5GAN4

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
90
structure length
74
Chain Sequence
MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSVKLNEIYIRGTFIKFIKLQDNIIDKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords U4 snRNA
total genus 10
structure length 74
sequence length 90
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan400
2EJGA 5GAN4 1LOJA 3SWNB 2RB6A 3L1AA 2K57A 4M77C 1I81A 4M7AB 4M75A 4F7UA 4NL2A 4C8QD 2FB7A 1M5Q1 4PJOD 2RM4A 2YHTA 4M7AF 1JRIA 2QTXA 4M7DF 4PJOE 3V7RA 2EJFA 3JCMV 4HA8A 3BY7A 1JBMA 2E1HA 2RA2A 5LJ3e 4M75B 5LJ3g 1KQ1A 2ZGWA 4XTXA 3V8KA 4M7DB 1WPYA 4C92G 1LNXA 2YLCA 4PJOB 3RIRA 3RERA 1BIBA 3JB9G 1N9SA 1N9RA 4M75F 3AHUA 4J6WA 5GAOn 5GANj 3JCMJ 1HK9A 4C8QC 3QSUA 1TH7A 5CAIA 4J6YA 4NOYA 4F7UG 5GAN2 5LJ5j 4C8QG 2EWNA 5GANf 3M4GA 3JCMQ 3JB9J 4M7DC 4M77E 4M77A 4C92E 4C92A 3V7CA 4HT8A 2VC8A 5GAN6 2I2LA 5GAMd 5GAN3 1H641 2DVEA 4X9CA 5GMKe 5GANh 4XU1A 5GAOp 3HFOA 3FB9A 4PNOA 4WF2A 1I8FA 5GMKl 2RD1A 5LJ5d 2E41A 4M78F 4RCBA 4A54A 5LJ3j 2Y90A 4EMGA 4XTVA 4C8QB 1U1TA 5LJ5h 3SWNC 4M78B 2VXEA 3QHSA 4M77F 1Y96B 3JCMd 5GAOl 2DTHA 3V8LA 3INZA 3L2ZA 4C8QF 2E65A 1WQWA 3V7SA 4M78D 5GAMh 2EAYA 5GANe 5GANg 4M77B 3BW1A 2VXFA 3EFSA 3JCMh 5GAMf 2JN0A 5GANd 1KQ2A 4M7AD 4M7DD 1D3BB 1WNLA 4J6XA 2E64A 3HFNA 4EMKB 4M7DG 4V2SA 2DJZA 4M7AG 3JCMf 5GMKi 4XTWA 4M78G 3RKXA 4NL3A 3HSBA 4N0AA 5GAN8 4JLIA 4M75C 1HXDA 1D3BA 4F7UE 4M7DE 4N0AC 1MGQA 5GAN7 5GAOm 3JCMX 2DZ9A 3VU3C 1I4K1 2CGHA 2DZCA 4XU0A 4XU3A 4Y91A 3JB9H 3JCMP 2YLBA 3SB2A 4M78C 5GAMe 5GAMg 4M7AC 4M75E 1M8VA 4HT9A 4EMKA 4C92D 5GAN5 3EFRA 3V8JA 2EJ9A 4XU2A 4F7UF 5GMKh 4RCCA 3QO3A 4M78A 1X01A 2E10A 1Y96A 4J5YA 3JCMg 1B34B 1LJOA 3SWNA 4DQ2A 3JCMe 3FJPA 4EMKC 2DTIA 4JRIA 2FYKA 4F7UB 4M75G 4M75D 4PJOG 4X9DA 4C92B 3PGGA 1BIAA 3RUXA 5LJ5g 5LJ5e 1U1SA 4MMLA 4JRKA 3BFMA 1B34A 1I5LA 4C92F 4QVCA 4A53A 2DTOA 4M77D 1WQ7A 3RKYA 4M7DA 3BDUA 4XTUA 5GMKj 3JB9D 4XTYA 3GIBA 4M7AA 4C92C 4M78E 5GAOq 3RESA 5LJ3d 4PJOC 2DKGA 3QUIA 3RKWA 2DXUA 5DY9A 5I21A 3JCMc 3JB9I 2HNIA 4XQ3A 4XTZA 5LJ3h 5GAMj 5LJ3f 3FIFA 4QVDA 4PJOA 5GMKm 2DEQA 4C8QA 4OP0A 4C8QE 4M7AE 2DXTA 4EMHA 4MMKA 4PJOF 5LJ5f 3JCMb 5GAOr 1YCYA 4M77G 3JB9F 4JUVA 3JCMW
chains in the Genus database with same CATH superfamily
2M51A 1IGQA 4KUIA 3OYJA 2LRQA 2FB7A 2CH4W 4M7DF 4ZTFA 3NTHA 4Y28E 3EG9B 1C0MA 3RERA 7AT1B 4ZNXA 5CIUA 1FMVA 4DOWA 2DRKA 5FU6B 2K5IA 1QP3A 3HRTA 1NPRA 1VQ9Q 3CPFA 2EWNA 4II1A 2XDDA 1U06A 2XHCA 5GAN3 5GAMd 3CC4A 5GMKl 4Z02A 4M78F 4OMFB 2D0NA 3RBBB 1YITA 1OEBA 2KAFA 1TU0B 1UG1A 2YSQA 1VQMQ 1LPLA 2VXFA 3EFSA 4AFSC 4J6XA 1VQ8A 2JMAA 3WVDB 2QI2A 4L59A 1XJWB 1ZUYA 3JCMX 1B7TA 4X34A 1VQ6T 5CKBA 3VS4A 1YBYA 2V1QA 1S1NA 3H6ZA 2D8HA 2NUPB 3L2VA 2CREA 2PZ1A 2FYKA 1K1ZA 4LE9A 2RN8A 4M75D 1R8OB 3THKA 1I5LA 2C0TA 1H3ZA 3VJPA 1ZUKA 2FPEA 2FZCB 4KRTA 1K8AR 2VGNA 3X26B 3RKWA 3OS0A 3MEWA 3JCMc 2QGGA 3FIFA 4QQ6A 4J8OA 2QA4A 2KSSA 2DBKA 1YCYA 4M77G 3CCMT 4JUVA 4DBRA 3CC2T 4PJOB 4LD9K 4RMOA 2FG0A 4PJOE 2EJFA 4PJNA 2NLUA 4C92G 4J9FA 3KFVA 3VUZA 3SDZA 2E6ZA 2KRSA 3EHRA 5GAOn 5GANj 1JJ2P 2HL5C 2CP7A 2HAXA 1TH7A 5D6YA 1KD1C 1RLQC 2FEIA 2A08A 1K9MR 4E2FB 1ZA1B 3EFOA 3GP8A 1YITQ 2QQAA 3CD6A 4LXCA 1SKUB 2JZ2A 2DPPB 2ZPFB 2RQRA 3L2ZA 2E65A 1WQWA 1H8KA 5D7UA 5GAMh 5GANe 5GANd 3CCLQ 2JW4A 3CCVA 4B6MA 4V2SA 2J6KA 1VQ6A 4A4EA 2R58A 4OGEA 3H0FA 1BI0A 3I55Q 3X20B 3RR6A 1Q82U 2K2MA 2CGHA 2DZCA 4DOVA 5KE2A 2RK1A 2P4TA 2YLBA 2O01E 4M78C 3HL8A 2GBQA 1SSHA 5KCHA 5GAN5 2HDAA 4JZ4A 4JJCA 1KHCA 3GLXA 1B34B 4ELZC 1QVFA 1J3TA 1BIAA 5LJ5e 4JRKA 2RK2A 2DEUA 2ECZA 4FW1A 3HPWA 2PNIA 2K5FA 3M56A 2DXUA 2F5KA 5DY9A 2DFUA 2HNIA 1WHGA 1UGSB 2I0NA 2H3EB 3A8GB 3OYAA 1YITT 4MMKA 4E7KA 2X51A 2QYZA 3CCLA 1SHFA 4AFUC 3QZ9B 2KE9A 2YRCA 4AG1C 1GBQA 3EGXA 4IURA 1IREB 3OYGA 2VWFA 2LJ1A 2R57A 2K3YA 2DILA 2C0IA 3VS5A 1JO8A 3V8KA 5IXFA 3J80E 5A2QE 3MKDA 2J7IA 4J6WA 2WSFE 2RNAA 3URGA 3CCSQ 1UDLA 3OMCA 2P4RA 2KEAA 2NYSA 4NOYA 1YWPA 2CSIA 5GANf 3VS1A 3BDLA 1I0CA 3PT9A 4CC3A 2V1RA 1MNEA 1OYXA 3WXMB 1GCQC 2RJDA 3CCMQ 3HP9A 1NJIC 2EPDA 1IHVA 3WVEB 3JCMd 2CYZB 1WYXA 4C0ZA 1VQMA 4FYWB 1IB8A 2LX7A 1NE8A 2ZPHB 2DE0X 2EGEA 2RO0A 3HSBA 2GTJA 4MZPA 1K0SA 1YFNA 5GAOm 5GAN7 1UEBA 4J9GA 3SB2A 2QQSA 3DLMA 5GAMe 2SEMA 2HQEA 2VASA 4RCCA 4FL6A 1G3YA 4L5GA 3OYYA 1EX4A 4PJOG 1MUZA 3UPUA 1WJRA 2P0PA 3CXCS 3BFMA 1YHQT 2JJ9A 1YJNA 4C92F 2ZPBB 1C1AA 5D6XA 4PJOC 3QUIA 2D8JA 3OS2A 3A8OB 4B9XA 1NLOC 2M0YA 1M3BA 1PD1A 1D1BA 3H0HA 5GMKm 4PKCC 1Q86C 2DXTA 1PG5B 5GAOr 4KH1B 3S3OA 4J9IA 4GY5A 2RI3A 3MEVA 2K79A 4M7AB 4MZTA 1TUDA 2K57A 4M75A 1CKBA 3L2RA 2K4YA 2YHTA 2ABLA 4Y92A 1JXOA 2DRMA 2KROA 2OTLQ 3VS7A 1A0NB 2MK5A 1M2VA 2KMTA 2M1HA 2KT8A 3LH0A 4A4GA 2FO0A 2ZCFB 1V76A 3LGLA 2XIDA 3EGXB 3I5SA 3JCMJ 1WHKA 2OTJA 1D0YA 1OV3A 4IUVA 3TQ7P 3CCQT 4RTVA 1V29B 3JB9J 1VIEA 1ZQ1A 3VS3A 1N27A 2BZ8A 4C5EA 3HFOA 3HTRA 5LJ5d 3CCJT 3NHNA 3S3NA 2VGMA 1M1GA 1PKSA 2X4YA 2H3JA 3M0QA 4M77F 4RKUE 4KBMB 3A8MB 5GAMf 4L6V5 1TSFA 3CD6T 1ZBXA 2X4XA 4QKUA 1GCQA 2DAQA 2COYA 1MGQA 4PFZA 4KGZB 3PTAA 2BIVA 2JT4A 1G2BA 3M55A 2V8JA 2ED1A 3MJXA 1LJOA 4HCZA 3CXCA 5I22A 1IO6A 3E9FA 4IUTA 4Z89A 5GMKj 4BDZA 3GIBA 1QWFA 2K3XA 3GBQA 4XQ3A 1G5VA 5C6SA 2H8HA 3CCET 4OP0A 4CC4B 3X28B 4P5NA 4DBHA 3EG0A 2BE7D 4F17A 3EH2A 3RMSA 1X75C 3CBPA 3LX7A 1VQ4T 1N6AA 4A4HA 1M9SA 3A8HB 4N4GA 4RUGA 1ACMB 4IUUA 1UB4A 2E1HA 2EKOA 4M75B 4HCKA 5DM7R 2DMOA 3OA6A 3I35A 2F1LA 4M75F 2F2WA 5IT9E 4PFOA 2GFUA 3OW2S 1S72T 4BACA 2HQHA 3QWXX 2AZSA 2JS0A 3TSWA 5GAN2 1M1KC 2LCLA 1MMNA 4F16A 4MDXA 2J06A 2LJ0A 5GAN6 4XU1A 5GAOp 3DB4A 4FW2A 1EIFA 1RAFB 4XTVA 3TCJA 1RABB 1VA7A 2CSQA 3M9QA 1NYGA 3V8LA 3LWHA 1YJWT 2XD0A 1V1CA 2LJ3A 2EAYA 2CUBA 4FCYA 3J81E 1UHCA 1YWOA 2RQUA 5J26A 3HFNA 4M7DG 4M7AG 1VQPQ 2PUOB 3G71Q 3QIIA 2KBTA 1KQSS 3OYMA 2YUOA 1I1JA 4OMQA 2Z0WA 4N0AC 4FYVB 1FYNA 3EGDB 1I4K1 4KT0E 2HSPA 1I07A 2FRWA 4HXJA 2EYQA 5FWBA 4BY6C 4HT9A 2E12A 1AWJA 4EDUA 1M1FA 2DTIA 4JRIA 1Q7YR 2EGAA 2GGRA 3OYEA 2DA9A 1VQLQ 1JJ2A 5CKFA 3EG9A 1QVGP 2PQWA 4M7DA 2M9UA 4J83A 9ATCB 1WLPB 3UDCA 2V8KA 3EGUA 1VQKA 2RHUA 2WSCE 3MPUB 3KBGA 2JVVA 1WIEA 4HVUA 5GAMj 1TUGB 4PFPA 1VQ9T 6AT1B 1NPPA 2HBWA 1MMGA 3M54A 3U23A 3P8BB 2ZPGB 4E7ZA 2EJGA 3EAEA 1WDXA 3LLRA 3MEUA 2XI9A 3VYHB 4QW2A 1M5Q1 1VQOA 4JDSA 1NLPC 3TEEA 2LQWA 1X27A 2DO3A 4PL6A 1C6VX 4WTOB 2C06A 2K2VA 4BI8B 5KYNA 1Y71A 2O88A 2DL5A 1GRIA 3UA7A 2L5QA 1PSFA 4C0GA 4JRPA 3CMEQ 1WXBA 2QAZA 5I11A 1UECA 4OB1B 1UGQB 5IH2A 1W6XA 2QDYB 1RAAB 4PNOA 2CT3A 4RCBA 4RTZA 3MEAA 2O9VA 1VQPT 2K9GA 2ZPIB 3INZA 1LVKA 2BZYA 3JCMh 4M7AD 1OZ2A 3QZ5B 1YJWQ 1WHJA 2PVGB 4FYYB 1VQKT 4N4IA 4D8KA 5DLQE 3G6ET 1YIJQ 3HKSA 3MP6A 1HJDA 1AZGB 3REBB 1E6HA 2HSEB 3JCMP 1TS9A 2RHZA 4AFZC 