c;  5LJ3 j;  5GAO r;  4PJO D;  4M7D G;  2QTX A;  4X9D A;  4XU3 A;  2VXF A;  5GMK l;  5LJ5 e;  5GAO p;  3PGG A;  4M7D F;  2YLC A;  1N9R A;  1LJO A;  3RKX A;  3V8K A;  1N9S A;  4C92 G;  4N0A C;  1I8F A;  1HXD A;  1BIA A;  1WNL A;  4A53 A;  1U1T A;  1D3B B;  1B34 A;  5GAN 8;  4JLI A;  3RUX A;  4N0A A;  3RES A;  3JCM V;  4C92 B;  4C92 F;  2RB6 A;  3EFS A;  5GAN h;  3JCM b;  3JCM e;  5I21 A;  5GAN f;  4M7D E;  4F7U B;  1JBM A;  2EJF A;  2DXT A;  3QUI A;  1Y96 A;  3FIF A;  3FJP A;  4M77 D;  4M78 D;  4M75 G;  4PNO A;  5LJ3 e;  5GMK m;  5GAN 3;  4C8Q G;  5GMK j;  2E1H A;  3FB9 A;  4JUV A;  4QVC A;  1KQ2 A;  4XTX A;  4V2S A;  4EMK C;  1U1S A;  4M75 F;  4C92 E;  4M7D C;  3V7R A;  4C8Q F;  4NOY A;  1BIB A;  1X01 A;  4EMK A;  1H64 1;  4M7D A;  1WQW A;  2EWN A;  5GAM h;  2DEQ A;  5GAM f;  2EJG A;  2FYK A;  2I2L A;  3BFM A;  2DKG A;  2RA2 A;  5GAN 2;  5GAM g;  1TH7 A;  5GAN 7;  2RD1 A;  1M5Q 1;  2ZGW A;  4RCC A;  4C92 C;  5GAO q;  4J5Y A;  4HA8 A;  4M75 E;  2FB7 A;  1D3B A;  3SWN B;  4C8Q E;  4C92 A;  3JB9 D;  3M4G A;  2DZ9 A;  3RKW A;  2DVE A;  3V8J A;  1I81 A;  4NL2 A;  3AHU A;  4F7U G;  3GIB A;  4EMG A;  5GMK e;  1I4K 1;  2K57 A;  3L2Z A;  4M75 C;  4XTY A;  4C8Q C;  3HFO A;  4M78 B;  4F7U F;  4M75 A;  3HSB A;  3JB9 J;  1HK9 A;  4XU1 A;  4C8Q A;  3JB9 H;  2DJZ A;  4MML A;  4M7A G;  4XU0 A;  3VU3 C;  1I5L A;  2DTO A;  5CAI A;  3RKY A;  4M7A B;  5GAN g;  5GMK i;  4M7A F;  2DTI A;  3SWN C;  4M7D D;  2VC8 A;  4J6W A;  3V8L A;  4F7U E;  2HNI A;  4NL3 A;  3JCM P;  3RER A;  5GAN d;  4PJO B;  3SWN A;  5LJ5 h;  5LJ5 f;  2CGH A;  4JRK A;  2VXE A;  4JRI A;  5GAN 4;  4XU2 A;  5GAM j;  4HT8 A;  4C92 D;  2E64 A;  1JRI A;  4M7A E; 
#chains in the Genus database with same CATH topology
 2EGC A;  4BE1 A;  4PKC C;  2YHT A;  1W2B A;  1U8R A;  4M78 F;  3EHQ A;  1ZSG A;  4RMO A;  2LT4 A;  3QYH B;  3LH0 A;  5KYX A;  1RLP C;  2K79 A;  4C0D C;  2L3P A;  3SDZ A;  4C5E A;  3L2U A;  2P0K A;  4Z89 A;  2K9G A;  3OYY A;  4M78 C;  2MK5 A;  1YIT A;  2IG0 A;  2E6N A;  2RH2 A;  1WDX A;  1XJW B;  3X20 B;  4RUG A;  5GAO m;  1YI2 T;  2R5A A;  1UE9 A;  1PRM C;  4IUP A;  1VQ6 A;  2MIO A;  3NPF A;  3EG2 A;  3CD6 A;  3EGX A;  3PVQ A;  2GTO A;  1KHC A;  2CS7 A;  1BI1 A;  1GCQ A;  2RB6 A;  3JCM e;  2D8H A;  5FW9 A;  1Y96 A;  3GF5 A;  4RTV A;  4HVW A;  2DL4 A;  2EQI A;  4ELY C;  2DVJ A;  2HQH A;  5KYW B;  2E3I A;  5FLX E;  4J5Y A;  5KYU B;  2XK0 A;  5HY6 A;  4C92 A;  4DBH A;  1Q7Y R;  1IGU A;  1SF9 A;  3RKW A;  2YXY A;  3CPW S;  1YIJ A;  1OZ3 A;  4QQG A;  2LCL A;  1VQ7 Q;  1ARK A;  2C0I A;  4OB1 B;  2M16 A;  1K9M R;  3OSV A;  1VQ7 T;  2FZC B;  4ZTJ A;  2BE9 B;  1QW1 A;  8ATC B;  2EVR A;  2XHC A;  1MV0 B;  2EYX A;  2RF0 A;  3S3N A;  2MOX A;  1QQJ A;  4AG1 C;  3UA7 A;  2A3L A;  5GAN 4;  4JDS A;  2DXB A;  1JRI A;  3CCU Q;  3M56 A;  1R8O B;  2J06 A;  2JS2 A;  5GAN e;  5J39 A;  4KT0 E;  5LJ5 g;  4DOW A;  3CCU T;  3H0F A;  2JW4 A;  4X9C A;  3SHW A;  2DIG A;  2ROT A;  3LLR A;  1VQK A;  2A36 A;  3BY7 A;  3VS2 A;  3CCM A;  4PJO G;  4QT7 A;  2K2M A;  1K8A R;  3OQ5 A;  4M78 E;  4E2F B;  1M8V A;  2DO3 A;  4FYY B;  1UFF A;  1M3C A;  3G4S A;  3X26 B;  2VUB A;  3WVD B;  2EYW A;  1YNZ A;  5CKE A;  2KI7 A;  3C94 A;  4HCK A;  1BU1 A;  2DZC A;  1KIK A;  2V1R A;  5CK9 A;  1OX8 A;  1NLP C;  2M51 A;  2FL7 A;  5KH6 A;  5CR2 A;  2L0A A;  3A1P A;  1VIE A;  2LQ8 A;  4BD3 A;  4JPB W;  2C06 A;  3M5A A;  3ZFJ A;  3OY9 A;  3PTA A;  5A0L A;  1WHK A;  2KT8 A;  2PUK B;  2G3R A;  3EG3 A;  1ZUU A;  3GBQ A;  2EJF A;  2DXT A;  2V26 A;  3X25 B;  3FJP A;  4M77 D;  4DBF A;  4O6J A;  5GMK j;  1AZE A;  2NUT A;  3AT1 B;  3CCE A;  2RMO A;  4EMK A;  1H64 1;  2PVO B;  3OYJ A;  5HK0 A;  1ACM B;  1QLY A;  4OMQ A;  3SWN B;  2QQ9 A;  1M90 C;  2RQR A;  1FMV A;  1B3Q A;  5I2M A;  1M2O A;  5J26 