5GAN4

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
90
structure length
74
Chain Sequence
b'MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSVKLNEIYIRGTFIKFIKLQDNIIDKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 10
structure length 74
sequence length 90
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan400
5GAN5 3BY7A 4C92D 5GAN8 3BW1A 3RKXA 4EMKA 4M78A 2EAYA 4M75A 3FIFA 1WQWA 4M7DF 2EJGA 4XU0A 5GANj 4PNOA 4NL2A 3BDUA 5GMKi 1YCYA 2E1HA 4C92B 4M7DD 4F7UB 3HFNA 1H641 1I4K1 5GMKl 1LNXA 5LJ3h 3V7CA 3JB9F 1HK9A 4NOYA 4X9DA 5LJ5d 5GAOp 4EMHA 3JB9H 4XU3A 4MMLA 2EJFA 3JB9D 4M7DB 2ZGWA 4M7AE 4PJOG 4M7AD 5LJ3g 1I8FA 4HT8A 3JCMJ 3JCMW 3M4GA 5GMKh 4DQ2A 2RD1A 5GAN2 3JCMV 3V8KA 1B34B 4F7UF 4M7AC 2DXUA 3RIRA 4M78C 1I81A 4JUVA 4M75C 4M7AA 2E10A 3V7SA 4C92E 4F7UE 1KQ2A 3EFSA 4OP0A 4C8QF 5GAN7 2RM4A 3PGGA 4QVCA 4RCCA 4M77F 5GAMh 4C8QE 5LJ3f 4C8QD 4C92C 4V2SA 2CGHA 4M77E 4M7DE 1U1TA 4M77D 4XQ3A 3RESA 2DEQA 4XTWA 1M5Q1 4J6WA 5GAMg 3AHUA 4PJOF 2FYKA 4C92A 3JCMP 5GANh 3RERA 4F7UA 5LJ5j 2I2LA 1MGQA 4JRIA 4J6XA 3QUIA 4C8QB 4NL3A 2EWNA 4M7AG 4M7DC 1Y96B 4M77B 5GAOn 1HXDA 4M78G 4MMKA 2RA2A 4M75G 5GANg 1I5LA 2DXTA 5LJ5h 4M7DA 2DJZA 3VU3C 5GAOr 3RKWA 4PJOB 1M8VA 3L2ZA 1WPYA 2E41A 3JCMb 5LJ3e 3GIBA 1B34A 3QO3A 3JCMh 4C92G 4QVDA 4HT9A 4F7UG 4A53A 2E65A 3QHSA 2DTHA 5LJ3d 5GAMf 1D3BB 4A54A 3JCMg 4M7DG 5GMKe 5GAOq 3V8JA 4JLIA 3FB9A 5GANf 2DTOA 5GAOl 4XTXA 2DKGA 3SWNB 4M78F 3JB9G 4C8QC 4M75F 5GAOm 3JB9I 2DZ9A 2VXEA 4M77C 4J5YA 4XTYA 2EJ9A 3JB9J 4PJOE 4PJOD 2E64A 4X9CA 1BIAA 4C8QA 5GAN3 5GAN4 5GAMe 1Y96A 4M77A 3SB2A 3JCMf 4N0AA 4M7AF 3V7RA 1JRIA 4EMKB 4M78B 4Y91A 2YHTA 5GAMd 4M75B 1N9SA 3BFMA 3JCMQ 5LJ5g 5GANe 4PJOA 4XTVA 1KQ1A 4XTZA 2QTXA 3QSUA 5LJ3j 5GANd 1JBMA 5GAN6 3HSBA 4WF2A 4C8QG 5LJ5e 2K57A 2YLBA 4XTUA 1D3BA 1LJOA 1U1SA 2DVEA 4JRKA 4M77G 2HNIA 1LOJA 1TH7A 5I21A 2DZCA 2DTIA 2Y90A 5DY9A 3SWNC 2FB7A 3HFOA 3RKYA 5GMKj 2VC8A 5GMKm 1N9RA 3EFRA 3JCMe 3V8LA 5LJ5f 4M78E 3SWNA 3JCMd 1WNLA 4M75E 4M78D 4M75D 1BIBA 1X01A 3L1AA 4N0AC 4EMGA 4XU2A 4RCBA 3JCMX 2RB6A 5CAIA 2JN0A 4HA8A 1WQ7A 4M7AB 4EMKC 3FJPA 2YLCA 4J6YA 4XU1A 2VXFA 3INZA 3RUXA 4C92F 5GAMj 4PJOC 3JCMc
chains in the Genus database with same CATH superfamily
4EMKA 1PG5B 4QVZA 4J9BA 1OI1A 4E7JA 2K9GA 4NOYA 1WHJA 1VIEA 3OYBA 2GGRA 2E12A 3ULRB 3CBOA 1PWTA 2DXBA 3CCVQ 4C92C 2CGHA 1QVFP 3CMAQ 1UTIA 2QTVA 5KYXA 2DFUA 3JCMP 1YIJA 4FM4B 4C0DC 4F7UA 3CC2T 2ZPHB 3GNFB 3DLLA 4AG1C 3CCRQ 1VQKA 4X34A 2DBMA 3QJ6A 4L59A 2JMAA 2L8DA 2CZ7B 1QW1A 3JCMb 4BI8B 1QVGP 3M5AA 3QHSA 3VRZA 2XIDA 4C5HA 2EQUA 4HVVA 3G4ST 1VQMA 4CC7A 4PFZA 4EIKA 2FL7A 3I56Q 1BYMA 1WXUA 4RTYA 1I07A 2KMTA 3JB9J 3QYHB 4PFOA 1H3HA 2YRDA 2K2MA 2VVKA 2M9UA 1YJWT 1K8AC 2XU8A 2KSSA 3OW2S 1WHGA 4CC3A 3GF5A 1PNJA 2DIQA 3MEVA 5GJWB 3I9QA 2DETA 1KC8R 1BBZA 3CEYA 4JZ4A 1AVZC 4A4KA 5LJ5e 2LTOA 4FSXA 2K4YA 3CCVA 2RF0A 2RHUA 3NMZC 2CSIA 2MWPA 3NTHA 4MDXA 2CDTA 1VQ8Q 1XQHA 1QCFA 2HD0A 1WNLA 3PIPA 1GCQA 1YCSB 2O9SA 3TU4K 1YJ9T 3CCUQ 3CCQT 3CC4A 4E7IA 1X6OA 5GAN8 4JRPA 1UGQB 3E19A 3L2UA 1GXIE 4JJDA 2ED1A 1YCYA 4AFQC 2L3RA 5IT9E 2JTFA 1B7TA 2MPXC 1B07A 3JB9F 4X9DA 3NPFA 1W2BS 4FYXB 2OTJA 1ZUYA 4DQ2A 1OPKA 4IUPA 4J7IA 2OI3A 2LT1A 5M9OA 2M16A 2PUKB 2NUTB 2XKOC 4RTZA 1OPLA 3EAEA 4M77F 5GAMh 4RUGA 4M7DE 4OVAA 4XQ3A 3CMAT 1X6BA 3P8DA 4B6MA 3CD6A 2HKNA 1UDLA 1TUGB 5LJ5j 5KYYA 4C8QB 2M02A 3I55Q 4JLGA 1VQ8A 1SPKA 3OYDA 2DXTA 3CCRT 4Z89A 2M0OA 2YUPA 5J26A 1VQ9T 3JCMh 1Y7XA 4F7UG 2OAWA 1P92A 4KUIA 2DERA 4IIMA 4ZGJB 2DF6A 3I56T 2AKKA 5GAOm 2XK0A 4J5YA 4PJOD 1VQ5Q 4CC4B 5HK0A 3LGFA 2D6FA 2D0QB 1G3SA 1E6HA 2KDSA 4OMLA 2XD0A 4LD9K 2DD5A 2QAZA 3CPWA 3RNJA 3VUBA 4DBQA 1IGUA 4PFPA 3M53A 4J7FA 3P8HA 2VC8A 1OX8A 4AG2C 1YITA 3G6EQ 1KG1A 2KGTA 3X28B 1GBRA 4GBQA 2E4HA 4DBFA 1ZUKA 3OB9A 4J6YA 4YTLA 3CCUT 3JCMc 4OF1A 2P0QA 1N6AA 3CCLA 1PRLC 4ME7A 1R0CB 4GLMA 3MKDA 2FPFA 2SEMA 5D7UA 3OS2A 2VYTA 2E6ZA 2GF7A 4ZNXA 4ZTJA 2LX7A 2EJFA 2E5KA 2C0OA 2ZGWA 2QQRA 5KE2A 4PJOG 2KQWA 1S72A 3JCMW 1H8KA 2EKHA 1G8XA 4HVWA 3MP6A 1W6XA 1W4SA 5EG2A 2DD4A 2I0NA 3LX7A 4BD3A 4AT1B 4OP0A 2LVMA 1YWOA 4RCCA 1MV0B 4XAXB 4M77E 5IN1A 1VYVA 2QQSA 3EG9A 2BE7D 2XICA 2PU9B 3I55T 1HXDA 4OB3B 2MWOA 2DE0X 3CPWP 4M7DA 2RHYA 3VU3C 1OULA 3RKWA 1YI2T 2D9TA 3QWXX 3GIBA 1TTHB 1B34A 1OV3A 3EHRA 1X69A 3E9FA 2M51A 1MMDA 4RTTA 4Z88A 3LWIA 3CCEA 4HCKA 3A8GB 3RBBB 2YRVA 3OSSC 3ER0A 1VQ7Q 4M77C 2YT6A 2EJ9A 1M4ZA 1BIAA 1VQ5T 5KYNA 4LUEA 3CBMA 1KQSS 4OMPA 1R77A 2KRMA 3L2VA 3QZ5B 1ZA1B 4KUDK 2VUBA 4OGEA 3M58A 2OTLQ 1PD0A 3G6ET 3VYGA 4M75E 4N0AC 5CVIA 4RCBA 3H6ZA 4J8OA 3OW2P 3ME9A 3VJPA 2L2PA 2L3PA 4OMMA 2F2WA 2MAMA 2WSFE 4M7DD 1BI2A 1NPRA 2XDPA 1HK9A 1HSQA 5GAOp 2KRNA 2DL7A 2D1XA 4ELZC 3RMSA 2MK5A 1RAAB 1M30A 2ABLA 2J06A 5CKBA 4M75C 2V1QA 1KHCA 3QJYA 3PGGA 1WXBA 1I0CA 4RKUE 2DEQA 1HYOA 2FPDA 5GAMg 3PIOA 4IUUA 4PK4A 1W2BP 3QUIA 1K9MU 5I11A 2CYZB 2RA2A 2YUNA 1JJ2A 4RTVA 5LJ5h 4OB2B 3OYNA 3OYMA 1D0YA 1Q7YU 2MIOA 2VASA 1QCOA 1UEBA 1XNIA 4MZTA 3JCMg 2AHJB 2CP6A 2K79A 4M7DG 1YHQA 5GMKe 3NTIA 1ZSZB 2L89A 4ELYC 4JS5A 1OU9A 2EIFA 1VQ7T 4FL6A 3REAB 1VQNQ 1VQPQ 2DZ9A 1B3QA 5EC7A 1RAEB 3X25B 2RQTA 4N0AA 3V7RA 1XOVA 4EMKB 2YHTA 1HD3A 2EGEA 4J9HA 2CH4W 5LJ3j 1BI3A 3HSBA 2LJ3A 2MYSA 3A8OB 4JJBA 1TH7A 1QKWA 1NEBA 2LCLA 2EQIA 2OTLT 4FU6A 3CCSA 2JW4A 3OYEA 1D09B 2JS2A 4FYVB 3KFVA 2HSEB 1X01A 2C0TA 3PE0A 4AFUC 3FDRA 2KT8A 3NGPA 1IHVA 2RI5A 4ZTFA 1X2QA 1N8RC 5KE3A 1Y0MA 4M75A 4BB7A 1JJ2P 1WDXA 5KYXB 4QQ6A 4F7UB 2AKLA 3CMET 1Q81U 3G71A 2VGNA 2CP5A 2QXFA 5LJ5d 4LNPA 4LDWA 4M7AE 3UF4A 5L8RE 2NLUA 2O9VA 1VYUA 4OMQA 3PMTA 2G6FX 3A98A 2HSPA 9ATCB 1VYTA 3V7SA 4HCZA 1RLQC 4PJMA 5J3BA 2KY9A 3CCJA 4O6JA 2RJFA 4LDYA 4XTWA 4RG8A 4J6WA 1VQ6Q 4PJOF 2ZPGB 4C0FA 5I2MA 1D0XA 3REBB 4N4IA 4E7SA 3HPWA 2C06A 2G3RA 5IH2A 1GRIA 2ZAEA 1WJQA 3M0SA 2ZPFB 4Z8AA 2HQHA 3GLXA 1Q82C 4IUTA 3QXEB 2DKGA 2IIMA 5FU7B 1IZ6A 1M3CA 2VV5A 3URGA 1VQNT 1VQPT 4KGXB 3QKJA 2OAUA 1K9MR 1YJNT 2RNAA 3RDVA 4DEYA 1WI7A 1M1KU 3EGXA 1KC8U 5CKFA 4KGVB 1Q7YR 3KXTA 5GAN6 4F17A 2K57A 2LP5A 4IUQA 2DTIA 1AOJA 4DOWA 5IXBA 2RQVA 3TCJA 1KD1U 2DBKA 1ABQA 1RABB 5ECAA 2HQXA 1VQLA 1QVFA 2DPPB 2EYWA 1M27C 4FYWB 4KRTA 2DJQA 1C0MA 3EH2A 2EAYA 1M1FA 2EJGA 2R57A 5GANj 2KR3A 2KEAA 2X4WA 5KYYB 1YIJQ 1N5ZA 1BCOA 2X3XD 1NJIU 1JEGA 1CKAA 4FT4A 1QVGA 3EG1A 5KCHA 1VQKQ 1OQKA 2J05A 1TU0B 2DM1A 2NWMA 2JM8A 4C5EA 4M7AA 4C92E 2BIVA 2CZ0B 1NE8A 1NEGA 4DA4A 1VQMQ 1CSKA 1FXXA 1PKTA 2RO0A 4BDZA 3AHUA 1F1BB 1VQ6T 1OOTA 2I2LA 1EX4A 3M4YA 3L2QA 1Q81R 3HRTA 2KE9A 2J6KA 4FYYB 5GAOn 1Q86C 2PVOB 1GBQA 2RHIA 1ZSGA 3O8VA 1K4US 1PSEA 2LQNA 5LL6S 3H0HA 2LNHB 2LC4A 1D1BA 2DO3A 2FPEA 2M0YA 2HEQA 2EQMA 2E70A 3HRUA 1WHLA 1RUWA 1RLPC 