5GAN7

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
80
structure length
66
Chain Sequence
AILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 6
structure length 66
sequence length 80
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
7 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan700
3SWNA 4M7AB 4XTYA 5LJ3h 4F7UF 5GAN3 3RERA 3RKXA 5GAOn 3EFRA 2K57A 4M7DF 2VXEA 4M77B 4N0AC 4XU3A 2I2LA 4X9DA 4C8QC 4NL3A 3L2ZA 4PJOB 2QTXA 2DXTA 2RB6A 4M75G 5LJ3g 1JBMA 4M75C 5GAMg 5GANd 5GAN8 2E41A 4A53A 2E10A 1M5Q1 3JCMb 4M7AA 4M7AG 1M8VA 2ZGWA 5LJ5d 4C92B 1KQ1A 1WQWA 2DZ9A 3VU3C 5GMKh 5GAMh 4M77G 4M77A 4M77C 4JRIA 4PJOG 2YLBA 4PJOA 4C8QB 3BY7A 4XU1A 4PJOC 1H641 3JB9I 4OP0A 4F7UB 5LJ3j 4NOYA 3JCMX 3JB9F 4J6XA 2RM4A 4M75B 5I21A 1MGQA 4J6YA 4M78D 3JCMh 5LJ3e 1I5LA 5GMKi 4C92A 3V7SA 4M7DE 3INZA 1Y96B 3FB9A 3FIFA 4M7AD 2EJ9A 3V8JA 3JCMP 3RKWA 1I4K1 1N9RA 4JUVA 2EJFA 3QSUA 4XTVA 4C8QG 4N0AA 2VXFA 3V8LA 4C8QA 2E64A 5GAOl 4F7UG 4F7UA 2EJGA 3JCMg 5GAOm 4M75A 4M7DC 3JB9J 4HA8A 1Y96A 3QO3A 3JCMV 3FJPA 5GAMf 5GAN4 5GAOp 4C92D 5LJ3f 3AHUA 3V7CA 4HT9A 4XTXA 1HK9A 2DKGA 4J5YA 1LOJA 4XQ3A 3M4GA 3RKYA 2YHTA 1YCYA 4C8QD 3BFMA 3L1AA 4M78E 5GAMj 2DEQA 1HXDA 1LNXA 2E65A 3JCMe 4M75D 5GAMe 1TH7A 3V8KA 4M78F 4M7DB 5GAN7 4EMHA 4M7AF 2RA2A 5GANh 4RCCA 2DTHA 3JB9G 3SB2A 1WPYA 4XTUA 5GAMd 4HT8A 5LJ5h 5LJ3d 2DJZA 4NL2A 3BW1A 4M77D 4XU2A 4M78C 4PJOD 3RESA 4JLIA 4X9CA 3JCMQ 4EMGA 5GMKj 2HNIA 2FB7A 5GANg 3JCMW 1D3BB 3V7RA 4M7DA 4M7DG 3HFNA 4XTZA 3JCMf 5GAN6 5GAOq 4XTWA 5GMKe 1U1TA 5LJ5g 4C92F 4XU0A 1B34B 2DXUA 4EMKC 5DY9A 4V2SA 3RIRA 1I81A 2EAYA 2YLCA 3RUXA 4M78B 3EFSA 2RD1A 3SWNC 5GANj 4QVDA 3GIBA 1D3BA 3JB9H 4M7AE 4M75F 1U1SA 4RCBA 5GANe 5LJ5j 5GAN2 5CAIA 4M7DD 1I8FA 1KQ2A 4M77E 1B34A 3PGGA 1JRIA 1BIAA 5LJ5e 3HFOA 3JCMd 4PJOE 4Y91A 4EMKB 2Y90A 1WNLA 4M78G 4M78A 4M77F 3BDUA 1X01A 4DQ2A 3QHSA 4JRKA 2DVEA 4PJOF 4M7AC 2FYKA 4MMLA 4C92E 3SWNB 3HSBA 4QVCA 5GAOr 3JCMJ 2EWNA 4J6WA 2E1HA 2DTOA 4MMKA 1LJOA 1BIBA 3JCMc 4A54A 4C8QE 4EMKA 1WQ7A 2VC8A 5GANf 5GAN5 4F7UE 5GMKl 3JB9D 4WF2A 5LJ5f 3QUIA 2JN0A 2DZCA 4M75E 5GMKm 4C8QF 4C92G 2DTIA 4PNOA 1N9SA 4C92C 2CGHA