A;  2BTT A;  5GMK e;  2D9T A;  2O31 A;  4LDV A;  1NJI R;  1X27 A;  1G3S A;  5DLO A;  3LH5 A;  4HXJ A;  2DJZ A;  2DXC A;  2F69 A;  3RKY A;  1QKX A;  4LD9 K;  2F2W A;  2MMP A;  3CMA A;  4JLG A;  1YHQ T;  3FC3 A;  1W1F A;  3EFO A;  1OX9 A;  2CZ1 B;  3CCR Q;  3LGF A;  5GAM g;  5IHN A;  3CCR T;  4DBQ A;  1M90 U;  2X3W D;  1D0Y A;  1LNX A;  5DY9 A;  2BKD N;  4DEX A;  1JJ2 A;  2O4X A;  2CT3 A;  1OPK A;  2K7A A;  2B86 A;  2AIR B;  1V29 B;  3M0Q A;  2JOY A;  4OB0 B;  1B34 B;  2RHU A;  4AFQ C;  1QMC A;  4PK4 A;  4M7A D;  2QQS A;  2LNV A;  2J7I A;  4GLK A;  2QA4 A;  2VXF A;  3NHN A;  3CC7 T;  1TTH B;  4F16 A;  1UEB A;  4J9F A;  1RAG B;  5KCO A;  5DLQ E;  5IT9 E;  3SEM A;  1YJW T;  3I55 Q;  4RG8 A;  2P4T A;  1HSQ A;  2HSP A;  2RK2 A;  2RHI A;  3QUI A;  2LQW A;  3QZ9 B;  5GMK m;  3I55 T;  1QVF S;  4IIM A;  4O5V A;  1VQ8 A;  2AKL A;  1TWB A;  2PU9 B;  1HYO A;  1D1A A;  2KXD A;  4NOY A;  3MKD A;  1GL5 A;  2EWN A;  4D8K A;  2K3B A;  2I2L A;  5C6S A;  3CCV T;  1WA7 A;  1TH7 A;  2P84 A;  3SFM A;  2DL5 A;  1M1F A;  2FB7 A;  3H0I A;  3VUZ A;  3VRZ A;  1NZ9 A;  2QGG A;  5CKB A;  2AKK A;  3O8V A;  3OYH A;  3SD4 A;  3EH1 A;  2KRS A;  1KSW A;  3M58 A;  1CSK A;  4HVV A;  5FU7 B;  4XU1 A;  2RNA A;  1M3A A;  2DTO A;  1W2B S;  2CP7 A;  1P92 A;  2QTV A;  3SWN C;  1PD0 A;  2K5I A;  5LJ5 h;  2QGF B;  1AD5 A;  4JRI A;  2RQU A;  1RUW A;  2HBW A;  1FMW A;  3NGP A;  5D6W A;  5CQY A;  3OYF A;  2VAS A;  2KGT A;  1VQ5 A;  2NUP B;  1Y57 A;  1EX4 A;  3MJX A;  4RCB A;  2YWW A;  3OYK A;  4OB3 B;  1OV3 A;  4JJN K;  1MV3 A;  3A8L B;  3PMI A;  4YTL A;  4PJO A;  1TUC A;  1W6X A;  2W10 A;  1YCY A;  4M7D B;  2WAC A;  3UT1 A;  4PJO F;  2D8J A;  1F1B B;  2KT1 A;  3Q1J A;  3OS0 A;  3OMC A;  3EG9 A;  3VS1 A;  3I9Q A;  4M4Z A;  1R0B G;  3REB B;  3M55 A;  1YWP A;  4ME7 A;  2ZPB B;  3UPU A;  2OX7 A;  4TVR A;  1JXO A;  1B07 A;  4M75 B;  4XTU A;  2RI3 A;  1Y07 A;  4J9I A;  3HRU A;  3VKI A;  2WSE E;  3A98 A;  1IGQ A;  2EQJ A;  3GOX A;  2AZS A;  3OYM A;  1VQP Q;  1ZBX A;  1SHG A;  3EGD B;  4KH0 B;  3I5S A;  5IXF A;  4F7U B;  1YJN Q;  1ZUY A;  1UGP B;  2QG9 B;  2CP0 A;  2DM1 A;  2WSC E;  5FWC A;  2XID A;  3TVT A;  1WQW A;  1EIF A;  1M2V B;  3G6E Q;  5GAM f;  2JUF A;  3CCL Q;  5FU6 B;  2FHD A;  4HCB A;  4OMN A;  2BIV A;  2V8K A;  2FPD A;  3CCL T;  3CCS Q;  4N4H A;  2J6K A;  3HSB A;  4JJD A;  3CCJ Q;  3JB9 H;  3CCS T;  4J9D A;  2HDA A;  2RI5 A;  4MZT A;  3UAT A;  2P4R A;  2QQB A;  2SRC A;  2KAF A;  5GJW B;  4BB7 A;  1RAB B;  3P8H A;  3S3O A;  2FRW A;  3CQT A;  3HP9 A;  5FU7 C;  1Q7Y C;  6AT1 B;  4UC4 A;  2X4X A;  2KYM A;  4M77 G;  5LJ3 f;  5GAN 5;  3MPU B;  4MMK A;  1K9M C;  2HCK A;  2ZPI B;  2EW3 A;  4JS5 A;  3OS5 A;  4LUD A;  4LD6 A;  3JCM d;  2DD4 A;  4J6X A;  1YI2 A;  3A5Z B;  2ZPH B;  1T3L A;  3A8G B;  3R6O A;  2RI2 A;  2RJC A;  4JZ3 A;  4PJO E;  2OAW A;  2LCC A;  4Z02 A;  2XG8 D;  1Q7Y U;  4C8Q B;  3U23 A;  3CCQ Q;  3LWI A;  2D1X A;  5GAO r;  3LW5 E;  1X2K A;  3TU4 K;  3CCQ T;  1K9M U;  2HBP A;  1K8A C;  2HD0 A;  1SG5 A;  4AFZ C;  1WJQ A;  4XAX B;  1VQN Q;  1KD1 R;  3GLX A;  2AHJ B;  1WNL A;  4CRI A;  4F04 B;  1D3B B;  2X35 A;  3JV3 A;  1VQN T;  4QQ6 A;  4EPC A;  2L3S A;  3M0R A;  2LTO A;  5FRO A;  4V2S A;  1VQM Q;  4B9W A;  1MMN A;  2HSE B;  1PSF A;  2LP5 A;  2J05 A;  1ZLM A;  1VQ7 A;  5GAN 7;  3ER0 A;  2RD1 A;  2DF6 A;  2OTL T;  1G3Y A;  2ESW A;  2DVE A;  3M0U A;  2L89 A;  1K8A U;  2FZK B;  1VIF A;  2L2P A;  1M30 A;  3WXM B;  5A2Q E;  3JB9 J;  1HK9 A;  1CKA A;  1QCF A;  3VUB A;  4M7A G;  1UG1 A;  3CCU A;  2LNH B;  2LMJ A;  2R58 A;  4M7D D;  2QAZ A;  3MP1 A;  2D0Q B;  2EGE A;  3EGX B;  1JJ2 S;  2R5M A;  3A8H B;  4IUQ A;  3TSW A;  2E3H A;  4ZN1 A;  4EMH A;  2E6Z A;  1UGV A;  3H6Z A;  2IIM A;  4BUG A;  1NJI C;  1FXX A;  4FW1 A;  1Y96 B;  4M75 