3M55A 2FZGB 3H0IA 3FEOA 3CC4Q 2PUOB 1M90C 2YWWA 2ZCFB 2BZYA 2DIGA 4IURA 4A4GA 2HL3A 3H0FA 1A0NB 1SG5A 3J81E 2DYBA 1LOJA 1EFNA 2J7IA 5D6XA 4QKUA 4BUGA 2BZ8A 2QASA 3ZEHA 2OTJQ 2DK3A 4M78E 3SWNA 1U3OA 2X35A 2V1RA 1YJ9A 1X43A 2YLCA 2VXFA 3C94A 5C0MA 2DVJA 3N5BB 1SHGA 1JXOA 2ROLA 3BY7A 1WLPB 3OY9A 1WJRA 1M1KR 4NS5A 3EG9B 2QG9B 2PVGB 1G2BA 3CD6Q 2RQUA 3EGDB 3CXCA 1YIJT 3JB9H 1OYXA 4PKCC 2QA4A 1VA7A 4MMLA 4M7DB 4HT8A 3X24B 2EPDA 4E7HA 5GMKh 1B34B 1KD1R 3X26B 3LWHA 2CSQA 2JMCA 2FZKB 4M78C 1UE9A 3OYCA 3SDZA 1PRMC 2GNCA 3ZFJA 4C8QF 1BK2A 4QVCA 2K3XA 2DRMA 1VQMT 1M5Q1 4C92A 2KXCA 4M7AG 1ABOA 4E2FB 3PFSA 4J9FA 1HJDA 1NJIR 1NPPA 8ATCB 3S3OA 2K3YA 2O2OA 1WPYA 1OZ2A 2J6OA 1AWWA 3LYIA 5LJ3d 3A8HB 3Q1JA 4FT2A 2MMPA 3EFOA 5HCKA 2K2VA 4LN2A 3M0UA 1UG1A 3CCVT 5FU6B 2XDDA 2EBPA 2CH4A 1VOMA 1YITQ 2H3EB 2JTMA 3JB9I 2B86A 4D8KA 2A36A 4X1VA 1VUBA 3M0RA 4B9XA 4A4EA 1PD1A 2R58A 4KBMB 3RR6A 1SHFA 3CXCP 1MUZA 4Y91A 3CCLQ 1ZQ1A 2A37A 4XTVA 1KQ1A 2MI6A 1Y57A 2ATCB 4BI3A 2QDLA 1EZZB 4Q5WA 2HZYA 1UGRB 5I2SA 3NTKA 1S72Q 2KAFA 3J7AF 2GQVA 1FYNA 5LJ5f 2OTJT 2FVUA 5KH6A 5CKDA 2QK0A 5L23A 3M56A 3RUXA 2HCKA 2COZA 1KSWA 4C92D 4M78A 5GJVB 2DMOA 2IVWA 2NUPA 1JQQA 2EW3A 2GFUA 2CUDA 3CD6T 4RTXA 3M9QA 4XU3A 4E7ZA 3PT9A 2HBPA 1VQ8T 5FLXE 1FWZA 3RIRA 1SF9A 3QPHA 3HTRA 3KBGA 4EDUA 5CK9A 6AT1B 1JU5C 4E7KA 2KT1A 2JTEA 3CCEQ 4C8QE 3OS0A 1VQ4A 1SRLA 3G1JA 4LDUA 2FYKA 3RERA 1MGQA 1NM7A 4J6XA 2JNGA 2HDAA 1QWEA 2ZPEB 1TXQA 5KCOA 2LT4A 5GAOr 2DXCA 4C92G 4QVDA 4HT9A 2CUBA 2FHDA 1AT1B 4BE1A 2IPOB 2RHZA 3FB9A 2BZXA 1ZBJA 1YITT 2WSCE 4C8QC 3OW2A 4QQDA 3H9NA 2JUFA 2JS0A 2K3BA 4M75B 1N9SA 2W0ZA 3S6WA 3CCLT 3OYFA 2HL5C 5IHKA 2QEXQ 3EGUA 1AWOA 5GANd 1UGSB 2QGFB 4F14A 1GFCA 4CRIA 2DYIA 1U1SA 1OX9A 3PVLA 2GTJA 3CPFA 3LH5A 3THKA 3RKYA 2L3QA 4LDVA 3HRSA 1S72T 3UATA 2PZ1A 2F5KA 4EMGA 1PM3A 1WQ7A 2SRCA 5CR2A 3DB3A 2LDMA 1NLPC 3VS7A 2CT4A 1W2BA 1M3AA 4ESRA 1ZLMA 4KULA 3X20B 5GMKi 1U8RA 2QI2A 3SEMA 4AFZC 3U23A 1H641 1W1FA 3C0CA 2PQWA 3OYLA 3OA6A 4A63B 1LVKA 3VUZA 4P5NA 2RJCA 1V76A 2DXUA 2QGGA 4JUVA 4C0ZA 4OB1B 1K73C 3A8LB 1RI0A 1KQ2A 5CIUA 1YHQQ 2QEXA 1XJWB 4MDWA 2KRSA 4BE0A 1CKBA 2LZ6B 1U06A 1I5LA 3CCMA 1QMCA 2DX1A 4LXCA 3EGXB 4DBRA 1WXTA 2HKQB 4O5VA 4OB0B 5LJ3e 2E3IA 4A4HA 4A53A 2DTHA 4BE2A 4J9EA 3TSWA 3V8JA 3GOXA 2KVQG 3CCSQ 3MP8A 2AK5A 2PVDB 3UA6A 2RHXA 3QZ9B 4JJNK 2X4XA 2EKOA 1W70A 3M54A 4M77A 2PNIA 3R6NA 4DEXA 3FLGA 4WCIA 2QQBA 3IQLA 2DL4A 1YBYA 1QVFS 2FEIA 3G71Q 5DLOA 2CP2A 1RI9A 1AWJA 2K5LA 4JDSA 3TEEA 3L1AA 4MZPA 4K11A 5FW9A 2K6DA 4M7AB 3QG1A 3FJPA 2FG0A 2L5QA 4D6WA 4F7UF 4E6RA 1UUEA 1WX6A 5KYWA 1TWBA 3BW1A 3CCJQ 5FRNA 3C4SA 2X4JA 4Z02A 5IAYA 3CC7A 3CMEA 1BU1A 3PNWC 2K5IA 3JB9D 2RI2A 2KI7A 2LJ0A 2F5TX 1X2KA 4C5IA 2GCXA 1M2OA 5GAN7 2ENMA 2RPNA 4C0GA 1T3LA 1RADB 5LJ3f 5J39A 4M77D 2Z0WA 1M3BA 4JRIA 4OGCA 1YP5A 3LGLA 3L2ZA 1SEMA 4ZN1A 5I22A 1ZHIA 5CQYA 1KC8C 2DAQA 3EHQA 4KH1B 1OZ3A 4LE9A 2YRCA 2EFIA 1ZBXA 1IREB 3SWNB 3JB9G 3CCST 1VQOA 3NHNA 3O5ZA 1KQSA 4R0KA 1VQLQ 2BKDN 2FO0A 1K0XA 3S3NA 3JCMQ 3PTAA 5GANe 2FZCB 5AT1B 1WJSA 5IHNA 3QSUA 1WA7A 2FRWA 4M77G 1KK7A 3G71T 1ZSZC 2DZCA 1C1AA 2Y4XA 1QLYA 2KK4A 3UT1A 5FRMA 1JB0E 4M75D 2IG0A 5KYUA 5CAIA 4EMKC 4XU1A 5GAMj 2AZVA 2GFAA 1AZGB 1O75A 3CQTA 1AD5A 2ZPIB 3CCJT 1K0SA 4XU0A 2EQJA 1GL5A 2RJDA 5DM7R 3UDCA 4C92B 2E5QA 3HFNA 2EYXA 3MO8A 3CC2Q 1LNXA 3I35A 1I1JA 4C0DB 1E6GA 1K9AA 2AZSA 2RI3A 4AFSC 1EIFA 1N27A 1WYXA 1RACB 2LQKA 1G3YA 2WACA 1KQSP 2JXBA 1G3WA 2X51A 1MMGA 4CI0C 1GCPA 1QP3A 2KNBB 4ANJA 1JO8A 2DLPA 1AEYA 4N4GA 4J9DA 4J83A 4M75G 1Z9ZA 5AYFA 1YJWQ 2LJ1A 3OYAA 2GTOA 2CKKA 1M8VA 1I5OB 2R5AA 2GQIA 5IXFA 4RTUA 1ARKA 2E65A 1Q82U 2CZ6B 4PJNA 2DA9A 2EGCA 2D0NA 2V8IA 1BB9A 1H92A 5GANf 2NYSA 3VYHB 2X4YA 1IXDA 2KYBA 4TVRA 3CC2A 2JOYA 4PJOE 2XDBA 5HY6A 2E64A 4X9CA 1YJ9Q 2WSEE 3AT1B 1VQLT 2JT4A 4M78B 1AZEA 2EGAA 2NUPB 5LJ5g 1UFFA 2COYA 5FWCA 1T0JA 3OYYA 3MP1A 4HXJA 1Z9QA 3ASKA 5D6WA 4JRKA 3G4SA 4BY6C 2QA4Q 5I21A 1YWPA 5FU7C 5A2QE 3EFRA 1GCQC 1RAIB 3F70A 1ZA2B 3CPWS 3JCMX 1G5VA 3VS2A 2H3JA 4PJOC 1YJWA 2VWFA 1NLOC 3VS0A 3GNGA 4M7DF 4PNOA 5CCAA 2XHCA 4GY5A 2F1LA 5LJ3h 4JZ3A 3UWNA 2YUOA 4M7AD 4L5GA 1MV3A 3V8KA 1QQJA 1VQ9Q 3CCQA 3OYIA 4ZGDB 2KBTA 1N8RR 3MJXA 2FRYA 1PCXA 3EFSA 1MHNA 1TSFA 2RM4A 4V2SA 4BI4A 3RESA 4IKFA 2F2VA 1G3TA 1RAGB 4KT0E 3GP8A 1M2VA 4VUBA 2X3WD 3R6OA 4NL3A 1Q86U 1MMNA 3C95A 1D0ZA 2CP7A 2A08A 2X9HA 1VQKT 2DJZA 1PHTA 2QDYB 3E1SA 3M57A 1QWFA 4FCYA 3M0PA 2CP0A 3DLMA 3OYKA 4F16A 2V8JA 2KXDA 2ESWA 1FMVA 3VS5A 4OMNA 3J80E 1QKXA 3OBWA 3CMAA 4QW2A 3I5SA 4E47A 1WFWA 1MMAA 1WHHA 3META 2DNUA 4XTYA 1M90U 1Y96A 3CCRA 3HKSA 3SB2A 3OMGA 1FX7A 4WTOB 2RN8A 3JAME 3BFMA 2AIRB 1VQ9A 4PJOA 5FWBA 4ATOA 2QTXA 2QQAA 1WIEA 3WVDB 4OMFB 4Y92A 1IRXA 1Q82R 1D3BA 2F2XA 1QCNA 2HNIA 3QWYA 2A7YA 2QA4T 3HFOA 2Y4YA 5GMKm 3I56A 4HKEA 3VV0A 2HBWA 2P0KA 1K8AU 3CC4T 1IGQA 1WHKA 5GAN5 2F69A 5C6SA 1AWXA 1VQ4Q 1BKBA 3VKIA 2RK1A 3WVEB 3BDUA 4XK8E 2A0FB 1IO6A 4KGZB 2YXYA 2V8KA 4PLIA 4EMHA 1T0HA 1TOVA 1KJWA 3TVTA 3TQ7P 1YI2Q 3WXMB 5GAN2 2CT3A 2LMJA 1Y71A 1R8OB 2EYZA 3OYHA 2O4XA 2LQWA 3CCUA 1TUDA 1YN8A 1RAHB 2BE9B 2LQ8A 2HMAA 3QDRB 4ZN3A 3M0QA 2VKNA 4J9CA 3OSVA 4JS4A 5GANh 3GBQA 4PJJA 3MCAB 2RJEA 4M7DC 3A1PA 4EPCA 2RQWA 2EWNA 1T3SA 2VB6A 4KH0B 4M77B 4MMKA 1UECA 2XMFA 3RMQA 1V29B 5CO7A 4IIOA 2EYYA 2D8HA 5FROA 1JJ2S 4IUVA 4A54A 3UPUA 4F04B 3EG2A 2O01E 2LRQA 3TSZA 2RK2A 2DTOA 2BUDA 5CQXA 3HP9A 2HQEA 4M75F 2ECZA 2EVRA 2COWA 3I55A 1Q86R 1OEBA 2HAXA 1UGPB 5KYWB 1JRIA 5GAMd 1YI2A 4II1A 1Q95G 3E2UA 3MPUB 2DL5A 1NYGA 4BACA 5FU6C 1UGVA 2CREA 3V8LA 1IB8A 3JCMd 4M78D 1VQ5A 2RB6A 2JN0A 1M90R 3OYGA 3RKXA 1TS9A 3QIIA 1E7OA 4JPBW 3L42A 1VQ4T 2EQKA 3OBYA 4NL2A 2BTTA 1OU8A 5HKCA 1I4K1 5GMKl 3EGDA 3CCMQ 5LJ3g 2DRKA 3G6EA 1PSFA 3JCMJ 3OYJA 3MEWA 2RD1A 1SKUB 1NYFA 1NG2A 5D6YA 1K8AR 1YNZA 1UHCA 1X6GA 3FJ5A 1XTDA 4E7LA 1WZOA 4DOVA 1U1TA 2DILA 2YUQA 4QQGA 2PTKA 3BE3A 1KIKA 3M0TA 4N4HA 3E9GA 4M78G 3LLRA 1K9MC 3JSCA 2AT1B 2LNVA 1X27A 1J3TA 2JZ2A 2K5FA 3MEUA 1Q7YC 3FC3A 1PC0A 2P4TA 1RAFB 4CC2A 2NUTA 5GAOq 3CCET 1UB4A 5GAOl 8AT1B 2DL8A 1D1CA 5KYUB 2L3SA 2VXEA 1JXMA 2KROA 3L2RA 1UHFA 4C8QA 5GAN4 1V1CA 2XI9A 1G83A 1X75C 3EG3A 3SD4A 4A4FA 1ZUUA 3CC7Q 4WF2A 4FW1A 2YLBA 4XTUA 3CMEQ 2DVEA 3VS4A 1ZX6A 1D1AA 5A0GA 4ZGEB 1GFDA 4M7AF 4JJCA 2MF2A 5DY9A 2E3HA 1VQ7A 3I5RA 1U5SA 3LW5E 3HL8A 2ROTA 3INZA 2JJ9A 5HK3A 2MOXA 3FIFA 1WQWA 2QEXT 4L6V5 3QDFA 2E1HA 3V7CA 1KHIA 1WHMA 1Q81C 3FRNA 4ORZA 2OTLA 1UJYA 3CCMT 1I8FA 2CP3A 1Y07A 3NFCA 2J6FA 4R55A 3JCMV 2CZ1B 3EG0A 3OS5A 3QYGB 4RMOA 4LUDA 1K73U 2A3LA 2E10A 5CKHA 1QVGS 4MZMA 2QYZA 3CBPA 4LD6A 1K76A 4Y28E 4C8QD 2XG8D 1QP2A 2ZZDA 5A0DA 1VQOQ 4HCBA 4LDXA 2C0IA 5GANg 1YJNQ 1MNDA 2LCCA 2RH2A 