5GAN4

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
90
structure length
74
Chain Sequence
MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSVKLNEIYIRGTFIKFIKLQDNIIDKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords U4 snRNA
total genus 10
structure length 74
sequence length 90
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan400
3RKWA 1X01A 2K57A 5GAN2 3RIRA 3JCMQ 1LJOA 1I81A 2DXTA 3M4GA 2ZGWA 4X9DA 4XTYA 5GANd 3JCMP 4PJOD 4M77B 5GAN3 5GAN5 3JB9H 4XTWA 4C92G 1D3BA 3QSUA 2FYKA 4M75A 4PJOG 4M77A 1U1SA 4N0AA 4EMGA 1HXDA 3SB2A 1U1TA 5GAMe 3BW1A 4M77F 4XU3A 4M7AG 4M7DD 4M78D 1LOJA 4C92E 2Y90A 4JRIA 4M7DE 1H641 2EJGA 1D3BB 2DKGA 4M77G 4NL2A 3EFSA 5GMKe 4J6WA 5GMKj 4DQ2A 5LJ3f 4C92F 5GAMj 5GAN4 4M77C 3JCMf 2E41A 4OP0A 1WQWA 5GMKm 4QVDA 5LJ5g 3RUXA 4C8QF 5GANe 1JBMA 1M8VA 5GANj 2DXUA 5LJ5d 3V7RA 2DZ9A 4M75G 2VXEA 3SWNB 4PJOA 4M78A 4Y91A 1BIAA 2E1HA 3L2ZA 4F7UB 4M7DB 5GAMh 4F7UG 3VU3C 5LJ3d 4M7DG 4EMKC 3BFMA 3FIFA 4M75D 3GIBA 3SWNC 3RKYA 1WNLA 1Y96A 3JCMh 3PGGA 4C92D 3HSBA 4M78E 1I8FA 4F7UE 2QTXA 4RCBA 1MGQA 3QO3A 4HA8A 4M75E 3FB9A 3V7SA 3JCMJ 5LJ5j 4MMLA 5LJ3g 1TH7A 1M5Q1 4V2SA 4M78G 3V8JA 2RM4A 4MMKA 4C8QA 4PJOE 4M7DF 3SWNA 4A54A 4PJOB 2DVEA 4NOYA 2RD1A 5LJ3h 3JCMV 5GAN6 5GANg 2E65A 3EFRA 4J6YA 4M75F 4WF2A 3V7CA 5GAOn 4M7AB 4M7AA 2HNIA 4M78F 4XTUA 4J6XA 1I4K1 2E10A 4C8QG 4PJOC 2DTIA 4PNOA 4C8QB 5GAOq 3JCMW 2YLCA 4C92A 4NL3A 4M78B 4M7AC 4HT9A 2DTHA 3V8LA 4EMKA 5CAIA 4JUVA 1KQ2A 4M75C 5GAOp 4C8QC 5I21A 4XQ3A 2VC8A 4M78C 3JB9G 3JCMb 3QUIA 4XTZA 5GAMd 2YHTA 3JCMX 2DTOA 3RKXA 4C8QE 5GANf 1B34A 3JB9F 4EMKB 4M7AF 1WQ7A 4XU1A 2CGHA 5LJ5h 4C92B 5GAOl 4M7AE 4X9CA 5LJ5f 5GAMf 3JCMe 3INZA 1HK9A 4J5YA 5DY9A 3V8KA 3RERA 1WPYA 1JRIA 3L1AA 3HFOA 4M77D 5LJ3e 1B34B 1KQ1A 2I2LA 5LJ3j 3JB9J 1LNXA 2DEQA 1N9SA 2EAYA 4QVCA 4M75B 3FJPA 4M77E 2DJZA 2JN0A 2EJFA 1YCYA 4F7UA 4M7DA 4N0AC 3JCMd 1N9RA 3JB9D 4EMHA 5GMKh 4M7AD 2EJ9A 2DZCA 2VXFA 4XU2A 1I5LA 3AHUA 4C92C 2E64A 4HT8A 4M7DC 4C8QD 2YLBA 5GMKl 1Y96B 5GAMg 4PJOF 2FB7A 5GAOr 2EWNA 2RA2A 5GAN8 3BY7A 5GANh 4RCCA 4JLIA 4XTVA 5LJ5e 4XTXA 5GAOm 3JCMg 3JB9I 5GMKi 3RESA 3JCMc 4A53A 3QHSA 3BDUA 4JRKA 3HFNA 4XU0A 4F7UF 1BIBA 2RB6A 5GAN7
chains in the Genus database with same CATH superfamily
3CD6Q 1K9MC 4Q5WA 3NTHA 4OMQA 2RN8A 2HSEB 2AZVA 2ZGWA 3F70A 1VQ9T 3DKMA 4E6RA 5GAN3 2DK3A 1KC8R 4C92G 3QKJA 2KI7A 5GAMe 1PSFA 2LTOA 2ABLA 3CCLT 4II1A 1EZZB 3O5ZA 4J6WA 5L8RE 2F2VA 4ATOA 2CKKA 3HRSA 1K73U 3IQLA 2PZ1A 1NLOC 5GANj 3EGXA 3SWNB 2LCCA 4M7DB 1EIFA 4JRPA 2RJDA 4JS4A 2YRCA 3CQTA 4PK4A 1I8FA 1CSKA 3MEWA 3RR6A 5IT9E 3OW2S 7AT1B 2QGFB 4CI0C 1RAFB 2DA9A 3HTRA 1V1CA 2DVEA 3QPHA 2RI3A 1PCXA 2GCXA 2QI2A 2YUQA 1YJNT 4JJDA 4HCBA 1UGRB 5GAOp 4C0FA 3RBBB 3G4SQ 4QVZA 3CCJT 1M1KC 4GY5A 3EGUA 2XU8A 4EDUA 1WYXA 2KT8A 5CCAA 4J5YA 4BE1A 3VS5A 4ANJA 4AFQC 1X2QA 2ROLA 1VQ4T 1MV0B 1AEYA 4JLGA 4MZTA 3UA6A 2K5FA 2EWNA 3CBMA 1KK7A 2ZPEB 2C06A 3CCSA 1KHIA 4JRKA 2DLPA 3THKA 4ESRA 3M4GA 1ZSGA 2H8HA 3OW2A 1IZ6A 3C0CA 3QSUA 3PVLA 2RHYA 2DXCA 4RTZA 5I2MA 4OB2B 2CT4A 3DB4A 5CKBA 1PWTA 4BDZA 1NG2A 1KD1R 2Y90A 4JRIA 3OQ5A 3CC2Q 1LPLA 3CCET 2JOYA 3H0IA 2D8JA 1G2BA 3CCEQ 2EPDA 1GXIE 2DD5A 3L2ZA 1UECA 3GIBA 3BFMA 4RTTA 3OBWA 1RACB 2EYYA 4FT4A 3X25B 1BU1A 1C1AA 1RAIB 2G6FX 4E47A 2F5KA 3M59A 2G3RA 1AWJA 1B07A 2FPEA 3V7CA 1G3YA 1ZBXA 1K4US 2E10A 4FM4B 2SRCA 4RTYA 4FSSA 2JJ9A 2XK0A 2VC8A 1PNJA 3VJPA 4XTZA 1WGSA 4JPBW 2QGGA 5GJVB 4ZGJB 5FU6C 1VQOA 1M4ZA 1K9MR 5IHKA 1B34B 2CZ0B 2Y4XA 2HQEA 1NPRA 2DRKA 4M7DA 1IB8A 1ABQA 2R5MA 4DBHA 1D09B 1YJ9T 4J7IA 3L2UA 2LX7A 1VQKT 2E5KA 2CSQA 4JLIA 2XDBA 1UDLA 2ZPGB 4WTOB 1V29B 4M7DF 1AD5A 1BIBA 2RB6A 3OA6A 2X3XD 2XICA 4PFOA 2KYBA 5CQXA 2K57A 3PNWC 4OB0B 1I81A 5DM7R 3SD4A 4E2FB 3CC7Q 2O88A 3D7SB 5CO7A 4EMGA 4XU3A 3N5BB 4ME7A 3EFSA 4J9GA 2O4XB 1WQWA 3CCQQ 3RUXA 3OYCA 3CCRA 1BI0A 4FYYB 4OGEA 3JRZA 2LRQA 3C12A 3ASKA 1TU0B 3PT9A 4EMKC 4FU6A 1VQ6Q 3SWNC 1Y96A 3QO3A 2YUOA 4BACA 4GLMA 4MMLA 2EQIA 1ZUKA 2ECZA 3LX7A 3V8JA 2DL4A 4PJOB 3EFRA 2RF0A 4J6XA 3KXTA 1T0JA 3CPFA 5CAIA 2JXBA 6AT1B 5CQYA 1E6GA 4BI4A 2RK1A 2J6FA 3GNGA 2R5AA 3JCMX 2EYZA 2IIMA 2XD0A 5KYYA 3H8ZA 5LJ5h 4C92B 1IGQA 1ZUYA 2JMCA 1YI2A 2CP6A 2QQSA 5A2QE 3RERA 1WPYA 1WA7A 1TUDA 3ZBDA 3ZL7C 1NJIU 1BB9A 3HL8A 4DBRA 4DA4A 4N0AC 2EQMA 1GFDA 2KVQG 1S72T 1XQHA 2FZCB 4M7DC 4OVAA 2EQJA 1JJ2P 4N4IA 5GAN8 1RL2A 1QCOA 4JJNK 4A53A 3OYFA 4BE0A 2DF6A 3RKWA 2DL5A 1G3TA 4FYVB 3G1JA 4OF1A 5FW9A 1RAAB 3A8OB 5HK0A 3MPUB 4DBQA 1D3BA 1VQNA 1YHQA 1VQ8T 3OW2P 1X43A 2YRDA 2D0NA 3M0PA 4XK8E 1TTHB 1D3BB 1QKWA 3VUBA 2L3SA 1K8AR 4C92F 2CDTA 3VS0A 1VQ5Q 1NEGA 2PVGB 4F7UG 4J9HA 1W4SA 1UGPB 1WDXA 1M90R 4M7DE 1GBRA 3EG3A 2J06A 4VUBA 2AK5A 2QXFA 4X34A 2RM4A 1WHJA 3CXCA 4RUGA 3CC7T 3S3MA 4BDYA 3OMGA 1Q82C 1RAEB 1OX9A 4C92A 4OMNA 3UT1A 1IXDA 2O9VA 2NUPA 3CC2A 1ACMB 3CBOA 2O9SA 4OMFB 1K8AU 4M7AF 1I07A 4PL6A 5GAOl 4D8DA 2KQWA 2QDLA 3HFOA 1JO8A 2C0IA 4IUUA 3TQ7P 1VQ7T 1M90C 2CP5A 1Q7YR 2OTLA 3ER0A 2O31A 5ECAA 1M90U 5C6SA 2LC4A 1Z9QA 3CMET 1Y96B 2A08A 2EGEA 5GAOr 3L2WA 3CCVT 2FZKB 1KD1U 5KCOA 4R56A 1YWOA 1M2VA 1TUGB 1K8AC 2X9HA 2VUBA 2MYSA 5GANd 4DBFA 3VS7A 2HZYA 4D8KA 2P0QA 4M75A 2W0ZA 1C6VX 3A8LB 2OI3A 4M78D 2P4TA 1VQOQ 1VQNT 4MDWA 2OAWA 4AFZC 5GMKe 1VQMT 2RH2A 2WACA 4FW1A 4PJJA 4QQDA 3H6ZA 2H3EB 4KH0B 3JCMf 1QVFA 4KUIA 2EFIA 1VQMQ 1WXUA 3C94A 3CCUT 2E1HA 3REBB 2KRMA 5LJ3d 4N4HA 2RQWA 3CCLA 2VGMA 3PGGA 4LE9A 2QG9B 4ORZA 3HKSA 1NPPA 4DOWA 2RNAA 4FL6A 4L59A 3VS6A 9ATCB 5LJ3h 4J6YA 1AVZC 1YIJQ 1TUCA 2DO3A 3CC7A 2AHJB 2KYMA 4PJOC 2DBMA 3OS0A 4C0DC 4KGXB 4M78B 4JJBA 4XQ3A 1RI9A 1OPKA 2VWFA 4MZMA 3I55A 1HSQA 1LCKA 3LYIA 2A3LA 1K73R 3CCQA 1NBEB 3UF4A 3JCMe 3CCRQ 2GQIA 1N8RR 2EVRA 3OS2A 4M77D 3G7ZA 3M5AA 1SEMA 2HQXA 3FJPA 3OYBA 2DRMA 5HK3A 1VQ6A 1X69A 3JCMd 4BUGA 2M16A 1PM3A 1QCFA 4XU2A 1WJSA 1FYNA 2DILA 1K9MU 2CP0A 2RHXA 3VRZA 2XG8D 2J05A 4XTXA 3HRUA 3EAEA 2XDDA 1IHWA 5IHIA 8AT1B 3P8BB 3M57A 1MHNA 3LW5E 4NS5A 1BYMA 3GPLA 5GAN2 1VQPQ 4IKFA 3MO8A 4M77B 2PUOB 1D1AA 4FSXA 1SRLA 1UB4A 3G71T 5FU7C 1YNZA 4Z89A 3SB2A 2VB6A 3OYYA 4J9DA 4C92E 1YI2Q 2DKGA 4ELZC 3JAME 2OJ2A 3HPWA 1T0HA 1VYTA 3QJYA 5LJ5d 1NE8A 2M0YA 1NEBA 2JM8A 2CP2A 1W1FA 2HDAA 2R58A 1VYUA 1FMWA 5KYUB 1EFNA 5LJ3g 2H3JA 2OAUA 2Z0WA 4KGVB 1M1GA 5D6XA 1X6BA 3FLGA 5FROA 4M75F 4WF2A 2KNBB 4M7AB 3L2QA 3G71A 2DD4A 2NUZA 3MKDA 4C8QG 1OI1A 3CBPA 4PNOA 1VQNQ 1YHQQ 2AIRB 1R0BG 1UJ0A 2V8JA 2DTHA 4C5EA 3V8LA 1UJYA 1ZHIA 1AOJA 2D8HA 4JUVA 2P84A 2KAFA 4AT1B 2PVOB 4KGZB 3A8MB 3RKXA 3MEUA 1DJ7B 3JB9F 3QYGB 3OYMA 2VVKA 3I5SA 1VQ5A 2CREA 1M2OA 3L1AA 1KQ1A 2DEQA 1QVFS 2EIFA 1U5SA 2LJ1A 1BCOA 5GMKh 5M9OA 3EFOA 3A98A 1I5LA 4PJLA 3I5RA 1VQ6T 2E64A 2BUDA 3H9NA 