chains in the Genus database with same CATH superfamily
4F16A 2JM8A 5GAOn 1WHKA 2CZ1B 2I2LA 2LDMA 1X69A 1RAEB 4M75C 4M7AG 1M8VA 5HK3A 1UGRB 1WJQA 1QCNA 4PJOA 2BE7D 3DKMA 2K5FA 2G3RA 3V7SA 2DK3A 2YXYA 2P0QA 2F1LA 3QSUA 1WZOA 4IUUA 2MWPA 4F7UG 2YUQA 4FW2A 3CC2T 2DL3A 2V8KA 1B07A 2PVGB 3P8DA 2QQAA 5GAOp 4HT9A 4C92D 3ER0A 2A37A 3FDRA 4C8QD 3PNWC 1ARKA 1B3QA 1AVZC 2QAZA 4BI3A 1HXDA 4KH0B 1QVPA 2SRCA 4M78F 4FYVB 1M30A 7AT1B 1YJ9Q 2J6FA 2B8AA 4A4KA 3CC7T 4JJCA 1K76A 4DOWA 1WHMA 2QXFA 1GBRA 1M2OA 2MAMA 3CC4A 2DXUA 2VV5A 4EMKC 5DY9A 2DD4A 2VVKA 1PKSA 2CSIA 3HL8A 1Y57A 4M78B 1Y71A 3CC2A 2RD1A 3BE3A 5CAIA 4LDUA 1B34A 3PGGA 1BIAA 4BE0A 3GNFB 3LW5E 1WNLA 1SEMA 3L2WA 1YI2Q 1NZ9A 1ZX6A 1RLPC 2WSCE 2DJQA 3CPWA 3CCLQ 1E7OA 3CMEQ 2AZVA 2FPFA 3CMAQ 3JB9D 2COZA 2DYBA 2DF6A 3UA7A 2DTIA 3SFMA 5KE3A 5FROA 3RKXA 5CKEA 4R0KA 5KH6A 2K57A 1FWZA 2M0OA 4FL6A 1NJIU 2CZ6B 2JM9A 2PUOB 1N8RU 2XDDA 2E10A 1K73R 2QGGA 2DILA 2FG0A 2F5KA 3CCSA 1OX9A 1RLQC 1HSQA 1I07A 3HKSA 5IHNA 1PRLC 3NHNA 3QKJA 1OX8A 1QMCA 4Z02A 2FEIA 4O6JA 5FWCA 2QA4A 3RNJA 1GRIA 1KD1R 2DERA 2KXDA 3A8GB 3X24B 2YRCA 1PWTA 3CCQA 2D1XA 3SHWA 2K2VA 3DLMA 2ZPGB 2M1HA 2GF7A 1HD3A 6AT1B 1YWOA 1YNZA 1TG0A 4M78E 5CCAA 1Q7YR 3KXTA 4M75D 1VQ6A 2IG0A 1TH7A 4KULA 4DEYA 4EPCA 5GAN7 1RAAB 2DTHA 3QXEB 2J6KA 1S72T 4HT8A 1XOVA 5KYXB 5IN1A 1PSEA 1UGSB 1YJ9T 3R6OA 4E7JA 1JU5C 1UG1A 1UJ0A 3J81E 1UECA 1K73C 2KROA 3HPWA 2YLCA 3OBYA 2GBQA 1FYNA 2HEQA 4RTWA 3JB9H 1SHGA 1PKTA 5CO7A 5A0LA 5KYYA 4IIOA 3GBQA 4A4EA 2RJFA 1KD1C 4LE9A 2QYZA 1YITQ 4PJOF 5D6WA 4J9EA 4MMLA 3OB9A 2VB6A 4CI0C 2QTVA 4BACA 1YI2T 2FL7A 4HCBA 2DD5A 1WQ7A 3QG1A 5IHIA 3CCLT 2H3EB 5GMKl 3REBB 3CMET 3FRNA 1S72A 2DZCA 2RJEA 2CT3A 3CMAT 3OYJA 2LMJA 1Q7YC 1W6XA 3SDZA 2DO3A 4IUTA 4HVUA 3H0IA 4NL3A 4KT0E 2X4JA 3L2ZA 4PJOB 1BKBA 4IURA 4MZMA 3CCRQ 1SF9A 2KRMA 3LWHA 4M77A 4N4IA 1XJWB 3G4SA 4PJOC 2K3YA 1GFDA 4TVRA 1M1KU 1JB0E 2LVMA 1AT1B 3HHTB 4M78D 1OZ2A 2COWA 4C92A 4C0ZA 5FU7C 4C8QA 1QVGP 1YI2A 1KQSS 2CS7A 1LCKA 5CIUA 1WGSA 2RJCA 4LDWA 4JLGA 2DKGA 2K2MA 4MDXA 3CCEQ 1YHQA 1ZUYA 2XDPA 3DB4A 2E65A 1YWPA 3V8KA 1VQ7Q 3IQLA 3CCVQ 3OYMA 2OTLT 2K3XA 2L0AA 4CRIA 2ED1A 3MEAA 2ECZA 