3QO3A 3SFMA 1NZ9A 2NUZA 2H8HA 3C12A 3TREA 1YHQT 2L0AA 4JLIA 3P8BB 5A0LA 2KYMA 1FMWA 4RG2A 1M9SA 2P4RA 4OMOA 5GAN3 4FW2A 5GAMe 1SSFA 2CS7A 1R0BG 3H41A 4XTZA 1M1KC 3UA7A 2ED0A 4C8QG 3CC7T 4R56A 1LJOA 1WGSA 1BI1A 2O31A 2Y90A 3OS1A 3VRYA 5GMKj 4D8DA 3JCMe 1N9RA 3OQ5A 3BDLA 3ZL7C 2LX9A 3L2WA 1RL2A 3PMIA 1VQNA 1VQPA 3EH1A 5CKEA 1BIBA 1LCKA 2K7AA 1KD1C 1YJNA 4HA8A 4C92F 3D7SB 3PVQA 2OJ2A 4HVUA 1M2VB 2E6NA 3T9NA 1PKSA 1DJ7B 4C5GA 2QQ9A 2V26A 4B9WA 4GLKA 1NJIC 3KUFA 3M4GA 4M7AC 3CXCS 1M1GA 1H3ZA 2ZPBB 1IHWA 1QVPA 1N8RU 1MNEA 3LH0A 1I81A 3GPLA 3OMCA 4JRQA 4F7UE 4UC4A 4M4ZA 1O9SA 1BI0A 2D8JA 3JRZA 3VS1A 3VS6A 1VIFA 2YSQA 2LCSA 4BY6B 1S1NA 3QBYA 2O88A 1TG0A 1VQOT 3A5ZB 4AMCA 1YFNA 4J9IA 1Y96B 4PL6A 3G7ZA 2M1HA 3MEAA 3DB4A 4DBHA 1M8MA 1SRMA 4FIBA 4PJOB 4PLLA 2E41A 3H8ZA 4BDYA 1TUCA 5GAMf 2JVVA 3JV3A 3EFOB 1D3BB 1K73R 3VS3A 2JM9A 1K1ZA 3G4SQ 2RQRA 1C6VX 4XTXA 2A28A 4M78F 1VQ6A 3HHTB 1ACMB 4FSSA 2DL3A 2GBQA 3MHXA 4PJLA 3SHWA 2P0PA 2R5MA 1UJ0A 4QT7A 3JCMf 3A8MB 2W10A 2P84A 1BCMA 2EYQA 1JBMA 2MCNA 2OX7A 2B8AA 5DLQE 3S3MA 5IHIA 4RTWA 3SWNC 2FB7A 1LPLA 1SSHA 3M59A 2VGMA 1ZSZA 1AHJB 2RMOA 2YDLA 3ZBDA 4XU2A 2O4XB 4HCCA 1FMKA 3CCQQ 1NBEB 2DEUA 1KFZA 3DKMA 4J9GA 7AT1B
chains in the Genus database with same CATH topology
5GAN5 5KE3A 4EMKA 2F69A 5C6SA 4M75A 4BB7A 1W2BA 4QVZA 4QQ6A 1BKBA 4KULA 3X20B 3VKIA 2RK1A 3WVEB 3BDUA 1OI1A 4XK8E 5GMKi 4E7JA 1U8RA 2QI2A 4F7UB 3CMET 1Q81U 1H641 3G71A 4NOYA 2VGNA 2QXFA 5LJ5d 2V8KA 4PLIA 4EMHA 4LDWA 2PQWA 3OYLA 3OA6A 4M7AE 5L8RE 1VIEA 2NLUA 3VUZA 4P5NA 3PMTA 3WXMB 5GAN2 2RJCA 3OYBA 1Y71A 1R8OB 2DXUA 3OYHA 2E12A 2O4XA 3CCUA 4JUVA 3CBOA 3V7SA 4C0ZA 4OB1B 1K73C 2DXBA 3A8LB 1RI0A 2LQ8A 4HCZA 3QDRB 5CIUA 5J3BA 1KQ2A 4ZN3A 2KY9A 3CCJA 2QEXA 4O6JA 4C92C 2RJFA 2CGHA 4LDYA 4MDWA 4XTWA 4RG8A 3OSVA 4J6WA 4PJOF 2ZPGB 4JS4A 4BE0A 4C0FA 5GANh 4FM4B 4C0DC 4F7UA 3JCMP 2ZPHB 2RJEA 3GNFB 3MCAB 5I2MA 4EPCA 3CC2T 2EWNA 4M7DC 4M77B 4MMKA 1I5LA 3DLLA 3CCMA 4N4IA 1VQKA 4X34A 3RMQA 3QJ6A 4L59A 1V29B 2L8DA 3HPWA 5CO7A 2CZ7B 1QW1A 4O5VA 4OB0B 2C06A 3JCMb 4BI8B 5LJ3e 4A4HA 2G3RA 3M5AA 5FROA 4A53A 3QHSA 2DTHA 1JJ2S 2XIDA 1WJQA 4IUVA 2EQUA 4A54A 4C5HA 3UPUA 2ZPFB 1YIJT 4BE2A 3GLXA 2O01E 1Q82C 2LRQA 3G4ST 4IUTA 3V8JA 2RK2A 2DTOA 1VQMA 2BUDA 5CQXA 3HP9A 3QXEB 2FL7A 3GOXA 2DKGA 2KVQG 2HQEA 4E7KA 1BYMA 5FU7B 1IZ6A 3MP8A 2VV5A 4M75F 3URGA 2PVDB 1VQNT 2RHXA 1VQPT 3JB9J 2KMTA 3QYHB 3QZ9B 3I55A 3QKJA 4JJNK 2OAUA 2X4XA 2EKOA 3M54A 4M77A 1YJNT 1UGPB 2HAXA 2M9UA 1YJWT 1JRIA 5GAMd 1YI2A 3FLGA 1K8AC 2XU8A 2KSSA 3OW2S 4II1A 1M1KU 2QQBA 1KC8U 5CKFA 3GF5A 2DIQA 3MEVA 3KXTA 1YBYA 5GAN6 3CEYA 4A4KA 5LJ5e 2K57A 2LTOA 4BACA 1QVFS 4FSXA 5FU6C 2K4YA 3CCVA 5DLOA 4IUQA 2RHUA 2DTIA 4DOWA 2MWPA 3NTHA 4MDXA 3V8LA 1XQHA 2K5LA 3TCJA 1KD1U 3JCMd 2HD0A 1WNLA 4JDSA 4M78D 3TEEA 3PIPA 3L1AA 4MZPA 1VQ5A 2RB6A 2HQXA 2JN0A 4M7AB 3TU4K 3QG1A 1YJ9T 3CCQT 3FJPA 2L5QA 1VQLA 3CC4A 4E7IA 1QVFA 2DPPB 4D6WA 1X6OA 4F7UF 3OYGA 5GAN8 3BW1A 3RKXA 4JRPA 1UGQB 2EAYA 3QIIA 3E19A 3L2UA 1M1FA 5FRNA 2EJGA 2R57A 5GANj 3L42A 3C4SA 2EQKA 3OBYA 2X4JA 4NL2A 1VQ4T 4Z02A 2X4WA 5IAYA 1YCYA 3CC7A 2L3RA 5IT9E 2JTFA 3CMEA 5HKCA 1I4K1 5GMKl 3JB9F 3PNWC 4X9DA 2K5IA 1NJIU 1W2BS 3JB9D 4FT4A 1QVGA 2RI2A 5LJ3g 5KCHA 3G6EA 1PSFA 2OTJA 3JCMJ 3OYJA 3MEWA 2RD1A 4DQ2A 4IUPA 4J7IA 2LT1A 5M9OA 2M16A 2F5TX 4C5EA 5D6YA 4M7AA 4C5IA 2GCXA 2BIVA 4C92E 2CZ0B 2PUKB 1NE8A 2XKOC 5GAN7 4C0GA 4M77F 3EAEA 5GAMh 4DA4A 5LJ3f 5J39A 1XTDA 4E7LA 1FXXA 4M7DE 4OVAA 1U1TA 4M77D 4XQ3A 4DOVA 3CMAT 2RO0A 3P8DA 4BDZA 3CD6A 3AHUA 4QQGA 1VQ6T 5LJ5j 2I2LA 4JRIA 3M4YA 4C8QB 3L2QA 3HRTA 4N4HA 4OGCA 3E9GA 4JLGA 4M78G 5GAOn 1Q86C 2PVOB 3LLRA 3OYDA 2DXTA 1K9MC 1VQ8A 3CCRT 3JSCA 2RHIA 3LGLA 3O8VA 2M0OA 3L2ZA 2LNVA 5J26A 4ZN1A 1VQ9T 2JZ2A 2K5FA 3JCMh 1PSEA 3MEUA 1ZHIA 1Y7XA 5CQYA 4F7UG 1Q7YC 5LL6S 3FC3A 1KC8C 2DAQA 1P92A 4KUIA 2P4TA 2LC4A 1OZ3A 2DO3A 5GAOq 3CCET 1UB4A 5GAOl 2EQMA 2EFIA 4ZGJB 1ZBXA 1IREB 3SWNB 3I56T 3JB9G 3CCST 2E70A 3HRUA 5GAOm 1VQOA 2XK0A 2VXEA 1KQSA 4J5YA 4PJOD 3M55A 3L2RA 4C8QA 5GAN4 5HK0A 3FEOA 2BKDN 2PUOB 1M90C 3LGFA 2ZCFB 2XI9A 2DIGA 2D6FA 4IURA 2D0QB 4A4GA 3S3NA 3JCMQ 1G3SA 5GANe 3PTAA 2KDSA 1X75C 2XD0A 3SD4A 4LD9K 1WJSA 3QSUA 2DD5A 4A4FA 4WF2A 4XTUA 2YLBA 3CPWA 2DVEA 4M77G 3VUBA 3J81E 5A0GA 3G71T 1LOJA 4ZGEB 5D6XA 2DZCA 4M7AF 2Y4XA 2MF2A 3M53A 5DY9A 4J7FA 4BUGA 3P8HA 2VC8A 1VQ7A 3ZEHA 1YITA 2KK4A 3UT1A 1KG1A 2DK3A 3X28B 4M78E 3SWNA 5FRMA 1JB0E 4M75D 2IG0A 2X35A 3LW5E 3HL8A 5CAIA 1YJ9A 3OB9A 4EMKC 4J6YA 2YLCA 4XU1A 4YTLA 2VXFA 3INZA 3C94A 5C0MA 3N5BB 5GAMj 2GFAA 3JCMc 3CCUT 5HK3A 4OF1A 2P0QA 3BY7A 1N6AA 1O75A 3CCLA 3FIFA 3OY9A 1WQWA 1WJRA 4ME7A 2ZPIB 3CCJT 4XU0A 2EQJA 4NS5A 2QEXT 2RJDA 4L6V5 5DM7R 2PVGB 2E1HA 3UDCA 4C92B 2E5QA 3HFNA 3OS2A 3MO8A 1LNXA 3V7CA 3CXCA 1KHIA 2E6ZA 2GF7A 1OYXA 2VYTA 4PKCC 4ZTJA 2QA4A 1Q81C 3JB9H 4C0DB 3FRNA 2EJFA 4MMLA 1S72A 2ZGWA 2QQRA 5KE2A 4PJOG 2KQWA 2OTLA 4M7DB 3CCMT 1I8FA 4HT8A 1Y07A 3X24B 3NFCA 3JCMW 4E7HA 5GMKh 4R55A 3JCMV 1B34B 2CZ1B 2RI3A 3MP6A 3X26B 3LWHA 3OS5A 1EIFA 1W4SA 1N27A 3QYGB 4RMOA 4M78C 3OYCA 1K73U 2A3LA 5EG2A 2DD4A 2LQKA 1G3YA 2E10A 2WACA 5CKHA 3SDZA 1QVGS 3LX7A 3ZFJA 4MZMA 3CBPA 4BD3A 4OP0A 4C8QF 4QVCA 2LVMA 4RCCA 1G3WA 4LD6A 4Y28E 2K3XA 4C8QD 4XAXB 4M77E 5IN1A 1VQMT 2XG8D 1YIJA 4CI0C 1QP2A 2ZZDA 2QQSA 1M5Q1 5A0DA 1QP3A 2XICA 4C92A 2PU9B 4M7AG 4HCBA 4LDXA 3PFSA 4N4GA 3I55T 1HXDA 4J83A 4OB3B 2MWOA 4M75G 5GANg 1NPPA 3S3OA 4M7DA 2K3YA 5AYFA 2RHYA 3VU3C 3OYAA 3RKWA 2CKKA 1YI2T 1M8VA 1WPYA 2LCCA 2D9TA 1OZ2A 2R5AA 2RH2A 3GIBA 1B34A 3QO3A 3SFMA 1NZ9A 3LYIA 2E65A 5LJ3d 3E9FA 3A8HB 2CZ6B 1Q82U 3Q1JA 4FT2A 3LWIA 2MMPA 2V8IA 3TREA 3C12A 2K2VA 1YHQT 3CCEA 4JLIA 3P8BB 3CCVT 5A0LA 5FU6B 5GANf 2XDDA 3A8GB 3VYHB 2X4YA 2YRVA 3OSSC 3ER0A 4RG2A 4TVRA 2JTMA 1M9SA 3JB9I 2JOYA 4M77C 3CC2A 4PJOE 2EJ9A 2XDBA 1VUBA 5HY6A 2E64A 1M4ZA 1BIAA 4X9CA 4A4EA 4B9XA 5GAN3 2R58A 2WSEE 5GAMe 1VQ5T 1SSFA 4KBMB 1VQLT 3CBMA 4M78B 2CS7A 4Y91A 1ZQ1A 5LJ5g 1KQSS 4XTVA 1KQ1A 4XTZA 1M1KC 2MI6A 3L2VA 3QZ5B 1GXIE 4KUDK 3OYYA 3MP1A 4C8QG 4R56A 3ASKA 5D6WA 3CC7T 1LJOA 4JRKA 4BI3A 4BY6C 1WGSA 3G4SA 1BI1A 2VUBA 4Q5WA 4OGEA 5I21A 1UGRB 2Y90A 5I2SA 3NTKA 3OS1A 5FU7C 5GMKj 5A2QE 3M58A 2KAFA 3JCMe 1N9RA 3EFRA 3J7AF 3OQ5A 2GQVA 3BDLA 3L2WA 2LX9A 1RL2A 3F70A 3PMIA 5LJ5f 3G6ET 3VYGA 2FVUA 5CKEA 4M75E 3CPWS 1VQPA 5KH6A 4N0AC 1BIBA 3JCMX 5CVIA 4RCBA 1KD1C 1G5VA 5CKDA 4HA8A 2H3JA 1YJNA 3M56A 3H6ZA 4PJOC 4C92F 3RUXA 1YJWA 4J8OA 1VQNA 3ME9A 3VJPA 4C92D 4M78A 3GNGA 2IVWA 4M7DF 2MAMA 2WSFE 4PNOA 5CCAA 4M7DD 2E6NA 2GFUA 1BI2A 2XHCA 3CD6T 4GY5A 1NPRA 3T9NA 5LJ3h 2XDPA 1HK9A 1DJ7B 5GAOp 3M9QA 4XU3A 3UWNA 4C5GA 2QQ9A 4B9WA 4GLKA 4M7AD 4L5GA 3PT9A 2HBPA 