2NYSA 3PIOA 5LJ5e 3WVDB 1TWBA 2E3IA 2QEXQ 1U1TA 3VS4A 2DYIA 2HBWA 2ROTA 2MCNA 4XTYA 4QQGA 1SHFA 1BBZA 1OPLA 1Q82U 2JMAA 5A0GA 2LNHB 4PLIA 3VS2A 1G8XA 5KH6A 3OYLA 4M77G 2VASA 3CEYA 5KE2A 2K3YA 4M77C 3LGFA 3VS1A 4A4GA 3FDRA 4OP0A 1Y71A 5GANe 1VQLA 2OTLQ 1W6XA 1PRLC 4M75G 3OYNA 2X4WA 3M54A 1W2BP 1G3WA 1QCNA 3M0SA 2QYZA 2FPDA 2JW4A 1U3OA 4AMCA 5HCKA 3JCMh 4D6WA 4M78E 2DMOA 1TG0A 1ZUUA 5LJ5j 1OQKA 2GQVA 2QTVA 1D1BA 2R57A 2KE9A 5GAN6 5FU6B 2BE7D 3CXCS 2HL5C 1G83A 2DL3A 3X28B 1FWZA 3TVTA 1M1KR 1QW1A 4EMKA 3UA7A 1KQ2A 3NFCA 2V8KA 4C8QE 4LN2A 3TCJA 1Y57A 2HEQA 4OGCA 1K9AA 4QW2A 5DY9A 3V8KA 2KRNA 1VQMA 5LJ3j 1YN8A 2J7IA 2FRWA 2OTLT 3Q1JA 3CCLQ 4J7FA 2JTFA 1Q81U 2EJ9A 2YXYA 3PVQA 5FRNA 4LDUA 1WJQA 2RJFA 2RPNA 5GMKi 1YIJA 4F7UF 1RAGB 1R77A 1BI3A 1QP3A 4F14A 4E7HA 4LDXA 2A36A 1UGQB 2QK0A 3NPFA 1LJOA 4JZ4A 1PSEA 3DLMA 2DETA 4PJOD 1AT1B 5D6YA 2RI2A 2EKHA 5KYWA 1QVPA 3I55Q 2CP3A 4OMOA 2PQWA 4NL2A 2OTJT 4L5GA 1N6AA 2B8AA 1H8KA 3EG1A 4C0DB 2VYTA 2DIGA 1H3HA 1BKBA 2NUPB 3R6NA 2E3HA 1YJ9A 1GFCA 1YHQT 4C5IA 3CCUQ 3M4YA 2LX9A 4QT7A 4BE2A 1PD0A 3GOXA 1QVGP 1F1BB 2EYWA 3UPUA 1D1CA 1UTIA 3A1PA 2L8DA 2KROA 4LD9K 3HHTB 3MP6A 3L2RA 1MGQA 4L6V5 4M75E 3FB9A 5FWBA 4YTLA 2YUPA 4AFUC 1VQOT 3EH2A 3X24B 4K11A 1TOVA 3SWNA 1VQPA 2EQUA 5GAOn 4M78F 2YT6A 1PKSA 4OMLA 3UDCA 1X2KA 3FEOA 4M7AC 5I11A 2PTKA 3G4ST 4M75C 4WCIA 2VGNA 2KK4A 3INZA 4C0ZA 3G6EA 4HKEA 2F2XA 4Z8AA 5LL6S 2LZ6B 3PMIA 2DJZA 4Z02A 2RQTA 3X26B 1VQKQ 1ZSZB 4PKCC 1NYGA 3I56T 1YJNQ 1QLYA 5I2SA 2F1LA 4R55A 5IXFA 1M8MA 5GANh 3JB9I 1E6HA 1UE9A 1SSHA 2K2VA 2BTTA 1Q82R 4BI3A 1XNIA 2C0TA 2QASA 3G71Q 3WXMB 4E7SA 5FRMA 3EHRA 3MP8A 2D1XA 5GAN5 2KT1A 4CC7A 3ME9A 5IAYA 3PTAA 1U1SA 4M77F 2E6ZA 2YRVA 8ATCB 5GMKj 1UGVA 1QWFA 3GLXA 1KQSP 1YITT 2EQKA 1VQLT 1MUZA 1VQ5T 2DBKA 2BZYA 2BE9B 1Z9ZA 3OYKA 1VQ4A 3H0HA 2QEXT 1RADB 1XTDA 2QDYB 4F7UE 2CZ6B 2JUFA 3U23A 2NLUA 4XAXB 1XJWB 1GCQC 5I22A 2QEXA 1VQ9Q 1TH7A 3QIIA 2DAQA 2O01E 3E2UA 4CRIA 5IN1A 4LNPA 3E1SA 2COYA 4C0GA 1M27C 2HNIA 3A8HB 5FWCA 2JVVA 3OYAA 3JCMW 4ZTFA 1RI0A 1M1FA 1YIJT 2DXBA 2YWWA 2DIQA 2LMJA 3QWXX 3I55T 3X20B 3RNJA 4LDVA 4M78C 4GLKA 1B34A 1N8RC 3SEMA 3QDFA 4MDXA 2QQAA 1VQLQ 5AT1B 3OBYA 4EPCA 1ARKA 4M77E 1AZEA 2F2WA 2CYZB 4Y28E 1OOTA 2GBQA 2V1RA 1XOVA 1Q95G 1NJIC 2MIOA 2NUTB 3EGDA 2JNGA 2IG0A 3EG9A 4ZGDB 1V76A 1SF9A 3QHSA 3BDUA 1PKTA 1RUWA 1YJWQ 1M9SA 3VS3A 1J3TA 4A4EA 4OMPA 3URGA 4FCYA 1PG5B 2W10A 3EH1A 1UHFA 1ZQ1A 3BW1A 4IIMA 4ZTJA 1KSWA 2L89A 4A4FA 4HCKA 1OULA 4E7IA 4DQ2A 2EGAA 1VOMA 2HAXA 1WX6A 4QVDA 2LQ8A 3C4SA 1RAHB 2DERA 2DZ9A 3LWIA 5A0DA 1KG1A 3CCVA 2X4YA 3FIFA 1A0NB 5AYFA 1K73C 2QTXA 4CC2A 1WFWA 1NJIR 2GTOA 2ZPIB 1I1JA 4M7AA 2V26A 1KQSS 1Q7YU 5GAOq 2M0OA 2E70A 1Q81C 1T3SA 1Q86C 3TREA 1GRIA 2WSCE 4QKUA 4AFSC 3M9QA 3QYHB 3J81E 1YITA 3QUIA 1T3LA 2A28A 3EHQA 5EC7A 3CCST 1YJ9Q 1W2BA 2AT1B 3CCUA 2L5QA 3GNFB 2X3WD 2CH4A 1N9RA 3QZ5B 2DZCA 4KRTA 1K0SA 2F69A 4C92C 3J7AF 4LUDA 5GAMg 3QZ9B 1UEBA 3CC4A 4QQ6A 1YWPA 4TVRA 4XTVA 1NYFA 2A0FB 2L0AA 1X01A 2DL7A 3OS5A 1UHCA 1AWXA 1WLPB 2VKNA 2DJQA 4FW2A 2X4XA 4CC4B 2BIVA 3RDVA 1SRMA 2BZXA 2RJEA 1QVGA 2DE0X 2YSQA 2ENMA 2ESWA 2B86A 3G6EQ 4RTXA 2GFAA 4RTUA 2LDMA 4PLLA 2YDLA 1QMCA 3DLLA 2FG0A 2P0KA 3TEEA 1ZA2B 1VQKA 2FZGB 1MMGA 2DFUA 1KQSA 3V7RA 2DNUA 4IUPA 1YJNA 5CKFA 4F04B 3CMAA 2DEUA 2O2OA 3SDZA 3V7SA 2XDPA 3NHNA 1M5Q1 3CMEQ 2HCKA 3OB9A 2QQBA 4PJOE 2KEAA 2JTEA 2RD1A 2FRYA 2I0NA 3WVEB 3KUFA 2DTIA 4IIOA 3EGXB 3VRYA 2RQVA 1R8OB 5I21A 4E7KA 1S1NA 2RI5A 3MP1A 1WXTA 2DTOA 4KULA 1WQ7A 4XU1A 2EBPA 3CC4T 5GAMf 4KUDK 1VQ7A 2LCSA 4J8OA 2CZ1B 3MJXA 4DOVA 1ZA1B 1VQ4Q 1G5VA 2EJFA 2BKDN 2KRSA 4Y92A 1Q7YC 3AHUA 1VQ9A 2YLBA 5GMKl 3QJ6A 1X27A 2L3QA 1LVKA 2P0PA 4IUVA 2QA4Q 3M55A 2RQRA 2M9UA 3VKIA 2M1HA 2PU9B 2XI9A 3OYHA 1I0CA 3RIRA 2CSIA 1ZSZA 2MWPA 1VA7A 3CPWS 5IHNA 1UG1A 3JB9H 2COWA 4O5VA 2LP5A 2K7AA 5CIUA 4M7AG 1JJ2A 2L2PA 1PD1A 3MHXA 2E12A 1H3ZA 1WI7A 2EJGA 1H92A 3M58A 4HCCA 3MEVA 4JDSA 5HKCA 3QBYA 4E7JA 1VQ8Q 3E9GA 5J39A 1IREB 2IPOB 4RG8A 1OEBA 5GMKm 5LJ5g 2PUKB 5IXBA 3H41A 2JZ2A 3OYDA 2X51A 4PFZA 3TSZA 4JRQA 3LGLA 2V1QA 2VXEA 4FT2A 1BIAA 1RABB 3CPWA 3VUZA 2JS0A 4M75D 2A37A 3CCMT 5EG2A 4LDYA 2RHIA 1S72Q 2OX7A 1MNEA 4KH1B 4FYWB 3UWNA 1YJWA 4V2SA 2LCLA 4M78G 4C8QA 1YCSB 4E7ZA 4A54A 3ULRB 2E65A 1IRXA 1MNDA 2ZZDA 4C8QB 2WSEE 2HBPA 1OU8A 2YLCA 2LT1A 3GF5A 2K5LA 1D0ZA 1I5OB 5DLQE 2ZAEA 2LJ0A 4N4GA 5KYNA 3A8GB 1P92A 1WHMA 1OZ2A 1ZLMA 2EKOA 3FRNA 3QWYA 2HMAA 2D0QB 4X9CA 2LVMA 1BI1A 2K6DA 1OX8A 3JB9J 2AZSA 2I2LA 2AKLA 5KYWB 3CCVQ 1Y0MA 4JS5A 3LWHA 2COZA 2M02A 2X4JA 2RQUA 1AZGB 5KCHA 1HJDA 1TS9A 4C8QD 3J80E 3L2VA 3KBGA 3HP9A 1GL5A 2QAZA 4C5HA 1VQPT 2X35A 1IGUA 2OTJA 4J83A 1X6OA 1OYXA 1M3CA 2CUDA 4HVUA 2QA4T 4J9FA 1MV3A 2DXTA 3VV0A 1MMDA 4B9WA 2KY9A 3P8HA 1D0XA 4XTWA 1YITQ 5CKEA 4C5GA 4N0AA 4M7DD 2DPPB 3A5ZB 1FMKA 1FMVA 5A0LA 3I9QA 1EX4A 2HKQB 5GJWB 4J9IA 4F16A 5LJ3f 3CCRT 2YUNA 2RMOA 3OYJA 3MCAB 3EG2A 5FU7B 2DXUA 3JV3A 2QQ9A 4LDWA 2J6OA 2MAMA 3CC4Q 1WNLA 2HSPA 3PFSA 3NTKA 3JCMJ 1VUBA 3R6OA 5IH2A 3CCJQ 1TXQA 3T9NA 4RTWA 2DYBA 2AKKA 3OYGA 4FYXB 4NOYA 5GANg 2LQWA 2KMTA 4NL3A 3S3NA 2HD0A 2LNVA 4X1VA 3SFMA 3BE3A 1JB0E 4DEXA 3I56A 2K2MA 1WHKA 5CVIA 4HVVA 1GCQA 1NLPC 1KFZA 2CGHA 3OYIA 2JT4A 3LH0A 5KYUA 2MOXA 4Z88A 1KC8C 1JRIA 4RG2A 2DVJA 5LJ3e 4A4KA 1OV3A 4RTVA 3META 4QVCA 3CMAQ 3OSSC 4F7UA 4JJCA 2GNCA 1SPKA 5KYXB 1M3AA 3CCMQ 4JZ3A 3C95A 3VYGA 4PJOF 3CMEA 1KC8U 4GBQA 2RA2A 3CMAT 1SSFA 1GCPA 2MI6A 3JCMg 1KD1C 4BY6B 2ZCFB 1VIEA 2RHZA 4CC3A 4ZNXA 1C0MA 4KBMB 1KIKA 3JCMP 3E19A 1PHTA 4ZGEB 4OMMA 1JXMA 4PJOG 1BK2A 3QXEB 3ZEHA 1LOJA 3DB3A 4BI8B 1ZBJA 2LQNA 1VQ7Q 2V8IA 1W2BS 1RLQC 4F17A 3PIPA 2GFUA 3NGPA 3HRTA 2CS7A 2E4HA 3OSVA 1QP2A 1RLPC 4PJOA 2EGCA 4Y91A 4F7UB 2KDSA 1OU9A 3VU3C 3ZFJA 4LXCA 2MMPA 4C92D 1FX7A 3HSBA 1ABOA 3MEAA 2NUTA 2QA4A 2ZPHB 3AT1B 3M0UA 4A63B 1IO6A 1E7OA 5CK9A 3CCQT 3L42A 5DLOA 3JCMV 1HD3A 4KT0E 2FL7A 1I4K1 2JS2A 3CD6A 2O4XA 3S3OA 3I35A 1AWOA 3QG1A 4E7LA 1WHHA 1Q86R 3JB9G 2RHUA 2YHTA 2GGRA 1YI2T 2M51A 1VQ8A 3M0TA 3KFVA 1JU5C 3RMQA 2XIDA 1HK9A 1O75A 5D7UA 2GF7A 2JN0A 1S72A 4EMHA 4M7AD 2L3PA 1R0CB 2WSFE 1PC0A 4B9XA 3OMCA 5L23A 1GBQA 4P5NA 1IHVA 2XMFA 1D0YA 3HFNA 3LH5A 2KGTA 2CH4W 2JTMA 2HKNA 2PVDB 3M0QA 3JCMQ 1TSFA 2DM1A 1YFNA 4IUQA 1O9SA 1VYVA 1Q86U 3S6WA 3VYHB 3E9FA 4M77A 1K1ZA 3EG9B 4ZN3A 1U8RA 1AWWA 5CKHA 3G4SA 3EGDB 2EW3A 1YBYA 2ED1A 2CP7A 4LD6A 2XHCA 5FLXE 3EG0A 1JBMA 4OB3B 1M8VA 4B6MA 4M78A 1WXBA 2JM9A 4M7DG 5KYXA 3CD6T 2A7YA 3M56A 3GP8A 4HCZA 3RKYA 1MMNA 2LQKA 4FIBA 2OTJQ 3NTIA 4HA8A 2KBTA 4OB1B 1G3SA 1M30A 3TSWA 1KHCA 4BD3A 4J9CA 2E5QA 2K9GA 2XKOC 4MMKA 4A4HA 1AHJB 3CCSQ 5HY6A 5CKDA 2RO0A 1UGSB 2NWMA 2E6NA 1MMAA 2HL3A 3PE0A 2K3XA 2ZPBB 