3P8HA 4WCIA 4GBQA 1M4ZA 2AIRB 2EJ9A 2M16A 5HK0A 3JCMe 1K0XA 2E3IA 2RF0A 1OI1A 2DYIA 3M59A 2MAMA 3TU4K 1ZX6A 2YUQA 1K9MU 2CZ7B 1Y0MA 2DL7A 3ZFJA 2IVWA 2EFIA 3RKYA 1WQ7A 2JTFA 2KXCA 2OJ2A 3BDUA 1VQKQ 1ZSZB 4F14A 1M90C 3OYNA 5LJ3d 3FC3A 2P0QA 2X9HA 1WFWA 3ASKA 2NUTA 3GOXA 2MMPA 5CKDA 2COWA 2RJEA 3VS2A 1NZ9A 4LDUA 3CMAA 1WJSA 2JM8A 3G7ZA 4LN2A 4CI0C 4F7UA 2A0FB 1AVZC 5I2MA 2RM4A 4M7AF 3CMET 5KYYB 2RA2A 1Y57A 1VQ7Q 1KQSP 2HBPA 3PVLA 4AT1B 5KYWB 1EZZB 3QJ6A 4C8QG 2CP0A 3EFOB 1N5ZA 2XMFA 2ESWA 1KD1U 3VV0A 1WI7A 4ME7A 2YT6A 4LD6A 2R5MA 3OYKA 3CBMA 2VXEA 5KYUB 2D1XA 4D8DA 1RL2A 1KQ2A 1XOVA 3JCMf 1CKAA 3CMAQ 2CKKA 1X43A 4RTXA 3NPFA 4PK4A 1FMWA 4BI3A 1AEYA 1SSFA 1BK2A 4OB0B 1VQ5T 1X69A 3N5BB 4ELYC 3CMAT 1X6GA 2BUDA 3CCLT 2CP5A 2ZPEB 4JS5A 1Q86R 2O31A 4ANJA 3FDRA 2AK5A 4M78A 1JB0E 1G3SA 2AKLA 2DIQA 4E7IA 1EFNA 3CCRQ 1VUBA 4X1VA 2RI2A 4MZMA 2QASA 5ECAA 1VQ8Q 4KGXB 2J05A 1BI1A 4M77D 1ABQA 5GAOq 2LNVA 4IIMA 1RADB 3DKMA 1SRLA 2ROTA 3QXEB 1BI3A 1JEGA 1HD3A 1Q95G 1SRMA 2FZKB 2DVJA 4OMPA 1QCNA 3JAME 2CDTA 3L1AA 1K73C 1UGPB 4C8QD 2PU9B 1OOTA 4PLLA 2QQ9A 4FM4B 2GQVA 3G6EA 2FZGB 3SEMA 5LJ3g 4E6RA 3G4ST 1WPYA 2MF2A 3C95A 4E7SA 3M5AA 1KK7A 3TVTA 1HK9A 2O4XB 1M3CA 2F69A 2CUDA 1KC8C 3SFMA 5LJ5j 3QDRB 1YJ9T 4M77A 1R0BG 4LDYA 3FB9A 1AOJA 2RD1A 1GXIE 1JU5C 1PRLC 2OX7A 3QYGB 1D1CA 4FSXA 1DJ7B 1T0JA 1OX9A 2DTHA 2LZ6B 4JJDA 4C0DB 2DM1A 2ZZDA 3QBYA 1VQNQ 5GMKi 1UGVA 2QXFA 3LH5A 4C5GA 2QDLA 2KY9A 1NEGA 2KR3A 1GFCA 3VU3C 3G6EQ 5CQXA 2NUTB 2CT4A 2DX1A 3CD6Q 1BI2A 1RACB 2E5KA 4N4HA 1X01A 1ZBJA 1AT1B 3FJPA 2IIMA 3LW5E 2L0AA 4X9DA 4ORZA 5FU7B 4C92B 1Q7YC 2E5QA 4MMLA 2LCCA 3OYLA 1M1KU 3AT1B 1QVGA 4FT4A 1QKWA 1AWWA 1NBEB 3TREA 2QQRA 4XTYA 4M78E 2HCKA 3OY9A 3BE3A 4GLMA 4OF1A 1D0ZA 4AG2C 2KYBA 4PJOA 2FVUA 3R6OA 3A1PA 4EMHA 2MWOA 4XK8E 5CKEA 2EKHA 1VIFA 2J6OA 1ARKA 2EBPA 3M0TA 1RLPC 3SWNB 4K11A 4A4KA 5L23A 3H8ZA 1ZSZC 1H92A 4KULA 4MDWA 3S6WA 1UJ0A 3L2WA 2K6DA 3G71A 1ZSGA 4FYXB 1JRIA 5IXBA 1YNZA 3CC4Q 2DL8A 4M7DB 2EW3A 2YLCA 1IRXA 3FJ5A 3CBOA 1N9SA 3LYIA 1QMCA 3AHUA 4OMLA 2F2VA 5LL6S 1UTIA 1BBZA 3L2QA 3M4GA 2ATCB 2ZAEA 1K9MC 1ZSZA 3V7CA 2I2LA 3G1JA 2YUNA 1YJNT 1SPKA 4J7FA 1F1BB 3PE0A 3VYGA 1VQLT 4E47A 1M3AA 4PJMA 4M78B 1Y96B 4IUPA 2JN0A 5IN1A 1WNLA 3EG3A 1MHNA 1RUWA 1X6OA 2VUBA 1MMAA 2AKKA 3RKXA 2QEXQ 1I5OB 4FT2A 2W0ZA 1WHLA 2DZ9A 4XU3A 2XU8A 2XDPA 2X35A 3M4YA 4RTUA 3M0PA 4PJLA 4C92D 1WGSA 5IHIA 2E10A 3OYFA 2LDMA 2QGFB 2FL7A 4D6WA 2RI5A 4Z8AA 2B8AA 1U1SA 2QEXT 3CMEA 1K76A 2DLPA 3NTKA 2XICA 2Y4YA 1UGRB 2MCNA 4F04B 1YN8A 2D0QB 1VQMT 2HMAA 3P8DA 4M7AE 3CCUT 3OYCA 5LJ5f 1IHWA 5A0GA 3KXTA 3CCUQ 1PNJA 2A37A 1G83A 4PLIA 3RDVA 3ER0A 4PJOD 2EYWA 3BY7A 2BKDN 1KQ1A 3CC2Q 2O4XA 4JPBW 2QA4Q 1UHFA 2A3LA 4OMNA 4LUEA 1WZOA 3UWNA 2DK3A 5A0DA 1Z9QA 3QSUA 1VYUA 5HKCA 2KVQG 5FWCA 4J9CA 4M7DC 2LT1A 1PCXA 2O2OA 4KUDK 1RAGB 1VQ6Q 1H641 4JS4A 2PTKA 1HYOA 1BU1A 4WF2A 1NJIR 3A98A 1QVFP 1YI2T 1M8MA 2Y90A 3OB9A 2BE9B 3V7SA 2LMJA 1QCOA 2LX9A 1QQJA 1D3BB 2O9SA 2RMOA 2EIFA 1KC8R 1JXMA 2E70A 4DBQA 2L2PA 2VV5A 3NFCA 3QWYA 5CCAA 1D3BA 3ME9A 2YXYA 1FX7A 3PMIA 2A7YA 2F2XA 3A5ZB 2COZA 4JLGA 2V26A 3SHWA 4F7UF 5CK9A 3GNFB 2RQTA 4DA4A 3RUXA 1TG0A 1MMDA 4VUBA 3I55A 3S3MA 3OYHA 2B86A 2MWPA 4DEYA 1GCPA 3UA6A 2K5LA 1KG1A 3GF5A 4R55A 4PJJA 3FLGA 1O9SA 2MOXA 1GL5A 2AZVA 4C8QE 1YCSB 2JXBA 4QQDA 4C0DC 3VS6A 2YUPA 3JB9F 2LC4A 5FLXE 4FIBA 4IIOA 1Q81U 2DIGA 4LUDA 5KCOA 1G3TA 4CRIA 2DD5A 1T3LA 1JBMA 2JTMA 2MI6A 3OW2P 2P0KA 3VKIA 2ROLA 3IQLA 3RIRA 3I5RA 1BIBA 4NS5A 1K9AA 3CCMA 2CP6A 2DF6A 3MCAB 2QA4T 1SF9A 1Q86U 1RAIB 4F7UG 4J9HA 1Y7XA 5KYYA 2JUFA 5AYFA 4ZTJA 4M77E 3PIOA 2CP2A 1PSEA 4JZ3A 1OU9A 2JOYA 1BCMA 1M1KR 3LGFA 1NG2A 1RI9A 2YDLA 3OQ5A 2BTTA 4C8QF 1VQNT 4BI4A 1X2QA 1TOVA 3CC7A 4EPCA 3C12A 2DXBA 3EG2A 1UUEA 2FHDA 4JLIA 1M27C 4M75C 2QEXA 2PVOB 3QKJA 4Y91A 2EYZA 3JB9H 1WHMA 5HK3A 5CR2A 1ZLMA 4M75E 1PKTA 5J39A 4GLKA 5IHNA 1K4US 3JV3A 3DLLA 4M75G 3REAB 5J3BA 3M0SA 1Q82R 1BKBA 1MV3A 3UATA 3G4SQ 1YJ9Q 3UF4A 2EQUA 2FRYA 4ZGEB 2JS2A 2K7AA 2KYMA 1S72A 2EQIA 1AWOA 3D7SB 1JJ2S 3JCMb 3ULRB 2D6FA 2OTJQ 3EHQA 2RB6A 1YJNQ 1N8RC 1KFZA 1M2VB 2WSEE 3CC4T 2KRNA 4HA8A 2LNHB 1XTDA 2F5TX 4BUGA 4RTWA 2DBMA 3CC2A 1IGUA 2PVDB 3MP8A 4A63B 3QJYA 3T9NA 1OZ3A 1QP2A 4OMMA 4M4ZA 1VQPA 4J6YA 2DL3A 2M0OA 1M2OA 4C92A 4DEXA 2VC8A 2EQKA 2DVEA 1VQOQ 2XK0A 3X25B 4LDWA 3HRUA 5KE3A 2HKQB 4QQGA 2OAWA 1X2KA 4M78D 5GANg 4M77B 3CC7Q 1UE9A 2W10A 5FRMA 3META 4QVZA 1N8RU 3L2UA 3I9QA 3KUFA 3I55T 3OYDA 1WX6A 4FU6A 2X3WD 4M7AC 1M8VA 1D1AA 2QG9B 1B3QA 1QVPA 1VYVA 3FEOA 2HEQA 5GMKh 2RQVA 1NEBA 4Q5WA 3SWNA 1R77A 4RG2A 2GF7A 4A4FA 3H41A 3RNJA 3EGDA 5EC7A 5LJ5g 3G4SA 1QVFS 2CZ0B 1YI2Q 2FPFA 5A0LA 2FPDA 4HKEA 2LTOA 4E7LA 2L89A 4HVVA 2GTOA 2V8IA 1S72Q 3JB9I 1Q7YU 5LJ3h 2HD0A 4OVAA 4CC7A 2LQKA 3GNGA 1VYTA 4ZGDB 2LCSA 3OBYA 1I81A 1TTHB 4XAXB 3CPWA 1TUCA 3I56Q 1PWTA 4JJNK 1Q81C 3CPWP 4ESRA 1G8XA 3VRZA 2KGTA 2ZGWA 4XTXA 1GFDA 1XNIA 3M58A 2YRVA 1U5SA 3O5ZA 2CH4A 4C0FA 2EGCA 3C0CA 1WJQA 1PD0A 4C5IA 3MP1A 4C5HA 5CAIA 2NUPA 3A8LB 3CCJA 1T0HA 3CCVQ 1XQHA 4C92E 4HT8A 3M0RA 3OBWA 1YHQA 2E41A 2OTLA 2L3SA 3J7AF 2RPNA 2CS7A 2LVMA 5KH6A 3OS1A 2P84A 2KXDA 2DJZA 2DJQA 1BYMA 1SHGA 4XTWA 1X6BA 1M30A 2DXCA 2E4HA 2E3HA 4BY6B 1KJWA 4M7DE 4Z88A 2HQXA 1LCKA 1PC0A 3VUBA 1OPKA 5GAMg 1RAEB 2KK4A 1FMKA 4EMKA 4EIKA 3QO3A 4DQ2A 5KYUA 2KRMA 3C4SA 4F7UB 1YI2A 1MNDA 3E9GA 1VQ5Q 3PGGA 2IG0A 3Q1JA 4YTLA 1B34A 4QVCA 4UC4A 5FW9A 4AMCA 1YJ9A 5GJVB 3E19A 3CCQQ 5I21A 1U8RA 4B9WA 4DBFA 3CXCP 4QVDA 1FWZA 4C8QA 5L8RE 2GCXA 2RQWA 2YRDA 2L3RA 1KQSA 3CCSA 1ABOA 2CP3A 1RI0A 1LOJA 4M77C 2Y4XA 4RG8A 3I56A 3VS0A 3LWIA 1VQLA 4NL2A 2OTLT 1VQ7T 1PM3A 4IKFA 1AD5A 2QTXA 3JCMV 3MHXA 4BD3A 3L42A 1N8RR 1K73U 2HKNA 2J6FA 5LJ3e 2GFAA 4OB3B 3E1SA 1VQ8T 1N9RA 2EQJA 4ZN3A 3EG1A 3CCRT 2RJCA 3DB3A 2KI7A 3CCEA 3QDFA 2AT1B 4KGVB 4C8QC 1WXTA 2JMCA 3JCMQ 2JTEA 1VQ5A 1SG5A 2LP5A 5GMKe 1YHQQ 1KC8U 1VQ4Q 1I8FA 2BZXA 4R0KA 1D09B 4JJBA 1NYFA 5AT1B 1HSQA 2HL3A 3H0IA 3CCQA 1GBRA 2AHJB 3GPLA 1QKXA 3BW1A 4OB2B 4EMKB 4OGCA 1D0XA 4QT7A 2R5AA 1IXDA 5GAN8 2OI3A 2M02A 3G71T 3M57A 5FROA 1T3SA 5CVIA 2L8DA 5FU6C 1R0CB 3EFRA 1ZUUA 4XU2A 3PFSA 8ATCB 1FXXA 3MO8A 1YJWA 4EMKC 1QLYA 2RH2A 4TVRA 2DNUA 5I2SA 4AFQC 4A53A 2X4JA 2VKNA 4J7IA 4BDYA 1RAHB 2DKGA 2JM9A 3CC7T 2JNGA 3RMQA 3CCST 5LJ3f 2L3PA 2DEQA 2LQNA 2QTVA 4PJOF 2DD4A 3OSVA 3JCMW 5GJWB 4LDVA 4ATOA 2PUKB 4HCCA 2ED0A 5CQYA 3CEYA 2DYBA 5IAYA 2A36A 3JB9G 2NUZA 3PNWC 2G6FX 3CCUA 1VQ9A 4JRQA 2XG8D 1AWXA 1AHJB 3NMZC 1PHTA 1OX8A 3ZEHA 3TSZA 4X9CA 5GANh 1W1FA 2XDBA 4A54A 1YIJT 4LDXA 1G3WA 2X4WA 1OULA 5IHKA 1BCOA 5D6WA 4R56A 3E2UA 3CPWS 5KYXB 4E7JA 3ZL7C 2QQBA 2E64A 2EVRA 4ZN1A 4FSSA 2VVKA 1Q82C 4M78G 4NL3A 4LNPA 4N0AA 