1NJIC 1VQ8T 5FLXE 4ELZC 1FWZA 3KUFA 3RMSA 3M4GA 3V8KA 4M7AC 3CXCS 1M1GA 1H3ZA 2ZPBB 5CKBA 1QVPA 3RIRA 1N8RU 3CCQA 3LH0A 1I81A 3QPHA 3KBGA 4M75C 3OYIA 3OMCA 4EDUA 5CK9A 4ZGDB 3GPLA 4JRQA 2OTJT 4F7UE 4UC4A 1O9SA 1KHCA 3EFSA 1BI0A 1MHNA 3QJYA 2RM4A 3JRZA 3PGGA 4C8QE 1VIFA 3OS0A 1VQ4A 4RKUE 4BY6B 4BI4A 4V2SA 3RESA 4IKFA 2DEQA 1G3TA 4LDUA 3QBYA 5GAMg 3PIOA 4KT0E 4IUUA 2FYKA 4VUBA 3GP8A 3RERA 1VQOT 3A5ZB 3R6OA 1MGQA 4NL3A 4J6XA 3QUIA 2JNGA 1Q86U 1K9MU 2CYZB 1Y96B 4PL6A 3C95A 3G7ZA 2ZPEB 2M1HA 2RA2A 3MEAA 1JJ2A 3DB4A 5KCOA 2LT4A 5LJ5h 1VQKT 2DJZA 2QDYB 3E1SA 3M57A 4FIBA 4OB2B 5GAOr 2DXCA 3OYMA 3OYNA 4PJOB 4PLLA 2E41A 1Q7YU 3H8ZA 4BDYA 4C92G 4QVDA 4HT9A 1UEBA 5GAMf 2FHDA 2JVVA 1D3BB 3DLMA 3OYKA 1XNIA 4MZTA 3JCMg 2V8JA 4BE1A 2AHJB 4M7DG 1YHQA 5GMKe 2RHZA 3FB9A 3NTIA 3J80E 3OBWA 4XTXA 2L89A 4ELYC 3CMAA 4QW2A 4JS5A 4E47A 2EIFA 1VQ7T 4M78F 1YITT 1VQ6A 2WSCE 3HHTB 4FL6A 4C8QC 3OW2A 3META 2DZ9A 4XTYA 4QQDA 3MHXA 2JUFA 3X25B 1M90U 1Y96A 2P0PA 2R5MA 3CCRA 3HKSA 3SB2A 3OMGA 1FX7A 4N0AA 3JCMf 3A8MB 1XOVA 3V7RA 4EMKB 2YHTA 3JAME 4M75B 1N9SA 3BFMA 3S6WA 1VQ9A 3CCLT 3OYFA 4PJOA 2EYQA 4ATOA 2QTXA 2QQAA 5LJ3j 1BI3A 1JBMA 5GANd 1UGSB 3WVDB 4CRIA 4OMFB 3HSBA 1D3BA 1U1SA 3A8OB 2HNIA 2B8AA 1TH7A 3CPFA 5DLQE 3S3MA 2A7YA 2QA4T 3SWNC 2FB7A 2Y4YA 3HFOA 3M59A 2LCLA 3RKYA 5GMKm 4LDVA 3HRSA 2VGMA 4FU6A 3I56A 3CCSA 1S72T 2OTLT 1AHJB 4HKEA 3VV0A 3ZBDA 3OYEA 2F5KA 1X01A 4EMGA 4XU2A 2O4XB 2P0KA 3FDRA 4HCCA 1K8AU 1WQ7A 2RI5A 3DKMA 3CC4T 4ZTFA 5CR2A 3DB3A 2LDMA 1N8RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN 5;  3BY7 A;  4C92 D;  5GAN 8;  3BW1 A;  3RKX A;  4EMK A;  4M78 A;  2EAY A;  4M75 A;  3FIF A;  1WQW A;  4M7D F;  2EJG A;  4XU0 A;  5GAN j;  4PNO A;  4NL2 A;  3BDU A;  5GMK i;  1YCY A;  2E1H A;  4C92 B;  4M7D D;  4F7U B;  3HFN A;  1H64 1;  1I4K 1;  5GMK l;  1LNX A;  5LJ3 h;  3V7C A;  3JB9 F;  1HK9 A;  4NOY A;  4X9D A;  5LJ5 d;  5GAO p;  4EMH A;  3JB9 H;  4XU3 A;  4MML A;  2EJF A;  3JB9 D;  4M7D B;  2ZGW A;  4M7A E;  4PJO G;  4M7A D;  5LJ3 g;  1I8F A;  4HT8 A;  3JCM J;  3JCM W;  3M4G A;  5GMK h;  4DQ2 A;  2RD1 A;  5GAN 2;  3JCM V;  3V8K A;  1B34 B;  4F7U F;  4M7A C;  2DXU A;  3RIR A;  4M78 C;  1I81 A;  4JUV A;  4M75 C;  4M7A A;  2E10 A;  3V7S A;  4C92 E;  4F7U E;  1KQ2 A;  3EFS A;  4OP0 A;  4C8Q F;  5GAN 7;  2RM4 A;  3PGG A;  4QVC A;  4RCC A;  4M77 F;  5GAM h;  4C8Q E;  5LJ3 f;  4C8Q D;  4C92 C;  4V2S A;  2CGH A;  4M77 E;  4M7D E;  1U1T A;  4M77 D;  4XQ3 A;  3RES A;  2DEQ A;  4XTW A;  1M5Q 1;  4J6W A;  5GAM g;  3AHU A;  4PJO F;  2FYK A;  4C92 A;  3JCM P;  5GAN h;  3RER A;  4F7U A;  5LJ5 j;  2I2L A;  1MGQ A;  4JRI A;  4J6X A;  3QUI A;  4C8Q B;  4NL3 A;  2EWN A;  4M7A G;  4M7D C;  1Y96 B;  4M77 B;  5GAO n;  1HXD A;  4M78 G;  4MMK A;  2RA2 A;  4M75 G;  5GAN g;  1I5L A;  2DXT A;  5LJ5 h;  4M7D A;  2DJZ A;  3VU3 C;  5GAO r;  3RKW A;  4PJO B;  1M8V A;  3L2Z A;  1WPY A;  2E41 A;  3JCM b;  5LJ3 e;  3GIB A;  1B34 A;  3QO3 A;  3JCM h;  4C92 G;  4QVD A;  4HT9 A;  4F7U G;  4A53 A;  2E65 A;  3QHS A;  2DTH A;  5LJ3 d;  5GAM f;  1D3B B;  4A54 A;  3JCM g;  4M7D G;  5GMK e;  5GAO q;  3V8J A;  4JLI A;  3FB9 A;  5GAN f;  2DTO A;  5GAO l;  4XTX A;  2DKG A;  3SWN B;  4M78 F;  3JB9 G;  4C8Q C;  4M75 F;  5GAO m;  3JB9 I;  2DZ9 A;  2VXE A;  4M77 C;  4J5Y A;  4XTY A;  2EJ9 A;  3JB9 J;  4PJO E;  4PJO D;  2E64 A;  4X9C A;  1BIA A;  4C8Q A;  5GAN 3;  5GAN 4;  5GAM e;  1Y96 A;  4M77 A;  3SB2 A;  3JCM f;  4N0A A;  4M7A F;  3V7R A;  1JRI A;  4EMK B;  4M78 B;  4Y91 A;  2YHT A;  5GAM d;  4M75 B;  1N9S A;  3BFM A;  3JCM Q;  5LJ5 g;  5GAN e;  4PJO A;  4XTV A;  1KQ1 A;  4XTZ A;  2QTX A;  3QSU A;  5LJ3 j;  5GAN d;  1JBM A;  5GAN 6;  3HSB A;  4WF2 A;  4C8Q G;  5LJ5 e;  2K57 A;  2YLB A;  4XTU A;  1D3B A;  1LJO A;  1U1S A;  2DVE A;  4JRK A;  4M77 G;  2HNI A;  1LOJ A;  1TH7 A;  5I21 A;  2DZC A;  2DTI A;  2Y90 A;  5DY9 A;  3SWN C;  2FB7 A;  3HFO A;  3RKY A;  5GMK j;  2VC8 A;  5GMK m;  1N9R A;  3EFR A;  3JCM e;  3V8L A;  5LJ5 f;  4M78 E;  3SWN A;  3JCM d;  1WNL A;  4M75 E;  4M78 D;  4M75 D;  1BIB A;  1X01 A;  3L1A A;  4N0A C;  4EMG A;  4XU2 A;  4RCB A;  3JCM X;  2RB6 A;  5CAI A;  2JN0 A;  4HA8 A;  1WQ7 A;  4M7A B;  4EMK C;  3FJP A;  2YLC A;  4J6Y A;  4XU1 A;  2VXF A;  3INZ A;  3RUX A;  4C92 F;  5GAM j;  4PJO C;  3JCM c; 
#chains in the Genus database with same CATH topology
 4EMK A;  1PG5 B;  4QVZ A;  4J9B A;  1OI1 A;  4E7J A;  2K9G A;  4NOY A;  1WHJ A;  1VIE A;  3OYB A;  2GGR A;  2E12 A;  3ULR B;  3CBO A;  1PWT A;  2DXB A;  3CCV Q;  4C92 C;  2CGH A;  1QVF P;  3CMA Q;  1UTI A;  2QTV A;  5KYX A;  2DFU A;  3JCM P;  1YIJ A;  4FM4 B;  4C0D C;  4F7U A;  3CC2 T;  2ZPH B;  3GNF B;  3DLL A;  4AG1 C;  3CCR Q;  1VQK A;  4X34 A;  2DBM A;  3QJ6 A;  4L59 A;  2JMA A;  2L8D A;  2CZ7 B;  1QW1 A;  3JCM b;  4BI8 B;  1QVG P;  3M5A A;  3QHS A;  3VRZ A;  2XID A;  4C5H A;  2EQU A;  4HVV A;  3G4S T;  1VQM A;  4CC7 A;  4PFZ A;  4EIK A;  2FL7 A;  3I56 Q;  1BYM A;  1WXU A;  4RTY A;  1I07 A;  2KMT A;  3JB9 J;  3QYH B;  4PFO A;  1H3H A;  2YRD A;  2K2M A;  2VVK A;  2M9U A;  1YJW T;  1K8A C;  2XU8 A;  2KSS A;  3OW2 S;  1WHG A;  4CC3 A;  3GF5 A;  1PNJ A;  2DIQ A;  3MEV A;  5GJW B;  3I9Q A;  2DET A;  1KC8 R;  1BBZ A;  3CEY A;  4JZ4 A;  1AVZ C;  4A4K A;  5LJ5 e;  2LTO A;  4FSX A;  2K4Y A;  3CCV A;  2RF0 A;  2RHU A;  3NMZ C;  2CSI A;  2MWP A;  3NTH A;  4MDX A;  2CDT A;  1VQ8 Q;  1XQH A;  1QCF A;  2HD0 A;  1WNL A;  3PIP A;  1GCQ A;  1YCS B;  2O9S A;  3TU4 K;  1YJ9 T;  3CCU Q;  3CCQ T;  3CC4 A;  4E7I A;  1X6O A;  5GAN 8;  4JRP A;  1UGQ B;  3E19 A;  3L2U A;  1GXI E;  4JJD A;  2ED1 A;  1YCY A;  4AFQ C;  2L3R A;  5IT9 E;  2JTF A;  1B7T A;  2MPX C;  1B07 A;  3JB9 F;  4X9D A;  3NPF A;  1W2B S;  4FYX B;  2OTJ A;  1ZUY A;  4DQ2 A;  1OPK A;  4IUP A;  4J7I A;  2OI3 A;  2LT1 A;  5M9O A;  2M16 A;  2PUK B;  2NUT B;  2XKO C;  4RTZ A;  1OPL A;  3EAE A;  4M77 F;  5GAM h;  4RUG A;  4M7D E;  4OVA A;  4XQ3 A;  3CMA T;  1X6B A;  3P8D A;  4B6M A;  3CD6 A;  2HKN A;  1UDL A;  1TUG B;  5LJ5 j;  5KYY A;  4C8Q B;  2M02 A;  3I55 Q;  4JLG A;  1VQ8 A;  1SPK A;  3OYD A;  2DXT A;  3CCR T;  4Z89 A;  2M0O A;  2YUP A;  5J26 A;  1VQ9 T;  3JCM h;  1Y7X A;  4F7U G;  2OAW A;  1P92 A;  4KUI A;  2DER A;  4IIM A;  4ZGJ B;  2DF6 A;  3I56 T;  2AKK A;  5GAO m;  2XK0 A;  4J5Y A;  4PJO D;  1VQ5 Q;  4CC4 B;  5HK0 A;  3LGF A;  2D6F A;  2D0Q B;  1G3S A;  1E6H A;  2KDS A;  4OML A;  2XD0 A;  4LD9 K;  2DD5 A;  2QAZ A;  3CPW A;  3RNJ A;  3VUB A;  4DBQ A;  1IGU A;  4PFP A;  3M53 A;  4J7F A;  3P8H A;  2VC8 A;  1OX8 A;  4AG2 C;  1YIT A;  3G6E Q;  1KG1 A;  2KGT A;  3X28 B;  1GBR A;  