1B3QA 2EYXA 4HT9A 2P4RA 2RK2A 2KXCA 1X6GA 2F5TX 2MF2A 4PJMA 5GAMd 2J6KA 3PMTA 2K5IA 2FHDA 1QQJA 4HXJA 4M7AE 3UATA 4PFPA 5LJ5f 3OS1A 2MK5A 2FO0A 1WZOA 1UUEA 1M3BA 1N9SA 2EAYA 4M75B 1YCYA 3CCEA 2MPXC 1Y7XA 2VXFA 1NZ9A 1K76A 4HT8A 3CXCP 4ELYC 1JJ2S 3CCJA 2K4YA 1M2VB 2FB7A 2D9TA 1Q81R 4RCCA 1N27A 3SHWA 3JCMc 1JQQA 1B7TA 4XU0A 1ZX6A 5GAN7 1N8RU 3P8DA 3O8VA 5KE3A 5J26A 4X9DA 1OZ3A 1WJRA 2ZPFB 2GTJA 3M0RA 2KXDA 3I56Q 4IURA 2FYKA 2L3RA 1SG5A 1HXDA 2QQRA 4PJNA 1CKAA 1VIFA 3JSCA 3NMZC 1JEGA 1H641 1NM7A 4J9EA 1ZSZC 1KJWA 4AG2C 4IUTA 2DL8A 1PRMC 1QKXA 2BZ8A 5GAMj 3FJ5A 5GAN4 1YJWT 2E41A 3FC3A 4C8QF 4DEYA 1HYOA 1CKBA 3H0FA 1SKUB 3OYEA 3CCMA 4HVWA 4LUEA 5GAMh 2FPFA 3OY9A 1QVGS 3RMSA 1Y07A 2KR3A 4RCBA 1YP5A 3LLRA 1QWEA 1SHGA 4ZN1A 2K3BA 2LJ3A 2PNIA 2ED0A 5KYYB 4EIKA 1BI2A 4RKUE 2SEMA 1N5ZA 4UC4A 2Y4YA 4BY6C 1X75C 1K0XA 3G6ET 2CZ7B 2FEIA 2FVUA 4XTUA 1JXOA 4O6JA 2K79A 4C8QC 2CUBA 1UFFA 1QVFP 1FXXA 3JCMb 5CR2A 2RJCA 1BCMA 5J3BA 3EFOB 5GANf 4EMKB 2MWOA 4RMOA 4BB7A 4AG1C 3BDLA 1U06A 3M53A 2C0OA 2D6FA 1LNXA 1M1KU 4J9BA 3CC2T 2LT4A 3TU4K 4MZPA 3GBQA 1WHLA 2HQHA 3JB9D 2VV5A 3QDRB 4M4ZA 1WIEA 2DX1A 1W70A 2ATCB 3REAB 2CT3A 2EYQA 2IVWA 3BY7A 5GAOm 4R0KA 3CPWP 1WHGA 5C0MA 5D6WA 3RESA 2KSSA
chains in the Genus database with same CATH topology
3WXMB 1K8AC 1K9MC 4Q5WA 2QA4T 2VUBA 3NTHA 5FRMA 2DXTA 2ZGWA 5GANd 3F70A 3MP8A 3VV0A 3DKMA 1VQ9T 5GAN3 2DK3A 4B9WA 5GAN5 2KY9A 3P8HA 4XTWA 4C92G 2P0QA 3QKJA 4M75A 3ME9A 5IAYA 5CKEA 4C5GA 3PTAA 1U1SA 4N0AA 1PSFA 5GAMe 3A8LB 4M77F 2LTOA 4M7DD 2E6ZA 4M78D 2P4TA 2DPPB 3A5ZB 3CCLT 2YRVA 5A0LA 1VQNT 4MDWA 4II1A 5GMKe 1VQMT 2RH2A 2WACA 4J6WA 5L8RE 5GMKj 3GLXA 4QQDA 5LJ3f 3H6ZA 4ATOA 2CKKA 3HRSA 1YITT 1K73U 2EQKA 3JCMf 3CCRT 1VQLT 1QVFA 3OYJA 3MCAB 4KUIA 5FU7B 5GANj 2DXUA 2EFIA 3C94A 3SWNB 3CCUT 2LCCA 1VQ5T 2E1HA 4M7DB 1EIFA 4JRPA 5LJ3d 4N4HA 3OYKA 2RJDA 1VQ4A 4JS4A 2QQ9A 4LDWA 2MAMA 3CCLA 2QEXT 2VGMA 1M8VA 1WNLA 3PGGA 3PFSA 1XTDA 2QDYB 3NTKA 1I8FA 3MEWA 4F7UE 2CZ6B 2JUFA 5IT9E 1VUBA 2NLUA 3HKSA 3R6OA 4XAXB 1NPPA 2QEXA 3OW2S 4DOWA 4CI0C 1TH7A 3QIIA 2DAQA 2O01E 4FL6A 3T9NA 4L59A 5IN1A 4CRIA 3JCMJ 3E1SA 3OYGA 2DVEA 3QPHA 4NOYA 2RI3A 5LJ3h 5GANg 4C0GA 4J6YA 2DO3A 2HNIA 3CC7A 2AHJB 2KMTA 3A8HB 4PJOC 2JVVA 3OS0A 2GCXA 3OYAA 1RI0A 1M1FA 4NL3A 4C0DC 4M78B 2DXBA 2QI2A 2DIQA 3S3NA 1YIJT 2HD0A 1YJNT 2LNVA 4HCBA 3I55T 1UGRB 3SFMA 5GAOp 4C0FA 3X20B 4XQ3A 1JB0E 4QVZA 4LDVA 4M78C 3I56A 3CCJT 1M1KC 4GY5A 5CVIA 4GLKA 4MZMA 3I55A 1B34A 3LYIA 1N8RC 2XU8A 4EDUA 2A3LA 2CGHA 3OYIA 3CCQA 4MDXA 2QQAA 3LH0A 5CCAA 4J5YA 3JCMe 4BE1A 1KC8C 3OBYA 1JRIA 4RG2A 4M77D 5LJ3e 3OS2A 3G7ZA 4EPCA 3M5AA 4A4KA 4QVCA 3META 2HQXA 1VQ4T 3FJPA 4M77E 3OYBA 5HK3A 1VQ6A 3OSSC 4F7UA 3JCMd 4BUGA 2M16A 4JLGA 2CYZB 4Y28E 1XOVA 4XU2A 1NJIC 1WJSA 4MZTA 2JNGA 1K9MU 3C95A 2RHXA 2IG0A 2K5FA 4PJOF 3VYGA 3CMEA 4ZGDB 2XG8D 1KC8U 2EWNA 2RA2A 3CMAT 3CBMA 1SSFA 2ZPEB 2C06A 4XTXA 2MI6A 3EAEA 3HRUA 3JCMg 2ZCFB 4BY6B 2XDDA 3P8BB 3CCSA 1KD1C 1KHIA 1VIEA 3BDUA 3QHSA 4JRKA 2RHZA 3M57A 1MHNA 3LW5E 1M9SA 4NS5A 1BYMA 3GPLA 5GAN2 4KBMB 3M4GA 4A4EA 4IKFA 3URGA 3JCMP 3E19A 3MO8A 4ZGEB 3OW2A 1IZ6A 4M77B 2PUOB 3QSUA 4FSXA 1UB4A 4PJOG 3G71T 5FU7C 2RHYA 2DXCA 4ZTFA 3JCMW 3SB2A 5I2MA 4OB2B 1ZQ1A 3BW1A 3QXEB 3DB4A 4ZTJA 5CKBA 1LOJA 3OYYA 3DB3A 3ZEHA 4BDZA 4C92E 4BI8B 2Y90A 4JRIA 2L89A 3OQ5A 2DKGA 4ELZC 4A4FA 3JAME 2V8IA 4E7IA 3CCET 2JOYA 1W2BS 4DQ2A 3PIPA 2GFUA 2HAXA 3HPWA 3HRTA 4QVDA 2CS7A 2LQ8A 3OSVA 1QP2A 3C4SA 3QJYA 5LJ5d 1NE8A 2DZ9A 4PJOA 1GXIE 4Y91A 2DD5A 3L2ZA 3LWIA 4F7UB 5A0DA 2KDSA 1KG1A 3CCVA 3VU3C 3GIBA 2X4YA 3BFMA 3FIFA 3ZFJA 2MMPA 3OBWA 2R58A 4C92D 1FX7A 3HSBA 5AYFA 3MEAA 1K73C 2QTXA 4FT4A 2QA4A 2ZPHB 3X25B 5LJ3g 2H3JA 2OAUA 4E47A 5CK9A 1M1GA 2F5KA 3CCQT 3M59A 2G3RA 3L42A 5D6XA 5DLOA 2ZPIB 3JCMV 3FLGA 5FROA 3V7CA 1G3YA 4M75F 1ZBXA 4WF2A 4M7AA 4M7AB 4KT0E 3L2QA 2FL7A 3G71A 2DD4A 1I4K1 2E10A 4C8QG 1KQSS 1OI1A 2O4XA 1Q7YU 3CBPA 4PNOA 3S3OA 5GAOq 3CD6A 2M0OA 2V8JA 2E70A 4FM4B 1Q81C 2DTHA 4C5EA 1Q86C 3TREA 3QG1A 1ZHIA 3V8LA 2WSCE 4JUVA 4E7LA 2KAFA 3M9QA 2PVOB 2XK0A 3QYHB 2VC8A 3JB9G 3J81E 3VJPA 1YITA 2RHUA 3A8MB 3QUIA 2YHTA 4XTZA 3RKXA 3MEUA 1YI2T 1DJ7B 1WGSA 3JB9F 1VQ8A 4ZGJB 5FU6C 3QYGB 1VQOA 1M4ZA 3RMQA 2XIDA 3OYMA 3CCST 1W2BA 1HK9A 1O75A 3CCUA 1VQ5A 3L1AA 1B34B 1KQ1A 2CZ0B 2Y4XA 2L5QA 2DEQA 2GF7A 3GNFB 1QVFS 2EIFA 2HQEA 1NPRA 2JN0A 4M7DA 2R5MA 1N9RA 1S72A 4EMHA 5M9OA 5GMKh 4M7AD 3QZ5B 2DZCA 2WSFE 1I5LA 2F69A 1VQ6T 4B9XA 2E64A 2BUDA 3OMCA 4J7IA 4C92C 1YJ9T 3J7AF 5GAMg 3L2UA 1VQKT 3QZ9B 1G5VA 1UEBA 3CC4A 3PIOA 4QQ6A 4P5NA 5LJ5e 4JLIA 4TVRA 4XTVA 2XDBA 3WVDB 2ZPGB 3HFNA 1V29B 4M7DF 1BIBA 2RB6A 1U1TA 3OA6A 1X01A 2XICA 2JTMA 3OS5A 2PVDB 2K57A 5CQXA 3PNWC 4OB0B 3JCMQ 1I81A 5DM7R 4XTYA 4QQGA 3SD4A 4IUQA 1O9SA 1Q82U 1Q86U 3S6WA 2X4XA 3VYHB 2BIVA 3E9FA 2RJEA 5A0GA 4M77A 1QVGA 5CO7A 4PLIA 4EMGA 4XU3A 3N5BB 4ZN3A 1U8RA 5CKHA 4ME7A 3G4SA 5KH6A 3OYLA 4M77G 3EFSA 3CEYA 2GFAA 1YBYA 2LDMA 4LD6A 4PLLA 5KE2A 2K3YA 2XHCA 4M77C 2O4XB 3LGFA 4A4GA 3FDRA 1WQWA 4OP0A 1Y71A 5FLXE 3RUXA 3OYCA 2P0KA 5GANe 1BI0A 1JBMA 3TEEA 4OB3B 3CCRA 4OGEA 3JRZA 2LRQA 3C12A 1KQSA 3V7RA 1VQKA 3ASKA 4M75G 3OYNA 4M78A 3PT9A 4IUPA 2X4WA 3M54A 1G3WA 4M7DG 3CD6T 2A7YA 5CKFA 1YJNA 4EMKC 3M56A 3GP8A 4FU6A 4HCZA 3CMAA 3SWNC 3RKYA 2LQKA 1Y96A 3JCMh 3SDZA 4FIBA 4M78E 3NTIA 4D6WA 3V7SA 3QO3A 4HA8A 2XDPA 4OB1B 4BACA 5LJ5j 4MMLA 1G3SA 4BD3A 1KHCA 1M5Q1 1N8RU 3OB9A 2E5QA 2QQBA 3LX7A 3V8JA 2XKOC 4MMKA 2GQVA 4PJOE 4PJOB 2R57A 2RD1A 4A4HA 1AHJB 5GAN6 3WVEB 3EFRA 5HY6A 5FU6B 3KUFA 5CKDA 2RO0A 3CXCS 1UGSB 4J6XA 3KXTA 3X28B 2E6NA 1FWZA 2DTIA 3CPFA 2K3XA 2ZPBB 1QW1A 4HT9A 4EMKA 5CAIA 5CQYA 1KQ2A 4BI4A 1R8OB 2RK1A 5I21A 3GNGA 2RK2A 4E7KA 2MF2A 3NFCA 2F5TX 2R5AA 5GAMd 2V8KA 2RI5A 3JCMX 3MP1A 2DTOA 3PMTA 2K5IA 2FHDA 4C8QE 1NJIU 4KULA 2XD0A 3TCJA 1WQ7A 4XU1A 3H8ZA 5LJ5h 4C92B 4M7AE 4OGCA 3CC4T 4QW2A 5GAMf 5LJ5f 1YI2A 2QQSA 4KUDK 5A2QE 5DY9A 3V8KA 1VQ7A 3RERA 1WPYA 3OS1A 1VQMA 4J8OA 5LJ3j 2CZ1B 1N9SA 4DOVA 2EAYA 4M75B 3ZBDA 2OTLT 2EJFA 1YCYA 3HL8A 3Q1JA 3CCEA 4J7FA 4N0AC 2EQMA 2BKDN 2JTFA 4DA4A 1Q81U 2EJ9A 2KVQG 1Y7XA 1S72T 1XQHA 1NZ9A 2VXFA 1Q7YC 3AHUA 4HT8A 4M7DC 1VQ9A 2YLBA 5GMKl 3QJ6A 2EQJA 4OVAA 4ELYC 4N4IA 2K4YA 4LDUA 3CCJA 1JJ2S 5FRNA 1WJQA 2D9TA 2FB7A 5GAN8 1RL2A 2RJFA 4RCCA 2P0PA 1N27A 4JJNK 4IUVA 5GMKi 3JCMc 4A53A 3OYFA 4XU0A 1YIJA 4F7UF 3M55A 4BE0A 5GAN7 2M9UA 3VKIA 3RKWA 1BI3A 1QP3A 2M1HA 3P8DA 1G3TA 2PU9B 3O8VA 2XI9A 4E7HA 3OYHA 4LDXA 1UGQB 5KE3A 3RIRA 5J26A 1LJOA 2MWPA 4OF1A 4X9DA 3A8OB 1OZ3A 1PSEA 1WJRA 3DLMA 5HK0A 3CPWS 4PJOD 2ZPFB 5D6YA 2RI2A 3JB9H 4O5VA 1D3BA 4IURA 2FYKA 2L3RA 1YHQA 1QVPA 1VQ8T 1VQNA 1HXDA 5CIUA 4M7AG 2QQRA 1JJ2A 1VIFA 3JSCA 