1OQKA 3OS5A 1W4SA 4F7UE 3M53A 3PVQA 1Y07A 2KQWA 5HCKA 4XU0A 1VQOT 1W2BP 2KT1A 3M0UA 2G3RA 2NWMA 4J9DA 3H9NA 2A28A 2K3BA 4IUQA 3FRNA 3V8JA 1M90R 5FRNA 4J9BA 4ZGJB 4J5YA 1Y96A 3ZBDA 2RHXA 4RTTA 4CC2A 1JQQA 2L3QA 1OU8A 2VB6A 3PIPA 2XKOC 2DTOA 1P92A 1YP5A 2CZ1B 2RHIA 2MYSA 4M7AA 4C92C 2EYYA 1W70A 2HZYA 3QYHB 1KSWA 2YWWA 1QCFA 4XTZA 5DLOA 1Q81R 1WA7A 1NM7A 4KH0B 2OTJT 1BB9A 2GNCA 1QWEA 1QVGS 3UT1A 1TXQA 2EYXA 3NTIA 1ZA2B 2DETA 3CCRA 5GAN4 3HHTB 1AZEA 1IZ6A 1VOMA 2RHYA 2C0OA 3V7RA 3JRZA 1H3HA 3OMGA 3I56T 1B07A 2LT4A 3X24B 1LNXA 2X3XD 5HY6A 4E7HA 3OSSC 3PMTA 1KHIA 1E7OA 1W2BA 2RJFA 1UFFA 5CO7A 2DL4A 3JSCA 3QG1A 1SEMA 3CCEQ 2D9TA 1PRMC 1WXUA 1MV0B 1K73R 1NJIU 1CSKA 1YIJA 4O5VA 3EH1A 2SRCA 1W2BS 5KYWA 2IPOB 1VQ4A 5LJ3j 1QW1A 4EMGA 4C8QB 1U1TA 5LJ5h 2EQMA 3SWNC 3SD4A 3QHSA 5GAOl 2LQ8A 2ENMA 2QK0A 2OAUA 2MIOA 2WACA 4M7DD 2CZ6B 2MPXC 2KNBB 1KD1R 3QPHA 3OYIA 3OW2A 4BE0A 1HXDA 2E6NA 5EG2A 4J9EA 8AT1B 1U3OA 1Z9ZA 1E6GA 4RTYA 1ZHIA 4O6JA 3CQTA 4HCBA 1O75A 1UJYA 3F70A 5FU7C 5KYXA 4OMOA 3CCVT 3OYBA 3R6NA 1TWBA 4BB7A 3JCMg 1VQNA 3C94A 1KIKA 2GQIA 2KDSA 1M90U 1K8AU 1WHHA 1OPLA 5C0MA 3NGPA 3CCJQ 4BE1A 3HRSA 4XTUA 3JB9D 1VQ7A 5CKHA 3RESA 3VRYA 1K8AC 5M9OA 2VYTA 4BE2A 2DERA 4HVWA 3O8VA
chains in the Genus database with same CATH topology
4ZGDB 4KUIA 3RMSA 3OBYA 3OYJA 3SWNB 1X75C 3CBPA 3LX7A 4A4KA 3H8ZA 1I81A 1VQ4T 4KULA 4MDWA 4XAXB 2LRQA 2FB7A 1N6AA 3CPWA 4A4HA 3S6WA 3L2WA 3G71A 1JRIA 1M9SA 3A8HB 4M7DF 4ZTFA 4JJNK 3NTHA 4N4GA 1Q81C 4Y28E 4IUUA 1UB4A 2E1HA 2EKOA 4M75B 5DM7R 2ZGWA 4XTXA 4M7DB 3OA6A 2YLCA 1XNIA 3M58A 3RERA 3CBOA 1N9SA 2YRVA 3LYIA 4M75F 3AHUA 5CIUA 5IT9E 4DOWA 5LL6S 4C0FA 2GFUA 5FU6B 1WJQA 2K5IA 4C5IA 3OW2S 3MP1A 4C5HA 1S72T 1QP3A 4BACA 3HRTA 1NPRA 5CAIA 3CPFA 3A8LB 5GAN2 3L2QA 3CCJA 2EWNA 4II1A 1M1KC 2XDDA 2LCLA 3M4GA 4MDXA 1K9MC 1XQHA 4C92E 4HT8A 3V7CA 2XHCA 5GAN6 2I2LA 5GAMd 5GAN3 3CC4A 3OBWA 4XU1A 5GAOp 4J7FA 1YJNT 5GMKl 3DB4A 1YHQA 4Z02A 2E41A 4M78F 3VYGA 1VQLT 2OTLA 4E47A 1EIFA 4XTVA 3TCJA 4OMFB 3J7AF 4M78B 3M9QA 1Y96B 1YITA 2KAFA 2CS7A 3V8LA 3LWHA 2LVMA 1YJWT 2XD0A 4IUPA 2EAYA 2VXFA 3EFSA 5KH6A 2JN0A 3OS1A 3J81E 5IN1A 1WNLA 4J6XA 5J26A 3HFNA 4M7DG 1MHNA 2DJZA 1VQ8A 4M7AG 1BYMA 1X6OA 2PUOB 2VUBA 2QI2A 4XTWA 3WVDB 3RKXA 4L59A 3QIIA 2DXCA 1KQSS 3OYMA 4BY6B 4FT2A 4M7DE 4N0AC 3JCMX 2DZ9A 2HQXA 1I4K1 4XU3A 2XU8A 4X34A 1VQ6T 4KT0E 5CKBA 3VUBA 2XDPA 2X35A 3M4YA 5GAMg 2EYQA 2KK4A 4BY6C 4HT9A 2E12A 1YBYA 4C92D 1WGSA 4EMKA 3H6ZA 4EDUA 1M1FA 3QO3A 2E10A 4DQ2A 3OYFA 3L2VA 2LDMA 2DTIA 4JRIA 2FYKA 3C4SA 4F7UB 2FL7A 4M75D 1YI2A 4D6WA 3E9GA 3OYEA 1R8OB 2RI5A 3PGGA 2IG0A 3Q1JA 2B8AA 1U1SA 2QEXT 3CMEA 4YTLA 1B34A 1I5LA 5CKFA 4QVCA 1JJ2A 1H3ZA 3VJPA 2PQWA 3NTKA 4UC4A 2M9UA 4J83A 4M7DA 2XICA 3UDCA 2Y4YA 2V8KA 1UGRB 1YJ9A 1VQKA 2VGNA 3E19A 2RHUA 3RKWA 2WSCE 3X26B 3OS0A 3MEWA 5I21A 1U8RA 3KBGA 2JVVA 2D0QB 3JCMc 4B9WA 1VQMT 5GAMj 1VQ9T 3FIFA 4QQ6A 4QVDA 1NPPA 3P8DA 4J8OA 2QA4A 1FWZA 2KSSA 4C8QA 4M7AE 3CCUT 3M54A 5L8RE 3OYCA 5LJ5f 2GCXA 1YCYA 3P8BB 4M77G 3CCMT 2ZPGB 2L3RA 4JUVA 5A0GA 3KXTA 1KQSA 2EJGA 3CCSA 3CC2T 1RI0A 3EAEA 1LOJA 3LLRA 4PJOB 4M77C 2Y4XA 2XI9A 3MEUA 4RG8A 3VYHB 3I56A 4NL2A 4PLIA 4QW2A 3LWIA 1M5Q1 4RMOA 1VQ7T 2OTLT 3ER0A 1VQOA 4IKFA 4JDSA 4PJOD 3TEEA 2QTXA 4PJOE 2EJFA 3MHXA 3JCMV 4BD3A 3BY7A 3L42A 1K73U 2DO3A 5LJ3e 2BKDN 1KQ1A 2NLUA 4C92G 2O4XA 2GFAA 4OB3B 3E1SA 4PL6A 1VQ8T 1N9RA 2EQJA 2A3LA 3SDZA 3VUZA 2E6ZA 4ZN3A 3CCRT 2RJCA 2C06A 2K2VA 3DB3A 4BI8B 1Y71A 3UWNA 5GAOn 3CCEA 5GANj 2DK3A 5A0DA 2L5QA 4C8QC 2HAXA 1PSFA 4C0GA 3QSUA 1TH7A 5D6YA 4JRPA 5HKCA 2KVQG 1KD1C 3JCMQ 1VQ5A 4M7DC 2LT1A 4OB1B 4KUDK 1UGQB 1H641 5GMKe 4JS4A 1KC8U 2QDYB 4PNOA 4WF2A 1I8FA 4RCBA 3MEAA 3GP8A 1YI2T 2Y90A 2QQAA 3CD6A 3OB9A 3CCQA 1VQPT 2JZ2A 2ZPIB 2AHJB 2DPPB 2ZPFB 3INZA 3GPLA 3L2ZA 2E65A 1WQWA 3V7SA 5GAMh 2LX9A 5GANe 3BW1A 3JCMh 5GANd 4M7AD 1OZ2A 3QZ5B 1D3BB 3CCVA 2EIFA 4OB2B 4EMKB 4OGCA 4V2SA 2PVGB 2E70A 1VQKT 4N4IA 2VV5A 3NFCA 1VQ6A 2R5AA 4A4EA 2R58A 5DLQE 3G6ET 5CCAA 4OGEA 5GAN8 1BI0A 1D3BA 3HKSA 3ME9A 3X20B 3MP6A 3G71T 1Q82U 3M57A 2CGHA 1FX7A 2DZCA 3PMIA 2A7YA 5FROA 4DOVA 5KE2A 3JCMP 2RK1A 2P4TA 2YLBA 3A5ZB 2O01E 2RHZA 4M78C 3P8HA 5CVIA 3HL8A 2L8DA 5KCHA 4JLGA 5FU6C 5GAN5 3EFRA 1M4ZA 2EJ9A 2M16A 4XU2A 4LD9K 3PFSA 4F7UF 1KHCA 5HK0A 5CK9A 1FXXA 3MO8A 3GLXA 3JCMe 1B34B 1YJWA 4EMKC 4ELZC 1OI1A 3GNFB 3M59A 2MAMA 3TU4K 1QVFA 4DA4A 2RH2A 1BIAA 3RUXA 5LJ5e 4TVRA 1K9MU 2CZ7B 4VUBA 3I55A 4JRKA 2RK2A 5I2SA 3S3MA 4A53A 3OYHA 2MWPA 3ZFJA 2IVWA 2EFIA 3RKYA 1WQ7A 2JTFA 2X4JA 3BDUA 2K5LA 1M90C 1KG1A 4J7IA 3OYNA 4BDYA 5LJ3d 3FC3A 3GF5A 2DKGA 3HPWA 3CC7T 2K5FA 3M56A 2P0QA 2DXUA 2JNGA 2F5KA 5DY9A 4R55A 3FLGA 1O9SA 2HNIA 3ASKA 3RMQA 3CCST 3GOXA 5LJ3f 2DEQA 1UGSB 4C8QE 2MMPA 3A8GB 3OYAA 4QQDA 4C0DC 4MMKA 4PJOF 5CKDA 4E7KA 1YITT 2RJEA 3JB9F 2DD4A 2LC4A 3OSVA 5FLXE 3JCMW 4FIBA 1Q81U 3CCLA 1NZ9A 2DIGA 4LDUA 1WJSA 3QZ9B 4LDVA 3CMAA 4ATOA 3G7ZA 4CI0C 2PUKB 4F7UA 4HCCA 5I2MA 5KCOA 1G3TA 2RM4A 4M7AF 4IURA 1IREB 3OYGA 4CRIA 2DD5A 2R57A 3CMET 2K3YA 1JBMA 2JTMA 2MI6A 5CQYA 2RA2A 2P0KA 3CEYA 3VKIA 3V8KA 5IAYA 3RIRA 1BIBA 4NS5A 3JB9G 2HBPA 3CCMA 3J80E 5A2QE 4J6WA 2WSFE 3MCAB 2QA4T 3URGA 3PNWC 3CCUA 3OMCA 1VQ9A 4JRQA 2XG8D 1Q86U 3QJ6A 4NOYA 4F7UG 1Y7XA 4C8QG 5GANf 2JUFA 1AHJB 5AYFA 4ZTJA 3BDLA 3ZEHA 3PT9A 4M77E 3PIOA 1OYXA 1PSEA 4X9CA 5GANh 3WXMB 2JOYA 2RJDA 3LGFA 3VV0A 1KD1U 4ME7A 2XDBA 4A54A 1YIJT 4LD6A 3HP9A 2R5MA 3OYKA 1NJIC 3CBMA 4LDXA 1G3WA 2VXEA 3WVEB 3JCMd 3OQ5A 2CYZB 2X4WA 4C8QF 1VQNT 1RL2A 4BI4A 4C0ZA 1VQMA 5D6WA 4R56A 1KQ2A 1NE8A 3CPWS 4E7JA 2QQBA 1XOVA 2E64A 3CC7A 4EPCA 4ZN1A 3C12A 2DXBA 3JCMf 1Q82C 2ZPHB 4M78G 2CKKA 4NL3A 2RO0A 3HSBA 4N0AA 4BI3A 2FHDA 4JLIA 3OS5A 4M75C 1W4SA 1SSFA 4MZPA 4F7UE 5GAOm 3M53A 4OB0B 5GAN7 1UEBA 2QEXA 2PVOB 3QKJA 1Y07A 2KQWA 1VQ5T 4XU0A 1VQOT 3N5BB 4Y91A 2G3RA 4ELYC 3JB9H 3CMAT 5HK3A 5CR2A 3SB2A 2QQSA 3DLMA 2BUDA 5GAMe 3CCLT 4M75E 2HQEA 4IUQA 3FRNA 3V8JA 2ZPEB 5J39A 4JS5A 4GLKA 5FRNA 3FDRA 4RCCA 4ZGJB 4FL6A 4M78A 4J5YA 1Y96A 1G3YA 4L5GA 1JB0E 3ZBDA 3DLLA 1G3SA 2RHXA 3OYYA 4M75G 2DIQA 4E7IA 4PJOG 5J3BA 3UPUA 1WJRA 1VUBA 2P0PA 2RI2A 1BKBA 4MZMA 3CXCS 3PIPA 3BFMA 1YHQT 2XKOC 1YJNA 4C92F 2ZPBB 2DTOA 1BI1A 1P92A 2CZ1B 4M77D 2RHIA 4M7AA 5D6XA 4C92C 2EQUA 5GAOq 4PJOC 2LNVA 4ZGEB 3QUIA 3DKMA 3QXEB 3OS2A 3A8OB 4B9XA 1BI3A 3QYHB 4XTZA 5DLOA 5GMKm 1S72A 4PKCC 2OTJT 1Q86C 1QVGS 2DXTA 3UT1A 1JJ2S 5GAOr 3JCMb 3NTIA 3S3OA 2D6FA 3JAME 3CCRA 4GY5A 2RI3A 3MEVA 3HHTB 2RB6A 3L1AA 2K57A 4MZTA 4M7AB 5GAN4 4M75A 3L2RA 1IZ6A 1K73C 1N8RC 1UGPB 2WSEE 2PU9B 4C8QD 2RHYA 2K4YA 3CC4T 2YHTA 4PLLA 2QQ9A 4FM4B 2GQVA 3JRZA 3V7RA 3G6EA 4HA8A 5LJ3g 3OMGA 3I56T 2LT4A 2KMTA 2M1HA 1WPYA 2MF2A 