D;  4M77 B;  4A54 A;  2A28 A;  3MET A;  1I07 A;  3JCM W;  1JU5 C;  3LGL A;  4BI4 A;  4C0F A;  3QSU A;  1Y7X A;  3BDL A;  3L2R A;  4X34 A;  5IHK A;  1PC0 A;  3JCM J;  2R57 A;  1VUB A;  4M78 A;  1S72 Q;  4OP0 A;  3INZ A;  3J80 E;  1IO6 A;  2DD5 A;  4QW2 A;  2XDD A;  4XTW A;  1S72 T;  3DB4 A;  1NJI U;  4E7Z A;  5CCA A;  4DA4 A;  1E6H A;  2QTX A;  4MZM A;  4BY6 B;  3CC2 Q;  1XOV A;  4ZGE B;  1SEM A;  3PGG A;  3URG A;  5D6X A;  1YWO A;  1LJO A;  2E4H A;  3CC2 T;  5CQX A;  4F14 A;  1NBE B;  2YT6 A;  3JSC A;  4IUT A;  2EQK A;  4BI3 A;  2B8A A;  3VV0 A;  1O9S A;  4PFP A;  1BCO A;  4QKU A;  1KQ2 A;  1VQ9 A;  4GBQ A;  1TU0 B;  1K73 R;  3V7R A;  2HMA A;  4J83 A;  2VV5 A;  2RQV A;  3OW2 P;  1WHJ A;  1VQO Q;  5KYY B;  1WXB A;  3MEW A;  1W70 A;  3UF4 A;  3QXE B;  2FPF A;  1ZBJ A;  1VQO T;  2BZX A;  5A0D A;  1T3S A;  4EMG A;  2JS0 A;  1YHQ A;  2K57 A;  3L2Z A;  4DEY A;  4WTO B;  4BI8 B;  2C0O A;  2D0N A;  2LZ6 B;  1X6G A;  4R55 A;  1G3W A;  2PVG B;  4LE9 A;  2X4W A;  1K76 A;  3CCR A;  3C4S A;  4E7S A;  2GFU A;  3CXC P;  4M7A B;  2JNG A;  3V8L A;  3JCM P;  1C6V X;  1RAH B;  3OBY A;  3QZ5 B;  4JRK A;  2VXE A;  4FCY A;  3A8O B;  5GAM j;  1GFC A;  3S3M A;  2E64 A;  3KXT A;  1N8R R;  5HCK A;  3SB2 A;  3TEE A;  3KBG A;  2NLU A;  4E7H A;  2IVW A;  1QVG P;  3V7C A;  3VS0 A;  4M77 F;  4C8Q D;  4RG2 A;  2ATC B;  2A0F B;  5GAN j;  3G7Z A;  2ED0 A;  1WHM A;  2NUT B;  2DXU A;  3M0P A;  4JJB A;  2QI2 A;  4EMK B;  5GAM e;  2E5Q A;  4XTV A;  2K5F A;  4OGC A;  1ZX6 A;  1VYT A;  3CC7 A;  3QPH A;  5AT1 B;  4M77 C;  4C0G A;  3EFR A;  1YJW A;  1TXQ A;  1G5V A;  2ZPG B;  4DOV A;  5LJ3 j;  3I55 A;  1E6G A;  4ATO A;  3RMS A;  1WJR A;  2JZ2 A;  4OVA A;  1PG5 B;  5IN1 A;  3TQ7 P;  1KK7 A;  3RR6 A;  3PIO A;  1HXD A;  3EFO B;  4FM4 B;  4X1V A;  3CCV A;  1WXU A;  1RAA B;  1RI9 A;  2CKK A;  5LJ3 e;  1WGS A;  4LN2 A;  2JTM A;  3GNF B;  5L23 A;  1K0S A;  4KBM B;  2I0N A;  1FX7 A;  1X01 A;  2COZ A;  2O4X B;  1UHC A;  2ECZ A;  1M5Q 1;  4RTZ A;  4MZP A;  2EKO A;  2DZ9 A;  1M1K R;  2JTF A;  1TS9 A;  1B7T A;  3ZL7 C;  4CC4 B;  4Y92 A;  4OGE A;  3ASK A;  5ECA A;  2CP3 A;  1MMA A;  1EZZ B;  1LVK A;  4J9G A;  2COW A;  2RHY A;  2L3R A;  1UHF A;  2YRV A;  2OTJ Q;  4M7A F;  1GXI E;  2LC4 A;  2OTJ T;  4PLL A;  2CGH A;  1ZA1 B;  2K3Y A;  1NYG A;  4C92 D;  1SHF A;  1YP5 A;  5FWB A;  5IAY A;  2X51 A;  4M7A C;  1VQ4 Q;  1GBR A;  2LJ3 A;  2M02 A;  4CC2 A;  1VQ4 T;  3JCM g;  4OB2 B;  2DL8 A;  2GGR A;  1NPR A;  2ZAE A;  4M77 E;  3CBM A;  2V1Q A;  1RAE B;  3MEV A;  4A63 B;  2GQI A;  3JCM X;  4F17 A;  3RIR A;  3CD6 Q;  3JB9 I;  3HFN A;  1Z9Q A;  2DJQ A;  1VYV A;  3HKS A;  1PD1 A;  2GNC A;  4M7D G;  2LDM A;  1Z9Z A;  4L6V 5;  1WHH A;  1XTD A;  2VB6 A;  4N0A C;  1AOJ A;  1U1T A;  2YRC A;  3WVE B;  1RAC B;  2JMA A;  2ZPF B;  4JZ4 A;  2EYQ A;  4P5N A;  2QDL A;  4M75 G;  2RO0 A;  1JEG A;  1K1Z A;  3CBO A;  2LJ1 A;  4XTX A;  1KG1 A;  1YIJ Q;  1QCN A;  2KEA A;  1OU8 A;  3CCS A;  2X4Y A;  2V8I A;  2BZY A;  4QVZ A;  1PM3 A;  1ZSZ B;  2JM9 A;  3HL8 A;  4LNP A;  3EG9 B;  1KD1 C;  3TCJ A;  4F7U G;  1QCO A;  4VUB A;  3RDV A;  4C5I A;  4ORZ A;  2QDY B;  4PJM A;  2ED1 A;  5CKF A;  3PVL A;  4L5G A;  3OW2 A;  2HNI A;  1TUG B;  3SWN A;  5LJ5 f;  1KC8 R;  4RKU E;  1D0Z A;  4ESR A;  1D09 B;  1T0H A;  4M7A E;  2ABL A;  2CYZ B;  4J6Y A;  1WQ7 A;  2JT4 A;  3M4Y A;  3NTH A;  3LWH A;  2AT1 B;  3ME9 A;  3RBB B;  2J6F A;  5A0G A;  2DTH A;  1YFN A;  3BE3 A;  1OEB A;  3TRE A;  2QEX A;  4IUR A;  3OYI A;  1JO8 A;  3CXC A;  1G8X A;  3JRZ A;  3N5B B;  3ULR B;  3E1S A;  4B6M A;  3NTK A;  2A37 A;  1OOT A;  2XMF A;  1WHL A;  4CI0 C;  4E7I A;  3UDC A;  2P0Q A;  1OPL A;  4D8D A;  1Q81 R;  4FSX A;  4C0Z A;  1QVG A;  5FRM A;  4HVU A;  4AFU C;  2HKN A;  2DMO A;  2RJE A;  4MDX A;  1NYF A;  4Q5W