4XK8E 3MHXA 2PQWA 2E12A 1H3ZA 1H641 2EJGA 1D3BB 4NL2A 3M58A 4HCCA 2OTJT 4IUTA 3MEVA 4JDSA 4L5GA 3VUBA 1N6AA 5HKCA 3QBYA 4C92F 4E7JA 5GAMj 2B8AA 3E9GA 5J39A 5GAN4 1YJWT 1IREB 4C0DB 4RG8A 2VYTA 2DIGA 2E41A 1BKBA 5GMKm 5LJ5g 3FC3A 2PUKB 1YJ9A 4C8QF 2JZ2A 3OYDA 4C5IA 1YHQT 4JRQA 3M4YA 3LGLA 2LX9A 2VXEA 4FT2A 2PVGB 3OYEA 3CCMA 1BIAA 3GOXA 4BE2A 3CPWA 3UPUA 3VUZA 5GAMh 4F7UG 1W4SA 4M75D 3OY9A 1UGPB 1QVGS 3CCMT 5EG2A 4LDYA 2RHIA 3RMSA 2L8DA 4LD9K 1Y07A 3HHTB 3MP6A 4M7DE 4RCBA 1MGQA 3L2RA 4L6V5 4M75E 3FB9A 3LLRA 4ZN1A 4VUBA 4YTLA 3UWNA 1YJWA 1VQOT 3X24B 2QXFA 4V2SA 2LCLA 4X34A 4M78G 2RM4A 4C8QA 1BI2A 4RKUE 3SWNA 4A54A 1VQPA 4UC4A 3CXCA 2EQUA 2E65A 2Y4YA 4BY6C 3CC7T 1X75C 5GAOn 3S3MA 4M78F 2CZ7B 2FVUA 4XTUA 3G6ET 4BDYA 3OMGA 3UDCA 2ZZDA 4C8QB 1Q82C 2WSEE 2HBPA 4O6JA 2YLCA 4C92A 2LT1A 3FEOA 3GF5A 4M7AC 2K5LA 1VQLA 3G4ST 3UT1A 4M75C 4C8QC 5DLQE 4N4GA 3CC2A 1FXXA 3A8GB 3CBOA 3JCMb 1P92A 3DLLA 4OMFB 5CR2A 1OZ2A 2RJCA 5GANf 5J3BA 1K8AU 2EKOA 4EMKB 3FRNA 4M7AF 2MWOA 2VGNA 4PL6A 2KK4A 5GAOl 4RMOA 2D0QB 4X9CA 4BB7A 3BDLA 2KQWA 3INZA 2LVMA 4C0ZA 1BI1A 3G6EA 3HFOA 3JB9J 2I2LA 3M53A 4HKEA 2D6FA 1LNXA 1M1KU 5LL6S 4IUUA 3PMIA 1VQ7T 4JS5A 2DJZA 3CC2T 2LT4A 4Z02A 1M90C 3TU4K 4MZPA 3X26B 2OTLA 3LWHA 3JB9D 2VV5A 2X4JA 3ER0A 1M90U 5KCHA 5C6SA 3QDRB 4PKCC 2LC4A 4C8QD 3I56T 3J80E 1Y96B 3L2VA 3CMET 3KBGA 5I2SA 3HP9A 5GAOr 2EYQA 2IVWA 3BY7A 4R55A 4C5HA 3L2WA 1VQPT 5GANh 3JB9I 3CCVT 5GAOm 2X35A 2OTJA 1KD1U 4J83A 2K2VA 5D6WA 3RESA 5C0MA 5KCOA 1X6OA 4R56A 2KSSA 4BI3A 1XNIA 1OYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RKW A;  1X01 A;  2K57 A;  5GAN 2;  3RIR A;  3JCM Q;  1LJO A;  1I81 A;  2DXT A;  3M4G A;  2ZGW A;  4X9D A;  4XTY A;  5GAN d;  3JCM P;  4PJO D;  4M77 B;  5GAN 3;  5GAN 5;  3JB9 H;  4XTW A;  4C92 G;  1D3B A;  3QSU A;  2FYK A;  4M75 A;  4PJO G;  4M77 A;  1U1S A;  4N0A A;  4EMG A;  1HXD A;  3SB2 A;  1U1T A;  5GAM e;  3BW1 A;  4M77 F;  4XU3 A;  4M7A G;  4M7D D;  4M78 D;  1LOJ A;  4C92 E;  2Y90 A;  4JRI A;  4M7D E;  1H64 1;  2EJG A;  1D3B B;  2DKG A;  4M77 G;  4NL2 A;  3EFS A;  5GMK e;  4J6W A;  5GMK j;  4DQ2 A;  5LJ3 f;  4C92 F;  5GAM j;  5GAN 4;  4M77 C;  3JCM f;  2E41 A;  4OP0 A;  1WQW A;  5GMK m;  4QVD A;  5LJ5 g;  3RUX A;  4C8Q F;  5GAN e;  1JBM A;  1M8V A;  5GAN j;  2DXU A;  5LJ5 d;  3V7R A;  2DZ9 A;  4M75 G;  2VXE A;  3SWN B;  4PJO A;  4M78 A;  4Y91 A;  1BIA A;  2E1H A;  3L2Z A;  4F7U B;  4M7D B;  5GAM h;  4F7U G;  3VU3 C;  5LJ3 d;  4M7D G;  4EMK C;  3BFM A;  3FIF A;  4M75 D;  3GIB A;  3SWN C;  3RKY A;  1WNL A;  1Y96 A;  3JCM h;  3PGG A;  4C92 D;  3HSB A;  4M78 E;  1I8F A;  4F7U E;  2QTX A;  4RCB A;  1MGQ A;  3QO3 A;  4HA8 A;  4M75 E;  3FB9 A;  3V7S A;  3JCM J;  5LJ5 j;  4MML A;  5LJ3 g;  1TH7 A;  1M5Q 1;  4V2S A;  4M78 G;  3V8J A;  2RM4 A;  4MMK A;  4C8Q A;  4PJO E;  4M7D F;  3SWN A;  4A54 A;  4PJO B;  2DVE A;  4NOY A;  2RD1 A;  5LJ3 h;  3JCM V;  5GAN 6;  5GAN g;  2E65 A;  3EFR A;  4J6Y A;  4M75 F;  4WF2 A;  3V7C A;  5GAO n;  4M7A B;  4M7A A;  2HNI A;  4M78 F;  4XTU A;  4J6X A;  1I4K 1;  2E10 A;  4C8Q G;  4PJO C;  2DTI A;  4PNO A;  4C8Q B;  5GAO q;  3JCM W;  2YLC A;  4C92 A;  4NL3 A;  4M78 B;  4M7A C;  4HT9 A;  2DTH A;  3V8L A;  4EMK A;  5CAI A;  4JUV A;  1KQ2 A;  4M75 C;  5GAO p;  4C8Q C;  5I21 A;  4XQ3 A;  2VC8 A;  4M78 C;  3JB9 G;  3JCM b;  3QUI A;  4XTZ A;  5GAM d;  2YHT A;  3JCM X;  2DTO A;  3RKX A;  4C8Q E;  5GAN f;  1B34 A;  3JB9 F;  4EMK B;  4M7A F;  1WQ7 A;  4XU1 A;  2CGH A;  5LJ5 h;  4C92 B;  5GAO l;  4M7A E;  4X9C A;  5LJ5 f;  5GAM f;  3JCM e;  3INZ A;  1HK9 A;  4J5Y A;  5DY9 A;  3V8K A;  3RER A;  1WPY A;  1JRI A;  3L1A A;  3HFO A;  4M77 D;  5LJ3 e;  1B34 B;  1KQ1 A;  2I2L A;  5LJ3 j;  3JB9 J;  1LNX A;  2DEQ A;  1N9S A;  2EAY A;  4QVC A;  4M75 B;  3FJP A;  4M77 E;  2DJZ A;  2JN0 A;  2EJF A;  1YCY A;  4F7U A;  4M7D A;  4N0A C;  3JCM d;  1N9R A;  3JB9 D;  4EMH A;  5GMK h;  4M7A D;  2EJ9 A;  2DZC A;  2VXF A;  4XU2 A;  1I5L A;  3AHU A;  4C92 C;  2E64 A;  4HT8 A;  4M7D C;  4C8Q D;  2YLB A;  5GMK l;  1Y96 B;  5GAM g;  4PJO F;  2FB7 A;  5GAO r;  2EWN A;  2RA2 A;  5GAN 8;  3BY7 A;  5GAN h;  4RCC A;  4JLI A;  4XTV A;  5LJ5 e;  4XTX A;  5GAO m;  3JCM g;  3JB9 I;  5GMK i;  3RES A;  3JCM c;  4A53 A;  3QHS A;  3BDU A;  4JRK A;  3HFN A;  4XU0 A;  4F7U F;  1BIB A;  2RB6 A;  5GAN 7; 
#chains in the Genus database with same CATH topology
 3CD6 Q;  1K9M C;  4Q5W A;  3NTH A;  4OMQ A;  2RN8 A;  2HSE B;  2AZV A;  2ZGW A;  3F70 A;  1VQ9 T;  3DKM A;  4E6R A;  5GAN 3;  2DK3 A;  1KC8 R;  4C92 G;  3QKJ A;  2KI7 A;  5GAM e;  1PSF A;  2LTO A;  2ABL A;  3CCL T;  4II1 A;  1EZZ B;  3O5Z A;  4J6W A;  5L8R E;  2F2V A;  4ATO A;  2CKK A;  3HRS A;  1K73 U;  3IQL A;  2PZ1 A;  1NLO C;  5GAN j;  3EGX A;  3SWN B;  2LCC A;  4M7D B;  1EIF A;  4JRP A;  2RJD A;  4JS4 A;  2YRC A;  3CQT A;  4PK4 A;  1I8F A;  1CSK A;  3MEW A;  3RR6 A;  5IT9 E;  3OW2 S;  7AT1 B;  2QGF B;  4CI0 C;  1RAF B;  2DA9 A;  3HTR A;  1V1C A;  2DVE A;  3QPH A;  2RI3 A;  1PCX A;  2GCX A;  2QI2 A;  2YUQ A;  1YJN T;  4JJD A;  4HCB A;  1UGR B;  5GAO p;  4C0F A;  3RBB B;  3G4S Q;  4QVZ A;  3CCJ T;  1M1K C;  4GY5 A;  3EGU A;  2XU8 A;  4EDU A;  1WYX A;  2KT8 A;  5CCA A;  4J5Y A;  4BE1 A;  3VS5 A;  4ANJ A;  4AFQ C;  1X2Q A;  2ROL A;  1VQ4 T;  1MV0 B;  1AEY A;  4JLG A;  4MZT A;  3UA6 A;  2K5F A;  2EWN A;  3CBM A;  1KK7 A;  2ZPE B;  2C06 A;  3CCS A;  1KHI A;  4JRK A;  2DLP A;  3THK A;  4ESR A;  3M4G A;  1ZSG A;  2H8H A;  3OW2 A;  1IZ6 A;  3C0C A;  3QSU A;  3PVL A;  2RHY A;  2DXC A;  4RTZ A;  5I2M A;  4OB2 B;  2CT4 A;  3DB4 A;  5CKB A;  1PWT A;  4BDZ A;  1NG2 A;  1KD1 R;  2Y90 A;  4JRI A;  3OQ5 A;  3CC2 Q;  1LPL A;  3CCE T;  2JOY A;  3H0I A;  2D8J A;  1G2B A;  3CCE Q;  2EPD A;  1GXI E;  2DD5 A;  3L2Z A;  1UEC A;  3GIB A;  3BFM A;  4RTT A;  3OBW A;  1RAC B;  2EYY A;  4FT4 A;  3X25 B;  1BU1 A;  1C1A A;  1RAI B;  2G6F X;  4E47 A;  2F5K A;  3M59 A;  2G3R A;  1AWJ A;  1B07 A;  2FPE A;  3V7C A;  1G3Y A;  1ZBX A;  1K4U S;  2E10 A;  4FM4 B;  2SRC A;  4RTY A;  4FSS A;  2JJ9 A;  2XK0 A;  2VC8 A;  1PNJ A;  3VJP A;  4XTZ A;  1WGS A;  4JPB W;  2QGG A;  5GJV B;  4ZGJ B;  5FU6 C;  1VQO A;  1M4Z A;  1K9M R;  5IHK A;  1B34 B;  2CZ0 B;  2Y4X A;  2HQE A;  1NPR A;  2DRK A;  4M7D A;  1IB8 A;  1ABQ A;  2R5M A;  4DBH A;  1D09 B;  1YJ9 T;  4J7I A;  3L2U A;  2LX7 A;  1VQK T;  2E5K A;  2CSQ A;  4JLI A;  2XDB A;  1UDL A;  2ZPG B;  4WTO B;  1V29 B;  4M7D F;  1AD5 A;  1BIB A;  2RB6 A;  3OA6 A;  2X3X D;  2XIC A;  4PFO A;  2KYB A;  5CQX A;  2K57 A;  3PNW C;  4OB0 B;  1I81 A;  5DM7 R;  3SD4 A;  4E2F B;  3CC7 Q;  2O88 A;  3D7S B;  5CO7 A;  4EMG A;  