1LNXA 3C95A 5HY6A 3X24B 3G4ST 4E7HA 1XTDA 3LH0A 2F5TX 3OSSC 3PMTA 4BUGA 4A4GA 1KHIA 3CC2A 1W2BA 2PVDB 3M5AA 3MP8A 2RJFA 2ZCFB 3QJYA 5CO7A 3T9NA 3LGLA 2XIDA 1OZ3A 3JSCA 1HK9A 2O4XB 3QG1A 3JCMJ 2OTJA 1QP2A 4IUVA 2D9TA 3CCQT 4J6YA 2F69A 1VQPA 1KC8C 3SFMA 5LJ5j 3QDRB 1NJIU 1V29B 3JB9J 1YIJA 2M0OA 1VIEA 4C92A 4M77A 1YJ9T 1ZQ1A 2VC8A 2EQKA 2DVEA 4O5VA 1N27A 2XK0A 4C5EA 3HFOA 4LDYA 3X25B 3FB9A 4LDWA 2RD1A 5LJ5d 3HRUA 1VQ4A 1W2BS 5LJ3j 3QYGB 3CCJT 1QW1A 1GXIE 3S3NA 5KE3A 4EMGA 4QQGA 2VGMA 4C8QB 4FSXA 1M1GA 1U1TA 1DJ7B 2EQMA 3SWNC 3SD4A 2X4YA 5LJ5h 2H3JA 3QHSA 4M77F 5GAOl 2LQ8A 2DTHA 4RKUE 4KBMB 2OAUA 4M78D 3A8MB 4C0DB 5GANg 4M77B 5GAMf 4L6V5 2ZZDA 2WACA 4M7DD 2CZ6B 3CD6T 3QBYA 1ZBXA 2X4XA 5FRMA 3QPHA 5GMKi 3OYIA 3OW2A 3META 4QVZA 1N8RU 2QXFA 3L2UA 2DAQA 4C5GA 1VQLA 4BE0A 1HXDA 2E6NA 5EG2A 2KY9A 1MGQA 3KUFA 3I55T 3VU3C 3OYDA 5CQXA 1ZHIA 4O6JA 3PTAA 4FU6A 4HCBA 2BIVA 1O75A 5CKEA 4M7AC 3F70A 5FU7C 1M8VA 3CCVT 3OYBA 1QVPA 3M55A 1BI2A 3FEOA 4BB7A 2V8JA 5GMKh 4N4HA 1X01A 3JCMg 1VQNA 3C94A 4Q5WA 1LJOA 3SWNA 3FJPA 4RG2A 2GF7A 4A4FA 4HCZA 3CXCA 3LW5E 4X9DA 5FU7B 4C92B 1Q7YC 2KDSA 3E9FA 5LJ5g 1M90U 1K8AU 3G4SA 1QVFS 2CZ0B 2E5QA 5C0MA 4MMLA 4IUTA 2LCCA 5A0LA 3OYLA 4BE1A 1M1KU 1QVGA 4FT4A 3HRSA 4XTUA 3TREA 5GMKj 2QQRA 3JB9D 4HKEA 4XTYA 4BDZA 1VQ7A 5CKHA 3GIBA 4M78E 3RESA 2LTOA 3OY9A 4E7LA 2L89A 4OF1A 1K8AC 2V8IA 2K3XA 3JB9I 1Q7YU 4XQ3A 5LJ3h 5M9OA 1G5VA 5C6SA 4PJOA 2HD0A 2FVUA 3R6OA 3CCET 4OP0A 4OVAA 2VYTA 4BE2A 3X28B 4EMHA 2LQKA 2MWOA 3GNGA 4P5NA 4XK8E 1VIFA 3O8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJG A;  5GAN 4;  1LOJ A;  3SWN B;  2RB6 A;  3L1A A;  2K57 A;  4M77 C;  1I81 A;  4M7A B;  4M75 A;  4F7U A;  4NL2 A;  4C8Q D;  2FB7 A;  1M5Q 1;  4PJO D;  2RM4 A;  2YHT A;  4M7A F;  1JRI A;  2QTX A;  4M7D F;  4PJO E;  3V7R A;  2EJF A;  3JCM V;  4HA8 A;  3BY7 A;  1JBM A;  2E1H A;  2RA2 A;  5LJ3 e;  4M75 B;  5LJ3 g;  1KQ1 A;  2ZGW A;  4XTX A;  3V8K A;  4M7D B;  1WPY A;  4C92 G;  1LNX A;  2YLC A;  4PJO B;  3RIR A;  3RER A;  1BIB A;  3JB9 G;  1N9S A;  1N9R A;  4M75 F;  3AHU A;  4J6W A;  5GAO n;  5GAN j;  3JCM J;  1HK9 A;  4C8Q C;  3QSU A;  1TH7 A;  5CAI A;  4J6Y A;  4NOY A;  4F7U G;  5GAN 2;  5LJ5 j;  4C8Q G;  2EWN A;  5GAN f;  3M4G A;  3JCM Q;  3JB9 J;  4M7D C;  4M77 E;  4M77 A;  4C92 E;  4C92 A;  3V7C A;  4HT8 A;  2VC8 A;  5GAN 6;  2I2L A;  5GAM d;  5GAN 3;  1H64 1;  2DVE A;  4X9C A;  5GMK e;  5GAN h;  4XU1 A;  5GAO p;  3HFO A;  3FB9 A;  4PNO A;  4WF2 A;  1I8F A;  5GMK l;  2RD1 A;  5LJ5 d;  2E41 A;  4M78 F;  4RCB A;  4A54 A;  5LJ3 j;  2Y90 A;  4EMG A;  4XTV A;  4C8Q B;  1U1T A;  5LJ5 h;  3SWN C;  4M78 B;  2VXE A;  3QHS A;  4M77 F;  1Y96 B;  3JCM d;  5GAO l;  2DTH A;  3V8L A;  3INZ A;  3L2Z A;  4C8Q F;  2E65 A;  1WQW A;  3V7S A;  4M78 D;  5GAM h;  2EAY A;  5GAN e;  5GAN g;  4M77 B;  3BW1 A;  2VXF A;  3EFS A;  3JCM h;  5GAM f;  2JN0 A;  5GAN d;  1KQ2 A;  4M7A D;  4M7D D;  1D3B B;  1WNL A;  4J6X A;  2E64 A;  3HFN A;  4EMK B;  4M7D G;  4V2S A;  2DJZ A;  4M7A G;  3JCM f;  5GMK i;  4XTW A;  4M78 G;  3RKX A;  4NL3 A;  3HSB A;  4N0A A;  5GAN 8;  4JLI A;  4M75 C;  1HXD A;  1D3B A;  4F7U E;  4M7D E;  4N0A C;  1MGQ A;  5GAN 7;  5GAO m;  3JCM X;  2DZ9 A;  3VU3 C;  1I4K 1;  2CGH A;  2DZC A;  4XU0 A;  4XU3 A;  4Y91 A;  3JB9 H;  3JCM P;  2YLB A;  3SB2 A;  4M78 C;  5GAM e;  5GAM g;  4M7A C;  4M75 E;  1M8V A;  4HT9 A;  4EMK A;  4C92 D;  5GAN 5;  3EFR A;  3V8J A;  2EJ9 A;  4XU2 A;  4F7U F;  5GMK h;  4RCC A;  3QO3 A;  4M78 A;  1X01 A;  2E10 A;  1Y96 A;  4J5Y A;  3JCM g;  1B34 B;  1LJO A;  3SWN A;  4DQ2 A;  3JCM e;  3FJP A;  4EMK C;  2DTI A;  4JRI A;  2FYK A;  4F7U B;  4M75 G;  4M75 D;  4PJO G;  4X9D A;  4C92 B;  3PGG A;  1BIA A;  3RUX A;  5LJ5 g;  5LJ5 e;  1U1S A;  4MML A;  4JRK A;  3BFM A;  1B34 A;  1I5L A;  4C92 F;  4QVC A;  4A53 A;  2DTO A;  4M77 D;  1WQ7 A;  3RKY A;  4M7D A;  3BDU A;  4XTU A;  5GMK j;  3JB9 D;  4XTY A;  3GIB A;  4M7A A;  4C92 C;  4M78 E;  5GAO q;  3RES A;  5LJ3 d;  4PJO C;  2DKG A;  3QUI A;  3RKW A;  2DXU A;  5DY9 A;  5I21 A;  3JCM c;  3JB9 I;  2HNI A;  4XQ3 A;  4XTZ A;  5LJ3 h;  5GAM j;  5LJ3 f;  3FIF A;  4QVD A;  4PJO A;  5GMK m;  2DEQ A;  4C8Q A;  4OP0 A;  4C8Q E;  4M7A E;  2DXT A;  4EMH A;  4MMK A;  4PJO F;  5LJ5 f;  3JCM b;  5GAO r;  1YCY A;  4M77 G;  3JB9 F;  4JUV A;  3JCM W; 
#chains in the Genus database with same CATH topology
 2M51 A;  1IGQ A;  4KUI A;  3OYJ A;  2LRQ A;  2FB7 A;  2CH4 W;  4M7D F;  4ZTF A;  3NTH A;  4Y28 E;  3EG9 B;  1C0M A;  3RER A;  7AT1 B;  4ZNX A;  5CIU A;  1FMV A;  4DOW A;  2DRK A;  5FU6 B;  2K5I A;  1QP3 A;  3HRT A;  1NPR A;  1VQ9 Q;  3CPF A;  2EWN A;  4II1 A;  2XDD A;  1U06 A;  2XHC A;  5GAN 3;  5GAM d;  3CC4 A;  5GMK l;  4Z02 A;  4M78 F;  4OMF B;  2D0N A;  3RBB B;  1YIT A;  1OEB A;  2KAF A;  1TU0 B;  1UG1 A;  2YSQ A;  1VQM Q;  1LPL A;  2VXF A;  3EFS A;  4AFS C;  4J6X A;  1VQ8 A;  2JMA A;  3WVD B;  2QI2 A;  4L59 A;  1XJW B;  1ZUY A;  3JCM X;  1B7T A;  4X34 A;  1VQ6 T;  5CKB A;  3VS4 A;  1YBY A;  2V1Q A;  1S1N A;  3H6Z A;  2D8H A;  2NUP B;  3L2V A;  2CRE A;  2PZ1 A;  2FYK A;  1K1Z A;  4LE9 A;  2RN8 A;  4M75 D;  1R8O B;  3THK A;  1I5L A;  2C0T A;  1H3Z A;  3VJP A;  1ZUK A;  2FPE A;  2FZC B;  4KRT A;  1K8A R;  2VGN A;  3X26 B;  3RKW A;  3OS0 A;  3MEW A;  3JCM c;  2QGG A;  3FIF A;  4QQ6 A;  4J8O A;  2QA4 A;  2KSS A;  2DBK A;  1YCY A;  4M77 G;  3CCM T;  4JUV A;  4DBR A;  3CC2 T;  4PJO B;  4LD9 K;  4RMO A;  2FG0 A;  4PJO E;  2EJF A;  4PJN A;  2NLU A;  4C92 G;  4J9F A;  3KFV A;  3VUZ A;  3SDZ A;  2E6Z A;  2KRS A;  3EHR A;  5GAO n;  5GAN j;  1JJ2 P;  2HL5 C;  2CP7 A;  2HAX A;  1TH7 A;  5D6Y A;  1KD1 C;  1RLQ C;  2FEI A;  2A08 A;  1K9M R;  4E2F B;  1ZA1 B;  3EFO A;  3GP8 A;  1YIT Q;  2QQA A;  3CD6 A;  4LXC A;  1SKU B;  2JZ2 A;  2DPP B;  2ZPF B;  2RQR A;  3L2Z A;  2E65 A;  1WQW A;  1H8K A;  5D7U A;  5GAM h;  5GAN e;  5GAN d;  3CCL Q;  2JW4 A;  3CCV A;  4B6M A;  4V2S A;  2J6K A;  1VQ6 A;  4A4E A;  2R58 A;  4OGE A;  3H0F A;  1BI0 A;  3I55 Q;  3X20 B;  3RR6 A;  1Q82 U;  2K2M A;  2CGH A;  2DZC A;  4DOV A;  5KE2 A;  2RK1 A;  2P4T A;  2YLB A;  2O01 E;  4M78 C;  3HL8 A;  2GBQ A;  1SSH A;  5KCH A;  5GAN 5;  2HDA A;  4JZ4 A;  4JJC A;  1KHC A;  3GLX A;  1B34 B;  4ELZ C;  1QVF A;  1J3T A;  1BIA A;  5LJ5 e;  4JRK A;  2RK2 A;  2DEU A;  2ECZ A;  4FW1 A;  3HPW A;  2PNI A;  2K5F A;  3M56 A;  2DXU A;  2F5K A;  5DY9 A;  2DFU A;  2HNI A;  1WHG A;  1UGS B;  2I0N A;  2H3E B;  3A8G B;  3OYA A;  1YIT T;  4MMK A;  4E7K A;  2X51 A;  2QYZ A;  3CCL A;  1SHF A;  4AFU C;  3QZ9 B;  2KE9 A;  2YRC A;  4AG1 C;  1GBQ A;  3EGX A;  4IUR A;  1IRE B;  3OYG A;  