A;  3LYI A;  4J9C A;  4FYW B;  1X6O A;  2YLC A;  2KSS A;  1N9S A;  2NYS A;  2HKQ B;  1I8F A;  3CCE Q;  1B34 A;  2DIL A;  1C0M A;  4J9H A;  1M4Z A;  3RMQ A;  5CVI A;  2OTL A;  2FPE A;  1G83 A;  4C8Q G;  2GTJ A;  4R0K A;  5KE3 A;  5HKC A;  4A4G A;  2MCN A;  2VKN A;  4N4I A;  2K6D A;  3I35 A;  2DKG A;  1WLP B;  3VYH B;  8AT1 B;  4KGZ B;  5I22 A;  4BE2 A;  3JB9 D;  1WJS A;  2QXF A;  3OMG A;  3M9Q A;  3GIB A;  4FYX B;  1YJ9 Q;  2RQW A;  1YN8 A;  2YUO A;  3CMA Q;  1YJ9 T;  1VQP T;  2CP5 A;  4E7K A;  3CMA T;  3VU3 C;  4BE0 A;  1YJN T;  1N6A A;  1UTI A;  1ZSZ C;  1K73 C;  1PKS A;  4PJN A;  3C95 A;  4FU6 A;  3LX7 A;  3G6E T;  4CC7 A;  4HT8 A;  4IKF A;  3CPF A;  2DRM A;  3CME A;  1AEY A;  5EG2 A;  3V7S A;  1TG0 A;  3JCM h;  2EKH A;  2KK4 A;  1AHJ B;  1UGS B;  1GCP A;  2AZV A;  1MND A;  3CCJ T;  3QHS A;  3FEO A;  3C0C A;  1SSH A;  1U5S A;  2Z0W A;  4AMC A;  4IUU A;  1RAF B;  3QDF A;  1PHT A;  2PQW A;  3VS7 A;  5LL6 S;  4C5H A;  2FG0 A;  2FO0 A;  2M0O A;  1N8R C;  1KQ1 A;  2LX9 A;  4ZTF A;  3EAE A;  2CP6 A;  2Y90 A;  3VYG A;  1KQS P;  2LCS A;  4FT2 A;  3UA6 A;  1FMK A;  4PJO D;  2JM8 A;  3DLL A;  2LQN A;  5IXB A;  2EGA A;  4M7D F;  4LDU A;  2DE0 X;  3RKX A;  1VQ8 Q;  1QWE A;  4C92 G;  1RL2 A;  1BIA A;  3RES A;  1SRL A;  5GAN h;  2JXB A;  3E2U A;  1VQO A;  2EBP A;  3MCA B;  4RTU A;  5EC7 A;  4R56 A;  1U1S A;  4M75 F;  4E7L A;  1N8R U;  3VJP A;  4M7D C;  1GFD A;  4OMO A;  2Y4X A;  2BE7 D;  4LDW A;  3G71 Q;  2MWO A;  1NG2 A;  2XI9 A;  5GAN 2;  2RA2 A;  4HT9 A;  3HRT A;  3G71 T;  2KRM A;  2V8J A;  5GJV B;  2RPN A;  2DA9 A;  5KYN A;  1SPK A;  1PWT A;  4KUL A;  1MNE A;  3V8J A;  2MPX C;  3FDR A;  1WFW A;  2YDL A;  4BDY A;  1I4K 1;  4JJC A;  4M75 C;  2EQM A;  4M78 B;  2KE9 A;  4F7U F;  3M57 A;  2O88 A;  4LUE A;  2O9V A;  1M2V A;  1I5L A;  2D6F A;  5L8R E;  2XD0 A;  4J6W A;  1VQM T;  3C12 A;  2HZY A;  1R0C B;  3ZBD A;  5GAN d;  4PFZ A;  1VQ5 Q;  2KXC A;  5KYX B;  2RN8 A;  4OML A;  3UWN A;  2PVD B;  1DJ7 B;  2CT4 A;  1S1N A;  1M1K C;  3CEY A;  1MGQ A;  4XK8 E;  1KHI A;  2ROL A;  3KFV A;  1ZQ1 A;  2K5L A;  2E10 A;  2E65 A;  4A4H A;  3BW1 A;  4HCC A;  2LX7 A;  3MO8 A;  3FRN A;  4J7F A;  3VS3 A;  5FU6 C;  5LJ3 d;  1H8K A;  3PE0 A;  3JAM E;  5LJ5 j;  1AZG B;  2CDT A;  1LPL A;  5GMK h;  1AWJ A;  1UGQ B;  3H41 A;  2K3X A;  2MAM A;  2HL3 A;  2AK5 A;  5GAO n;  1M8M A;  2K4Y A;  1M1K U;  2DX1 A;  1Y71 A;  1X75 C;  4KUD K;  5LJ5 e;  2WSF E;  2ZPE B;  3P8D A;  4E47 A;  4FYV B;  3OYE A;  2KYB A;  1QVF A;  1Q95 G;  2CZ7 B;  4FW2 A;  1W4S A;  2KDS A;  4C92 B;  3MEU A;  3OB9 A;  1QVP A;  4M7D E;  1NEB A;  5D7U A;  3X28 B;  3QYG B;  1BI0 A;  2DRK A;  5GAN 3;  3PMT A;  1H92 A;  3T9N A;  2DNU A;  4C8Q F;  2YUP A;  1I5O B;  3QWY A;  1ZHI A;  3PIP A;  1WIE A;  2F5T X;  4M75 E;  1D3B A;  3REA B;  2BUD A;  2OTJ A;  3OW2 S;  3P8B B;  5CKH A;  3G1J A;  4ANJ A;  4C8Q C;  1WI7 A;  2CH4 W;  4C5G A;  1NLO C;  1C1A A;  2G6F X;  3CC4 Q;  3A8M B;  4MDW A;  2VC8 A;  4F7U E;  3CC4 T;  4EDU A;  1V1C A;  4NS5 A;  1VQ4 A;  3QWX X;  2SEM A;  3MHX A;  3CXC S;  2EYY A;  2KY9 A;  3FLG A;  4KGV B;  1YI2 Q;  1BI2 A;  4ELZ C;  1AVZ C;  1D1B A;  5M9O A;  3IQL A;  4PJJ A;  4JRQ A;  3L2W A;  2O9S A;  1QVG S;  2MYS A;  2CSI A;  3JB9 G;  2X3X D;  2RM4 A;  4II1 A;  3HTR A;  1KC8 C;  2M9U A;  4QQD A;  3QDR B;  2FEI A;  4M77 A;  1MUZ A;  3OYA A;  3H0H A;  3JCM c;  2BZ8 A;  3GP8 A;  4X9D A;  4PLI A;  1WZO A;  3D7S B;  1N9R A;  1WXT A;  4E6R A;  4A53 A;  1GCQ C;  2QQA A;  4L59 A;  4JLI A;  4C92 F;  1NM7 A;  2L3Q A;  2HQX A;  3JCM b;  2LVM A;  4M78 D;  1SSF A;  3THK A;  1KC8 U;  3I56 Q;  1VQL Q;  1YCS B;  1Q81 C;  1OYX A;  1KQS A;  3I56 T;  4RTW A;  1VQL T;  3M0T A;  3CPW P;  1BKB A;  2CSQ A;  3BFM A;  3VS5 A;  2KBT A;  2OJ2 A;  4RCC A;  4C92 C;  2HAX A;  4C8Q