4XU3 A;  3N5B B;  4ME7 A;  3EFS A;  4J9G A;  2O4X B;  1WQW A;  3CCQ Q;  3RUX A;  3OYC A;  3CCR A;  1BI0 A;  4FYY B;  4OGE A;  3JRZ A;  2LRQ A;  3C12 A;  3ASK A;  1TU0 B;  3PT9 A;  4EMK C;  4FU6 A;  1VQ6 Q;  3SWN C;  1Y96 A;  3QO3 A;  2YUO A;  4BAC A;  4GLM A;  4MML A;  2EQI A;  1ZUK A;  2ECZ A;  3LX7 A;  3V8J A;  2DL4 A;  4PJO B;  3EFR A;  2RF0 A;  4J6X A;  3KXT A;  1T0J A;  3CPF A;  5CAI A;  2JXB A;  6AT1 B;  5CQY A;  1E6G A;  4BI4 A;  2RK1 A;  2J6F A;  3GNG A;  2R5A A;  3JCM X;  2EYZ A;  2IIM A;  2XD0 A;  5KYY A;  3H8Z A;  5LJ5 h;  4C92 B;  1IGQ A;  1ZUY A;  2JMC A;  1YI2 A;  2CP6 A;  2QQS A;  5A2Q E;  3RER A;  1WPY A;  1WA7 A;  1TUD A;  3ZBD A;  3ZL7 C;  1NJI U;  1BB9 A;  3HL8 A;  4DBR A;  4DA4 A;  4N0A C;  2EQM A;  1GFD A;  2KVQ G;  1S72 T;  1XQH A;  2FZC B;  4M7D C;  4OVA A;  2EQJ A;  1JJ2 P;  4N4I A;  5GAN 8;  1RL2 A;  1QCO A;  4JJN K;  4A53 A;  3OYF A;  4BE0 A;  2DF6 A;  3RKW A;  2DL5 A;  1G3T A;  4FYV B;  3G1J A;  4OF1 A;  5FW9 A;  1RAA B;  3A8O B;  5HK0 A;  3MPU B;  4DBQ A;  1D3B A;  1VQN A;  1YHQ A;  1VQ8 T;  3OW2 P;  1X43 A;  2YRD A;  2D0N A;  3M0P A;  4XK8 E;  1TTH B;  1D3B B;  1QKW A;  3VUB A;  2L3S A;  1K8A R;  4C92 F;  2CDT A;  3VS0 A;  1VQ5 Q;  1NEG A;  2PVG B;  4F7U G;  4J9H A;  1W4S A;  1UGP B;  1WDX A;  1M90 R;  4M7D E;  1GBR A;  3EG3 A;  2J06 A;  4VUB A;  2AK5 A;  2QXF A;  4X34 A;  2RM4 A;  1WHJ A;  3CXC A;  4RUG A;  3CC7 T;  3S3M A;  4BDY A;  3OMG A;  1Q82 C;  1RAE B;  1OX9 A;  4C92 A;  4OMN A;  3UT1 A;  1IXD A;  2O9V A;  2NUP A;  3CC2 A;  1ACM B;  3CBO A;  2O9S A;  4OMF B;  1K8A U;  4M7A F;  1I07 A;  4PL6 A;  5GAO l;  4D8D A;  2KQW A;  2QDL A;  3HFO A;  1JO8 A;  2C0I A;  4IUU A;  3TQ7 P;  1VQ7 T;  1M90 C;  2CP5 A;  1Q7Y R;  2OTL A;  3ER0 A;  2O31 A;  5ECA A;  1M90 U;  5C6S A;  2LC4 A;  1Z9Q A;  3CME T;  1Y96 B;  2A08 A;  2EGE A;  5GAO r;  3L2W A;  3CCV T;  2FZK B;  1KD1 U;  5KCO A;  4R56 A;  1YWO A;  1M2V A;  1TUG B;  1K8A C;  2X9H A;  2VUB A;  2MYS A;  5GAN d;  4DBF A;  3VS7 A;  2HZY A;  4D8K A;  2P0Q A;  4M75 A;  2W0Z A;  1C6V X;  3A8L B;  2OI3 A;  4M78 D;  2P4T A;  1VQO Q;  1VQN T;  4MDW A;  2OAW A;  4AFZ C;  5GMK e;  1VQM T;  2RH2 A;  2WAC A;  4FW1 A;  4PJJ A;  4QQD A;  3H6Z A;  2H3E B;  4KH0 B;  3JCM f;  1QVF A;  4KUI A;  2EFI A;  1VQM Q;  1WXU A;  3C94 A;  3CCU T;  2E1H A;  3REB B;  2KRM A;  5LJ3 d;  4N4H A;  2RQW A;  3CCL A;  2VGM A;  3PGG A;  4LE9 A;  2QG9 B;  4ORZ A;  3HKS A;  1NPP A;  4DOW A;  2RNA A;  4FL6 A;  4L59 A;  3VS6 A;  9ATC B;  5LJ3 h;  4J6Y A;  1AVZ C;  1YIJ Q;  1TUC A;  2DO3 A;  3CC7 A;  2AHJ B;  2KYM A;  4PJO C;  2DBM A;  3OS0 A;  4C0D C;  4KGX B;  4M78 B;  4JJB A;  4XQ3 A;  1RI9 A;  1OPK A;  2VWF A;  4MZM A;  3I55 A;  1HSQ A;  1LCK A;  3LYI A;  2A3L A;  1K73 R;  3CCQ A;  1NBE B;  3UF4 A;  3JCM e;  3CCR Q;  2GQI A;  1N8R R;  2EVR A;  3OS2 A;  4M77 D;  3G7Z A;  3M5A A;  1SEM A;  2HQX A;  3FJP A;  3OYB A;  2DRM A;  5HK3 A;  1VQ6 A;  1X69 A;  3JCM d;  4BUG A;  2M16 A;  1PM3 A;  1QCF A;  4XU2 A;  1WJS A;  1FYN A;  2DIL A;  1K9M U;  2CP0 A;  2RHX A;  3VRZ A;  2XG8 D;  2J05 A;  4XTX A;  3HRU A;  3EAE A;  2XDD A;  1IHW A;  5IHI A;  8AT1 B;  3P8B B;  3M57 A;  1MHN A;  3LW5 E;  4NS5 A;  1BYM A;  3GPL A;  5GAN 2;  1VQP Q;  4IKF A;  3MO8 A;  4M77 B;  2PUO B;  1D1A A;  4FSX A;  1SRL A;  1UB4 A;  3G71 T;  5FU7 C;  1YNZ A;  4Z89 A;  3SB2 A;  2VB6 A;  3OYY A;  4J9D A;  4C92 E;  1YI2 Q;  2DKG A;  4ELZ C;  3JAM E;  2OJ2 A;  3HPW A;  1T0H A;  1VYT A;  3QJY A;  5LJ5 d;  1NE8 A;  2M0Y A;  1NEB A;  2JM8 A;  2CP2 A;  1W1F A;  2HDA A;  2R58 A;  1VYU A;  1FMW A;  5KYU B;  1EFN A;  5LJ3 g;  2H3J A;  2OAU A;  2Z0W A;  4KGV B;  1M1G A;  5D6X A;  1X6B A;  3FLG A;  5FRO A;  4M75 F;  4WF2 A;  2KNB B;  4M7A B;  3L2Q A;  3G71 A;  2DD4 A;  2NUZ A;  3MKD A;  4C8Q G;  1OI1 A;  3CBP A;  4PNO A;  1VQN Q;  1YHQ Q;  2AIR B;  1R0B G;  1UJ0 A;  2V8J A;  2DTH A;  4C5E A;  3V8L A;  1UJY A;  1ZHI A;  1AOJ A;  2D8H A;  4JUV A;  2P84 A;  2KAF A;  4AT1 B;  2PVO B;  4KGZ B;  3A8M B;  3RKX A;  3MEU A;  1DJ7 B;  3JB9 F;  3QYG B;  3OYM A;  2VVK A;  3I5S A;  1VQ5 A;  2CRE A;  1M2O A;  3L1A A;  1KQ1 A;  2DEQ A;  1QVF S;  2EIF A;  1U5S A;  2LJ1 A;  1BCO A;  5GMK h;  5M9O A;  3EFO A;  3A98 A;  1I5L A;  4PJL A;  3I5R A;  1VQ6 T;  2E64 A;  2BUD A;  3H9N A;  2NYS A;  3PIO A;  5LJ5 e;  3WVD B;  1TWB A;  2E3I A;  2QEX Q;  1U1T A;  3VS4 A;  2DYI A;  2HBW A;  2ROT A;  2MCN A;  4XTY A;  4QQG A;  1SHF A;  1BBZ A;  1OPL A;  1Q82 U;  2JMA A;  5A0G A;  2LNH B;  4PLI A;  3VS2 A;  1G8X A;  5KH6 A;  3OYL A;  4M77 G;  2VAS A;  3CEY A;  5KE2 A;  2K3Y A;  4M77 C;  3LGF A;  3VS1 A;  4A4G A;  3FDR A;  4OP0 A;  1Y71 A;  5GAN e;  1VQL A;  2OTL Q;  1W6X A;  1PRL C;  4M75 G;  3OYN A;  2X4W A;  3M54 A;  1W2B P;  1G3W A;  1QCN A;  3M0S A;  2QYZ A;  2FPD A;  2JW4 A;  1U3O A;  4AMC A;  5HCK A;  3JCM h;  4D6W A;  4M78 E;  2DMO A;  1TG0 A;  1ZUU A;  5LJ5 j;  1OQK A;  2GQV A;  2QTV A;  1D1B A;  2R57 A;  2KE9 A;  5GAN 6;  5FU6 B;  2BE7 D;  3CXC S;  2HL5 C;  1G83 A;  2DL3 A;  3X28 B;  1FWZ A;  3TVT A;  1M1K R;  1QW1 A;  4EMK A;  3UA7 A;  1KQ2 A;  3NFC A;  2V8K A;  4C8Q E;  4LN2 A;  3TCJ A;  1Y57 A;  2HEQ A;  4OGC A;  1K9A A;  4QW2 A;  5DY9 A;  3V8K A;  2KRN A;  1VQM A;  5LJ3 j;  1YN8 A;  2J7I A;  2FRW A;  2OTL T;  3Q1J A;  3CCL Q;  4J7F A;  2JTF A;  1Q81 U;  2EJ9 A;  2YXY A;  3PVQ A;  5FRN A;  4LDU A;  1WJQ A;  2RJF A;  2RPN A;  5GMK i;  1YIJ A;  4F7U F;  1RAG B;  1R77 A;  1BI3 A;  1QP3 A;  4F14 A;  4E7H A;  4LDX A;  2A36 A;  1UGQ B;  2QK0 A;  3NPF A;  1LJO A;  4JZ4 A;  1PSE A;  3DLM A;  2DET A;  4PJO D;  1AT1 B;  5D6Y A;  2RI2 A;  2EKH A;  5KYW A;  1QVP A;  3I55 Q;  2CP3 A;  4OMO A;  2PQW A;  4NL2 A;  2OTJ T;  4L5G A;  1N6A A;  2B8A A;  1H8K A;  3EG1 A;  4C0D B;  2VYT A;  2DIG A;  1H3H A;  1BKB A;  2NUP B;  3R6N A;  2E3H A;  1YJ9 A;  1GFC A;  1YHQ T;  4C5I A;  3CCU Q;  3M4Y A;  2LX9 A;  4QT7 A;  4BE2 A;  1PD0 A;  3GOX A;  1QVG P;  1F1B B;  2EYW A;  3UPU A;  1D1C A;  1UTI A;  3A1P A;  2L8D A;  2KRO A;  4LD9 K;  3HHT B;  3MP6 A;  3L2R A;  1MGQ A;  4L6V 5;  4M75 E;  3FB9 A;  5FWB A;  4YTL A;  2YUP A;  4AFU C;  1VQO T;  3EH2 A;  3X24 B;  4K11 A;  1TOV A;  3SWN A;  1VQP A;  2EQU A;  5GAO n;  4M78 F;  2YT6 A;  1PKS A;  4OML A;  3UDC A;  1X2K A;  3FEO A;  4M7A C;  5I11 A;  2PTK A;  3G4S T;  4M75 C;  4WCI A;  2VGN A;  2KK4 A;  3INZ A;  4C0Z A;  3G6E A;  4HKE A;  2F2X A;  4Z8A A;  5LL6 S;  2LZ6 B;  3PMI A;  2DJZ A;  4Z02 A;  2RQT A;  3X26 B;  1VQK Q;  1ZSZ B;  4PKC C;  1NYG A;  3I56 T;  1YJN Q;  1QLY A;  5I2S A;  2F1L A;  4R55 A;  5IXF A;  1M8M A;  5GAN h;  3JB9 I;  1E6H A;  1UE9 