1PD0A 4DA4A 1TSFA 2J05A 1BI2A 1KHIA 2KT8A 1B34B 2HQXA 1PNJA 1VQOQ 3M56A 1UHCA 1OU8A 2X3WD 1Y07A 1YJNT 4A4FA 2E3HA 4F04B 2CH4A 4RG8A 4PJOE 1U06A 2ABLA 3QIIA 2F2WA 1OULA 4JRKA 5IXBA 1IRXA 2KVQG 1YITT 2E6NA 1VIEA 3OS5A 1NM7A 4KGXB 3QJYA 2OTLA 2HQEA 1WJRA 5GAN3 3EHRA 2ZPEB 1VQNQ 4C5HA 2XI9A 4K11A 2RO0A 1WXBA 1MNEA 1MMDA 4IUPA 1YJNA 3CCRT 1KHCA 3VU3C 3TU4K 4LXCA 3CCUA 1UJYA 1M90R 5HCKA 3BY7A 2EQJA 2FRWA 4OGCA 4OP0A 1QVFP 3JCMX 2X35A 5KYUA 3JCMh 4IUVA 2XKOC 2DMOA 3VJPA 5KYWA 2EVRA 1Q82R 5GAOl 1D1CA 3M57A 3JCMg 2HBWA 2DAQA 2RQVA 3EG1A 4M75A 2FPEA 3ME9A 1U3OA 2LJ3A 4OVAA 4FU6A 3VV0A 4E7IA 1C1AA 2BUDA 1KJWA 2F2VA 3PVQA 3CCET 2CREA 2HL3A 4ZTJA 4M7AF 3E1SA 4RCCA 1QP3A 2OI3A 5LJ3d 2LQWA 1IGUA 4PJOD 3CCVT 4JZ3A 1UE9A 4GLMA 2X4XA 2ZAEA 3M9QA 1ZSZC 3JCMW 4F17A 3JCMf 2O88A 2C06A 2JNGA 4OF1A 5KYYB 1M90C 3RIRA 3UPUA 1I81A 2R5MA 3OYYA 1M3CA 2E5KA 4FT4A 1VQOT 5GANj 2RNAA 3NTHA 2QASA 4E2FB 4RTYA 1Q82C 3QWXX 1R8OB 2J06A 4M77F 2XMFA 4M7AC 3M0PA 2ZPHB 3FLGA 4QT7A 1K4US 1BK2A 5GAN5 4DBQA 4EMKA 2VC8A 4BDYA 2O2OA 5FU6C 2DBMA 3I56Q 4QVZA 3G7ZA 4C8QF 4PNOA 4XTYA 3CCVA 2A28A 2QQSA 2WACA 2DXBA 2ZPIB 3QDFA 4M77B 4N0AC 4UC4A 1TUDA 1VQNT 3QYHB 2P4RA 1QVGA 3M58A 5LJ5d 4C92B 1Q95G 3RMSA 2KXCA 1O9SA 4M77C 2GTJA 4C8QB 2J7IA 4E7LA 1H641 4JDSA 1BBZA 1QP2A 4J6YA 5FRNA 2LJ1A 1M90U 3RKWA 4C0GA 1WHJA 2E64A 3UWNA 1NYGA 1Q86U 1GXIE 1VYUA 2F2XA 3OYDA 2X4WA 3M0TA 4XK8E 1ZUKA 5GAN4 3O5ZA 1NPPA 2K3BA 4IIMA 2MYSA 3J7AF 2L3QA 3O8VA 1D0YA 1K9MR 4JS5A 2KY9A 4RMOA 2AKKA 4E47A 4C0DB 3EGDB 1QCOA 1FMVA 4XTUA 4OB0B 3A8MB 1C0MA 4XU2A 3CQTA 2RI3A 4JLIA 5D6XA 4J7FA 1UTIA 2GQVA 1BCMA 2MWOA 4O5VA 2JMAA 3GOXA 1VQMA 3VRYA 2R5AA 2KK4A 4BI8B 2VYTA 4AMCA 5C6SA 3PFSA 2V1RA 4RTVA 3SWNC 1YP5A 2EIFA 2FHDA 2GTOA 2PVDB 3VS0A 1RAIB 1MUZA 4M77E 2E6ZA 2ZZDA 2A3LA 1IREB 2KEAA 3WVEB 4DBFA 3M55A 1AWWA 4C92E 1UB4A 1OYXA 2MK5A 1N6AA 1XTDA 4C8QE 1G2BA 3CCJA 4PLLA 1K9MC 2V8JA 5GMKm 1QVFA 1HYOA 3I56T 3EFRA 3A8HB 2X9HA 2OAUA 4YTLA 2DVJA 1WXTA 2NLUA 4OMNA 2DFUA 2D0NA 2E41A 3EGUA 5KYUB 3H0HA 2E5QA 4JRQA 3RDVA 2KR3A 3E19A 5KYWB 4JRIA 1RACB 4N4HA 3EG9A 1NJIR 1PCXA 4Y28E 2CP7A 4NOYA 4BE2A 3S6WA 3S3OA 4M75B 1N8RR 3OYEA 4GY5A 