E;  1TUD A;  1I81 A;  3AHU A;  2PNI A;  2DET A;  1PSE A;  1X2Q A;  2H8H A;  4MML A;  1Q82 R;  4BY6 C;  3J81 E;  2CP2 A;  4PFO A;  1JB0 E;  1OZ2 A;  5KYY A;  3VS6 A;  1Q81 U;  1QP3 A;  4CC3 A;  3NFC A;  2NWM A;  5D6Y A;  4XU2 A;  2X4J A;  5KCH A;  2CZ6 B;  2YLB A;  1AT1 B;  3QO3 A;  1LOJ A;  1NPP A;  1R77 A;  3X24 B;  4M7A A;  1WHG A;  1WYX A;  4AFS C;  4DBR A;  2YUN A;  3BDU A;  5KYW A;  1J3T A;  5KYU A;  1BB9 A;  4D6W A;  4KH1 B;  1TSF A;  5KE2 A;  1OU9 A;  1Q86 R;  1GRI A;  4A4E A;  1BYM A;  4FSS A;  1T0J A;  2DYI A;  2CUB A;  3KUF A;  2GF7 A;  3OYC A;  1X69 A;  2GCX A;  3J7A F;  1XNI A;  1K9A A;  3VS4 A;  2JTE A;  4XU3 A;  4AT1 B;  1YIT Q;  2ZZD A;  1VQ9 Q;  1YIT T;  3V8K A;  1RLQ C;  2H3E B;  1IHV A;  1VQ9 T;  4N0A A;  2XKO C;  4KRT A;  1VQ6 Q;  3OS1 A;  1I1J A;  5I2S A;  2EFI A;  2C0T A;  1VQ6 T;  4ZN3 A;  4QVC A;  1EFN A;  3CD6 T;  4EMK C;  2DIQ A;  4C92 E;  2O2O A;  1BIB A;  1YHQ Q;  1VQP A;  1YJ9 A;  4A4F A;  2DEQ A;  2PTK A;  2KNB B;  2DL3 A;  2ZGW A;  4BAC A;  1YJN A;  2CUD A;  2L5Q A;  4OF1 A;  3OYB A;  2DFU A;  3MP8 A;  4KGX B;  2VWF A;  3G6E A;  3GPL A;  9ATC B;  3HFO A;  4FIB A;  3CCL A;  2VYT A;  5GAN g;  2Y4Y A;  1VA7 A;  2DTI A;  1UJY A;  4PJO B;  3DB3 A;  1YIJ T;  2EYZ A;  3CCJ A;  2VGM A;  4PJL A;  2GQV A;  3L1A A;  4OMF B;  3QKJ A;  1PNJ A;  4ZNX A;  3FJ5 A;  3RNJ A;  1QKW A;  1G2B A;  1I0C A;  2FVU A;  3CC7 Q;  1MMG A;  1BI3 A;  4FT4 A;  5IH2 A;  5LJ3 g;  2HEQ A;  3OS2 A;  1YBY A;  2F1L A;  2JJ9 A;  1YJW Q;  2RJD A;  1V76 A;  5GAO l;  2O01 E;  1VQK Q;  2OI3 A;  4K11 A;  3H9N A;  2MI6 A;  3CCM Q;  1JXM A;  2EQU A;  2F5K A;  3JB9 F;  1VQK T;  3CCM T;  4QVD A;  5CO7 A;  4AG2 C;  1WPY A;  4IIO A;  2DLP A;  1D1C A;  2F2V A;  1KD1 U;  1H3Z A;  5GAN 6;  3CCV Q;  1WX6 A;  3G4S Q;  2RHZ A;  2J6O A;  1ABQ A;  3OYD A;  2PZ1 A;  3G4S T;  2DK3 A;  5AYF A;  2XDB A;  1MHN A;  1O75 A;  2KMT A;  1QVF P;  3QBY A;  4RTT A;  2E70 A;  5GAN 8;  3CCQ A;  1XQH A;  3JCM V;  3L2Q A;  3G71 A;  3EFS A;  1ABO A;  2QAS A;  2DPP B;  4PNO A;  3OYG A;  2HQE A;  1OQK A;  2LQK A;  3FB9 A;  3QG1 A;  1VQN A;  3MEA A;  1D0X A;  3HPW A;  2EJG A;  2FYK A;  4J7I A;  3OBW A;  2QK0 A;  5GAO q;  3E9F A;  5CIU A;  1U3O A;  2ZCF B;  3EH2 A;  1OUL A;  3H8Z A;  1VQM A;  3M4G A;  2EIF A;  1W2B P;  2KQW A;  3QII A;  1IRE B;  3CCE T;  3OYN A;  4Z88 A;  1AWX A;  3MP6 A;  2FZG B;  2CH4 A;  2PUO B;  1AWW A;  1ZSZ A;  2DL7 A;  2F2X A;  1UDL A;  3QJY A;  3CPW A;  3RER A;  4PL6 A;  3M59 A;  4EIK A;  4J9E A;  1K4U S;  1HD3 A;  2W0Z A;  3EHR A;  3NMZ C;  5IHI A;  4M78 G;  5CKD A;  5HK3 A;  3JCM f;  2A7Y A;  4HCZ A;  1A0N B;  5LJ5 d;  4Y91 A;  1UEC A;  1PCX A;  2E12 A;  4DQ2 A;  4PJO C;  5DM7 R;  4XQ3 A;  3DLM A;  2KR3 A;  2MF2 A;  4ZGJ B;  1KJW A;  3PFS A;  4WF2 A;  3GNG A;  1RAD B;  2GBQ A;  3PNW C;  4N4G A;  4J8O A;  3OA6 A;  2EJ9 A;  1UUE A;  4OMP A;  1IRX A;  3OYL A;  2VVK A;  3OSS C;  2EAY A;  2E5K A;  3ZEH A;  4IUV A;  3HRS A;  1U06 A;  1X43 A;  1AWO A;  2L8D A;  1S72 A;  1KQS S;  2JVV A;  1QP2 A;  1UJ0 A;  1IXD A;  2KRN A;  2FRY A;  1G3T A;  2RK1 A;  1K73 U;  1M90 R;  3RUX A;  1SKU B;  1X6B A;  5GAN f;  2QA4 Q;  5I21 A;  2NUP A;  3CC2 A;  2H3J A;  2IPO B;  2YRD A;  1H3H A;  1IB8 A;  2QA4 T;  1M1G A;  4JUV A;  1BBZ A;  2KRO A;  3PT9 A;  4Z8A A;  4M7D A;  4JS4 A;  5FRN A;  5GAM h;  2YSQ A;  3VRY A;  2RJF A;  1PKT A;  1RI0 A;  3CC4 A;  3L2V A;  2QYZ A;  2NUZ A;  1VQ8 T;  2DBK A;  2DAQ A;  1FYN A;  4XTY A;  3HHT B;  2X9H A;  3E19 A;  1OI1 A;  4M75 A;  3L42 A;  4LDY A;  7AT1 B;  4XU0 A;  3M53 A;  5GMK i;  1ZA2 B;  4NL3 A;  2KVQ G;  2DYB A;  2MWP A;  2XDP A;  2DER A;  3EGU A;  1N27 A;  4C0D B;  2A08 A;  2QEX Q;  3EGD A;  1HJD A;  1M3B A;  4HKE A;  4F7U A;  2XIC A;  4RTY A;  3TSZ A;  2QEX T;  5LJ3 h;  3JCM Q;  5GAM d;  3E9G