A;  1SSH A;  2K2V A;  2BTT A;  1Q82 R;  4BI3 A;  1XNI A;  2C0T A;  2QAS A;  3G71 Q;  3WXM B;  4E7S A;  5FRM A;  3EHR A;  3MP8 A;  2D1X A;  5GAN 5;  2KT1 A;  4CC7 A;  3ME9 A;  5IAY A;  3PTA A;  1U1S A;  4M77 F;  2E6Z A;  2YRV A;  8ATC B;  5GMK j;  1UGV A;  1QWF A;  3GLX A;  1KQS P;  1YIT T;  2EQK A;  1VQL T;  1MUZ A;  1VQ5 T;  2DBK A;  2BZY A;  2BE9 B;  1Z9Z A;  3OYK A;  1VQ4 A;  3H0H A;  2QEX T;  1RAD B;  1XTD A;  2QDY B;  4F7U E;  2CZ6 B;  2JUF A;  3U23 A;  2NLU A;  4XAX B;  1XJW B;  1GCQ C;  5I22 A;  2QEX A;  1VQ9 Q;  1TH7 A;  3QII A;  2DAQ A;  2O01 E;  3E2U A;  4CRI A;  5IN1 A;  4LNP A;  3E1S A;  2COY A;  4C0G A;  1M27 C;  2HNI A;  3A8H B;  5FWC A;  2JVV A;  3OYA A;  3JCM W;  4ZTF A;  1RI0 A;  1M1F A;  1YIJ T;  2DXB A;  2YWW A;  2DIQ A;  2LMJ A;  3QWX X;  3I55 T;  3X20 B;  3RNJ A;  4LDV A;  4M78 C;  4GLK A;  1B34 A;  1N8R C;  3SEM A;  3QDF A;  4MDX A;  2QQA A;  1VQL Q;  5AT1 B;  3OBY A;  4EPC A;  1ARK A;  4M77 E;  1AZE A;  2F2W A;  2CYZ B;  4Y28 E;  1OOT A;  2GBQ A;  2V1R A;  1XOV A;  1Q95 G;  1NJI C;  2MIO A;  2NUT B;  3EGD A;  2JNG A;  2IG0 A;  3EG9 A;  4ZGD B;  1V76 A;  1SF9 A;  3QHS A;  3BDU A;  1PKT A;  1RUW A;  1YJW Q;  1M9S A;  3VS3 A;  1J3T A;  4A4E A;  4OMP A;  3URG A;  4FCY A;  1PG5 B;  2W10 A;  3EH1 A;  1UHF A;  1ZQ1 A;  3BW1 A;  4IIM A;  4ZTJ A;  1KSW A;  2L89 A;  4A4F A;  4HCK A;  1OUL A;  4E7I A;  4DQ2 A;  2EGA A;  1VOM A;  2HAX A;  1WX6 A;  4QVD A;  2LQ8 A;  3C4S A;  1RAH B;  2DER A;  2DZ9 A;  3LWI A;  5A0D A;  1KG1 A;  3CCV A;  2X4Y A;  3FIF A;  1A0N B;  5AYF A;  1K73 C;  2QTX A;  4CC2 A;  1WFW A;  1NJI R;  2GTO A;  2ZPI B;  1I1J A;  4M7A A;  2V26 A;  1KQS S;  1Q7Y U;  5GAO q;  2M0O A;  2E70 A;  1Q81 C;  1T3S A;  1Q86 C;  3TRE A;  1GRI A;  2WSC E;  4QKU A;  4AFS C;  3M9Q A;  3QYH B;  3J81 E;  1YIT A;  3QUI A;  1T3L A;  2A28 A;  3EHQ A;  5EC7 A;  3CCS T;  1YJ9 Q;  1W2B A;  2AT1 B;  3CCU A;  2L5Q A;  3GNF B;  2X3W D;  2CH4 A;  1N9R A;  3QZ5 B;  2DZC A;  4KRT A;  1K0S A;  2F69 A;  4C92 C;  3J7A F;  4LUD A;  5GAM g;  3QZ9 B;  1UEB A;  3CC4 A;  4QQ6 A;  1YWP A;  4TVR A;  4XTV A;  1NYF A;  2A0F B;  2L0A A;  1X01 A;  2DL7 A;  3OS5 A;  1UHC A;  1AWX A;  1WLP B;  2VKN A;  2DJQ A;  4FW2 A;  2X4X A;  4CC4 B;  2BIV A;  3RDV A;  1SRM A;  2BZX A;  2RJE A;  1QVG A;  2DE0 X;  2YSQ A;  2ENM A;  2ESW A;  2B86 A;  3G6E Q;  4RTX A;  2GFA A;  4RTU A;  2LDM A;  4PLL A;  2YDL A;  1QMC A;  3DLL A;  2FG0 A;  2P0K A;  3TEE A;  1ZA2 B;  1VQK A;  2FZG B;  1MMG A;  2DFU A;  1KQS A;  3V7R A;  2DNU A;  4IUP A;  1YJN A;  5CKF A;  4F04 B;  3CMA A;  2DEU A;  2O2O A;  3SDZ A;  3V7S A;  2XDP A;  3NHN A;  1M5Q 1;  3CME Q;  2HCK A;  3OB9 A;  2QQB A;  4PJO E;  2KEA A;  2JTE A;  2RD1 A;  2FRY A;  2I0N A;  3WVE B;  3KUF A;  2DTI A;  4IIO A;  3EGX B;  3VRY A;  2RQV A;  1R8O B;  5I21 A;  4E7K A;  1S1N A;  2RI5 A;  3MP1 A;  1WXT A;  2DTO A;  4KUL A;  1WQ7 A;  4XU1 A;  2EBP A;  3CC4 T;  5GAM f;  4KUD K;  1VQ7 A;  2LCS A;  4J8O A;  2CZ1 B;  3MJX A;  4DOV A;  1ZA1 B;  1VQ4 Q;  1G5V A;  2EJF A;  2BKD N;  2KRS A;  4Y92 A;  1Q7Y C;  3AHU A;  1VQ9 A;  2YLB A;  5GMK l;  3QJ6 A;  1X27 A;  2L3Q A;  1LVK A;  2P0P A;  4IUV A;  2QA4 Q;  3M55 A;  2RQR A;  2M9U A;  3VKI A;  2M1H A;  2PU9 B;  2XI9 A;  3OYH A;  1I0C A;  3RIR A;  2CSI A;  1ZSZ A;  2MWP A;  1VA7 A;  3CPW S;  5IHN A;  1UG1 A;  3JB9 H;  2COW A;  4O5V A;  2LP5 A;  2K7A A;  5CIU A;  4M7A G;  1JJ2 A;  2L2P A;  1PD1 A;  3MHX A;  2E12 A;  1H3Z A;  1WI7 A;  2EJG A;  1H92 A;  3M58 A;  4HCC A;  3MEV A;  4JDS A;  5HKC A;  3QBY A;  4E7J A;  1VQ8 Q;  3E9G A;  5J39 A;  1IRE B;  2IPO B;  4RG8 A;  1OEB A;  5GMK m;  5LJ5 g;  2PUK B;  5IXB A;  3H41 A;  2JZ2 A;  3OYD A;  2X51 A;  4PFZ A;  3TSZ A;  4JRQ A;  3LGL A;  2V1Q A;  2VXE A;  4FT2 A;  1BIA A;  1RAB B;  3CPW A;  3VUZ A;  2JS0 A;  4M75 D;  2A37 A;  3CCM T;  5EG2 A;  4LDY A;  2RHI A;  1S72 Q;  2OX7 A;  1MNE A;  4KH1 B;  4FYW B;  3UWN A;  1YJW A;  4V2S A;  2LCL A;  4M78 G;  4C8Q A;  1YCS B;  4E7Z A;  4A54 A;  3ULR B;  2E65 A;  1IRX A;  1MND A;  2ZZD A;  4C8Q B;  2WSE E;  2HBP A;  1OU8 A;  2YLC A;  2LT1 A;  3GF5 A;  2K5L A;  1D0Z A;  1I5O B;  5DLQ E;  2ZAE A;  2LJ0 A;  4N4G A;  5KYN A;  3A8G B;  1P92 A;  1WHM A;  1OZ2 A;  1ZLM A;  2EKO A;  3FRN A;  3QWY A;  2HMA A;  2D0Q B;  4X9C A;  2LVM A;  1BI1 A;  2K6D A;  1OX8 A;  3JB9 J;  2AZS A;  2I2L A;  2AKL A;  5KYW B;  3CCV Q;  1Y0M A;  4JS5 A;  3LWH A;  2COZ A;  2M02 A;  2X4J A;  2RQU A;  1AZG B;  5KCH A;  1HJD A;  1TS9 A;  4C8Q D;  3J80 E;  3L2V A;  3KBG A;  3HP9 A;  1GL5 A;  2QAZ A;  4C5H A;  1VQP T;  2X35 A;  1IGU A;  2OTJ A;  4J83 A;  1X6O A;  1OYX A;  1M3C A;  2CUD A;  4HVU A;  2QA4 T;  4J9F A;  1MV3 A;  2DXT A;  3VV0 A;  1MMD A;  4B9W A;  2KY9 A;  3P8H A;  1D0X A;  4XTW A;  1YIT Q;  5CKE A;  4C5G A;  4N0A A;  4M7D D;  2DPP B;  3A5Z B;  1FMK A;  1FMV A;  5A0L A;  3I9Q A;  1EX4 A;  2HKQ B;  5GJW B;  4J9I A;  4F16 A;  5LJ3 f;  3CCR T;  2YUN A;  2RMO A;  3OYJ A;  3MCA B;  3EG2 A;  5FU7 B;  2DXU A;  3JV3 A;  2QQ9 A;  4LDW A;  2J6O A;  2MAM A;  3CC4 Q;  1WNL A;  2HSP A;  3PFS A;  3NTK A;  3JCM J;  1VUB A;  3R6O A;  5IH2 A;  3CCJ Q;  1TXQ A;  3T9N A;  4RTW A;  2DYB A;  2AKK A;  3OYG A;  4FYX B;  4NOY A;  5GAN g;  2LQW A;  2KMT A;  4NL3 A;  3S3N A;  2HD0 A;  2LNV A;  4X1V A;  3SFM A;  3BE3 A;  1JB0 E;  4DEX A;  3I56 A;  2K2M A;  1WHK A;  5CVI A;  4HVV A;  1GCQ A;  1NLP C;  1KFZ A;  2CGH A;  3OYI A;  2JT4 A;  3LH0 A;  5KYU A;  2MOX A;  4Z88 A;  1KC8 C;  1JRI A;  4RG2 A;  2DVJ A;  5LJ3 e;  4A4K A;  1OV3 A;  4RTV A;  3MET A;  4QVC A;  3CMA Q;  3OSS C;  4F7U A;  4JJC A;  2GNC A;  1SPK A;  5KYX B;  1M3A A;  3CCM Q;  4JZ3 A;  3C95 A;  3VYG A;  4PJO F;  3CME A;  1KC8 U;  4GBQ A;  2RA2 A;  3CMA T;  1SSF A;  1GCP A;  2MI6 A;  3JCM g;  1KD1 C;  4BY6 B;  2ZCF B;  1VIE A;  2RHZ A;  4CC3 A;  4ZNX A;  1C0M A;  4KBM B;  1KIK A;  3JCM P;  3E19 A;  1PHT A;  4ZGE B;  4OMM A;  1JXM A;  4PJO G;  1BK2 A;  3QXE B;  3ZEH A;  1LOJ A;  3DB3 A;  4BI8 B;  1ZBJ A;  2LQN A;  1VQ7 Q;  2V8I A;  1W2B S;  1RLQ C;  4F17 A;  3PIP A;  2GFU A;  3NGP A;  3HRT A;  2CS7 A;  2E4H A;  3OSV A;  1QP2 A;  1RLP C;  4PJO A;  2EGC A;  4Y91 A;  4F7U B;  2KDS A;  1OU9 A;  3VU3 C;  3ZFJ A;  4LXC A;  2MMP A;  4C92 D;  1FX7 A;  3HSB A;  1ABO A;  3MEA A;  2NUT A;  2QA4 A;  2ZPH B;  3AT1 B;  3M0U A;  4A63 B;  1IO6 A;  1E7O A;  5CK9 A;  3CCQ T;  3L42 A;  5DLO A;  3JCM V;  1HD3 A;  4KT0 E;  2FL7 A;  1I4K 1;  2JS2 A;  3CD6 A;  2O4X A;  3S3O A;  3I35 A;  1AWO A;  3QG1 A;  4E7L A;  1WHH A;  1Q86 R;  3JB9 G;  2RHU A;  2YHT A;  2GGR A;  1YI2 T;  2M51 A;  1VQ8 A;  3M0T A;  3KFV A;  1JU5 