4GBQ A;  2E4H A;  4DBF A;  1ZUK A;  3OB9 A;  4J6Y A;  4YTL A;  3CCU T;  3JCM c;  4OF1 A;  2P0Q A;  1N6A A;  3CCL A;  1PRL C;  4ME7 A;  1R0C B;  4GLM A;  3MKD A;  2FPF A;  2SEM A;  5D7U A;  3OS2 A;  2VYT A;  2E6Z A;  2GF7 A;  4ZNX A;  4ZTJ A;  2LX7 A;  2EJF A;  2E5K A;  2C0O A;  2ZGW A;  2QQR A;  5KE2 A;  4PJO G;  2KQW A;  1S72 A;  3JCM W;  1H8K A;  2EKH A;  1G8X A;  4HVW A;  3MP6 A;  1W6X A;  1W4S A;  5EG2 A;  2DD4 A;  2I0N A;  3LX7 A;  4BD3 A;  4AT1 B;  4OP0 A;  2LVM A;  1YWO A;  4RCC A;  1MV0 B;  4XAX B;  4M77 E;  5IN1 A;  1VYV A;  2QQS A;  3EG9 A;  2BE7 D;  2XIC A;  2PU9 B;  3I55 T;  1HXD A;  4OB3 B;  2MWO A;  2DE0 X;  3CPW P;  4M7D A;  2RHY A;  3VU3 C;  1OUL A;  3RKW A;  1YI2 T;  2D9T A;  3QWX X;  3GIB A;  1TTH B;  1B34 A;  1OV3 A;  3EHR A;  1X69 A;  3E9F A;  2M51 A;  1MMD A;  4RTT A;  4Z88 A;  3LWI A;  3CCE A;  4HCK A;  3A8G B;  3RBB B;  2YRV A;  3OSS C;  3ER0 A;  1VQ7 Q;  4M77 C;  2YT6 A;  2EJ9 A;  1M4Z A;  1BIA A;  1VQ5 T;  5KYN A;  4LUE A;  3CBM A;  1KQS S;  4OMP A;  1R77 A;  2KRM A;  3L2V A;  3QZ5 B;  1ZA1 B;  4KUD K;  2VUB A;  4OGE A;  3M58 A;  2OTL Q;  1PD0 A;  3G6E T;  3VYG A;  4M75 E;  4N0A C;  5CVI A;  4RCB A;  3H6Z A;  4J8O A;  3OW2 P;  3ME9 A;  3VJP A;  2L2P A;  2L3P A;  4OMM A;  2F2W A;  2MAM A;  2WSF E;  4M7D D;  1BI2 A;  1NPR A;  2XDP A;  1HK9 A;  1HSQ A;  5GAO p;  2KRN A;  2DL7 A;  2D1X A;  4ELZ C;  3RMS A;  2MK5 A;  1RAA B;  1M30 A;  2ABL A;  2J06 A;  5CKB A;  4M75 C;  2V1Q A;  1KHC A;  3QJY A;  3PGG A;  1WXB A;  1I0C A;  4RKU E;  2DEQ A;  1HYO A;  2FPD A;  5GAM g;  3PIO A;  4IUU A;  4PK4 A;  1W2B P;  3QUI A;  1K9M U;  5I11 A;  2CYZ B;  2RA2 A;  2YUN A;  1JJ2 A;  4RTV A;  5LJ5 h;  4OB2 B;  3OYN A;  3OYM A;  1D0Y A;  1Q7Y U;  2MIO A;  2VAS A;  1QCO A;  1UEB A;  1XNI A;  4MZT A;  3JCM g;  2AHJ B;  2CP6 A;  2K79 A;  4M7D G;  1YHQ A;  5GMK e;  3NTI A;  1ZSZ B;  2L89 A;  4ELY C;  4JS5 A;  1OU9 A;  2EIF A;  1VQ7 T;  4FL6 A;  3REA B;  1VQN Q;  1VQP Q;  2DZ9 A;  1B3Q A;  5EC7 A;  1RAE B;  3X25 B;  2RQT A;  4N0A A;  3V7R A;  1XOV A;  4EMK B;  2YHT A;  1HD3 A;  2EGE A;  4J9H A;  2CH4 W;  5LJ3 j;  1BI3 A;  3HSB A;  2LJ3 A;  2MYS A;  3A8O B;  4JJB A;  1TH7 A;  1QKW A;  1NEB A;  2LCL A;  2EQI A;  2OTL T;  4FU6 A;  3CCS A;  2JW4 A;  3OYE A;  1D09 B;  2JS2 A;  4FYV B;  3KFV A;  2HSE B;  1X01 A;  2C0T A;  3PE0 A;  4AFU C;  3FDR A;  2KT8 A;  3NGP A;  1IHV A;  2RI5 A;  4ZTF A;  1X2Q A;  1N8R C;  5KE3 A;  1Y0M A;  4M75 A;  4BB7 A;  1JJ2 P;  1WDX A;  5KYX B;  4QQ6 A;  4F7U B;  2AKL A;  3CME T;  1Q81 U;  3G71 A;  2VGN A;  2CP5 A;  2QXF A;  5LJ5 d;  4LNP A;  4LDW A;  4M7A E;  3UF4 A;  5L8R E;  2NLU A;  2O9V A;  1VYU A;  4OMQ A;  3PMT A;  2G6F X;  3A98 A;  2HSP A;  9ATC B;  1VYT A;  3V7S A;  4HCZ A;  1RLQ C;  4PJM A;  5J3B A;  2KY9 A;  3CCJ A;  4O6J A;  2RJF A;  4LDY A;  4XTW A;  4RG8 A;  4J6W A;  1VQ6 Q;  4PJO F;  2ZPG B;  4C0F A;  5I2M A;  1D0X A;  3REB B;  4N4I A;  4E7S A;  3HPW A;  2C06 A;  2G3R A;  5IH2 A;  1GRI A;  2ZAE A;  1WJQ A;  3M0S A;  2ZPF B;  4Z8A A;  2HQH A;  3GLX A;  1Q82 C;  4IUT A;  3QXE B;  2DKG A;  2IIM A;  5FU7 B;  1IZ6 A;  1M3C A;  2VV5 A;  3URG A;  1VQN T;  1VQP T;  4KGX B;  3QKJ A;  2OAU A;  1K9M R;  1YJN T;  2RNA A;  3RDV A;  4DEY A;  1WI7 A;  1M1K U;  3EGX A;  1KC8 U;  5CKF A;  4KGV B;  1Q7Y R;  3KXT A;  5GAN 6;  4F17 A;  2K57 A;  2LP5 A;  4IUQ A;  2DTI A;  1AOJ A;  4DOW A;  5IXB A;  2RQV A;  3TCJ A;  1KD1 U;  2DBK A;  1ABQ A;  1RAB B;  5ECA A;  2HQX A;  1VQL A;  1QVF A;  2DPP B;  2EYW A;  1M27 C;  4FYW B;  4KRT A;  2DJQ A;  1C0M A;  3EH2 A;  2EAY A;  1M1F A;  2EJG A;  2R57 A;  5GAN j;  2KR3 A;  2KEA A;  2X4W A;  5KYY B;  1YIJ Q;  1N5Z A;  1BCO A;  2X3X D;  1NJI U;  1JEG A;  1CKA A;  4FT4 A;  1QVG A;  3EG1 A;  5KCH A;  1VQK Q;  1OQK A;  2J05 A;  1TU0 B;  2DM1 A;  2NWM A;  2JM8 A;  4C5E A;  4M7A A;  4C92 E;  2BIV A;  2CZ0 B;  1NE8 A;  1NEG A;  4DA4 A;  1VQM Q;  1CSK A;  1FXX A;  1PKT A;  2RO0 A;  4BDZ A;  3AHU A;  1F1B B;  1VQ6 T;  1OOT A;  2I2L A;  1EX4 A;  3M4Y A;  3L2Q A;  1Q81 R;  3HRT A;  2KE9 A;  2J6K A;  4FYY B;  5GAO n;  1Q86 C;  2PVO B;  1GBQ A;  2RHI A;  1ZSG A;  3O8V A;  1K4U S;  1PSE A;  2LQN A;  5LL6 S;  3H0H A;  2LNH B;  2LC4 A;  1D1B A;  2DO3 A;  2FPE A;  2M0Y A;  2HEQ A;  2EQM A;  2E70 A;  3HRU A;  1WHL A;  1RUW A;  1RLP C;  3M55 A;  2FZG B;  3H0I A;  3FEO A;  3CC4 Q;  2PUO B;  1M90 C;  2YWW A;  2ZCF B;  2BZY A;  2DIG A;  4IUR A;  4A4G A;  2HL3 A;  3H0F A;  1A0N B;  1SG5 A;  3J81 E;  2DYB A;  1LOJ A;  1EFN A;  2J7I A;  5D6X A;  4QKU A;  4BUG A;  2BZ8 A;  2QAS A;  3ZEH A;  2OTJ Q;  2DK3 A;  4M78 E;  3SWN A;  1U3O A;  2X35 A;  2V1R A;  1YJ9 A;  1X43 A;  2YLC A;  2VXF A;  3C94 A;  5C0M A;  2DVJ A;  3N5B B;  1SHG A;  1JXO A;  2ROL A;  3BY7 A;  1WLP B;  3OY9 A;  1WJR A;  1M1K R;  4NS5 A;  3EG9 B;  2QG9 B;  2PVG B;  1G2B A;  3CD6 Q;  2RQU A;  3EGD B;  3CXC A;  1YIJ T;  3JB9 H;  1OYX A;  4PKC C;  2QA4 A;  1VA7 A;  4MML A;  4M7D B;  4HT8 A;  3X24 B;  2EPD A;  4E7H A;  5GMK h;  1B34 B;  1KD1 R;  3X26 B;  3LWH A;  2CSQ A;  2JMC A;  2FZK B;  4M78 C;  1UE9 A;  3OYC A;  3SDZ A;  1PRM C;  2GNC A;  3ZFJ A;  4C8Q F;  1BK2 A;  4QVC A;  2K3X A;  2DRM A;  1VQM T;  1M5Q 1;  4C92 A;  2KXC A;  4M7A G;  1ABO A;  4E2F B;  3PFS A;  4J9F A;  1HJD A;  1NJI R;  1NPP A;  8ATC B;  3S3O A;  2K3Y A;  2O2O A;  1WPY A;  1OZ2 A;  2J6O A;  1AWW A;  3LYI A;  5LJ3 d;  3A8H B;  3Q1J A;  4FT2 A;  2MMP A;  3EFO A;  5HCK A;  2K2V A;  4LN2 A;  3M0U A;  1UG1 A;  3CCV T;  5FU6 B;  2XDD A;  2EBP A;  2CH4 A;  1VOM A;  1YIT Q;  2H3E B;  2JTM A;  3JB9 I;  2B86 A;  4D8K A;  2A36 A;  4X1V A;  1VUB A;  3M0R A;  4B9X A;  4A4E A;  1PD1 A;  2R58 A;  4KBM B;  3RR6 A;  1SHF A;  3CXC P;  1MUZ A;  4Y91 A;  3CCL Q;  1ZQ1 A;  2A37 A;  4XTV A;  1KQ1 A;  2MI6 A;  1Y57 A;  2ATC B;  4BI3 A;  2QDL A;  1EZZ B;  4Q5W A;  2HZY A;  1UGR B;  5I2S A;  3NTK A;  1S72 Q;  2KAF A;  3J7A F;  2GQV A;  1FYN A;  5LJ5 f;  2OTJ T;  2FVU A;  5KH6 A;  5CKD A;  2QK0 A;  5L23 A;  3M56 A;  3RUX A;  2HCK A;  2COZ A;  1KSW A;  4C92 D;  4M78 A;  5GJV B;  2DMO A;  2IVW A;  2NUP A;  1JQQ A;  2EW3 A;  2GFU A;  2CUD A;  3CD6 T;  4RTX A;  3M9Q A;  4XU3 A;  4E7Z A;  3PT9 A;  2HBP A;  1VQ8 T;  5FLX E;  1FWZ A;  3RIR A;  1SF9 A;  3QPH A;  3HTR A;  3KBG A;  4EDU A;  5CK9 A;  6AT1 B;  1JU5 C;  4E7K A;  2KT1 A;  2JTE A;  3CCE Q;  4C8Q E;  3OS0 A;  1VQ4 A;  1SRL A;  3G1J A;  4LDU A;  2FYK A;  3RER A;  1MGQ A;  1NM7 A;  4J6X A;  2JNG A;  2HDA A;  1QWE A;  2ZPE B;  1TXQ A;  5KCO A;  2LT4 A;  5GAO r;  2DXC A;  4C92 G;  4QVD A;  4HT9 A;  2CUB A;  2FHD A;  1AT1 B;  4BE1 A;  2IPO B;  2RHZ A;  3FB9 