A;  1NEG A;  1IZ6 A;  1Q82 C;  2CRE A;  2ENM A;  1JQQ A;  2K2V A;  4B9X A;  2EPD A;  1PRL C;  2CZ0 B;  2E41 A;  3EG0 A;  4RTX A;  4XTZ A;  1FWZ A;  1K0X A;  4LXC A;  2VGN A;  2JN0 A;  1VQ5 T;  2OAU A;  3DKM A;  1VYU A;  4FL6 A;  5I11 A;  4J9B A;  1M27 C;  3EG1 A;  2COY A;  2M1H A;  3R6N A;  4GLM A;  2LJ0 A;  4KUI A;  2RQT A;  1UB4 A;  1UGR B;  3S6W A;  1CKB A;  4JRP A;  3CBP A;  2HL5 C;  1SRM A;  2OTL Q;  5GMK l;  2JMC A;  5GAO p;  3NTI A;  1IHW A;  3I56 A;  1VQL A;  1Q82 U;  1VOM A;  2M0Y A;  2LT1 A;  1TOV A;  1QWF A;  3I5R A;  2RHX A;  1ZUK A;  1JBM A;  4GY5 A;  2P0P A;  1Q86 C;  3FIF A;  4ZGD B;  2DBM A;  2E1H A;  1MMD A;  3QJ6 A;  1Y0M A;  2QQR A;  1KFZ A;  1RAI B;  2GFA A;  4BDZ A;  2XU8 A;  4A4K A;  1BK2 A;  4HA8 A;  1E7O A;  1BCM A;  4NL2 A;  5J3B A;  4OMM A;  2LRQ A;  1M9S A;  1GBQ A;  4WCI A;  4C8Q A;  4Y28 E;  1JJ2 P;  3M0S A;  3CME Q;  1Q86 U;  5CAI A;  5C0M A;  1LCK A;  3O5Z A;  1NE8 A;  3CME T;  4LDX A;  1N5Z A;  3F70 A;  2YUQ A;  3M54 A;  4E7J A;  2DEU A; 
#chains in the Genus database with same CATH homology
 1Q7Y C;  2CYZ B;  2CZ6 B;  4J6Y A;  5KCH A;  4BE1 A;  4PKC C;  4UC4 A;  1WQ7 A;  2YHT A;  2X4X A;  2YLB A;  4M77 G;  1W2B A;  3M4Y A;  3NTH A;  1LOJ A;  3QO3 A;  3LWH A;  1NPP A;  5LJ3 f;  5GAN 5;  4MMK A;  1U8R A;  3ME9 A;  3X24 B;  1K9M C;  2ZPI B;  4M78 F;  4JS5 A;  3OS5 A;  5A0G A;  4M7A A;  2DTH A;  4RMO A;  3TRE A;  2QEX A;  2LT4 A;  4IUR A;  4LD6 A;  3QYH B;  3LH0 A;  3OYI A;  3BDU A;  3CXC A;  3JCM d;  4C0D C;  2DD4 A;  4J6X A;  1YI2 A;  3SDZ A;  3JRZ A;  3N5B B;  4C5E A;  3L2U A;  3E1S A;  2P0K A;  3A5Z B;  4D6W A;  3CC2 A;  2ZPH B;  3NTK A;  3A8G B;  3R6O A;  2RI2 A;  4CI0 C;  3OYY A;  3UDC A;  4M78 C;  5KE2 A;  4E7I A;  2RJC A;  4PJO E;  1YIT A;  2IG0 A;  2E6N A;  2P0Q A;  2RH2 A;  4A4E A;  1BYM A;  2LCC A;  4Z02 A;  3X20 B;  2XG8 D;  3KUF A;  1Q7Y U;  4FSX A;  4C0Z A;  2GF7 A;  5GAO m;  1QVG A;  4C8Q B;  3OYC A;  1YI2 T;  4E7H A;  5FRM A;  2R5A A;  3LWI A;  2GCX A;  3J7A F;  2RJE A;  5GAO r;  3LW5 E;  4MDX A;  1XNI A;  4IUP A;  4Q5W A;  3LYI A;  3TU4 K;  3CCQ T;  4XU3 A;  1K9M U;  1VQ6 A;  2HBP A;  2ZZD A;  1X6O A;  1K8A C;  3CD6 A;  2HD0 A;  2YLC A;  1WJQ A;  2KSS A;  4XAX B;  1YIT T;  3V8K A;  1N9S A;  1I8F A;  3GLX A;  2AHJ B;  1WNL A;  4CRI A;  1B34 A;  1D3B B;  1VQ9 T;  4N0A A;  2X35 A;  1KHC A;  2XKO C;  2CS7 A;  1VQN T;  1BI1 A;  2RB6 A;  4QQ6 A;  1M4Z A;  3JCM e;  3RMQ A;  4EPC A;  5CVI A;  3OS1 A;  2OTL A;  5I2S A;  1Y96 A;  3GF5 A;  2EFI A;  4C8Q G;  1VQ6 T;  2LTO A;  5FRO A;  4ZN3 A;  5KE3 A;  4QVC A;  5HKC A;  4V2S A;  4A4G A;  4B9W A;  4EMK C;  3CD6 T;  2DIQ A;  4C92 E;  1PSF A;  1BIB A;  4N4I A;  1VQP A;  4A4F A;  1YJ9 A;  1VQ7 A;  4ELY C;  2DEQ A;  5GAN 7;  3ER0 A;  2DKG A;  2RD1 A;  2ZGW A;  4BAC A;  3VYH B;  1YJN A;  5FLX E;  4J5Y A;  2L5Q A;  4OF1 A;  2XK0 A;  2OTL T;  1G3Y A;  5HY6 A;  4C92 A;  3OYB A;  4BE2 A;  3JB9 D;  1WJS A;  3MP8 A;  3RKW A;  2DVE A;  2QXF A;  3OMG A;  2L89 A;  3CPW S;  1K8A U;  3M9Q A;  1YIJ A;  1OZ3 A;  3GIB A;  4QQG A;  1VIF A;  2LCL A;  3G6E A;  3GPL A;  4OB1 B;  2M16 A;  3WXM B;  3HFO A;  5A2Q E;  3JB9 J;  1HK9 A;  3OSV A;  1YJ9 T;  1VQP T;  4FIB A;  1VQ7 T;  3VUB A;  4E7K A;  4M7A G;  4ZTJ A;  3CMA T;  1QW1 A;  3VU3 C;  4BE0 A;  1YJN T;  1N6A A;  2XHC A;  3CCU A;  3CCL A;  2VYT A;  1K73 C;  5GAN g;  2Y4Y A;  2DTI A;  2R58 A;  4M7D D;  4PJO B;  3C95 A;  3DB3 A;  3S3N A;  4FU6 A;  3MP1 A;  1YIJ T;  2D0Q B;  2A3L A;  5GAN 4;  3CCJ A;  2VGM A;  4JDS A;  2R5M A;  3LX7 A;  3A8H B;  4IUQ A;  3G6E T;  1JJ2 S;  2DXB A;  4HT8 A;  1JRI A;  4IKF A;  4ZN1 A;  2GQV A;  3CPF A;  3M56 A;  1R8O B;  4EMH A;  3CME A;  5EG2 A;  5GAN e;  5J39 A;  3V7S A;  2E6Z A;  3L1A A;  4KT0 E;  3H6Z A;  4OMF B;  3JCM h;  4DOW A;  5LJ5 g;  4BUG