4M7AD 4JZ4A 4A4HA 1G83A 1VQ8Q 3I5RA 2LNHB 1RI0A 4J9CA 3J80E 3UATA 4DBRA 4J9IA 1OI1A 1W1FA 2K5LA 4PJMA 1UDLA 5CQYA 1Q81U 2L2PA 3LH5A 5GAMe 2XG8D 3OW2S 2KDSA 5GANh 2HKQB 3SB2A 1WPYA 3DLLA 1K9MU 1GBQA 4M77D 2DXCA 4L6V5 4HVVA 3JV3A 3HRSA 1KQSP 5GANg 4M7DG 1VYTA 2MCNA 4PJLA 1FMKA 3JRZA 2R57A 3GP8A 4PK4A 1X2KA 1NJIC 2D6FA 3NTIA 1YBYA 1N8RC 2LCCA 2V8IA 1AWJA 5CQXA 4BB7A 2EYWA 3TSZA 1N5ZA 3MCAB 4Y91A 4EMKB 2FZGB 4ZGJB 3D7SB 2HKNA 3S3MA 5CK9A 1ZQ1A 1X2QA 2L8DA 2E1HA 3URGA 3JCMc 2AHJB 5GANf 3OA6A 2COYA 2AKLA 3M5AA 4DOVA 4M75E 3PIPA 3PE0A 4C92G 3LGLA 4RTZA 5GAMh 4CC3A 4Z89A 3OYNA 3I55T 4JJBA 2DBKA 1VQ9Q 1FXXA 4KGVB 5GAMg 2NUPA 2JZ2A 1UEBA 2GNCA 4KGZB 3I9QA 4ZGEB 4RTTA 2RN8A 4AFSC 1ABOA 4PFZA 1JXOA 2EKHA 2KI7A 3CC7A 5LJ3e 2KQWA 1RAFB 1FMWA 4RG2A 2EW3A 1I4K1 2EQKA 2YT6A 3V8LA 2IVWA 4CC4B 2PU9B 5GAOm 4PKCC 1X27A 1M1KR 4LN2A 1VQ8T 5GAMf 5DM7R 4XTXA 1RADB 3I55A 4XQ3A 3M4GA 2LP5A 2GQIA 2QDYB 4HXJA 4OMOA 2W10A 3EHQA 1Z9ZA 2QDLA 3JB9G 5D7UA 2DJZA 2OTJQ 4LNPA 3VS2A 3RESA 4X9CA 3CBOA 4EMGA 4PJNA 3HFNA 3MKDA 3ZBDA 4FYXB 1IO6A 2IIMA 3A5ZB 3TQ7P 1X6BA 3GIBA 2GGRA 3HRTA 4Y92A 4RCBA 5GAN2 4QQGA 1VQ8A 5LJ5e 2JUFA 5GJWB 2OJ2A 2DVEA 4D6WA 3Q1JA 1K9AA 1M1KC 5EG2A 1ZSZA 3VS3A 2LX9A 2K79A 2V1QA 3A8OB 1Y7XA 1RUWA 2LQKA 2DRKA 3OY9A 4ZN3A 2CUBA 1UGVA 2RF0A 1UGPB 4JPBW 2PNIA 3VS7A 3CCMQ 4CC2A 3EG9B 4M75G 1S1NA 5FLXE 1VQ9T 2O9SA 4M7AA 2NYSA 1WHLA 3OMGA 3MJXA 3N5BB 3EG3A 1K1ZA 1ZA1B 2ROLA 2HSEB 5A2QE 1DJ7B 2BIVA 5I21A 4B9WA 4DBHA 3FIFA 1YJ9A 2QGFB 3LH0A 4LD6A 5HY6A 1M1FA 3ASKA 4N0AA 1I0CA 4ME7A 2KRSA 4F7UA 1I5OB 4E7SA 2VGNA 2JS2A 2LCLA 1Y96A 2BTTA 3RR6A 4DEXA 1M4ZA 1EZZB 1KQSA 2SEMA 2ZCFB 3TCJA 1MV3A 5FU7B 2CYZB 3VRZA 2RI5A 2DEQA 5I2SA 4PFPA 1I1JA 1SSFA 4EMHA 1UUEA 1VOMA 3OSSC 2JTEA 4OB2B 4RUGA 1TTHB 5LL6S 3CCLA 3A98A 2FB7A 2OTJT 3CMEA 5IHKA 5J39A 3CMAA 1YJWQ 3QBYA 4MZPA 2EAYA 1TXQA 3OYGA 5C0MA 2M9UA 1NLPC 2KBTA 2RHZA 2EGCA 1JRIA 1B7TA 3CXCS 4FIBA 4M78G 1WDXA 3GPLA 5GAOr 2LCSA 3M0UA 4BE1A 1IHWA 4HKEA 4J9GA 5AYFA 2NUPB 5KE2A 2JS0A 1AZEA 1I5LA 3SWNA 1V1CA 3L2QA 1Z9QA 1QCFA 3CD6Q 1PM3A 5CVIA 1JBMA 3CCMT 1D0XA 1K0SA 4J9HA 2D9TA 1D1AA 4B6MA 2RMOA 2M51A 3X20B 3TREA 5L23A 3NGPA 