2VWF A;  2LJ1 A;  2R57 A;  2K3Y A;  2DIL A;  2C0I A;  3VS5 A;  1JO8 A;  3V8K A;  5IXF A;  3J80 E;  5A2Q E;  3MKD A;  2J7I A;  4J6W A;  2WSF E;  2RNA A;  3URG A;  3CCS Q;  1UDL A;  3OMC A;  2P4R A;  2KEA A;  2NYS A;  4NOY A;  1YWP A;  2CSI A;  5GAN f;  3VS1 A;  3BDL A;  1I0C A;  3PT9 A;  4CC3 A;  2V1R A;  1MNE A;  1OYX A;  3WXM B;  1GCQ C;  2RJD A;  3CCM Q;  3HP9 A;  1NJI C;  2EPD A;  1IHV A;  3WVE B;  3JCM d;  2CYZ B;  1WYX A;  4C0Z A;  1VQM A;  4FYW B;  1IB8 A;  2LX7 A;  1NE8 A;  2ZPH B;  2DE0 X;  2EGE A;  2RO0 A;  3HSB A;  2GTJ A;  4MZP A;  1K0S A;  1YFN A;  5GAO m;  5GAN 7;  1UEB A;  4J9G A;  3SB2 A;  2QQS A;  3DLM A;  5GAM e;  2SEM A;  2HQE A;  2VAS A;  4RCC A;  4FL6 A;  1G3Y A;  4L5G A;  3OYY A;  1EX4 A;  4PJO G;  1MUZ A;  3UPU A;  1WJR A;  2P0P A;  3CXC S;  3BFM A;  1YHQ T;  2JJ9 A;  1YJN A;  4C92 F;  2ZPB B;  1C1A A;  5D6X A;  4PJO C;  3QUI A;  2D8J A;  3OS2 A;  3A8O B;  4B9X A;  1NLO C;  2M0Y A;  1M3B A;  1PD1 A;  1D1B A;  3H0H A;  5GMK m;  4PKC C;  1Q86 C;  2DXT A;  1PG5 B;  5GAO r;  4KH1 B;  3S3O A;  4J9I A;  4GY5 A;  2RI3 A;  3MEV A;  2K79 A;  4M7A B;  4MZT A;  1TUD A;  2K57 A;  4M75 A;  1CKB A;  3L2R A;  2K4Y A;  2YHT A;  2ABL A;  4Y92 A;  1JXO A;  2DRM A;  2KRO A;  2OTL Q;  3VS7 A;  1A0N B;  2MK5 A;  1M2V A;  2KMT A;  2M1H A;  2KT8 A;  3LH0 A;  4A4G A;  2FO0 A;  2ZCF B;  1V76 A;  3LGL A;  2XID A;  3EGX B;  3I5S A;  3JCM J;  1WHK A;  2OTJ A;  1D0Y A;  1OV3 A;  4IUV A;  3TQ7 P;  3CCQ T;  4RTV A;  1V29 B;  3JB9 J;  1VIE A;  1ZQ1 A;  3VS3 A;  1N27 A;  2BZ8 A;  4C5E A;  3HFO A;  3HTR A;  5LJ5 d;  3CCJ T;  3NHN A;  3S3N A;  2VGM A;  1M1G A;  1PKS A;  2X4Y A;  2H3J A;  3M0Q A;  4M77 F;  4RKU E;  4KBM B;  3A8M B;  5GAM f;  4L6V 5;  1TSF A;  3CD6 T;  1ZBX A;  2X4X A;  4QKU A;  1GCQ A;  2DAQ A;  2COY A;  1MGQ A;  4PFZ A;  4KGZ B;  3PTA A;  2BIV A;  2JT4 A;  1G2B A;  3M55 A;  2V8J A;  2ED1 A;  3MJX A;  1LJO A;  4HCZ A;  3CXC A;  5I22 A;  1IO6 A;  3E9F A;  4IUT A;  4Z89 A;  5GMK j;  4BDZ A;  3GIB A;  1QWF A;  2K3X A;  3GBQ A;  4XQ3 A;  1G5V A;  5C6S A;  2H8H A;  3CCE T;  4OP0 A;  4CC4 B;  3X28 B;  4P5N A;  4DBH A;  3EG0 A;  2BE7 D;  4F17 A;  3EH2 A;  3RMS A;  1X75 C;  3CBP A;  3LX7 A;  1VQ4 T;  1N6A A;  4A4H A;  1M9S A;  3A8H B;  4N4G A;  4RUG A;  1ACM B;  4IUU A;  1UB4 A;  2E1H A;  2EKO A;  4M75 B;  4HCK A;  5DM7 R;  2DMO A;  3OA6 A;  3I35 A;  2F1L A;  4M75 F;  2F2W A;  5IT9 E;  4PFO A;  2GFU A;  3OW2 S;  1S72 T;  4BAC A;  2HQH A;  3QWX X;  2AZS A;  2JS0 A;  3TSW A;  5GAN 2;  1M1K C;  2LCL A;  1MMN A;  4F16 A;  4MDX A;  2J06 A;  2LJ0 A;  5GAN 6;  4XU1 A;  5GAO p;  3DB4 A;  4FW2 A;  1EIF A;  1RAF B;  4XTV A;  3TCJ A;  1RAB B;  1VA7 A;  2CSQ A;  3M9Q A;  1NYG A;  3V8L A;  3LWH A;  1YJW T;  2XD0 A;  1V1C A;  2LJ3 A;  2EAY A;  2CUB A;  4FCY A;  3J81 E;  1UHC A;  1YWO A;  2RQU A;  5J26 A;  3HFN A;  4M7D G;  4M7A G;  1VQP Q;  2PUO B;  3G71 Q;  3QII A;  2KBT A;  1KQS S;  3OYM A;  2YUO A;  1I1J A;  4OMQ A;  2Z0W A;  4N0A C;  4FYV B;  1FYN A;  3EGD B;  1I4K 1;  4KT0 E;  2HSP A;  1I07 A;  2FRW A;  4HXJ A;  2EYQ A;  5FWB A;  4BY6 C;  4HT9 A;  2E12 A;  1AWJ A;  4EDU A;  1M1F A;  2DTI A;  4JRI A;  1Q7Y R;  2EGA A;  2GGR A;  3OYE A;  2DA9 A;  1VQL Q;  1JJ2 A;  5CKF A;  3EG9 A;  1QVG P;  2PQW A;  4M7D A;  2M9U A;  4J83 A;  9ATC B;  1WLP B;  3UDC A;  2V8K A;  3EGU A;  1VQK A;  2RHU A;  2WSC E;  3MPU B;  3KBG A;  2JVV A;  1WIE A;  4HVU A;  5GAM j;  1TUG B;  4PFP A;  1VQ9 T;  6AT1 B;  1NPP A;  2HBW A;  1MMG A;  3M54 A;  3U23 A;  3P8B B;  2ZPG B;  4E7Z A;  2EJG A;  3EAE A;  1WDX A;  3LLR A;  3MEU A;  2XI9 A;  3VYH B;  4QW2 A;  1M5Q 1;  1VQO A;  4JDS A;  1NLP C;  3TEE A;  2LQW A;  1X27 A;  2DO3 A;  4PL6 A;  1C6V X;  4WTO B;  2C06 A;  2K2V A;  4BI8 B;  5KYN A;  1Y71 A;  2O88 A;  2DL5 A;  1GRI A;  3UA7 A;  2L5Q A;  1PSF A;  4C0G A;  4JRP A;  3CME Q;  1WXB A;  2QAZ A;  5I11 A;  1UEC A;  4OB1 B;  1UGQ B;  5IH2 A;  1W6X A;  2QDY B;  1RAA B;  4PNO A;  2CT3 A;  4RCB A;  4RTZ A;  3MEA A;  2O9V A;  1VQP T;  2K9G A;  2ZPI B;  3INZ A;  1LVK A;  2BZY A;  3JCM h;  4M7A D;  1OZ2 A;  3QZ5 B;  1YJW Q;  1WHJ A;  2PVG B;  4FYY B;  1VQK T;  4N4I A;  4D8K A;  5DLQ E;  3G6E T;  1YIJ Q;  3HKS A;  3MP6 A;  1HJD A;  1AZG B;  3REB B;  1E6H A;  2HSE B;  3JCM P;  1TS9 A;  2RHZ A;  4AFZ C;  3P8H A;  4WCI A;  4GBQ A;  1M4Z A;  2AIR B;  2EJ9 A;  2M16 A;  5HK0 A;  3JCM e;  1K0X A;  2E3I A;  2RF0 A;  1OI1 A;  2DYI A;  3M59 A;  2MAM A;  3TU4 K;  1ZX6 A;  2YUQ A;  1K9M U;  2CZ7 B;  1Y0M A;  2DL7 A;  3ZFJ A;  2IVW A;  2EFI A;  3RKY A;  1WQ7 A;  2JTF A;  2KXC A;  2OJ2 A;  3BDU A;  1VQK Q;  1ZSZ B;  4F14 A;  1M90 C;  3OYN A;  5LJ3 d;  3FC3 A;  2P0Q A;  2X9H A;  1WFW A;  3ASK A;  2NUT A;  3GOX A;  2MMP A;  5CKD A;  2COW A;  2RJE A;  3VS2 A;  1NZ9 A;  4LDU A;  3CMA A;  1WJS A;  2JM8 A;  3G7Z A;  4LN2 A;  4CI0 C;  4F7U A;  2A0F B;  1AVZ C;  5I2M A;  2RM4 A;  4M7A F;  3CME T;  5KYY B;  2RA2 A;  1Y57 A;  1VQ7 Q;  1KQS P;  2HBP A;  3PVL A;  4AT1 B;  5KYW B;  1EZZ B;  3QJ6 A;  4C8Q G;  2CP0 A;  3EFO B;  1N5Z A;  2XMF A;  2ESW A;  1KD1 U;  3VV0 A;  1WI7 A;  4ME7 A;  2YT6 A;  4LD6 A;  2R5M A;  3OYK A;  3CBM A;  2VXE A;  5KYU B;  2D1X A;  4D8D A;  1RL2 A;  1KQ2 A;  1XOV A;  3JCM f;  1CKA A;  3CMA Q;  2CKK A;  1X43 A;  4RTX A;  3NPF A;  4PK4 A;  1FMW A;  4BI3 A;  1AEY A;  1SSF A;  1BK2 A;  4OB0 B;  1VQ5 T;  1X69 A;  3N5B B;  4ELY C;  3CMA T;  1X6G A;  2BUD A;  3CCL T;  2CP5 A;  2ZPE B;  4JS5 A;  1Q86 R;  2O31 A;  4ANJ A;  3FDR A;  2AK5 A;  4M78 A;  1JB0 E;  1G3S A;  2AKL A;  2DIQ A;  4E7I A;  1EFN A;  3CCR Q;  1VUB A;  4X1V A;  2RI2 A;  4MZM A;  2QAS A;  5ECA A;  1VQ8 Q;  4KGX B;  2J05 A;  1BI1 A;  4M77 D;  1ABQ A;  5GAO q;  2LNV A;  4IIM A;  1RAD B;  3DKM A;  1SRL A;  2ROT A;  3QXE B;  1BI3 A;  1JEG A;  1HD3 A;  1Q95 G;  1SRM A;  2FZK B;  2DVJ A;  4OMP A;  1QCN A;  3JAM E;  2CDT A;  3L1A A;  1K73 C;  1UGP B;  4C8Q D;  2PU9 B;  1OOT A;  4PLL A;  2QQ9 A;  4FM4 B;  2GQV A;  3G6E A;  2FZG B;  3SEM A;  5LJ3 g;  4E6R A;  3G4S T;  1WPY A;  2MF2 A;  3C95 A;  4E7S A;  3M5A A;  1KK7 A;  3TVT A;  1HK9 A;  2O4X B;  1M3C A;  2F69 A;  2CUD A;  1KC8 C;  3SFM A;  5LJ5 j;  3QDR B;  1YJ9 T;  4M77 A;  1R0B G;  4LDY A;  3FB9 A;  1AOJ A;  2RD1 A;  1GXI E;  1JU5 C;  1PRL C;  2OX7 A;  3QYG B;  1D1C A;  4FSX A;  1DJ7 B;  1T0J A;  1OX9 A;  2DTH A;  2LZ6 B;  4JJD A;  4C0D B;  2DM1 A;  2ZZD A;  3QBY A;  1VQN Q;  5GMK i;  1UGV A;  2QXF A;  3LH5 A;  4C5G A;  2QDL A;  2KY9 A;  1NEG A;  2KR3 A;  1GFC A;  3VU3 C;  3G6E Q;  5CQX A;  2NUT B;  2CT4 A;  2DX1 A;  3CD6 Q;  1BI2 A;  1RAC B;  2E5K A;  4N4H A;  1X01 A;  1ZBJ A;  1AT1 