A;  2BZX A;  1ZBJ A;  1YIT T;  2WSC E;  4C8Q C;  3OW2 A;  4QQD A;  3H9N A;  2JUF A;  2JS0 A;  2K3B A;  4M75 B;  1N9S A;  2W0Z A;  3S6W A;  3CCL T;  3OYF A;  2HL5 C;  5IHK A;  2QEX Q;  3EGU A;  1AWO A;  5GAN d;  1UGS B;  2QGF B;  4F14 A;  1GFC A;  4CRI A;  2DYI A;  1U1S A;  1OX9 A;  3PVL A;  2GTJ A;  3CPF A;  3LH5 A;  3THK A;  3RKY A;  2L3Q A;  4LDV A;  3HRS A;  1S72 T;  3UAT A;  2PZ1 A;  2F5K A;  4EMG A;  1PM3 A;  1WQ7 A;  2SRC A;  5CR2 A;  3DB3 A;  2LDM A;  1NLP C;  3VS7 A;  2CT4 A;  1W2B A;  1M3A A;  4ESR A;  1ZLM A;  4KUL A;  3X20 B;  5GMK i;  1U8R A;  2QI2 A;  3SEM A;  4AFZ C;  3U23 A;  1H64 1;  1W1F A;  3C0C A;  2PQW A;  3OYL A;  3OA6 A;  4A63 B;  1LVK A;  3VUZ A;  4P5N A;  2RJC A;  1V76 A;  2DXU A;  2QGG A;  4JUV A;  4C0Z A;  4OB1 B;  1K73 C;  3A8L B;  1RI0 A;  1KQ2 A;  5CIU A;  1YHQ Q;  2QEX A;  1XJW B;  4MDW A;  2KRS A;  4BE0 A;  1CKB A;  2LZ6 B;  1U06 A;  1I5L A;  3CCM A;  1QMC A;  2DX1 A;  4LXC A;  3EGX B;  4DBR A;  1WXT A;  2HKQ B;  4O5V A;  4OB0 B;  5LJ3 e;  2E3I A;  4A4H A;  4A53 A;  2DTH A;  4BE2 A;  4J9E A;  3TSW A;  3V8J A;  3GOX A;  2KVQ G;  3CCS Q;  3MP8 A;  2AK5 A;  2PVD B;  3UA6 A;  2RHX A;  3QZ9 B;  4JJN K;  2X4X A;  2EKO A;  1W70 A;  3M54 A;  4M77 A;  2PNI A;  3R6N A;  4DEX A;  3FLG A;  4WCI A;  2QQB A;  3IQL A;  2DL4 A;  1YBY A;  1QVF S;  2FEI A;  3G71 Q;  5DLO A;  2CP2 A;  1RI9 A;  1AWJ A;  2K5L A;  4JDS A;  3TEE A;  3L1A A;  4MZP A;  4K11 A;  5FW9 A;  2K6D A;  4M7A B;  3QG1 A;  3FJP A;  2FG0 A;  2L5Q A;  4D6W A;  4F7U F;  4E6R A;  1UUE A;  1WX6 A;  5KYW A;  1TWB A;  3BW1 A;  3CCJ Q;  5FRN A;  3C4S A;  2X4J A;  4Z02 A;  5IAY A;  3CC7 A;  3CME A;  1BU1 A;  3PNW C;  2K5I A;  3JB9 D;  2RI2 A;  2KI7 A;  2LJ0 A;  2F5T X;  1X2K A;  4C5I A;  2GCX A;  1M2O A;  5GAN 7;  2ENM A;  2RPN A;  4C0G A;  1T3L A;  1RAD B;  5LJ3 f;  5J39 A;  4M77 D;  2Z0W A;  1M3B A;  4JRI A;  4OGC A;  1YP5 A;  3LGL A;  3L2Z A;  1SEM A;  4ZN1 A;  5I22 A;  1ZHI A;  5CQY A;  1KC8 C;  2DAQ A;  3EHQ A;  4KH1 B;  1OZ3 A;  4LE9 A;  2YRC A;  2EFI A;  1ZBX A;  1IRE B;  3SWN B;  3JB9 G;  3CCS T;  1VQO A;  3NHN A;  3O5Z A;  1KQS A;  4R0K A;  1VQL Q;  2BKD N;  2FO0 A;  1K0X A;  3S3N A;  3JCM Q;  3PTA A;  5GAN e;  2FZC B;  5AT1 B;  1WJS A;  5IHN A;  3QSU A;  1WA7 A;  2FRW A;  4M77 G;  1KK7 A;  3G71 T;  1ZSZ C;  2DZC A;  1C1A A;  2Y4X A;  1QLY A;  2KK4 A;  3UT1 A;  5FRM A;  1JB0 E;  4M75 D;  2IG0 A;  5KYU A;  5CAI A;  4EMK C;  4XU1 A;  5GAM j;  2AZV A;  2GFA A;  1AZG B;  1O75 A;  3CQT A;  1AD5 A;  2ZPI B;  3CCJ T;  1K0S A;  4XU0 A;  2EQJ A;  1GL5 A;  2RJD A;  5DM7 R;  3UDC A;  4C92 B;  2E5Q A;  3HFN A;  2EYX A;  3MO8 A;  3CC2 Q;  1LNX A;  3I35 A;  1I1J A;  4C0D B;  1E6G A;  1K9A A;  2AZS A;  2RI3 A;  4AFS C;  1EIF A;  1N27 A;  1WYX A;  1RAC B;  2LQK A;  1G3Y A;  2WAC A;  1KQS P;  2JXB A;  1G3W A;  2X51 A;  1MMG A;  4CI0 C;  1GCP A;  1QP3 A;  2KNB B;  4ANJ A;  1JO8 A;  2DLP A;  1AEY A;  4N4G A;  4J9D A;  4J83 A;  4M75 G;  1Z9Z A;  5AYF A;  1YJW Q;  2LJ1 A;  3OYA A;  2GTO A;  2CKK A;  1M8V A;  1I5O B;  2R5A A;  2GQI A;  5IXF A;  4RTU A;  1ARK A;  2E65 A;  1Q82 U;  2CZ6 B;  4PJN A;  2DA9 A;  2EGC A;  2D0N A;  2V8I A;  1BB9 A;  1H92 A;  5GAN f;  2NYS A;  3VYH B;  2X4Y A;  1IXD A;  2KYB A;  4TVR A;  3CC2 A;  2JOY A;  4PJO E;  2XDB A;  5HY6 A;  2E64 A;  4X9C A;  1YJ9 Q;  2WSE E;  3AT1 B;  1VQL T;  2JT4 A;  4M78 B;  1AZE A;  2EGA A;  2NUP B;  5LJ5 g;  1UFF A;  2COY A;  5FWC A;  1T0J A;  3OYY A;  3MP1 A;  4HXJ A;  1Z9Q A;  3ASK A;  5D6W A;  4JRK A;  3G4S A;  4BY6 C;  2QA4 Q;  5I21 A;  1YWP A;  5FU7 C;  5A2Q E;  3EFR A;  1GCQ C;  1RAI B;  3F70 A;  1ZA2 B;  3CPW S;  3JCM X;  1G5V A;  3VS2 A;  2H3J A;  4PJO C;  1YJW A;  2VWF A;  1NLO C;  3VS0 A;  3GNG A;  4M7D F;  4PNO A;  5CCA A;  2XHC A;  4GY5 A;  2F1L A;  5LJ3 h;  4JZ3 A;  3UWN A;  2YUO A;  4M7A D;  4L5G A;  1MV3 A;  3V8K A;  1QQJ A;  1VQ9 Q;  3CCQ A;  3OYI A;  4ZGD B;  2KBT A;  1N8R R;  3MJX A;  2FRY A;  1PCX A;  3EFS A;  1MHN A;  1TSF A;  2RM4 A;  4V2S A;  4BI4 A;  3RES A;  4IKF A;  2F2V A;  1G3T A;  1RAG B;  4KT0 E;  3GP8 A;  1M2V A;  4VUB A;  2X3W D;  3R6O A;  4NL3 A;  1Q86 U;  1MMN A;  3C95 A;  1D0Z A;  2CP7 A;  2A08 A;  2X9H A;  1VQK T;  2DJZ A;  1PHT A;  2QDY B;  3E1S A;  3M57 A;  1QWF A;  4FCY A;  3M0P A;  2CP0 A;  3DLM A;  3OYK A;  4F16 A;  2V8J A;  2KXD A;  2ESW A;  1FMV A;  3VS5 A;  4OMN A;  3J80 E;  1QKX A;  3OBW A;  3CMA A;  4QW2 A;  3I5S A;  4E47 A;  1WFW A;  1MMA A;  1WHH A;  3MET A;  2DNU A;  4XTY A;  1M90 U;  1Y96 A;  3CCR A;  3HKS A;  3SB2 A;  3OMG A;  1FX7 A;  4WTO B;  2RN8 A;  3JAM E;  3BFM A;  2AIR B;  1VQ9 A;  4PJO A;  5FWB A;  4ATO A;  2QTX A;  2QQA A;  1WIE A;  3WVD B;  4OMF B;  4Y92 A;  1IRX A;  1Q82 R;  1D3B A;  2F2X A;  1QCN A;  2HNI A;  3QWY A;  2A7Y A;  2QA4 T;  3HFO A;  2Y4Y A;  5GMK m;  3I56 A;  4HKE A;  3VV0 A;  2HBW A;  2P0K A;  1K8A U;  3CC4 T;  1IGQ A;  1WHK A;  5GAN 5;  2F69 A;  5C6S A;  1AWX A;  1VQ4 Q;  1BKB A;  3VKI A;  2RK1 A;  3WVE B;  3BDU A;  4XK8 E;  2A0F B;  1IO6 A;  4KGZ B;  2YXY A;  2V8K A;  4PLI A;  4EMH A;  1T0H A;  1TOV A;  1KJW A;  3TVT A;  3TQ7 P;  1YI2 Q;  3WXM B;  5GAN 2;  2CT3 A;  2LMJ A;  1Y71 A;  1R8O B;  2EYZ A;  3OYH A;  2O4X A;  2LQW A;  3CCU A;  1TUD A;  1YN8 A;  1RAH B;  2BE9 B;  2LQ8 A;  2HMA A;  3QDR B;  4ZN3 A;  3M0Q A;  2VKN A;  4J9C A;  3OSV A;  4JS4 A;  5GAN h;  3GBQ A;  4PJJ A;  3MCA B;  2RJE A;  4M7D C;  3A1P A;  4EPC A;  2RQW A;  2EWN A;  1T3S A;  2VB6 A;  4KH0 B;  4M77 B;  4MMK A;  1UEC A;  2XMF A;  3RMQ A;  1V29 B;  5CO7 A;  4IIO A;  2EYY A;  2D8H A;  5FRO A;  1JJ2 S;  4IUV A;  4A54 A;  3UPU A;  4F04 B;  3EG2 A;  2O01 E;  2LRQ A;  3TSZ A;  2RK2 A;  2DTO A;  2BUD A;  5CQX A;  3HP9 A;  2HQE A;  4M75 F;  2ECZ A;  2EVR A;  2COW A;  3I55 A;  1Q86 R;  1OEB A;  2HAX A;  1UGP B;  5KYW B;  1JRI A;  5GAM d;  1YI2 A;  4II1 A;  1Q95 G;  3E2U A;  3MPU B;  2DL5 A;  1NYG A;  4BAC A;  5FU6 C;  1UGV A;  2CRE A;  3V8L A;  1IB8 A;  3JCM d;  4M78 D;  1VQ5 A;  2RB6 A;  2JN0 A;  1M90 R;  3OYG A;  3RKX A;  1TS9 A;  3QII A;  1E7O A;  4JPB W;  3L42 A;  1VQ4 T;  2EQK A;  3OBY A;  4NL2 A;  2BTT A;  1OU8 A;  5HKC A;  1I4K 1;  5GMK l;  3EGD A;  3CCM Q;  5LJ3 g;  2DRK A;  3G6E A;  1PSF A;  3JCM J;  3OYJ A;  3MEW A;  2RD1 A;  1SKU B;  1NYF A;  1NG2 A;  5D6Y A;  1K8A R;  1YNZ A;  1UHC A;  1X6G A;  3FJ5 A;  1XTD A;  4E7L A;  1WZO A;  4DOV A;  1U1T A;  2DIL A;  2YUQ A;  4QQG A;  2PTK A;  3BE3 A;  1KIK A;  3M0T A;  4N4H A;  3E9G A;  4M78 G;  3LLR A;  1K9M C;  3JSC A;  2AT1 B;  2LNV A;  1X27 A;  1J3T A;  2JZ2 A;  2K5F A;  3MEU A;  1Q7Y C;  3FC3 A;  1PC0 A;  2P4T A;  1RAF