4OMMA 1ZBXA 2WSFE 2M02A 4JUVA 2QEXQ 3THKA 4HCCA 2DE0X 2K9GA 5A0DA 3C0CA 4HCKA 2H3JA 2FPDA 5HKCA 3QO3A 4V2SA 2DL7A 4EDUA 4LUEA 2EGAA 4BI4A 3HRUA 1SG5A 2PUKB 3PVLA 2P4TA 1SSHA 1CSKA 1Q86R 3NTKA 3CCMA 1R0CB 4JJNK 1VQLQ 1NPRA 2FRYA 3BW1A 2YRVA 3OBWA 1YITA 1BB9A 4GBQA 4ZTFA 1SRMA 3H6ZA 2HNIA 5ECAA 4WTOB 2CZ0B 4XTWA 5GMKe 1WYXA 4PLIA 3LGFA 3RUXA 1YJWT 2BE9B 4RKUE 2EBPA 3OS2A 5FW9A 3BDLA 2EKOA 3L2VA 1ZSZB 1VQ5Q 3OW2P 2JW4A 3CCRA 3CPFA 1PSFA 1VQ7T 3LYIA 2JTFA 1BYMA 1M3AA 4Z88A 2XIDA 3OYFA 3OYIA 4LDXA 1OQKA 1T3LA 3CBMA 1PRMC 1PHTA 1QWFA 1K8AU 1E6HA 2R58A 1Q86C 2GCXA 2K7AA 4M7AB 4F7UF 4LDVA 2K5IA 4M7DF 2EGEA 1GCQC 1YIJQ 2DXTA 2RB6A 5FU6B 3PIOA 3CD6T 1MV0B 3GF5A 2DETA 3QDRB 3VUZA 1OOTA 2AT1B 1KQ1A 1WQWA 5GMKh 4E6RA 3CCEA 4KBMB 1AWOA 4PJOG 1VQPQ 4F7UB 2QK0A 1VQKQ 4D8KA 1VQ7A 1MGQA 5HK0A 1Y96B 1H3ZA 2VUBA 2RI2A 3SD4A 4E7HA 3C12A 2LT1A 2QEXT 3E2UA 4M7DC 2AZSA 2BZYA 2DLPA 1G8XA 1VQOA 1WHGA 1YCYA 3VUBA 4C5EA 1TUCA 5GAMj 2EYQA 3CD6A 3MEVA 4NS5A 3QWYA 1UGQB 2K6DA 2HDAA 1VQLT 5CKFA 2YWWA 3P8BB 3EFOA 2DM1A 1NEGA 2RQTA 4OMLA 1Q81R 3V7RA 2EQUA 1NBEB 2RQUA 5GAN6 1H92A 2HBPA 1G3YA 1SHFA 2L5QA 3HP9A 3MEWA 1XNIA 2P0PA 1E6GA 3VS1A 1RABB 2EFIA 1ZA2B 4M7AE 4QVDA 1VQNA 1OEBA 4AG1C 4FYYB 1I8FA 5CKBA 2G6FX 2CSQA 3BDUA 2D0QB 3R6NA 4EIKA 3ULRB 1FX7A 3SWNB 2O4XA 2HQHA 3M59A 2O31A 4J6WA 4FCYA 3EH1A 2RHXA 3CC4Q 3I5SA 4F7UE 5CKDA 2E4HA 3VYHB 1ZLMA 2VGMA 4XTVA 4OB1B 2L3PA 1WJSA 4J9DA 4F14A 3CC2Q 2CP6A 2VXEA 1KK7A 3G6EQ 1WA7A 1YN8A 1W2BS 1YIJT 3U23A 3TSWA 1Q81C 4QQ6A 2FO0A 2ZPBB 2JT4A 3QZ5B 2YLBA 4XU1A 2OX7A 1BI3A 2DL4A 2K4YA 5LJ3j 4J6XA 1OPKA 3A1PA 1VQPT 1VUBA 1VQKT 3JCMP 2VKNA 1BI1A 1JJ2S 1D09B 2O9VA 1M27C 4OB3B 1X43A 5AT1B 1IZ6A 2CH4W 1QKXA 1AZGB 3CCSQ 1LOJA 4HVWA 1CKAA 3OYLA 2KSSA 2HCKA 2F5TX 1YIJA 4P5NA 1BU1A 1T3SA 3I35A 2QA4Q 3OW2A 4J8OA 3JCMQ 2EYZA 1EX4A 2ESWA 3TVTA 2XU8A 3H0FA 3MEUA 2RHYA 3CCQQ 5KYNA 1VQKA 3I56A 1JO8A 1QKWA 2CDTA 1CKBA 1H3HA 4E7KA 2HAXA 3PTAA 3WVDB 1MMNA 3M0SA 5LJ5j 1VQ6Q 4M7DD 4AFZC 1JQQA 3JCMd 4WCIA 2M0YA 2Y90A 5GJVB 3OQ5A 3E9FA 3MP8A 1T0JA 1QWEA 2X51A 1J3TA 2JJ9A 2DIGA 1GFCA 3LLRA 1VIFA 1WXUA 4MMKA 3RERA 3NFCA 1U8RA 5EC7A 5D6YA 2PZ1A 3CC4T 2M16A 