B;  3FJP A;  2IIM A;  3LW5 E;  2L0A A;  4X9D A;  4ORZ A;  5FU7 B;  4C92 B;  1Q7Y C;  2E5Q A;  4MML A;  2LCC A;  3OYL A;  1M1K U;  3AT1 B;  1QVG A;  4FT4 A;  1QKW A;  1AWW A;  1NBE B;  3TRE A;  2QQR A;  4XTY A;  4M78 E;  2HCK A;  3OY9 A;  3BE3 A;  4GLM A;  4OF1 A;  1D0Z A;  4AG2 C;  2KYB A;  4PJO A;  2FVU A;  3R6O A;  3A1P A;  4EMH A;  2MWO A;  4XK8 E;  5CKE A;  2EKH A;  1VIF A;  2J6O A;  1ARK A;  2EBP A;  3M0T A;  1RLP C;  3SWN B;  4K11 A;  4A4K A;  5L23 A;  3H8Z A;  1ZSZ C;  1H92 A;  4KUL A;  4MDW A;  3S6W A;  1UJ0 A;  3L2W A;  2K6D A;  3G71 A;  1ZSG A;  4FYX B;  1JRI A;  5IXB A;  1YNZ A;  3CC4 Q;  2DL8 A;  4M7D B;  2EW3 A;  2YLC A;  1IRX A;  3FJ5 A;  3CBO A;  1N9S A;  3LYI A;  1QMC A;  3AHU A;  4OML A;  2F2V A;  5LL6 S;  1UTI A;  1BBZ A;  3L2Q A;  3M4G A;  2ATC B;  2ZAE A;  1K9M C;  1ZSZ A;  3V7C A;  2I2L A;  3G1J A;  2YUN A;  1YJN T;  1SPK A;  4J7F A;  1F1B B;  3PE0 A;  3VYG A;  1VQL T;  4E47 A;  1M3A A;  4PJM A;  4M78 B;  1Y96 B;  4IUP A;  2JN0 A;  5IN1 A;  1WNL A;  3EG3 A;  1MHN A;  1RUW A;  1X6O A;  2VUB A;  1MMA A;  2AKK A;  3RKX A;  2QEX Q;  1I5O B;  4FT2 A;  2W0Z A;  1WHL A;  2DZ9 A;  4XU3 A;  2XU8 A;  2XDP A;  2X35 A;  3M4Y A;  4RTU A;  3M0P A;  4PJL A;  4C92 D;  1WGS A;  5IHI A;  2E10 A;  3OYF A;  2LDM A;  2QGF B;  2FL7 A;  4D6W A;  2RI5 A;  4Z8A A;  2B8A A;  1U1S A;  2QEX T;  3CME A;  1K76 A;  2DLP A;  3NTK A;  2XIC A;  2Y4Y A;  1UGR B;  2MCN A;  4F04 B;  1YN8 A;  2D0Q B;  1VQM T;  2HMA A;  3P8D A;  4M7A E;  3CCU T;  3OYC A;  5LJ5 f;  1IHW A;  5A0G A;  3KXT A;  3CCU Q;  1PNJ A;  2A37 A;  1G83 A;  4PLI A;  3RDV A;  3ER0 A;  4PJO D;  2EYW A;  3BY7 A;  2BKD N;  1KQ1 A;  3CC2 Q;  2O4X A;  4JPB W;  2QA4 Q;  1UHF A;  2A3L A;  4OMN A;  4LUE A;  1WZO A;  3UWN A;  2DK3 A;  5A0D A;  1Z9Q A;  3QSU A;  1VYU A;  5HKC A;  2KVQ G;  5FWC A;  4J9C A;  4M7D C;  2LT1 A;  1PCX A;  2O2O A;  4KUD K;  1RAG B;  1VQ6 Q;  1H64 1;  4JS4 A;  2PTK A;  1HYO A;  1BU1 A;  4WF2 A;  1NJI R;  3A98 A;  1QVF P;  1YI2 T;  1M8M A;  2Y90 A;  3OB9 A;  2BE9 B;  3V7S A;  2LMJ A;  1QCO A;  2LX9 A;  1QQJ A;  1D3B B;  2O9S A;  2RMO A;  2EIF A;  1KC8 R;  1JXM A;  2E70 A;  4DBQ A;  2L2P A;  2VV5 A;  3NFC A;  3QWY A;  5CCA A;  1D3B A;  3ME9 A;  2YXY A;  1FX7 A;  3PMI A;  2A7Y A;  2F2X A;  3A5Z B;  2COZ A;  4JLG A;  2V26 A;  3SHW A;  4F7U F;  5CK9 A;  3GNF B;  2RQT A;  4DA4 A;  3RUX A;  1TG0 A;  1MMD A;  4VUB A;  3I55 A;  3S3M A;  3OYH A;  2B86 A;  2MWP A;  4DEY A;  1GCP A;  3UA6 A;  2K5L A;  1KG1 A;  3GF5 A;  4R55 A;  4PJJ A;  3FLG A;  1O9S A;  2MOX A;  1GL5 A;  2AZV A;  4C8Q E;  1YCS B;  2JXB A;  4QQD A;  4C0D C;  3VS6 A;  2YUP A;  3JB9 F;  2LC4 A;  5FLX E;  4FIB A;  4IIO A;  1Q81 U;  2DIG A;  4LUD A;  5KCO A;  1G3T A;  4CRI A;  2DD5 A;  1T3L A;  1JBM A;  2JTM A;  2MI6 A;  3OW2 P;  2P0K A;  3VKI A;  2ROL A;  3IQL A;  3RIR A;  3I5R A;  1BIB A;  4NS5 A;  1K9A A;  3CCM A;  2CP6 A;  2DF6 A;  3MCA B;  2QA4 T;  1SF9 A;  1Q86 U;  1RAI B;  4F7U G;  4J9H A;  1Y7X A;  5KYY A;  2JUF A;  5AYF A;  4ZTJ A;  4M77 E;  3PIO A;  2CP2 A;  1PSE A;  4JZ3 A;  1OU9 A;  2JOY A;  1BCM A;  1M1K R;  3LGF A;  1NG2 A;  1RI9 A;  2YDL A;  3OQ5 A;  2BTT A;  4C8Q F;  1VQN T;  4BI4 A;  1X2Q A;  1TOV A;  3CC7 A;  4EPC A;  3C12 A;  2DXB A;  3EG2 A;  1UUE A;  2FHD A;  4JLI A;  1M27 C;  4M75 C;  2QEX A;  2PVO B;  3QKJ A;  4Y91 A;  2EYZ A;  3JB9 H;  1WHM A;  5HK3 A;  5CR2 A;  1ZLM A;  4M75 E;  1PKT A;  5J39 A;  4GLK A;  5IHN A;  1K4U S;  3JV3 A;  3DLL A;  4M75 G;  3REA B;  5J3B A;  3M0S A;  1Q82 R;  1BKB A;  1MV3 A;  3UAT A;  3G4S Q;  1YJ9 Q;  3UF4 A;  2EQU A;  2FRY A;  4ZGE B;  2JS2 A;  2K7A A;  2KYM A;  1S72 A;  2EQI A;  1AWO A;  3D7S B;  1JJ2 S;  3JCM b;  3ULR B;  2D6F A;  2OTJ Q;  3EHQ A;  2RB6 A;  1YJN Q;  1N8R C;  1KFZ A;  1M2V B;  2WSE E;  3CC4 T;  2KRN A;  4HA8 A;  2LNH B;  1XTD A;  2F5T X;  4BUG A;  4RTW A;  2DBM A;  3CC2 A;  1IGU A;  2PVD B;  3MP8 A;  4A63 B;  3QJY A;  3T9N A;  1OZ3 A;  1QP2 A;  4OMM A;  4M4Z A;  1VQP A;  4J6Y A;  2DL3 A;  2M0O A;  1M2O A;  4C92 A;  4DEX A;  2VC8 A;  2EQK A;  2DVE A;  1VQO Q;  2XK0 A;  3X25 B;  4LDW A;  3HRU A;  5KE3 A;  2HKQ B;  4QQG A;  2OAW A;  1X2K A;  4M78 D;  5GAN g;  4M77 B;  3CC7 Q;  1UE9 A;  2W10 A;  5FRM A;  3MET A;  4QVZ A;  1N8R U;  3L2U A;  3I9Q A;  3KUF A;  3I55 T;  3OYD A;  1WX6 A;  4FU6 A;  2X3W D;  4M7A C;  1M8V A;  1D1A A;  2QG9 B;  1B3Q A;  1QVP A;  1VYV A;  3FEO A;  2HEQ A;  5GMK h;  2RQV A;  1NEB A;  4Q5W A;  3SWN A;  1R77 A;  4RG2 A;  2GF7 A;  4A4F A;  3H41 A;  3RNJ A;  3EGD A;  5EC7 A;  5LJ5 g;  3G4S A;  1QVF S;  2CZ0 B;  1YI2 Q;  2FPF A;  5A0L A;  2FPD A;  4HKE A;  2LTO A;  4E7L A;  2L89 A;  4HVV A;  2GTO A;  2V8I A;  1S72 Q;  3JB9 I;  1Q7Y U;  5LJ3 h;  2HD0 A;  4OVA A;  4CC7 A;  2LQK A;  3GNG A;  1VYT A;  4ZGD B;  2LCS A;  3OBY A;  1I81 A;  1TTH B;  4XAX B;  3CPW A;  1TUC A;  3I56 Q;  1PWT A;  4JJN K;  1Q81 C;  3CPW P;  4ESR A;  1G8X A;  3VRZ A;  2KGT A;  2ZGW A;  4XTX A;  1GFD A;  1XNI A;  3M58 A;  2YRV A;  1U5S A;  3O5Z A;  2CH4 A;  4C0F A;  2EGC A;  3C0C A;  1WJQ A;  1PD0 A;  4C5I A;  3MP1 A;  4C5H A;  5CAI A;  2NUP A;  3A8L B;  3CCJ A;  1T0H A;  3CCV Q;  1XQH A;  4C92 E;  4HT8 A;  3M0R A;  3OBW A;  1YHQ A;  2E41 A;  2OTL A;  2L3S A;  3J7A F;  2RPN A;  2CS7 A;  2LVM A;  5KH6 A;  3OS1 A;  2P84 A;  2KXD A;  2DJZ A;  2DJQ A;  1BYM A;  1SHG A;  4XTW A;  1X6B A;  1M30 A;  2DXC A;  2E4H A;  2E3H A;  4BY6 B;  1KJW A;  4M7D E;  4Z88 A;  2HQX A;  1LCK A;  1PC0 A;  3VUB A;  1OPK A;  5GAM g;  1RAE B;  2KK4 A;  1FMK A;  4EMK A;  4EIK A;  3QO3 A;  4DQ2 A;  5KYU A;  2KRM A;  3C4S A;  4F7U B;  1YI2 A;  1MND A;  3E9G A;  1VQ5 Q;  3PGG A;  2IG0 A;  3Q1J A;  4YTL A;  1B34 A;  4QVC A;  4UC4 A;  5FW9 A;  4AMC A;  1YJ9 A;  5GJV B;  3E19 A;  3CCQ Q;  5I21 A;  1U8R A;  4B9W A;  4DBF A;  3CXC P;  4QVD A;  1FWZ A;  4C8Q A;  5L8R E;  2GCX A;  2RQW A;  2YRD A;  2L3R A;  1KQS A;  3CCS A;  1ABO A;  2CP3 A;  1RI0 A;  1LOJ A;  4M77 C;  2Y4X A;  4RG8 A;  3I56 A;  3VS0 A;  3LWI A;  1VQL A;  4NL2 A;  2OTL T;  1VQ7 T;  1PM3 A;  4IKF A;  1AD5 A;  2QTX A;  3JCM V;  3MHX A;  4BD3 A;  3L42 A;  1N8R R;  1K73 U;  2HKN A;  2J6F A;  5LJ3 e;  2GFA A;  4OB3 B;  3E1S A;  1VQ8 T;  1N9R A;  2EQJ A;  4ZN3 A;  3EG1 A;  3CCR T;  2RJC A;  3DB3 A;  2KI7 A;  3CCE A;  3QDF A;  2AT1 B;  4KGV B;  4C8Q C;  1WXT A;  2JMC A;  3JCM Q;  2JTE A;  1VQ5 A;  1SG5 A;  2LP5 A;  5GMK e;  1YHQ Q;  1KC8 U;  1VQ4 Q;  1I8F A;  2BZX A;  4R0K A;  1D09 B;  4JJB A;  1NYF A;  5AT1 B;  1HSQ A;  2HL3 A;  3H0I A;  3CCQ A;  1GBR A;  2AHJ B;  3GPL A;  1QKX A;  3BW1 A;  4OB2 B;  4EMK B;  4OGC A;  1D0X A;  4QT7 A;  