C;  3RMQ A;  2XID A;  1HK9 A;  1O75 A;  5D7U A;  2GF7 A;  2JN0 A;  1S72 A;  4EMH A;  4M7A D;  2L3P A;  1R0C B;  2WSF E;  1PC0 A;  4B9X A;  3OMC A;  5L23 A;  1GBQ A;  4P5N A;  1IHV A;  2XMF A;  1D0Y A;  3HFN A;  3LH5 A;  2KGT A;  2CH4 W;  2JTM A;  2HKN A;  2PVD B;  3M0Q A;  3JCM Q;  1TSF A;  2DM1 A;  1YFN A;  4IUQ A;  1O9S A;  1VYV A;  1Q86 U;  3S6W A;  3VYH B;  3E9F A;  4M77 A;  1K1Z A;  3EG9 B;  4ZN3 A;  1U8R A;  1AWW A;  5CKH A;  3G4S A;  3EGD B;  2EW3 A;  1YBY A;  2ED1 A;  2CP7 A;  4LD6 A;  2XHC A;  5FLX E;  3EG0 A;  1JBM A;  4OB3 B;  1M8V A;  4B6M A;  4M78 A;  1WXB A;  2JM9 A;  4M7D G;  5KYX A;  3CD6 T;  2A7Y A;  3M56 A;  3GP8 A;  4HCZ A;  3RKY A;  1MMN A;  2LQK A;  4FIB A;  2OTJ Q;  3NTI A;  4HA8 A;  2KBT A;  4OB1 B;  1G3S A;  1M30 A;  3TSW A;  1KHC A;  4BD3 A;  4J9C A;  2E5Q A;  2K9G A;  2XKO C;  4MMK A;  4A4H A;  1AHJ B;  3CCS Q;  5HY6 A;  5CKD A;  2RO0 A;  1UGS B;  2NWM A;  2E6N A;  1MMA A;  2HL3 A;  3PE0 A;  2K3X A;  2ZPB B;  1B3Q A;  2EYX A;  4HT9 A;  2P4R A;  2RK2 A;  2KXC A;  1X6G A;  2F5T X;  2MF2 A;  4PJM A;  5GAM d;  2J6K A;  3PMT A;  2K5I A;  2FHD A;  1QQJ A;  4HXJ A;  4M7A E;  3UAT A;  4PFP A;  5LJ5 f;  3OS1 A;  2MK5 A;  2FO0 A;  1WZO A;  1UUE A;  1M3B A;  1N9S A;  2EAY A;  4M75 B;  1YCY A;  3CCE A;  2MPX C;  1Y7X A;  2VXF A;  1NZ9 A;  1K76 A;  4HT8 A;  3CXC P;  4ELY C;  1JJ2 S;  3CCJ A;  2K4Y A;  1M2V B;  2FB7 A;  2D9T A;  1Q81 R;  4RCC A;  1N27 A;  3SHW A;  3JCM c;  1JQQ A;  1B7T A;  4XU0 A;  1ZX6 A;  5GAN 7;  1N8R U;  3P8D A;  3O8V A;  5KE3 A;  5J26 A;  4X9D A;  1OZ3 A;  1WJR A;  2ZPF B;  2GTJ A;  3M0R A;  2KXD A;  3I56 Q;  4IUR A;  2FYK A;  2L3R A;  1SG5 A;  1HXD A;  2QQR A;  4PJN A;  1CKA A;  1VIF A;  3JSC A;  3NMZ C;  1JEG A;  1H64 1;  1NM7 A;  4J9E A;  1ZSZ C;  1KJW A;  4AG2 C;  4IUT A;  2DL8 A;  1PRM C;  1QKX A;  2BZ8 A;  5GAM j;  3FJ5 A;  5GAN 4;  1YJW T;  2E41 A;  3FC3 A;  4C8Q F;  4DEY A;  1HYO A;  1CKB A;  3H0F A;  1SKU B;  3OYE A;  3CCM A;  4HVW A;  4LUE A;  5GAM h;  2FPF A;  3OY9 A;  1QVG S;  3RMS A;  1Y07 A;  2KR3 A;  4RCB A;  1YP5 A;  3LLR A;  1QWE A;  1SHG A;  4ZN1 A;  2K3B A;  2LJ3 A;  2PNI A;  2ED0 A;  5KYY B;  4EIK A;  1BI2 A;  4RKU E;  2SEM A;  1N5Z A;  4UC4 A;  2Y4Y A;  4BY6 C;  1X75 C;  1K0X A;  3G6E T;  2CZ7 B;  2FEI A;  2FVU A;  4XTU A;  1JXO A;  4O6J A;  2K79 A;  4C8Q C;  2CUB A;  1UFF A;  1QVF P;  1FXX A;  3JCM b;  5CR2 A;  2RJC A;  1BCM A;  5J3B A;  3EFO B;  5GAN f;  4EMK B;  2MWO A;  4RMO A;  4BB7 A;  4AG1 C;  3BDL A;  1U06 A;  3M53 A;  2C0O A;  2D6F A;  1LNX A;  1M1K U;  4J9B A;  3CC2 T;  2LT4 A;  3TU4 K;  4MZP A;  3GBQ A;  1WHL A;  2HQH A;  3JB9 D;  2VV5 A;  3QDR B;  4M4Z A;  1WIE A;  2DX1 A;  1W70 A;  2ATC B;  3REA B;  2CT3 A;  2EYQ A;  2IVW A;  3BY7 A;  5GAO m;  4R0K A;  3CPW P;  1WHG A;  5C0M A;  5D6W A;  3RES A;  2KSS A; 
#chains in the Genus database with same CATH homology
 3WXM B;  1K8A C;  1K9M C;  4Q5W A;  2QA4 T;  2VUB A;  3NTH A;  5FRM A;  2DXT A;  2ZGW A;  5GAN d;  3F70 A;  3MP8 A;  3VV0 A;  3DKM A;  1VQ9 T;  5GAN 3;  2DK3 A;  4B9W A;  5GAN 5;  2KY9 A;  3P8H A;  4XTW A;  4C92 G;  2P0Q A;  3QKJ A;  4M75 A;  3ME9 A;  5IAY A;  5CKE A;  4C5G A;  3PTA A;  1U1S A;  4N0A A;  1PSF A;  5GAM e;  3A8L B;  4M77 F;  2LTO A;  4M7D D;  2E6Z A;  4M78 D;  2P4T A;  2DPP B;  3A5Z B;  3CCL T;  2YRV A;  5A0L A;  1VQN T;  4MDW A;  4II1 A;  5GMK e;  1VQM T;  2RH2 A;  2WAC A;  4J6W A;  5L8R E;  5GMK j;  3GLX A;  4QQD A;  5LJ3 f;  3H6Z A;  4ATO A;  2CKK A;  3HRS A;  1YIT T;  1K73 U;  2EQK A;  3JCM f;  3CCR T;  1VQL T;  1QVF A;  3OYJ A;  3MCA B;  4KUI A;  5FU7 B;  5GAN j;  2DXU A;  2EFI A;  3C94 A;  3SWN B;  3CCU T;  2LCC A;  1VQ5 T;  2E1H A;  4M7D B;  1EIF A;  4JRP A;  5LJ3 d;  4N4H A;  3OYK A;  2RJD A;  1VQ4 A;  4JS4 A;  2QQ9 A;  4LDW A;  2MAM A;  3CCL A;  2QEX T;  2VGM A;  1M8V A;  1WNL A;  3PGG A;  3PFS A;  1XTD A;  2QDY B;  3NTK A;  1I8F A;  3MEW A;  4F7U E;  2CZ6 B;  2JUF A;  5IT9 E;  1VUB A;  2NLU A;  3HKS A;  3R6O A;  4XAX B;  1NPP A;  2QEX A;  3OW2 S;  4DOW A;  4CI0 C;  1TH7 A;  3QII A;  2DAQ A;  2O01 E;  4FL6 A;  3T9N A;  4L59 A;  5IN1 A;  4CRI A;  3JCM J;  3E1S A;  3OYG A;  2DVE A;  3QPH A;  4NOY A;  2RI3 A;  5LJ3 h;  5GAN g;  4C0G A;  4J6Y A;  2DO3 A;  2HNI A;  3CC7 A;  2AHJ B;  2KMT A;  3A8H B;  4PJO C;  2JVV A;  3OS0 A;  2GCX A;  3OYA A;  1RI0 A;  1M1F A;  4NL3 A;  4C0D C;  4M78 B;  2DXB A;  2QI2 A;  2DIQ A;  3S3N A;  1YIJ T;  2HD0 A;  1YJN T;  2LNV A;  4HCB A;  3I55 T;  1UGR B;  3SFM A;  5GAO p;  4C0F A;  3X20 B;  4XQ3 A;  1JB0 E;  4QVZ A;  4LDV A;  4M78 C;  3I56 A;  3CCJ T;  1M1K C;  4GY5 A;  5CVI A;  4GLK A;  4MZM A;  3I55 A;  1B34 A;  3LYI A;  1N8R C;  2XU8 A;  4EDU A;  2A3L A;  2CGH A;  3OYI A;  3CCQ A;  4MDX A;  2QQA A;  3LH0 A;  5CCA A;  4J5Y A;  3JCM e;  4BE1 A;  1KC8 C;  3OBY A;  1JRI A;  4RG2 A;  4M77 D;  5LJ3 e;  3OS2 A;  3G7Z A;  4EPC A;  3M5A A;  4A4K A;  4QVC A;  3MET A;  2HQX A;  1VQ4 T;  3FJP A;  4M77 E;  3OYB A;  5HK3 A;  1VQ6 A;  3OSS C;  4F7U A;  3JCM d;  4BUG A;  2M16 A;  4JLG A;  2CYZ B;  4Y28 E;  1XOV A;  4XU2 A;  1NJI C;  1WJS A;  4MZT A;  2JNG A;  1K9M U;  3C95 A;  2RHX A;  2IG0 A;  2K5F A;  4PJO F;  3VYG A;  3CME A;  4ZGD B;  2XG8 D;  1KC8 U;  2EWN A;  2RA2 A;  3CMA T;  3CBM A;  1SSF A;  2ZPE B;  2C06 A;  4XTX A;  2MI6 A;  3EAE A;  3HRU A;  3JCM g;  2ZCF B;  4BY6 B;  2XDD A;  3P8B B;  3CCS A;  1KD1 C;  1KHI A;  1VIE A;  3BDU A;  3QHS A;  4JRK A;  2RHZ A;  3M57 A;  1MHN A;  3LW5 E;  1M9S A;  4NS5 A;  1BYM A;  3GPL A;  5GAN 2;  4KBM B;  3M4G A;  4A4E A;  4IKF A;  3URG A;  3JCM P;  3E19 A;  3MO8 A;  4ZGE B;  3OW2 A;  1IZ6 A;  4M77 B;  2PUO B;  3QSU A;  4FSX A;  1UB4 A;  4PJO G;  3G71 T;  5FU7 C;  2RHY A;  2DXC A;  4ZTF A;  3JCM W;  3SB2 A;  5I2M A;  4OB2 B;  1ZQ1 A;  3BW1 A;  3QXE B;  3DB4 A;  4ZTJ A;  5CKB A;  1LOJ A;  3OYY A;  3DB3 A;  3ZEH A;  4BDZ A;  4C92 E;  4BI8 B;  2Y90 A;  4JRI A;  2L89 A;  3OQ5 A;  2DKG A;  4ELZ C;  4A4F A;  3JAM E;  2V8I A;  4E7I A;  3CCE T;  2JOY A;  1W2B S;  4DQ2 A;  3PIP A;  2GFU A;  2HAX A;  3HPW A;  3HRT A;  4QVD A;  2CS7 A;  2LQ8 A;  3OSV A;  1QP2 A;  3C4S A;  3QJY A;  5LJ5 d;  1NE8 A;  2DZ9 A;  4PJO A;  1GXI E;  4Y91 A;  2DD5 A;  3L2Z A;  3LWI A;  4F7U B;  5A0D A;  2KDS A;  1KG1 A;  3CCV A;  3VU3 C;  3GIB A;  2X4Y A;  3BFM A;  3FIF A;  3ZFJ A;  2MMP A;  3OBW A;  2R58 A;  4C92 D;  1FX7 A;  3HSB A;  5AYF A;  3MEA A;  1K73 C;  2QTX A;  4FT4 A;  2QA4 A;  2ZPH B;  3X25 B;  5LJ3 g;  2H3J A;  2OAU A;  4E47 A;  5CK9 A;  1M1G A;  2F5K A;  3CCQ T;  3M59 A;  2G3R A;  3L42 A;  5D6X A;  5DLO A;  2ZPI B;  3JCM V;  3FLG A;  5FRO A;  3V7C A;  