3VYGA 4C5IA 1TOVA 3FC3A 4X9DA 4JRPA 4RTUA 2LC4A 4AFUC 5I11A 1UHFA 3CXCP 4A53A 4QKUA 3G6ET 3VS6A 3MO8A 3KBGA 2LNVA 4Z8AA 5CR2A 2KE9A 4D8DA 1IGQA 4M77G 1K0XA 2MF2A 1S72Q 2JTMA 3QPHA 4ELZC 4FSXA 4C8QG 2L89A 3KFVA 5J26A 2HSPA 3ZL7C 4R56A 2MPXC 4CC7A 2KYBA 2RK2A 3LX7A 2XK0A 2RJDA 4L5GA 2MI6A 4VUBA 2WSEE 2RH2A 3G4SQ 3EFOB 2L3RA 3CCST 1MMAA 3QJ6A 2YUPA 2RA2A 3G6EA 2GFUA 3PMIA 4ANJA 2KT1A 3OSVA 3C4SA 4M78C 2PQWA 5DLOA 2A36A 4FSSA 2QA4T 1KIKA 4XTZA 1T0HA 2KYMA 2OAWA 2X3XD 4KRTA 3M4YA 1GCPA 4J9BA 2AIRB 5I2MA 3CCQT 4ESRA 1YHQQ 5IH2A 2O4XB 1H8KA 2Z0WA 1VQ6T 3CPWS 1KSWA 2KMTA 2JOYA 2CZ7B 3HSBA 4QVCA 3JCMJ 2EYYA 2DEUA 2KRNA 4J9FA 2MIOA 3RMQA 3OYCA 1NEBA 2JN0A 1PD1A 1VQ4Q 3T9NA 4PFOA 5LJ3h 5KCOA 4ZNXA 2E12A 1VA7A 1PC0A 1ZSGA 2CUDA 1N27A 1OV3A 4A4GA 5LJ3g 3AT1B 2DRMA 2BZ8A 1V76A 1MNDA 2DZ9A 1ZHIA 5IAYA 1TS9A 3JB9I 1NYFA 1O75A 1IHVA 2Y4XA 2MOXA 4JS4A 1AEYA 2BZXA 1X75C 3EG0A 2OTLQ 3FB9A 3V8JA 1M3BA 3FJ5A 1GCQA 1WI7A 2A7YA 4OMPA 5J3BA 2W0ZA 1IB8A 3VS5A 1M9SA 2FVUA 3AHUA 3JCMV 2PTKA 4ORZA 5LJ3f 1WFWA 1YJNQ 2CP5A 1R0BG 3G71Q 3CCUQ 4C0FA 4RTXA 1BI0A 3X28B 4B9XA 2CP0A 3VS4A 1TU0B 3G4ST 3VKIA 1G3WA 5LJ5h 4AFQC 3DB3A 5GMKj 1LVKA 4M7DA 3H41A 2ZPFB 1M1GA 2AK5A 5LJ5g 1QQJA 4XU0A 2QG9B 2JMCA 1MMGA 2KGTA 1QW1A 3EH2A 2E70A 1M2VA 1RI9A 3OYAA 1WLPB 1U1SA 1YCSB 1VQ9A 1YHQT 1KQ2A 4IKFA 3HFOA 1EFNA 1TWBA 2C0IA 1X6GA 2FZCB 4X34A 2EQIA 1RL2A 3CXCA 3G1JA 3OYHA 3EGXA 2LRQA 4A63B 1F1BB 5LJ5f 1K73U 5KCHA 1NE8A 1JXMA 5FWBA 2JXBA 1VQ4T 2RQWA 2D8JA 4QQDA 3META 1AOJA 2XHCA 5GANd 3JCMb 1K8AR 2QQRA 8ATCB 2DYIA 2LQNA 3MP6A 4GLKA 1KD1U 3L42A 2QQBA 1ZUUA 4R55A 4ELYC 2YUOA 2ATCB 8AT1B 5GMKi 1D0ZA 4LD9K 2YUNA 3OMCA 1N9RA 4N4GA 2EJFA 2OTJA 1WHHA 3E9GA 1Q7YU 3EAEA 3UA6A 9ATCB 1W2BP 3JB9J 3OS1A 1LPLA 3EGDA 3V7CA 2DL5A 3RKYA 1VQ4A 4KUIA 1KG1A 4J7IA 1LNXA 3G71T 3CCUT 3JCMe 2RHUA 5CKHA 3OYBA 1G3TA 4PJJA 5IT9E 3GLXA 2DNUA 4IUQA 2EYXA 5GAMd 2RHIA 4FW1A 2DX1A 4FT2A 1JJ2P 2H8HA 1BCOA 3M53A 1W4SA 3HTRA 1K8AC 1G5VA 1U1TA 2V26A 4KH1B 3M0RA 2NUTA 1D3BA 4ZGDB 2DPPB 1OZ3A 1W70A 2ENMA 4AG2C 3JAME 4DQ2A 1WIEA 1EIFA 3G71A 4FM4B 2EWNA 2LX7A 2DTOA 1LJOA 3JSCA 4A54A 4KUDK 3MP1A 1VQMQ 4LDYA 4WF2A 2GFAA 1N9SA 