2R5A A;  1IXD A;  5GAN 8;  2OI3 A;  2M02 A;  3G71 T;  3M57 A;  5FRO A;  1T3S A;  5CVI A;  2L8D A;  5FU6 C;  1R0C B;  3EFR A;  1ZUU A;  4XU2 A;  3PFS A;  8ATC B;  1FXX A;  3MO8 A;  1YJW A;  4EMK C;  1QLY A;  2RH2 A;  4TVR A;  2DNU A;  5I2S A;  4AFQ C;  4A53 A;  2X4J A;  2VKN A;  4J7I A;  4BDY A;  1RAH B;  2DKG A;  2JM9 A;  3CC7 T;  2JNG A;  3RMQ A;  3CCS T;  5LJ3 f;  2L3P A;  2DEQ A;  2LQN A;  2QTV A;  4PJO F;  2DD4 A;  3OSV A;  3JCM W;  5GJW B;  4LDV A;  4ATO A;  2PUK B;  4HCC A;  2ED0 A;  5CQY A;  3CEY A;  2DYB A;  5IAY A;  2A36 A;  3JB9 G;  2NUZ A;  3PNW C;  2G6F X;  3CCU A;  1VQ9 A;  4JRQ A;  2XG8 D;  1AWX A;  1AHJ B;  3NMZ C;  1PHT A;  1OX8 A;  3ZEH A;  3TSZ A;  4X9C A;  5GAN h;  1W1F A;  2XDB A;  4A54 A;  1YIJ T;  4LDX A;  1G3W A;  2X4W A;  1OUL A;  5IHK A;  1BCO A;  5D6W A;  4R56 A;  3E2U A;  3CPW S;  5KYX B;  4E7J A;  3ZL7 C;  2QQB A;  2E64 A;  2EVR A;  4ZN1 A;  4FSS A;  2VVK A;  1Q82 C;  4M78 G;  4NL3 A;  4LNP A;  4N0A A;  1OQK A;  3OS5 A;  1W4S A;  4F7U E;  3M53 A;  3PVQ A;  1Y07 A;  2KQW A;  5HCK A;  4XU0 A;  1VQO T;  1W2B P;  2KT1 A;  3M0U A;  2G3R A;  2NWM A;  4J9D A;  3H9N A;  2A28 A;  2K3B A;  4IUQ A;  3FRN A;  3V8J A;  1M90 R;  5FRN A;  4J9B A;  4ZGJ B;  4J5Y A;  1Y96 A;  3ZBD A;  2RHX A;  4RTT A;  4CC2 A;  1JQQ A;  2L3Q A;  1OU8 A;  2VB6 A;  3PIP A;  2XKO C;  2DTO A;  1P92 A;  1YP5 A;  2CZ1 B;  2RHI A;  2MYS A;  4M7A A;  4C92 C;  2EYY A;  1W70 A;  2HZY A;  3QYH B;  1KSW A;  2YWW A;  1QCF A;  4XTZ A;  5DLO A;  1Q81 R;  1WA7 A;  1NM7 A;  4KH0 B;  2OTJ T;  1BB9 A;  2GNC A;  1QWE A;  1QVG S;  3UT1 A;  1TXQ A;  2EYX A;  3NTI A;  1ZA2 B;  2DET A;  3CCR A;  5GAN 4;  3HHT B;  1AZE A;  1IZ6 A;  1VOM A;  2RHY A;  2C0O A;  3V7R A;  3JRZ A;  1H3H A;  3OMG A;  3I56 T;  1B07 A;  2LT4 A;  3X24 B;  1LNX A;  2X3X D;  5HY6 A;  4E7H A;  3OSS C;  3PMT A;  1KHI A;  1E7O A;  1W2B A;  2RJF A;  1UFF A;  5CO7 A;  2DL4 A;  3JSC A;  3QG1 A;  1SEM A;  3CCE Q;  2D9T A;  1PRM C;  1WXU A;  1MV0 B;  1K73 R;  1NJI U;  1CSK A;  1YIJ A;  4O5V A;  3EH1 A;  2SRC A;  1W2B S;  5KYW A;  2IPO B;  1VQ4 A;  5LJ3 j;  1QW1 A;  4EMG A;  4C8Q B;  1U1T A;  5LJ5 h;  2EQM A;  3SWN C;  3SD4 A;  3QHS A;  5GAO l;  2LQ8 A;  2ENM A;  2QK0 A;  2OAU A;  2MIO A;  2WAC A;  4M7D D;  2CZ6 B;  2MPX C;  2KNB B;  1KD1 R;  3QPH A;  3OYI A;  3OW2 A;  4BE0 A;  1HXD A;  2E6N A;  5EG2 A;  4J9E A;  8AT1 B;  1U3O A;  1Z9Z A;  1E6G A;  4RTY A;  1ZHI A;  4O6J A;  3CQT A;  4HCB A;  1O75 A;  1UJY A;  3F70 A;  5FU7 C;  5KYX A;  4OMO A;  3CCV T;  3OYB A;  3R6N A;  1TWB A;  4BB7 A;  3JCM g;  1VQN A;  3C94 A;  1KIK A;  2GQI A;  2KDS A;  1M90 U;  1K8A U;  1WHH A;  1OPL A;  5C0M A;  3NGP A;  3CCJ Q;  4BE1 A;  3HRS A;  4XTU A;  3JB9 D;  1VQ7 A;  5CKH A;  3RES A;  3VRY A;  1K8A C;  5M9O A;  2VYT A;  4BE2 A;  2DER A;  4HVW A;  3O8V A; 
#chains in the Genus database with same CATH homology
 4ZGD B;  4KUI A;  3RMS A;  3OBY A;  3OYJ A;  3SWN B;  1X75 C;  3CBP A;  3LX7 A;  4A4K A;  3H8Z A;  1I81 A;  1VQ4 T;  4KUL A;  4MDW A;  4XAX B;  2LRQ A;  2FB7 A;  1N6A A;  3CPW A;  4A4H A;  3S6W A;  3L2W A;  3G71 A;  1JRI A;  1M9S A;  3A8H B;  4M7D F;  4ZTF A;  4JJN K;  3NTH A;  4N4G A;  1Q81 C;  4Y28 E;  4IUU A;  1UB4 A;  2E1H A;  2EKO A;  4M75 B;  5DM7 R;  2ZGW A;  4XTX A;  4M7D B;  3OA6 A;  2YLC A;  1XNI A;  3M58 A;  3RER A;  3CBO A;  1N9S A;  2YRV A;  3LYI A;  4M75 F;  3AHU A;  5CIU A;  5IT9 E;  4DOW A;  5LL6 S;  4C0F A;  2GFU A;  5FU6 B;  1WJQ A;  2K5I A;  4C5I A;  3OW2 S;  3MP1 A;  4C5H A;  1S72 T;  1QP3 A;  4BAC A;  3HRT A;  1NPR A;  5CAI A;  3CPF A;  3A8L B;  5GAN 2;  3L2Q A;  3CCJ A;  2EWN A;  4II1 A;  1M1K C;  2XDD A;  2LCL A;  3M4G A;  4MDX A;  1K9M C;  1XQH A;  4C92 E;  4HT8 A;  3V7C A;  2XHC A;  5GAN 6;  2I2L A;  5GAM d;  5GAN 3;  3CC4 A;  3OBW A;  4XU1 A;  5GAO p;  4J7F A;  1YJN T;  5GMK l;  3DB4 A;  1YHQ A;  4Z02 A;  2E41 A;  4M78 F;  3VYG A;  1VQL T;  2OTL A;  4E47 A;  1EIF A;  4XTV A;  3TCJ A;  4OMF B;  3J7A F;  4M78 B;  3M9Q A;  1Y96 B;  1YIT A;  2KAF A;  2CS7 A;  3V8L A;  3LWH A;  2LVM A;  1YJW T;  2XD0 A;  4IUP A;  2EAY A;  2VXF A;  3EFS A;  5KH6 A;  2JN0 A;  3OS1 A;  3J81 E;  5IN1 A;  1WNL A;  4J6X A;  5J26 A;  3HFN A;  4M7D G;  1MHN A;  2DJZ A;  1VQ8 A;  4M7A G;  1BYM A;  1X6O A;  2PUO B;  2VUB A;  2QI2 A;  4XTW A;  3WVD B;  3RKX A;  4L59 A;  3QII A;  2DXC A;  1KQS S;  3OYM A;  4BY6 B;  4FT2 A;  4M7D E;  4N0A C;  3JCM X;  2DZ9 A;  2HQX A;  1I4K 1;  4XU3 A;  2XU8 A;  4X34 A;  1VQ6 T;  4KT0 E;  5CKB A;  3VUB A;  2XDP A;  2X35 A;  3M4Y A;  5GAM g;  2EYQ A;  2KK4 A;  4BY6 C;  4HT9 A;  2E12 A;  1YBY A;  4C92 D;  1WGS A;  4EMK A;  3H6Z A;  4EDU A;  1M1F A;  3QO3 A;  2E10 A;  4DQ2 A;  3OYF A;  3L2V A;  2LDM A;  2DTI A;  4JRI A;  2FYK A;  3C4S A;  4F7U B;  2FL7 A;  4M75 D;  1YI2 A;  4D6W A;  3E9G A;  3OYE A;  1R8O B;  2RI5 A;  3PGG A;  2IG0 A;  3Q1J A;  2B8A A;  1U1S A;  2QEX T;  3CME A;  4YTL A;  1B34 A;  1I5L A;  5CKF A;  4QVC A;  1JJ2 A;  1H3Z A;  3VJP A;  2PQW A;  3NTK A;  4UC4 A;  2M9U A;  4J83 A;  4M7D A;  2XIC A;  3UDC A;  2Y4Y A;  2V8K A;  1UGR B;  1YJ9 A;  1VQK A;  2VGN A;  3E19 A;  2RHU A;  3RKW A;  2WSC E;  3X26 B;  3OS0 A;  3MEW A;  5I21 A;  1U8R A;  3KBG A;  2JVV A;  2D0Q B;  3JCM c;  4B9W A;  1VQM T;  5GAM j;  1VQ9 T;  3FIF A;  4QQ6 A;  4QVD A;  1NPP A;  3P8D A;  4J8O A;  2QA4 A;  1FWZ A;  2KSS A;  4C8Q A;  4M7A E;  3CCU T;  3M54 A;  5L8R E;  3OYC A;  5LJ5 f;  2GCX A;  1YCY A;  3P8B B;  4M77 G;  3CCM T;  2ZPG B;  2L3R A;  4JUV A;  5A0G A;  3KXT A;  1KQS A;  2EJG A;  3CCS A;  3CC2 T;  1RI0 A;  3EAE A;  1LOJ A;  3LLR A;  4PJO B;  4M77 C;  2Y4X A;  2XI9 A;  3MEU A;  4RG8 A;  3VYH B;  3I56 A;  4NL2 A;  4PLI A;  4QW2 A;  3LWI A;  1M5Q 1;  4RMO A;  1VQ7 T;  2OTL T;  3ER0 A;  1VQO A;  4IKF A;  4JDS A;  4PJO D;  3TEE A;  2QTX A;  4PJO E;  2EJF A;  3MHX A;  3JCM V;  4BD3 A;  3BY7 A;  3L42 A;  1K73 U;  2DO3 A;  5LJ3 e;  2BKD N;  1KQ1 A;  2NLU A;  4C92 G;  2O4X A;  2GFA A;  4OB3 B;  3E1S A;  4PL6 A;  1VQ8 T;  1N9R A;  2EQJ A;  2A3L A;  3SDZ A;  3VUZ A;  2E6Z A;  4ZN3 A;  3CCR T;  2RJC A;  2C06 A;  2K2V A;  3DB3 A;  4BI8 B;  1Y71 A;  3UWN A;  5GAO n;  3CCE A;  5GAN j;  2DK3 A;  5A0D A;  2L5Q A;  4C8Q C;  2HAX A;  1PSF A;  4C0G A;  3QSU A;  1TH7 A;  5D6Y A;  4JRP A;  5HKC A;  2KVQ G;  1KD1 C;  3JCM Q;  1VQ5 A;  4M7D C;  2LT1 A;  4OB1 B;  4KUD K;  1UGQ B;  1H64 1;  5GMK e;  4JS4 A;  1KC8 U;  2QDY B;  4PNO A;  4WF2 A;  1I8F A;  4RCB A;  3MEA A;  3GP8 A;  1YI2 T;  2Y90 A;  2QQA A;  3CD6 A;  3OB9 A;  3CCQ A;  1VQP T;  2JZ2 A;  2ZPI B;  2AHJ B;  2DPP B;  2ZPF B;  3INZ A;  3GPL A;  3L2Z A;  2E65 A;  