1G3Y A;  4M75 F;  1ZBX A;  4WF2 A;  4M7A A;  4M7A B;  4KT0 E;  3L2Q A;  2FL7 A;  3G71 A;  2DD4 A;  1I4K 1;  2E10 A;  4C8Q G;  1KQS S;  1OI1 A;  2O4X A;  1Q7Y U;  3CBP A;  4PNO A;  3S3O A;  5GAO q;  3CD6 A;  2M0O A;  2V8J A;  2E70 A;  4FM4 B;  1Q81 C;  2DTH A;  4C5E A;  1Q86 C;  3TRE A;  3QG1 A;  1ZHI A;  3V8L A;  2WSC E;  4JUV A;  4E7L A;  2KAF A;  3M9Q A;  2PVO B;  2XK0 A;  3QYH B;  2VC8 A;  3JB9 G;  3J81 E;  3VJP A;  1YIT A;  2RHU A;  3A8M B;  3QUI A;  2YHT A;  4XTZ A;  3RKX A;  3MEU A;  1YI2 T;  1DJ7 B;  1WGS A;  3JB9 F;  1VQ8 A;  4ZGJ B;  5FU6 C;  3QYG B;  1VQO A;  1M4Z A;  3RMQ A;  2XID A;  3OYM A;  3CCS T;  1W2B A;  1HK9 A;  1O75 A;  3CCU A;  1VQ5 A;  3L1A A;  1B34 B;  1KQ1 A;  2CZ0 B;  2Y4X A;  2L5Q A;  2DEQ A;  2GF7 A;  3GNF B;  1QVF S;  2EIF A;  2HQE A;  1NPR A;  2JN0 A;  4M7D A;  2R5M A;  1N9R A;  1S72 A;  4EMH A;  5M9O A;  5GMK h;  4M7A D;  3QZ5 B;  2DZC A;  2WSF E;  1I5L A;  2F69 A;  1VQ6 T;  4B9X A;  2E64 A;  2BUD A;  3OMC A;  4J7I A;  4C92 C;  1YJ9 T;  3J7A F;  5GAM g;  3L2U A;  1VQK T;  3QZ9 B;  1G5V A;  1UEB A;  3CC4 A;  3PIO A;  4QQ6 A;  4P5N A;  5LJ5 e;  4JLI A;  4TVR A;  4XTV A;  2XDB A;  3WVD B;  2ZPG B;  3HFN A;  1V29 B;  4M7D F;  1BIB A;  2RB6 A;  1U1T A;  3OA6 A;  1X01 A;  2XIC A;  2JTM A;  3OS5 A;  2PVD B;  2K57 A;  5CQX A;  3PNW C;  4OB0 B;  3JCM Q;  1I81 A;  5DM7 R;  4XTY A;  4QQG A;  3SD4 A;  4IUQ A;  1O9S A;  1Q82 U;  1Q86 U;  3S6W A;  2X4X A;  3VYH B;  2BIV A;  3E9F A;  2RJE A;  5A0G A;  4M77 A;  1QVG A;  5CO7 A;  4PLI A;  4EMG A;  4XU3 A;  3N5B B;  4ZN3 A;  1U8R A;  5CKH A;  4ME7 A;  3G4S A;  5KH6 A;  3OYL A;  4M77 G;  3EFS A;  3CEY A;  2GFA A;  1YBY A;  2LDM A;  4LD6 A;  4PLL A;  5KE2 A;  2K3Y A;  2XHC A;  4M77 C;  2O4X B;  3LGF A;  4A4G A;  3FDR A;  1WQW A;  4OP0 A;  1Y71 A;  5FLX E;  3RUX A;  3OYC A;  2P0K A;  5GAN e;  1BI0 A;  1JBM A;  3TEE A;  4OB3 B;  3CCR A;  4OGE A;  3JRZ A;  2LRQ A;  3C12 A;  1KQS A;  3V7R A;  1VQK A;  3ASK A;  4M75 G;  3OYN A;  4M78 A;  3PT9 A;  4IUP A;  2X4W A;  3M54 A;  1G3W A;  4M7D G;  3CD6 T;  2A7Y A;  5CKF A;  1YJN A;  4EMK C;  3M56 A;  3GP8 A;  4FU6 A;  4HCZ A;  3CMA A;  3SWN C;  3RKY A;  2LQK A;  1Y96 A;  3JCM h;  3SDZ A;  4FIB A;  4M78 E;  3NTI A;  4D6W A;  3V7S A;  3QO3 A;  4HA8 A;  2XDP A;  4OB1 B;  4BAC A;  5LJ5 j;  4MML A;  1G3S A;  4BD3 A;  1KHC A;  1M5Q 1;  1N8R U;  3OB9 A;  2E5Q A;  2QQB A;  3LX7 A;  3V8J A;  2XKO C;  4MMK A;  2GQV A;  4PJO E;  4PJO B;  2R57 A;  2RD1 A;  4A4H A;  1AHJ B;  5GAN 6;  3WVE B;  3EFR A;  5HY6 A;  5FU6 B;  3KUF A;  5CKD A;  2RO0 A;  3CXC S;  1UGS B;  4J6X A;  3KXT A;  3X28 B;  2E6N A;  1FWZ A;  2DTI A;  3CPF A;  2K3X A;  2ZPB B;  1QW1 A;  4HT9 A;  4EMK A;  5CAI A;  5CQY A;  1KQ2 A;  4BI4 A;  1R8O B;  2RK1 A;  5I21 A;  3GNG A;  2RK2 A;  4E7K A;  2MF2 A;  3NFC A;  2F5T X;  2R5A A;  5GAM d;  2V8K A;  2RI5 A;  3JCM X;  3MP1 A;  2DTO A;  3PMT A;  2K5I A;  2FHD A;  4C8Q E;  1NJI U;  4KUL A;  2XD0 A;  3TCJ A;  1WQ7 A;  4XU1 A;  3H8Z A;  5LJ5 h;  4C92 B;  4M7A E;  4OGC A;  3CC4 T;  4QW2 A;  5GAM f;  5LJ5 f;  1YI2 A;  2QQS A;  4KUD K;  5A2Q E;  5DY9 A;  3V8K A;  1VQ7 A;  3RER A;  1WPY A;  3OS1 A;  1VQM A;  4J8O A;  5LJ3 j;  2CZ1 B;  1N9S A;  4DOV A;  2EAY A;  4M75 B;  3ZBD A;  2OTL T;  2EJF A;  1YCY A;  3HL8 A;  3Q1J A;  3CCE A;  4J7F A;  4N0A C;  2EQM A;  2BKD N;  2JTF A;  4DA4 A;  1Q81 U;  2EJ9 A;  2KVQ G;  1Y7X A;  1S72 T;  1XQH A;  1NZ9 A;  2VXF A;  1Q7Y C;  3AHU A;  4HT8 A;  4M7D C;  1VQ9 A;  2YLB A;  5GMK l;  3QJ6 A;  2EQJ A;  4OVA A;  4ELY C;  4N4I A;  2K4Y A;  4LDU A;  3CCJ A;  1JJ2 S;  5FRN A;  1WJQ A;  2D9T A;  2FB7 A;  5GAN 8;  1RL2 A;  2RJF A;  4RCC A;  2P0P A;  1N27 A;  4JJN K;  4IUV A;  5GMK i;  3JCM c;  4A53 A;  3OYF A;  4XU0 A;  1YIJ A;  4F7U F;  3M55 A;  4BE0 A;  5GAN 7;  2M9U A;  3VKI A;  3RKW A;  1BI3 A;  1QP3 A;  2M1H A;  3P8D A;  1G3T A;  2PU9 B;  3O8V A;  2XI9 A;  4E7H A;  3OYH A;  4LDX A;  1UGQ B;  5KE3 A;  3RIR A;  5J26 A;  1LJO A;  2MWP A;  4OF1 A;  4X9D A;  3A8O B;  1OZ3 A;  1PSE A;  1WJR A;  3DLM A;  5HK0 A;  3CPW S;  4PJO D;  2ZPF B;  5D6Y A;  2RI2 A;  3JB9 H;  4O5V A;  1D3B A;  4IUR A;  2FYK A;  2L3R A;  1YHQ A;  1QVP A;  1VQ8 T;  1VQN A;  1HXD A;  5CIU A;  4M7A G;  2QQR A;  1JJ2 A;  1VIF A;  3JSC A;  4XK8 E;  3MHX A;  2PQW A;  2E12 A;  1H3Z A;  1H64 1;  2EJG A;  1D3B B;  4NL2 A;  3M58 A;  4HCC A;  2OTJ T;  4IUT A;  3MEV A;  4JDS A;  4L5G A;  3VUB A;  1N6A A;  5HKC A;  3QBY A;  4C92 F;  4E7J A;  5GAM j;  2B8A A;  3E9G A;  5J39 A;  5GAN 4;  1YJW T;  1IRE B;  4C0D B;  4RG8 A;  2VYT A;  2DIG A;  2E41 A;  1BKB A;  5GMK m;  5LJ5 g;  3FC3 A;  2PUK B;  1YJ9 A;  4C8Q F;  2JZ2 A;  3OYD A;  4C5I A;  1YHQ T;  4JRQ A;  3M4Y A;  3LGL A;  2LX9 A;  2VXE A;  4FT2 A;  2PVG B;  3OYE A;  3CCM A;  1BIA A;  3GOX A;  4BE2 A;  3CPW A;  3UPU A;  3VUZ A;  5GAM h;  4F7U G;  1W4S A;  4M75 D;  3OY9 A;  1UGP B;  1QVG S;  3CCM T;  5EG2 A;  4LDY A;  2RHI A;  3RMS A;  2L8D A;  4LD9 K;  1Y07 A;  3HHT B;  3MP6 A;  4M7D E;  4RCB A;  1MGQ A;  3L2R A;  4L6V 5;  4M75 E;  3FB9 A;  3LLR A;  4ZN1 A;  4VUB A;  4YTL A;  3UWN A;  1YJW A;  1VQO T;  3X24 B;  2QXF A;  4V2S A;  2LCL A;  4X34 A;  4M78 G;  2RM4 A;  4C8Q A;  1BI2 A;  4RKU E;  3SWN A;  4A54 A;  1VQP A;  4UC4 A;  3CXC A;  2EQU A;  2E65 A;  2Y4Y A;  4BY6 C;  3CC7 T;  1X75 C;  5GAO n;  3S3M A;  4M78 F;  2CZ7 B;  2FVU A;  4XTU A;  3G6E T;  4BDY A;  3OMG A;  3UDC A;  2ZZD A;  4C8Q B;  1Q82 C;  2WSE E;  2HBP A;  4O6J A;  2YLC A;  4C92 A;  2LT1 A;  3FEO A;  3GF5 A;  4M7A C;  2K5L A;  1VQL A;  3G4S T;  3UT1 A;  4M75 C;  4C8Q C;  5DLQ E;  4N4G A;  3CC2 A;  1FXX A;  3A8G B;  3CBO A;  3JCM b;  1P92 A;  3DLL A;  4OMF B;  5CR2 A;  1OZ2 A;  2RJC A;  5GAN f;  5J3B A;  1K8A U;  2EKO A;  4EMK B;  3FRN A;  4M7A F;  2MWO A;  2VGN A;  4PL6 A;  2KK4 A;  5GAO l;  4RMO A;  2D0Q B;  4X9C A;  4BB7 A;  3BDL A;  2KQW A;  3INZ A;  2LVM A;  4C0Z A;  1BI1 A;  3G6E A;  3HFO A;  3JB9 J;  2I2L A;  3M53 A;  4HKE A;  2D6F A;  1LNX A;  1M1K U;  5LL6 S;  4IUU A;  3PMI A;  1VQ7 T;  4JS5 A;  2DJZ A;  3CC2 T;  2LT4 A;  4Z02 A;  1M90 C;  3TU4 K;  4MZP A;  3X26 B;  2OTL A;  3LWH A;  3JB9 D;  2VV5 A;  2X4J A;  3ER0 A;  1M90 U;  5KCH A;  5C6S A;  3QDR B;  4PKC C;  2LC4 A;  4C8Q D;  3I56 T;  3J80 E;  1Y96 B;  3L2V A;  3CME T;  3KBG A;  5I2S A;  3HP9 A;  5GAO r;  2EYQ A;  2IVW A;  3BY7 A;  4R55 A;  4C5H A;  3L2W A;  1VQP T;  5GAN h;  3JB9 I;  3CCV T;  5GAO m;  2X35 A;  2OTJ A;  1KD1 U;  4J83 A;  2K2V A;  5D6W A;  3RES A;  5C0M A;  5KCO A;  1X6O A;  4R56 A;  2KSS A;  4BI3 A;  1XNI A;  1OYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...