2I0NA 1XQHA 5DLQE 2P0KA 4ATOA 5L8RE 5GAN8 4JJDA 2BKDN 2CP3A 1M5Q1 1AD5A 3QYGB 2HL5C 4X1VA 2L3SA 5IXFA 4C5GA 2CKKA 3CCJQ 4E7ZA 2RM4A 2NUZA 1SRLA 2YDLA 1D1BA 2LTOA 2DIQA 3X26B 3C94A 2LT4A 4MDWA 2VXFA 2DA9A 3ZFJA 2YSQA 4Q5WA 4J83A 4HA8A 1YJWA 2CT4A 3L2RA 3UDCA 2D8HA 2CP2A 1HK9A 2HD0A 4OMQA 3REAB 2VASA 2YHTA 5FRMA 1Y0MA 1P92A 2XDBA 2JVVA 2NWMA 2RPNA 2XD0A 4M7DB 3S3NA 2E3IA 1KC8R 4BD3A 2PVOB 4NL2A 3F70A 3RBBB 1MHNA 3KUFA 4BDZA 2VWFA 1HJDA 4HCZA 4II1A 1M2VB 3MPUB 2QI2A 5GAOq 1SPKA 4C92F 2KNBB 2YRDA 4OGEA 3CBPA 3A8LB 3SEMA 2LZ6B 1TUGB 2C0TA 3PMTA 4FYWB 3GNGA 1U5SA 3EGXB 3C95A 4M78A 4L59A 1AWXA 3QHSA 4PL6A 2FYKA 3UF4A 1RAGB 1YFNA 4BY6B 1NG2A 2A08A 2P84A 3FEOA 1BIBA 2IPOB 2KAFA 3QUIA 2O01E 4C92C 1VQMT 4MZTA 4BY6C 2QEXA 3TEEA 1QVGS 1KC8C 4C8QC 4XU3A 4LUDA 4QW2A 1WX6A 4BUGA 2QTXA 1VQ5T 3CPWP 2DL8A 5M9OA 1G3SA 3LWIA 2ZGWA 1KFZA 2B86A 1Q82U 3P8HA 1W2BA 2A0FB 2RK1A 4XAXB 2EPDA 3H8ZA 3EG2A 3CEYA 3JB9F 1VQLA 4ZN1A 1OU9A 4M7DE 2LJ0A 3INZA 3CCJT 1ACMB 2EJ9A 4M4ZA 1JEGA 1ZBJA 2RQRA 3OYKA 1QLYA 2EJGA 3MHXA 2MMPA 1JJ2A 3FJPA 4C0DC 3NMZC 2FZKB 3PT9A 4J5YA 4OMFB 3BFMA 3L1AA 2ROTA 2ED0A 1M8MA 1VYVA 1VQ5A 5I22A 2EQMA 3X25B 3CC7Q 3M54A 3NPFA 1SKUB 1RAHB 3ZEHA 4AT1B 2NUTB 1D3BB 2J6OA 1KC8U 2HZYA 2Y4YA 1X6OA 2HMAA 5KYXA 3I55Q 1UFFA 1NLOC 3EFSA 3L2UA 2F69A 4M75F 1V29B 2QQ9A 2LQ8A 5GANe 2X4YA 3M0QA 1R77A 5A0GA 3UT1A 2XICA 1X01A 3WXMB 1C6VX 1PG5B 1ABQA 1A0NB 2C0OA 3H9NA 1AHJB 1OPLA 1VQPA 1QVFS 1GL5A 1IXDA 3QZ9B 3OS0A 2CGHA
chains in the Genus database with same CATH topology
3SWNA 5LJ3h 4XTYA 5KCOA 3L2QA 3CCVA 2QQSA 5GAOn 2E12A 2DXBA 2WACA 2ZPIB 4M77B 4N0AC 4UC4A 2CZ1B 2I2LA 2LDMA 1N27A 1VQNT 5CVIA 3QYHB 4A4GA 1JBMA 4M75C 5LJ3g 3CCMT 1QVGA 3M58A 4M7AG 1M8VA 5HK3A 2D9TA 5LJ5d 4C92B 1UGRB 2DZ9A 1ZHIA 3RMSA 5IAYA 1O9SA 1WJQA 4M77C 4PJOA 3X20B 3TREA 4C8QB 4E7LA 1Q82U 1H641 3JB9I 3DKMA 1O75A 2Y4XA 2K5FA 4JS4A 4JDSA 1ZBXA 2G3RA 1QP2A 4J6YA 1I5LA 2WSFE 5FRNA 1X75C 3V7SA 2DK3A 3FB9A 3V8JA 1M90U 3RKWA 4JUVA 2P0QA 4HCCA 3QSUA 4C0GA 2A7YA 2E64A 4IUUA 3UWNA 2MWPA 4F7UG 3CC2T 1Q86U 5A0DA 1GXIE 5J3BA 2H3JA 3OYDA 2V8KA 2PVGB 2X4WA 1M9SA 2FVUA 2QQAA 3P8DA 3QO3A 4XK8E 3JCMV 5HKCA 