1WQW A;  3V7S A;  5GAM h;  2LX9 A;  5GAN e;  3BW1 A;  3JCM h;  5GAN d;  4M7A D;  1OZ2 A;  3QZ5 B;  1D3B B;  3CCV A;  2EIF A;  4OB2 B;  4EMK B;  4OGC A;  4V2S A;  2PVG B;  2E70 A;  1VQK T;  4N4I A;  2VV5 A;  3NFC A;  1VQ6 A;  2R5A A;  4A4E A;  2R58 A;  5DLQ E;  3G6E T;  5CCA A;  4OGE A;  5GAN 8;  1BI0 A;  1D3B A;  3HKS A;  3ME9 A;  3X20 B;  3MP6 A;  3G71 T;  1Q82 U;  3M57 A;  2CGH A;  1FX7 A;  2DZC A;  3PMI A;  2A7Y A;  5FRO A;  4DOV A;  5KE2 A;  3JCM P;  2RK1 A;  2P4T A;  2YLB A;  3A5Z B;  2O01 E;  2RHZ A;  4M78 C;  3P8H A;  5CVI A;  3HL8 A;  2L8D A;  5KCH A;  4JLG A;  5FU6 C;  5GAN 5;  3EFR A;  1M4Z A;  2EJ9 A;  2M16 A;  4XU2 A;  4LD9 K;  3PFS A;  4F7U F;  1KHC A;  5HK0 A;  5CK9 A;  1FXX A;  3MO8 A;  3GLX A;  3JCM e;  1B34 B;  1YJW A;  4EMK C;  4ELZ C;  1OI1 A;  3GNF B;  3M59 A;  2MAM A;  3TU4 K;  1QVF A;  4DA4 A;  2RH2 A;  1BIA A;  3RUX A;  5LJ5 e;  4TVR A;  1K9M U;  2CZ7 B;  4VUB A;  3I55 A;  4JRK A;  2RK2 A;  5I2S A;  3S3M A;  4A53 A;  3OYH A;  2MWP A;  3ZFJ A;  2IVW A;  2EFI A;  3RKY A;  1WQ7 A;  2JTF A;  2X4J A;  3BDU A;  2K5L A;  1M90 C;  1KG1 A;  4J7I A;  3OYN A;  4BDY A;  5LJ3 d;  3FC3 A;  3GF5 A;  2DKG A;  3HPW A;  3CC7 T;  2K5F A;  3M56 A;  2P0Q A;  2DXU A;  2JNG A;  2F5K A;  5DY9 A;  4R55 A;  3FLG A;  1O9S A;  2HNI A;  3ASK A;  3RMQ A;  3CCS T;  3GOX A;  5LJ3 f;  2DEQ A;  1UGS B;  4C8Q E;  2MMP A;  3A8G B;  3OYA A;  4QQD A;  4C0D C;  4MMK A;  4PJO F;  5CKD A;  4E7K A;  1YIT T;  2RJE A;  3JB9 F;  2DD4 A;  2LC4 A;  3OSV A;  5FLX E;  3JCM W;  4FIB A;  1Q81 U;  3CCL A;  1NZ9 A;  2DIG A;  4LDU A;  1WJS A;  3QZ9 B;  4LDV A;  3CMA A;  4ATO A;  3G7Z A;  4CI0 C;  2PUK B;  4F7U A;  4HCC A;  5I2M A;  5KCO A;  1G3T A;  2RM4 A;  4M7A F;  4IUR A;  1IRE B;  3OYG A;  4CRI A;  2DD5 A;  2R57 A;  3CME T;  2K3Y A;  1JBM A;  2JTM A;  2MI6 A;  5CQY A;  2RA2 A;  2P0K A;  3CEY A;  3VKI A;  3V8K A;  5IAY A;  3RIR A;  1BIB A;  4NS5 A;  3JB9 G;  2HBP A;  3CCM A;  3J80 E;  5A2Q E;  4J6W A;  2WSF E;  3MCA B;  2QA4 T;  3URG A;  3PNW C;  3CCU A;  3OMC A;  1VQ9 A;  4JRQ A;  2XG8 D;  1Q86 U;  3QJ6 A;  4NOY A;  4F7U G;  1Y7X A;  4C8Q G;  5GAN f;  2JUF A;  1AHJ B;  5AYF A;  4ZTJ A;  3BDL A;  3ZEH A;  3PT9 A;  4M77 E;  3PIO A;  1OYX A;  1PSE A;  4X9C A;  5GAN h;  3WXM B;  2JOY A;  2RJD A;  3LGF A;  3VV0 A;  1KD1 U;  4ME7 A;  2XDB A;  4A54 A;  1YIJ T;  4LD6 A;  3HP9 A;  2R5M A;  3OYK A;  1NJI C;  3CBM A;  4LDX A;  1G3W A;  2VXE A;  3WVE B;  3JCM d;  3OQ5 A;  2CYZ B;  2X4W A;  4C8Q F;  1VQN T;  1RL2 A;  4BI4 A;  4C0Z A;  1VQM A;  5D6W A;  4R56 A;  1KQ2 A;  1NE8 A;  3CPW S;  4E7J A;  2QQB A;  1XOV A;  2E64 A;  3CC7 A;  4EPC A;  4ZN1 A;  3C12 A;  2DXB A;  3JCM f;  1Q82 C;  2ZPH B;  4M78 G;  2CKK A;  4NL3 A;  2RO0 A;  3HSB A;  4N0A A;  4BI3 A;  2FHD A;  4JLI A;  3OS5 A;  4M75 C;  1W4S A;  1SSF A;  4MZP A;  4F7U E;  5GAO m;  3M53 A;  4OB0 B;  5GAN 7;  1UEB A;  2QEX A;  2PVO B;  3QKJ A;  1Y07 A;  2KQW A;  1VQ5 T;  4XU0 A;  1VQO T;  3N5B B;  4Y91 A;  2G3R A;  4ELY C;  3JB9 H;  3CMA T;  5HK3 A;  5CR2 A;  3SB2 A;  2QQS A;  3DLM A;  2BUD A;  5GAM e;  3CCL T;  4M75 E;  2HQE A;  4IUQ A;  3FRN A;  3V8J A;  2ZPE B;  5J39 A;  4JS5 A;  4GLK A;  5FRN A;  3FDR A;  4RCC A;  4ZGJ B;  4FL6 A;  4M78 A;  4J5Y A;  1Y96 A;  1G3Y A;  4L5G A;  1JB0 E;  3ZBD A;  3DLL A;  1G3S A;  2RHX A;  3OYY A;  4M75 G;  2DIQ A;  4E7I A;  4PJO G;  5J3B A;  3UPU A;  1WJR A;  1VUB A;  2P0P A;  2RI2 A;  1BKB A;  4MZM A;  3CXC S;  3PIP A;  3BFM A;  1YHQ T;  2XKO C;  1YJN A;  4C92 F;  2ZPB B;  2DTO A;  1BI1 A;  1P92 A;  2CZ1 B;  4M77 D;  2RHI A;  4M7A A;  5D6X A;  4C92 C;  2EQU A;  5GAO q;  4PJO C;  2LNV A;  4ZGE B;  3QUI A;  3DKM A;  3QXE B;  3OS2 A;  3A8O B;  4B9X A;  1BI3 A;  3QYH B;  4XTZ A;  5DLO A;  5GMK m;  1S72 A;  4PKC C;  2OTJ T;  1Q86 C;  1QVG S;  2DXT A;  3UT1 A;  1JJ2 S;  5GAO r;  3JCM b;  3NTI A;  3S3O A;  2D6F A;  3JAM E;  3CCR A;  4GY5 A;  2RI3 A;  3MEV A;  3HHT B;  2RB6 A;  3L1A A;  2K57 A;  4MZT A;  4M7A B;  5GAN 4;  4M75 A;  3L2R A;  1IZ6 A;  1K73 C;  1N8R C;  1UGP B;  2WSE E;  2PU9 B;  4C8Q D;  2RHY A;  2K4Y A;  3CC4 T;  2YHT A;  4PLL A;  2QQ9 A;  4FM4 B;  2GQV A;  3JRZ A;  3V7R A;  3G6E A;  4HA8 A;  5LJ3 g;  3OMG A;  3I56 T;  2LT4 A;  2KMT A;  2M1H A;  1WPY A;  2MF2 A;  1LNX A;  3C95 A;  5HY6 A;  3X24 B;  3G4S T;  4E7H A;  1XTD A;  3LH0 A;  2F5T X;  3OSS C;  3PMT A;  4BUG A;  4A4G A;  1KHI A;  3CC2 A;  1W2B A;  2PVD B;  3M5A A;  3MP8 A;  2RJF A;  2ZCF B;  3QJY A;  5CO7 A;  3T9N A;  3LGL A;  2XID A;  1OZ3 A;  3JSC A;  1HK9 A;  2O4X B;  3QG1 A;  3JCM J;  2OTJ A;  1QP2 A;  4IUV A;  2D9T A;  3CCQ T;  4J6Y A;  2F69 A;  1VQP A;  1KC8 C;  3SFM A;  5LJ5 j;  3QDR B;  1NJI U;  1V29 B;  3JB9 J;  1YIJ A;  2M0O A;  1VIE A;  4C92 A;  4M77 A;  1YJ9 T;  1ZQ1 A;  2VC8 A;  2EQK A;  2DVE A;  4O5V A;  1N27 A;  2XK0 A;  4C5E A;  3HFO A;  4LDY A;  3X25 B;  3FB9 A;  4LDW A;  2RD1 A;  5LJ5 d;  3HRU A;  1VQ4 A;  1W2B S;  5LJ3 j;  3QYG B;  3CCJ T;  1QW1 A;  1GXI E;  3S3N A;  5KE3 A;  4EMG A;  4QQG A;  2VGM A;  4C8Q B;  4FSX A;  1M1G A;  1U1T A;  1DJ7 B;  2EQM A;  3SWN C;  3SD4 A;  2X4Y A;  5LJ5 h;  2H3J A;  3QHS A;  4M77 F;  5GAO l;  2LQ8 A;  2DTH A;  4RKU E;  4KBM B;  2OAU A;  4M78 D;  3A8M B;  4C0D B;  5GAN g;  4M77 B;  5GAM f;  4L6V 5;  2ZZD A;  2WAC A;  4M7D D;  2CZ6 B;  3CD6 T;  3QBY A;  1ZBX A;  2X4X A;  5FRM A;  3QPH A;  5GMK i;  3OYI A;  3OW2 A;  3MET A;  4QVZ A;  1N8R U;  2QXF A;  3L2U A;  2DAQ A;  4C5G A;  1VQL A;  4BE0 A;  1HXD A;  2E6N A;  5EG2 A;  2KY9 A;  1MGQ A;  3KUF A;  3I55 T;  3VU3 C;  3OYD A;  5CQX A;  1ZHI A;  4O6J A;  3PTA A;  4FU6 A;  4HCB A;  2BIV A;  1O75 A;  5CKE A;  4M7A C;  3F70 A;  5FU7 C;  1M8V A;  3CCV T;  3OYB A;  1QVP A;  3M55 A;  1BI2 A;  3FEO A;  4BB7 A;  2V8J A;  5GMK h;  4N4H A;  1X01 A;  3JCM g;  1VQN A;  3C94 A;  4Q5W A;  1LJO A;  3SWN A;  3FJP A;  4RG2 A;  2GF7 A;  4A4F A;  4HCZ A;  3CXC A;  3LW5 E;  4X9D A;  5FU7 B;  4C92 B;  1Q7Y C;  2KDS A;  3E9F A;  5LJ5 g;  1M90 U;  1K8A U;  3G4S A;  1QVF S;  2CZ0 B;  2E5Q A;  5C0M A;  4MML A;  4IUT A;  2LCC A;  5A0L A;  3OYL A;  4BE1 A;  1M1K U;  1QVG A;  4FT4 A;  3HRS A;  4XTU A;  3TRE A;  5GMK j;  2QQR A;  3JB9 D;  4HKE A;  4XTY A;  4BDZ A;  1VQ7 A;  5CKH A;  3GIB A;  4M78 E;  3RES A;  2LTO A;  3OY9 A;  4E7L A;  2L89 A;  4OF1 A;  1K8A C;  2V8I A;  2K3X A;  3JB9 I;  1Q7Y U;  4XQ3 A;  5LJ3 h;  5M9O A;  1G5V A;  5C6S A;  4PJO A;  2HD0 A;  2FVU A;  3R6O A;  3CCE T;  4OP0 A;  4OVA A;  2VYT A;  4BE2 A;  3X28 B;  4EMH A;  2LQK A;  2MWO A;  3GNG A;  4P5N A;  4XK8 E;  1VIF A;  3O8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...