A;  3CCU T;  1NJI C;  1FXX A;  2KK4 A;  1AHJ B;  3QKJ A;  1UGS B;  1Y96 B;  4M75 D;  4M77 B;  4X9C A;  2DIG A;  4A54 A;  3LLR A;  2FVU A;  1VQK A;  3BY7 A;  3MET A;  3CCM A;  3CCJ T;  3QHS A;  4PJO G;  1BI3 A;  4FT4 A;  3JCM W;  3FEO A;  3LGL A;  5LJ3 g;  4BI4 A;  4C0F A;  3OS2 A;  1YBY A;  3QSU A;  3OQ5 A;  1Y7X A;  3BDL A;  4M78 E;  3L2R A;  1M8V A;  4X34 A;  2DO3 A;  2RJD A;  5GAO l;  4IUU A;  2PQW A;  2O01 E;  5LL6 S;  4C5H A;  3G4S A;  2MI6 A;  3X26 B;  2EQU A;  2VUB A;  2F5K A;  3JB9 F;  2M0O A;  1VQK T;  3JCM J;  1N8R C;  2R57 A;  1KQ1 A;  1VUB A;  4M78 A;  4OP0 A;  3WVD B;  3INZ A;  3J80 E;  2LX9 A;  4QVD A;  3CCM T;  3EAE A;  4ZTF A;  2Y90 A;  3C94 A;  5CKE A;  2DD5 A;  4QW2 A;  2DZC A;  5CO7 A;  1WPY A;  3VYG A;  2XDD A;  4XTW A;  1S72 T;  1KD1 U;  1H3Z A;  4FT2 A;  5CK9 A;  5GAN 6;  3DB4 A;  2RHZ A;  4PJO D;  1NJI U;  5CCA A;  3OYD A;  2FL7 A;  4DA4 A;  2QTX A;  4MZM A;  4BY6 B;  5KH6 A;  5CR2 A;  3DLL A;  1VIE A;  1XOV A;  4ZGE B;  3G4S T;  3PGG A;  2LQ8 A;  2DK3 A;  5AYF A;  3URG A;  4LDU A;  4M7D F;  2XDB A;  1MHN A;  1O75 A;  2KMT A;  5D6X A;  1LJO A;  3QBY A;  3RKX A;  4BD3 A;  2C06 A;  3M5A A;  4C92 G;  3CC2 T;  3ZFJ A;  2E70 A;  3OY9 A;  1RL2 A;  5CQX A;  3PTA A;  1BIA A;  5A0L A;  5GAN 8;  3CCQ A;  1XQH A;  3RES A;  3JCM V;  3L2Q A;  3G71 A;  2PUK B;  3EFS A;  2G3R A;  3JSC A;  4IUT A;  5GAN h;  2EQK A;  4BI3 A;  2EJF A;  2B8A A;  2DXT A;  3VV0 A;  2DPP B;  1O9S A;  3FJP A;  4M77 D;  4PNO A;  3X25 B;  3OYG A;  2HQE A;  1VQO A;  4O6J A;  3MCA B;  2LQK A;  3FB9 A;  5GMK j;  3QG1 A;  1VQ9 A;  1KQ2 A;  4R56 A;  1VQN A;  1U1S A;  4M75 F;  4E7L A;  1N8R U;  3V7R A;  3VJP A;  4M7D C;  3MEA A;  4J83 A;  2VV5 A;  3CCE A;  2Y4X A;  3HPW A;  4LDW A;  4EMK A;  1H64 1;  2MWO A;  2PVO B;  3OYJ A;  2XI9 A;  2EJG A;  2FYK A;  4J7I A;  5HK0 A;  5GAN 2;  2RA2 A;  4HT9 A;  3OBW A;  3HRT A;  3E9F A;  5GAO q;  5CIU A;  3G71 T;  2V8J A;  2ZCF B;  3MEW A;  3SWN B;  3QXE B;  2QQ9 A;  3H8Z A;  1VQO T;  4KUL A;  1VQM A;  3M4G A;  5A0D A;  1M90 C;  3V8J A;  5I2M A;  5J26 A;  2EIF A;  3FDR A;  2KQW A;  3QII A;  4EMG A;  5GMK e;  2D9T A;  4LDV A;  4BDY A;  1I4K 1;  2K57 A;  3L2Z A;  4M75 C;  1YHQ A;  1IRE B;  4BI8 B;  3CCE T;  2EQM A;  1G3S A;  4M78 B;  4F7U F;  5DLO A;  3OYN A;  4R55 A;  3M57 A;  1G3W A;  2DJZ A;  2DXC A;  2PVG B;  2X4W A;  3MP6 A;  3CCR A;  1I5L A;  3C4S A;  2F69 A;  2GFU A;  2D6F A;  2PUO B;  4M7A B;  3RKY A;  5L8R E;  2XD0 A;  4J6W A;  4LD9 K;  2JNG A;  3V8L A;  3JCM P;  1VQM T;  3C12 A;  3QJY A;  3ZBD A;  5GAN d;  3CPW A;  4PL6 A;  3RER A;  2MMP A;  3M59 A;  3CMA A;  3OBY A;  3QZ5 B;  4JRK A;  2VXE A;  4JLG A;  1YHQ T;  3FC3 A;  3UWN A;  3A8O B;  5GAM j;  3S3M A;  2PVD B;  2E64 A;  2CZ1 B;  1DJ7 B;  3KXT A;  3LGF A;  3SB2 A;  3TEE A;  3KBG A;  5GAM g;  1M1K C;  2NLU A;  3CEY A;  4M78 G;  5CKD A;  3JCM f;  5HK3 A;  2A7Y A;  1MGQ A;  2IVW A;  4HCZ A;  4XK8 E;  3CCR T;  5LJ5 d;  1KHI A;  3V7C A;  1M90 U;  4Y91 A;  4M77 F;  2E12 A;  1LNX A;  4C8Q D;  4RG2 A;  4DQ2 A;  5DM7 R;  4PJO C;  5DY9 A;  4XQ3 A;  5GAN j;  3G7Z A;  1ZQ1 A;  2BKD N;  2K5L A;  2E10 A;  2E65 A;  3DLM A;  3BW1 A;  4A4H A;  1JJ2 A;  2DXU A;  2O4X A;  2MF2 A;  4HCC A;  4ZGJ B;  5GAM e;  2QI2 A;  4EMK B;  3PFS A;  3MO8 A;  3FRN A;  4J7F A;  5FU6 C;  4WF2 A;  3GNG A;  2E5Q A;  4XTV A;  5LJ3 d;  3PNW C;  2K5F A;  4OGC A;  4N4G A;  3JAM E;  1V29 B;  4J8O A;  3OA6 A;  3QPH A;  2EJ9 A;  5LJ5 j;  3CC7 A;  4M77 C;  5GMK h;  2JOY A;  4OB0 B;  1B34 B;  4C0G A;  1UGQ B;  2K3X A;  3EFR A;  3OYL A;  2MAM A;  5GAO n;  1YJW A;  3OSS C;  2RHU A;  1G5V A;  2EAY A;  2K4Y A;  3ZEH A;  4IUV A;  1M1K U;  2ZPG B;  3HRS A;  2QQS A;  4DOV A;  2LNV A;  5LJ3 j;  4M7A D;  4GLK A;  3I55 A;  1Y71 A;  2L8D A;  1X75 C;  2QA4 A;  3RMS A;  4ATO