B;  4CC2 A;  2NUT A;  5GAO q;  3CCE T;  1UB4 A;  5GAO l;  8AT1 B;  2DL8 A;  1D1C A;  5KYU B;  2L3S A;  2VXE A;  1JXM A;  2KRO A;  3L2R A;  1UHF A;  4C8Q A;  5GAN 4;  1V1C A;  2XI9 A;  1G83 A;  1X75 C;  3EG3 A;  3SD4 A;  4A4F A;  1ZUU A;  3CC7 Q;  4WF2 A;  4FW1 A;  2YLB A;  4XTU A;  3CME Q;  2DVE A;  3VS4 A;  1ZX6 A;  1D1A A;  5A0G A;  4ZGE B;  1GFD A;  4M7A F;  4JJC A;  2MF2 A;  5DY9 A;  2E3H A;  1VQ7 A;  3I5R A;  1U5S A;  3LW5 E;  3HL8 A;  2ROT A;  3INZ A;  2JJ9 A;  5HK3 A;  2MOX A;  3FIF A;  1WQW A;  2QEX T;  4L6V 5;  3QDF A;  2E1H A;  3V7C A;  1KHI A;  1WHM A;  1Q81 C;  3FRN A;  4ORZ A;  2OTL A;  1UJY A;  3CCM T;  1I8F A;  2CP3 A;  1Y07 A;  3NFC A;  2J6F A;  4R55 A;  3JCM V;  2CZ1 B;  3EG0 A;  3OS5 A;  3QYG B;  4RMO A;  4LUD A;  1K73 U;  2A3L A;  2E10 A;  5CKH A;  1QVG S;  4MZM A;  2QYZ A;  3CBP A;  4LD6 A;  1K76 A;  4Y28 E;  4C8Q D;  2XG8 D;  1QP2 A;  2ZZD A;  5A0D A;  1VQO Q;  4HCB A;  4LDX A;  2C0I A;  5GAN g;  1YJN Q;  1MND A;  2LCC A;  2RH2 A;  3QO3 A;  3SFM A;  1NZ9 A;  2NUZ A;  2H8H A;  3C12 A;  3TRE A;  1YHQ T;  2L0A A;  4JLI A;  3P8B B;  5A0L A;  2KYM A;  1FMW A;  4RG2 A;  1M9S A;  2P4R A;  4OMO A;  5GAN 3;  4FW2 A;  5GAM e;  1SSF A;  2CS7 A;  1R0B G;  3H41 A;  4XTZ A;  1M1K C;  3UA7 A;  2ED0 A;  4C8Q G;  3CC7 T;  4R56 A;  1LJO A;  1WGS A;  1BI1 A;  2O31 A;  2Y90 A;  3OS1 A;  3VRY A;  5GMK j;  4D8D A;  3JCM e;  1N9R A;  3OQ5 A;  3BDL A;  3ZL7 C;  2LX9 A;  3L2W A;  1RL2 A;  3PMI A;  1VQN A;  1VQP A;  3EH1 A;  5CKE A;  1BIB A;  1LCK A;  2K7A A;  1KD1 C;  1YJN A;  4HA8 A;  4C92 F;  3D7S B;  3PVQ A;  2OJ2 A;  4HVU A;  1M2V B;  2E6N A;  3T9N A;  1PKS A;  1DJ7 B;  4C5G A;  2QQ9 A;  2V26 A;  4B9W A;  4GLK A;  1NJI C;  3KUF A;  3M4G A;  4M7A C;  3CXC S;  1M1G A;  1H3Z A;  2ZPB B;  1IHW A;  1QVP A;  1N8R U;  1MNE A;  3LH0 A;  1I81 A;  3GPL A;  3OMC A;  4JRQ A;  4F7U E;  4UC4 A;  4M4Z A;  1O9S A;  1BI0 A;  2D8J A;  3JRZ A;  3VS1 A;  3VS6 A;  1VIF A;  2YSQ A;  2LCS A;  4BY6 B;  1S1N A;  3QBY A;  2O88 A;  1TG0 A;  1VQO T;  3A5Z B;  4AMC A;  1YFN A;  4J9I A;  1Y96 B;  4PL6 A;  3G7Z A;  2M1H A;  3MEA A;  3DB4 A;  4DBH A;  1M8M A;  1SRM A;  4FIB A;  4PJO B;  4PLL A;  2E41 A;  3H8Z A;  4BDY A;  1TUC A;  5GAM f;  2JVV A;  3JV3 A;  3EFO B;  1D3B B;  1K73 R;  3VS3 A;  2JM9 A;  1K1Z A;  3G4S Q;  2RQR A;  1C6V X;  4XTX A;  2A28 A;  4M78 F;  1VQ6 A;  3HHT B;  1ACM B;  4FSS A;  2DL3 A;  2GBQ A;  3MHX A;  4PJL A;  3SHW A;  2P0P A;  2R5M A;  1UJ0 A;  4QT7 A;  3JCM f;  3A8M B;  2W10 A;  2P84 A;  1BCM A;  2EYQ A;  1JBM A;  2MCN A;  2OX7 A;  2B8A A;  5DLQ E;  3S3M A;  5IHI A;  4RTW A;  3SWN C;  2FB7 A;  1LPL A;  1SSH A;  3M59 A;  2VGM A;  1ZSZ A;  1AHJ B;  2RMO A;  2YDL A;  3ZBD A;  4XU2 A;  2O4X B;  4HCC A;  1FMK A;  3CCQ Q;  1NBE B;  2DEU A;  1KFZ A;  3DKM A;  4J9G A;  7AT1 B; 
#chains in the Genus database with same CATH homology
 5GAN 5;  5KE3 A;  4EMK A;  2F69 A;  5C6S A;  4M75 A;  4BB7 A;  1W2B A;  4QVZ A;  4QQ6 A;  1BKB A;  4KUL A;  3X20 B;  3VKI A;  2RK1 A;  3WVE B;  3BDU A;  1OI1 A;  4XK8 E;  5GMK i;  4E7J A;  1U8R A;  2QI2 A;  4F7U B;  3CME T;  1Q81 U;  1H64 1;  3G71 A;  4NOY A;  2VGN A;  2QXF A;  5LJ5 d;  2V8K A;  4PLI A;  4EMH A;  4LDW A;  2PQW A;  3OYL A;  3OA6 A;  4M7A E;  5L8R E;  1VIE A;  2NLU A;  3VUZ A;  4P5N A;  3PMT A;  3WXM B;  5GAN 2;  2RJC A;  3OYB A;  1Y71 A;  1R8O B;  2DXU A;  3OYH A;  2E12 A;  2O4X A;  3CCU A;  4JUV A;  3CBO A;  3V7S A;  4C0Z A;  4OB1 B;  1K73 C;  2DXB A;  3A8L B;  1RI0 A;  2LQ8 A;  4HCZ A;  3QDR B;  5CIU A;  5J3B A;  1KQ2 A;  4ZN3 A;  2KY9 A;  3CCJ A;  2QEX A;  4O6J A;  4C92 C;  2RJF A;  2CGH A;  4LDY A;  4MDW A;  4XTW A;  4RG8 A;  3OSV A;  4J6W A;  4PJO F;  2ZPG B;  4JS4 A;  4BE0 A;  4C0F A;  5GAN h;  4FM4 B;  4C0D C;  4F7U A;  3JCM P;  2ZPH B;  2RJE A;  3GNF B;  3MCA B;  5I2M A;  4EPC A;  3CC2 T;  2EWN A;  4M7D C;  4M77 B;  4MMK A;  1I5L A;  3DLL A;  3CCM A;  4N4I A;  1VQK A;  4X34 A;  3RMQ A;  3QJ6 A;  4L59 A;  1V29 B;  2L8D A;  3HPW A;  5CO7 A;  2CZ7 B;  1QW1 A;  4O5V A;  4OB0 B;  2C06 A;  3JCM b;  4BI8 B;  5LJ3 e;  4A4H A;  2G3R A;  3M5A A;  5FRO A;  4A53 A;  3QHS A;  2DTH A;  1JJ2 S;  2XID A;  1WJQ A;  4IUV A;  2EQU A;  4A54 A;  4C5H A;  3UPU A;  2ZPF B;  1YIJ T;  4BE2 A;  3GLX A;  2O01 E;  1Q82 C;  2LRQ A;  3G4S T;  4IUT A;  3V8J A;  2RK2 A;  2DTO A;  1VQM A;  2BUD A;  5CQX A;  3HP9 A;  3QXE B;  2FL7 A;  3GOX A;  2DKG A;  2KVQ G;  2HQE A;  4E7K A;  1BYM A;  5FU7 B;  1IZ6 A;  3MP8 A;  2VV5 A;  4M75 F;  3URG A;  2PVD B;  1VQN T;  2RHX A;  1VQP T;  3JB9 J;  2KMT A;  3QYH B;  3QZ9 B;  3I55 A;  3QKJ A;  4JJN K;  2OAU A;  2X4X A;  2EKO A;  3M54 A;  4M77 A;  1YJN T;  1UGP B;  2HAX A;  2M9U A;  1YJW T;  1JRI A;  5GAM d;  1YI2 A;  3FLG A;  1K8A C;  2XU8 A;  2KSS A;  3OW2 S;  4II1 A;  1M1K U;  2QQB A;  1KC8 U;  5CKF A;  3GF5 A;  2DIQ A;  3MEV A;  3KXT A;  1YBY A;  5GAN 6;  3CEY A;  4A4K A;  5LJ5 e;  2K57 A;  2LTO A;  4BAC A;  1QVF S;  4FSX A;  5FU6 C;  2K4Y A;  3CCV A;  5DLO A;  4IUQ A;  2RHU A;  2DTI A;  4DOW A;  2MWP A;  3NTH A;  4MDX A;  3V8L A;  1XQH A;  2K5L A;  3TCJ A;  1KD1 U;  3JCM d;  2HD0 A;  1WNL A;  4JDS A;  4M78 D;  3TEE A;  3PIP A;  3L1A A;  4MZP A;  1VQ5 A;  2RB6 A;  2HQX A;  2JN0 A;  4M7A B;  3TU4 K;  3QG1 A;  1YJ9 T;  3CCQ T;  3FJP A;  2L5Q A;  1VQL A;  3CC4 A;  4E7I A;  1QVF A;  2DPP B;  4D6W A;  1X6O A;  4F7U F;  3OYG A;  5GAN 8;  3BW1 A;  3RKX A;  4JRP A;  1UGQ B;  2EAY A;  3QII A;  3E19 A;  3L2U A;  1M1F A;  5FRN A;  2EJG A;  2R57 A;  5GAN j;  3L42 A;  3C4S A;  2EQK A;  3OBY A;  2X4J A;  4NL2 A;  1VQ4 T;  4Z02 A;  2X4W A;  5IAY A;  1YCY A;  3CC7 A;  2L3R A;  5IT9 E;  2JTF A;  3CME A;  5HKC A;  1I4K 1;  5GMK l;  3JB9 F;  3PNW C;  4X9D A;  2K5I A;  1NJI U;  1W2B S;  3JB9 D;  4FT4 A;  1QVG A;  2RI2 A;  5LJ3 g;  5KCH A;  3G6E A;  1PSF A;  2OTJ A;  3JCM J;  3OYJ A;  3MEW A;  2RD1 A;  4DQ2 A;  4IUP A;  4J7I A;  2LT1 A;  5M9O A;  2M16 A;  2F5T X;  4C5E A;  5D6Y A;  4M7A A;  4C5I A;  2GCX A;  2BIV A;  4C92 E;  2CZ0 B;  2PUK B;  1NE8 A;  2XKO C;  5GAN 7;  4C0G A;  4M77 F;  3EAE A;  5GAM h;  4DA4 A;  5LJ3 f;  5J39 A;  1XTD A;  4E7L A;  1FXX A;  4M7D E;  4OVA A;  1U1T A;  4M77 D;  4XQ3 A;  4DOV A;  3CMA T;  2RO0 A;  3P8D A;  4BDZ A;  3CD6 A;  3AHU A;  4QQG A;  1VQ6 T;  5LJ5 j;  2I2L A;  4JRI A;  3M4Y A;  4C8Q B;  3L2Q A;  3HRT A;  4N4H A;  4OGC A;  3E9G A;  4JLG A;  4M78 G;  5GAO n;  1Q86 C;  2PVO B;  3LLR A;  3OYD A;  2DXT A;  1K9M C;  1VQ8 A;  3CCR T;  3JSC A;  2RHI A;  3LGL A;  3O8V A;  2M0O A;  3L2Z A;  2LNV A;  5J26 A;  4ZN1 A;  1VQ9 T;  2JZ2 A;  2K5F A;  3JCM h;  1PSE A;  3MEU A;  1ZHI