A;  1WJR A;  4KUD K;  2VXF A;  3CC7 T;  2JZ2 A;  4OVA A;  5LJ5 e;  1S72 A;  2WSF E;  5IN1 A;  2ZPE B;  3P8D A;  4E47 A;  3OYE A;  1KQS S;  2JVV A;  1QP2 A;  1UEB A;  1QVF A;  1G3T A;  2RK1 A;  1K73 U;  5KCO A;  3PIO A;  1HXD A;  2CZ7 B;  5DLQ E;  1W4S A;  3CCV A;  4FM4 B;  3RUX A;  2KDS A;  4C92 B;  5IT9 E;  3MEU A;  4RG8 A;  2P4T A;  3OB9 A;  1YJW T;  1QVP A;  5GAN f;  5I21 A;  4M7D E;  2CKK A;  2RK2 A;  3X28 B;  2RHI A;  3QUI A;  3QYG B;  1BI0 A;  1WGS A;  2H3J A;  5LJ3 e;  5GAN 3;  3QZ9 B;  3PMT A;  5GMK m;  3I55 T;  1QVF S;  2JTM A;  3GNF B;  3T9N A;  2QA4 T;  4O5V A;  1M1G A;  4JUV A;  1VQ8 A;  2PU9 B;  4KBM B;  1FX7 A;  4C8Q F;  4NOY A;  3PT9 A;  1X01 A;  4M7D A;  4JS4 A;  2EWN A;  5FRN A;  5GAM h;  2O4X B;  5C6S A;  2I2L A;  1ZHI A;  3CCV T;  1TH7 A;  3PIP A;  1M5Q 1;  3SFM A;  2F5T X;  4M75 E;  1M1F A;  2FB7 A;  1D3B A;  2RJF A;  4MZP A;  2EKO A;  3VUZ A;  1RI0 A;  1NZ9 A;  2DZ9 A;  5CKB A;  2BUD A;  3O8V A;  3OYH A;  3P8B B;  3L2V A;  3OW2 S;  3CC4 A;  2JTF A;  2OTJ A;  5CKH A;  3SD4 A;  1VQ8 T;  2DAQ A;  4XTY A;  3HHT B;  4OGE A;  4C8Q C;  3M58 A;  3ASK A;  3E19 A;  1OI1 A;  5FU7 B;  4M75 A;  4XU1 A;  4C5G A;  3L42 A;  4LDY A;  4XU0 A;  2RHY A;  2L3R A;  2YRV A;  2DTO A;  3A8M B;  3M53 A;  1W2B S;  4MDW A;  1P92 A;  5GMK i;  4M7A F;  3SWN C;  2VC8 A;  4F7U E;  2LC4 A;  4NL3 A;  1GXI E;  2KVQ G;  2K5I A;  3CC4 T;  4EDU A;  2OTJ T;  4PLL A;  5LJ5 h;  2MWP A;  2XDP A;  2CGH A;  1N27 A;  4JRI A;  4NS5 A;  1VQ4 A;  2K3Y A;  4C92 D;  4C0D B;  3MHX A;  3CXC S;  2KY9 A;  4HKE A;  4F7U A;  2XIC A;  3FLG A;  5D6W A;  1BI2 A;  5CQY A;  2QEX T;  3OYF A;  5LJ3 h;  3JCM Q;  5GAM d;  1VQ5 A;  5IAY A;  3E9G A;  4ELZ C;  4M7A C;  4RCB A;  3OYK A;  4OB3 B;  4JJN K;  3A8L B;  1IZ6 A;  3PMI A;  4YTL A;  1Q82 C;  4PJO A;  1VQ4 T;  3JCM g;  5M9O A;  2K2V A;  4OB2 B;  4B9X A;  1YCY A;  4JRQ A;  3L2W A;  4M7D B;  1NPR A;  2CZ0 B;  2WAC A;  2E41 A;  3UT1 A;  1QVG S;  4PJO F;  4M77 E;  4XTZ A;  3CBM A;  1FWZ A;  3Q1J A;  3OS0 A;  3OMC A;  3JB9 G;  2RM4 A;  4II1 A;  1KC8 C;  2M9U A;  2JN0 A;  2VGN A;  3MEV A;  1VQ5 T;  2OAU A;  3DKM A;  3JCM X;  4QQD A;  3QDR B;  4FL6 A;  3M55 A;  3RIR A;  4M77 A;  3JB9 I;  2M1H A;  4ME7 A;  2ZPB B;  3HFN A;  3UPU A;  4TVR A;  4KUI A;  3OYA A;  1UB4 A;  1UGR B;  4M75 B;  3HKS A;  3S6W A;  4XTU A;  2RI3 A;  4JRP A;  3JCM c;  3CBP A;  4M7D G;  2LDM A;  3GP8 A;  1Y07 A;  4X9D A;  4PLI A;  5GMK l;  3HRU A;  5GAO p;  3NTI A;  3VKI A;  4L6V 5;  1N9R A;  3I56 A;  1VQL A;  2WSE E;  1Q82 U;  1XTD A;  4N0A C;  2EQJ A;  2LT1 A;  4A53 A;  3GOX A;  1U1T A;  3OYM A;  2QQA A;  4L59 A;  4JLI A;  1ZBX A;  2RHX A;  3WVE B;  4C92 F;  2HQX A;  2ZPF B;  3JCM b;  2LVM A;  4F7U B;  1JBM A;  4GY5 A;  2P0P A;  2EYQ A;  4P5N A;  3FIF A;  4M78 D;  1UGP B;  1SSF A;  4M75 G;  1Q86 C;  1KC8 U;  4ZGD B;  2RO0 A;  2E1H A;  3CBO A;  1Q81 C;  3QJ6 A;  4XTX A;  1OYX A;  2QQR A;  2WSC E;  1KQS A;  1KG1 A;  2GFA A;  3I56 T;  1VQL T;  2XID A;  1WQW A;  1EIF A;  1BKB A;  5GAM f;  2JUF A;  3CCS A;  2X4Y A;  3BFM A;  2V8I A;  4BDZ A;  2XU8 A;  4A4K A;  4QVZ A;  4RCC A;  4C92 C;  2HAX A;  4HA8 A;  4C8Q E;  3HL8 A;  5FU6 B;  2FHD A;  4HCB A;  2BIV A;  2V8K A;  1I81 A;  4NL2 A;  3TCJ A;  1KD1 C;  4F7U G;  3AHU A;  5J3B A;  3CCL T;  1PSE A;  4N4H A;  4VUB A;  4C5I A;  2LRQ A;  3HSB A;  1M9S A;  4C8Q A;  2QDY B;  3CCS T;  4Y28 E;  3JB9 H;  4MML A;  4BY6 C;  2RI5 A;  3J81 E;  4MZT A;  1Q86 U;  5CAI A;  5C0M A;  5CKF A;  4L5G A;  1JB0 E;  1OZ2 A;  3OW2 A;  1NE8 A;  2HNI A;  2QQB A;  3CME T;  1Q81 U;  4LDX A;  3SWN A;  3F70 A;  5LJ5 f;  1QP3 A;  3NFC A;  3M54 A;  2KAF A;  4RKU E;  4E7J A;  5D6Y A;  4BB7 A;  3P8H A;  4XU2 A;  3S3O A;  2X4J A;  3HP9 A;  4M7A E;  5FU7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...