A;  1Y7X A;  5CQY A;  4F7U G;  1Q7Y C;  5LL6 S;  3FC3 A;  1KC8 C;  2DAQ A;  1P92 A;  4KUI A;  2P4T A;  2LC4 A;  1OZ3 A;  2DO3 A;  5GAO q;  3CCE T;  1UB4 A;  5GAO l;  2EQM A;  2EFI A;  4ZGJ B;  1ZBX A;  1IRE B;  3SWN B;  3I56 T;  3JB9 G;  3CCS T;  2E70 A;  3HRU A;  5GAO m;  1VQO A;  2XK0 A;  2VXE A;  1KQS A;  4J5Y A;  4PJO D;  3M55 A;  3L2R A;  4C8Q A;  5GAN 4;  5HK0 A;  3FEO A;  2BKD N;  2PUO B;  1M90 C;  3LGF A;  2ZCF B;  2XI9 A;  2DIG A;  2D6F A;  4IUR A;  2D0Q B;  4A4G A;  3S3N A;  3JCM Q;  1G3S A;  5GAN e;  3PTA A;  2KDS A;  1X75 C;  2XD0 A;  3SD4 A;  4LD9 K;  1WJS A;  3QSU A;  2DD5 A;  4A4F A;  4WF2 A;  4XTU A;  2YLB A;  3CPW A;  2DVE A;  4M77 G;  3VUB A;  3J81 E;  5A0G A;  3G71 T;  1LOJ A;  4ZGE B;  5D6X A;  2DZC A;  4M7A F;  2Y4X A;  2MF2 A;  3M53 A;  5DY9 A;  4J7F A;  4BUG A;  3P8H A;  2VC8 A;  1VQ7 A;  3ZEH A;  1YIT A;  2KK4 A;  3UT1 A;  1KG1 A;  2DK3 A;  3X28 B;  4M78 E;  3SWN A;  5FRM A;  1JB0 E;  4M75 D;  2IG0 A;  2X35 A;  3LW5 E;  3HL8 A;  5CAI A;  1YJ9 A;  3OB9 A;  4EMK C;  4J6Y A;  2YLC A;  4XU1 A;  4YTL A;  2VXF A;  3INZ A;  3C94 A;  5C0M A;  3N5B B;  5GAM j;  2GFA A;  3JCM c;  3CCU T;  5HK3 A;  4OF1 A;  2P0Q A;  3BY7 A;  1N6A A;  1O75 A;  3CCL A;  3FIF A;  3OY9 A;  1WQW A;  1WJR A;  4ME7 A;  2ZPI B;  3CCJ T;  4XU0 A;  2EQJ A;  4NS5 A;  2QEX T;  2RJD A;  4L6V 5;  5DM7 R;  2PVG B;  2E1H A;  3UDC A;  4C92 B;  2E5Q A;  3HFN A;  3OS2 A;  3MO8 A;  1LNX A;  3V7C A;  3CXC A;  1KHI A;  2E6Z A;  2GF7 A;  1OYX A;  2VYT A;  4PKC C;  4ZTJ A;  2QA4 A;  1Q81 C;  3JB9 H;  4C0D B;  3FRN A;  2EJF A;  4MML A;  1S72 A;  2ZGW A;  2QQR A;  5KE2 A;  4PJO G;  2KQW A;  2OTL A;  4M7D B;  3CCM T;  1I8F A;  4HT8 A;  1Y07 A;  3X24 B;  3NFC A;  3JCM W;  4E7H A;  5GMK h;  4R55 A;  3JCM V;  1B34 B;  2CZ1 B;  2RI3 A;  3MP6 A;  3X26 B;  3LWH A;  3OS5 A;  1EIF A;  1W4S A;  1N27 A;  3QYG B;  4RMO A;  4M78 C;  3OYC A;  1K73 U;  2A3L A;  5EG2 A;  2DD4 A;  2LQK A;  1G3Y A;  2E10 A;  2WAC A;  5CKH A;  3SDZ A;  1QVG S;  3LX7 A;  3ZFJ A;  4MZM A;  3CBP A;  4BD3 A;  4OP0 A;  4C8Q F;  4QVC A;  2LVM A;  4RCC A;  1G3W A;  4LD6 A;  4Y28 E;  2K3X A;  4C8Q D;  4XAX B;  4M77 E;  5IN1 A;  1VQM T;  2XG8 D;  1YIJ A;  4CI0 C;  1QP2 A;  2ZZD A;  2QQS A;  1M5Q 1;  5A0D A;  1QP3 A;  2XIC A;  4C92 A;  2PU9 B;  4M7A G;  4HCB A;  4LDX A;  3PFS A;  4N4G A;  3I55 T;  1HXD A;  4J83 A;  4OB3 B;  2MWO A;  4M75 G;  5GAN g;  1NPP A;  3S3O A;  4M7D A;  2K3Y A;  5AYF A;  2RHY A;  3VU3 C;  3OYA A;  3RKW A;  2CKK A;  1YI2 T;  1M8V A;  1WPY A;  2LCC A;  2D9T A;  1OZ2 A;  2R5A A;  2RH2 A;  3GIB A;  1B34 A;  3QO3 A;  3SFM A;  1NZ9 A;  3LYI A;  2E65 A;  5LJ3 d;  3E9F A;  3A8H B;  2CZ6 B;  1Q82 U;  3Q1J A;  4FT2 A;  3LWI A;  2MMP A;  2V8I A;  3TRE A;  3C12 A;  2K2V A;  1YHQ T;  3CCE A;  4JLI A;  3P8B B;  3CCV T;  5A0L A;  5FU6 B;  5GAN f;  2XDD A;  3A8G B;  3VYH B;  2X4Y A;  2YRV A;  3OSS C;  3ER0 A;  4RG2 A;  4TVR A;  2JTM A;  1M9S A;  3JB9 I;  2JOY A;  4M77 C;  3CC2 A;  4PJO E;  2EJ9 A;  2XDB A;  1VUB A;  5HY6 A;  2E64 A;  1M4Z A;  1BIA A;  4X9C A;  4A4E A;  4B9X A;  5GAN 3;  2R58 A;  2WSE E;  5GAM e;  1VQ5 T;  1SSF A;  4KBM B;  1VQL T;  3CBM A;  4M78 B;  2CS7 A;  4Y91 A;  1ZQ1 A;  5LJ5 g;  1KQS S;  4XTV A;  1KQ1 A;  4XTZ A;  1M1K C;  2MI6 A;  3L2V A;  3QZ5 B;  1GXI E;  4KUD K;  3OYY A;  3MP1 A;  4C8Q G;  4R56 A;  3ASK A;  5D6W A;  3CC7 T;  1LJO A;  4JRK A;  4BI3 A;  4BY6 C;  1WGS A;  3G4S A;  1BI1 A;  2VUB A;  4Q5W A;  4OGE A;  5I21 A;  1UGR B;  2Y90 A;  5I2S A;  3NTK A;  3OS1 A;  5FU7 C;  5GMK j;  5A2Q E;  3M58 A;  2KAF A;  3JCM e;  1N9R A;  3EFR A;  3J7A F;  3OQ5 A;  2GQV A;  3BDL A;  3L2W A;  2LX9 A;  1RL2 A;  3F70 A;  3PMI A;  5LJ5 f;  3G6E T;  3VYG A;  2FVU A;  5CKE A;  4M75 E;  3CPW S;  1VQP A;  5KH6 A;  4N0A C;  1BIB A;  3JCM X;  5CVI A;  4RCB A;  1KD1 C;  1G5V A;  5CKD A;  4HA8 A;  2H3J A;  1YJN A;  3M56 A;  3H6Z A;  4PJO C;  4C92 F;  3RUX A;  1YJW A;  4J8O A;  1VQN A;  3ME9 A;  3VJP A;  4C92 D;  4M78 A;  3GNG A;  2IVW A;  4M7D F;  2MAM A;  2WSF E;  4PNO A;  5CCA A;  4M7D D;  2E6N A;  2GFU A;  1BI2 A;  2XHC A;  3CD6 T;  4GY5 A;  1NPR A;  3T9N A;  5LJ3 h;  2XDP A;  1HK9 A;  1DJ7 B;  5GAO p;  3M9Q A;  4XU3 A;  3UWN A;  4C5G A;  2QQ9 A;  4B9W A;  4GLK A;  4M7A D;  4L5G A;  3PT9 A;  2HBP A;  1NJI C;  1VQ8 T;  5FLX E;  4ELZ C;  1FWZ A;  3KUF A;  3RMS A;  3M4G A;  3V8K A;  4M7A C;  3CXC S;  1M1G A;  1H3Z A;  2ZPB B;  5CKB A;  1QVP A;  3RIR A;  1N8R U;  3CCQ A;  3LH0 A;  1I81 A;  3QPH A;  3KBG A;  4M75 C;  3OYI A;  3OMC A;  4EDU A;  5CK9 A;  4ZGD B;  3GPL A;  4JRQ A;  2OTJ T;  4F7U E;  4UC4 A;  1O9S A;  1KHC A;  3EFS A;  1BI0 A;  1MHN A;  3QJY A;  2RM4 A;  3JRZ A;  3PGG A;  4C8Q E;  1VIF A;  3OS0 A;  1VQ4 A;  4RKU E;  4BY6 B;  4BI4 A;  4V2S A;  3RES A;  4IKF A;  2DEQ A;  1G3T A;  4LDU A;  3QBY A;  5GAM g;  3PIO A;  4KT0 E;  4IUU A;  2FYK A;  4VUB A;  3GP8 A;  3RER A;  1VQO T;  3A5Z B;  3R6O A;  1MGQ A;  4NL3 A;  4J6X A;  3QUI A;  2JNG A;  1Q86 U;  1K9M U;  2CYZ B;  1Y96 B;  4PL6 A;  3C95 A;  3G7Z A;  2ZPE B;  2M1H A;  2RA2 A;  3MEA A;  1JJ2 A;  3DB4 A;  5KCO A;  2LT4 A;  5LJ5 h;  1VQK T;  2DJZ A;  2QDY B;  3E1S A;  3M57 A;  4FIB A;  4OB2 B;  5GAO r;  2DXC A;  3OYM A;  3OYN A;  4PJO B;  4PLL A;  2E41 A;  1Q7Y U;  3H8Z A;  4BDY A;  4C92 G;  4QVD A;  4HT9 A;  1UEB A;  5GAM f;  2FHD A;  2JVV A;  1D3B B;  3DLM A;  3OYK A;  1XNI A;  4MZT A;  3JCM g;  2V8J A;  4BE1 A;  2AHJ B;  4M7D G;  1YHQ A;  5GMK e;  2RHZ A;  3FB9 A;  3NTI A;  3J80 E;  3OBW A;  4XTX A;  2L89 A;  4ELY C;  3CMA A;  4QW2 A;  4JS5 A;  4E47 A;  2EIF A;  1VQ7 T;  4M78 F;  1YIT T;  1VQ6 A;  2WSC E;  3HHT B;  4FL6 A;  4C8Q C;  3OW2 A;  3MET A;  2DZ9 A;  4XTY A;  4QQD A;  3MHX A;  2JUF A;  3X25 B;  1M90 U;  1Y96 A;  2P0P A;  2R5M A;  3CCR A;  3HKS A;  3SB2 A;  3OMG A;  1FX7 A;  4N0A A;  3JCM f;  3A8M B;  1XOV A;  3V7R A;  4EMK B;  2YHT A;  3JAM E;  4M75 B;  1N9S A;  3BFM A;  3S6W A;  1VQ9 A;  3CCL T;  3OYF A;  4PJO A;  2EYQ A;  4ATO A;  2QTX A;  2QQA A;  5LJ3 j;  1BI3 A;  1JBM A;  5GAN d;  1UGS B;  3WVD B;  4CRI A;  4OMF B;  3HSB A;  1D3B A;  1U1S A;  3A8O B;  2HNI A;  2B8A A;  1TH7 A;  3CPF A;  5DLQ E;  3S3M A;  2A7Y A;  2QA4 T;  3SWN C;  2FB7 A;  2Y4Y A;  3HFO A;  3M59 A;  2LCL A;  3RKY A;  5GMK m;  4LDV A;  3HRS A;  2VGM A;  4FU6 A;  3I56 A;  3CCS A;  1S72 T;  2OTL T;  1AHJ B;  4HKE A;  3VV0 A;  3ZBD A;  3OYE A;  2F5K A;  1X01 A;  4EMG A;  4XU2 A;  2O4X B;  2P0K A;  3FDR A;  4HCC A;  1K8A U;  1WQ7 A;  2RI5 A;  3DKM A;  3CC4 T;  4ZTF A;  5CR2 A;  3DB3 A;  2LDM A;  1N8R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...