5GAN4 5GAOp 3AHUA 1NPPA 5LJ3f 4C92D 4HT9A 4EDUA 3ER0A 3J7AF 3FDRA 4BI4A 3HRUA 3O8VA 4C0FA 4C8QD 3PNWC 2PUKB 2P4TA 4BI3A 1HXDA 4JS5A 1QVPA 2KY9A 3NTKA 3CCMA 4RMOA 1BI0A 4JJNK 4M78F 3X28B 4B9XA 3G4ST 4E47A 1NPRA 3VKIA 1G3WA 4C0DB 2B8AA 4XTUA 4A4KA 4OB0B 5LJ5h 3CC7T 3A8MB 3BW1A 2YRVA 3OBWA 3DB3A 4XU2A 1YITA 4DOWA 2RI3A 4JLIA 4ZTFA 2QXFA 3H6ZA 5GMKj 2HNIA 5D6XA 4J7FA 4M7DA 2CZ0B 2GQVA 2MWOA 2ZPFB 1M1GA 2MAMA 4O5VA 4PLIA 4XTWA 5GMKe 5LJ5g 3GOXA 3CC4A 4XU0A 1VQMA 2DXUA 2VV5A 2R5AA 5DY9A 4EMKC 2KK4A 3LGFA 2VYTA 4BI8B 2DD4A 3RUXA 3HL8A 4M78B 5C6SA 1YJWT 1Y71A 4RKUE 1QW1A 3CC2A 3PFSA 2RD1A 2E70A 3SWNC 3OS2A 2EIFA 2FHDA 2PVDB 3OYAA 3BDLA 2EKOA 3L2VA 1U1SA 1VQ9A 5CAIA 4LDUA 1YHQT 1KQ2A 4M77E 4IKFA 1B34A 3PGGA 1BIAA 2E6ZA 4BE0A 3HFOA 2ZZDA 3CPFA 3CCRA 1PSFA 3GNFB 2A3LA 1IREB 1VQ7T 3LW5E 1WNLA 3LYIA 2JTFA 4X34A 3WVEB 1BYMA 3L2WA 3M55A 2XIDA 1RL2A 1NZ9A 4C92E 1UB4A 1OYXA 3OYFA 3OYIA 2WSCE 3CXCA 3CPWA 4LDXA 3OYHA 1N6AA 2LRQA 1XTDA 4C8QE 3CCJA 3CBMA 4PLLA 3JB9D 1K9MC 2V8JA 5LJ5f 1K73U 5KCHA 1K8AU 5GMKm 2R58A 1NE8A 2DTIA 3SFMA 5KE3A 1Q86C 1QVFA 2GCXA 4M7AB 4F7UF 4LDVA 3RKXA 5CKEA 5FROA 3I56T 5KH6A 3EFRA 2K57A 1FWZA 3A8HB 2K5IA 2M0OA 4FL6A 1VQ4T 1NJIU 2OAUA 4M7DF 4QQDA 4YTLA 2CZ6B 2PUOB 3META 2DXTA 2RB6A 5FU6B 2NLUA 3PIOA 2XHCA 2XDDA 3GF5A 5GANd 1N8RU 3CD6T 2E41A 2E10A 3QDRB 3JCMb 2QQRA 3VUZA 2E5QA 1KQ1A 1WQWA 4JRQA 5GMKh 2F5KA 3MP6A 4GLKA 3CCSA 1KD1U 3CCEA 4KBMB 3E19A 3L42A 4JRIA 4PJOG 2QQBA 4N4HA 4R55A 4Y28E 4F7UB 4NOYA 3HKSA 4ELYC 4BE2A 3S6WA 3S3OA 1VQ7A 4M75B 1MGQA 5HK0A 5GMKi 3OYEA 3QKJA 4GY5A 4LD9K 1Y96B 4Z02A 4O6JA 4M7AD 1H3ZA 3OMCA 2VUBA 2QA4A 1N9RA 2RI2A 2EJFA 4N4GA 4A4HA 2OTJA 3SD4A 3E9GA 4E7HA 3C12A 3A8GB 3X24B 1Q7YU 2LT1A 3EAEA 2QEXT 3OA6A 4M7DC 3CCQA 3OS1A 3JB9J 3V7CA 1RI0A 1VQOA 3J80E 2K2VA 3DLMA 2ZPGB 2M1HA 2GF7A 1OI1A 3RKYA 1VQ4A 1YCYA 3VUBA 4C5EA 2K5LA 4KUIA 4M78E 5GAMj 1KG1A 5CQYA 4J7IA 5CCAA 1Q81U 1LNXA 2EYQA 3G71T 3JCMe 3CCUT 3KXTA 2RHUA 4M75D 5GAMe 2IG0A 1VQ6A 1TH7A 4KULA 2XG8D 3CD6A 3MEVA 5CKHA 3OW2S 4EPCA 5GAN7 2KDSA 4NS5A 1G3TA 3OYBA 5GANh 1UGQB 2DTHA 5IT9E 3GLXA 4IUQA 3SB2A 1WPYA 3QXEB 5GAMd 3DLLA 1S72T 2RHIA 1K9MU 1XOVA 5CKFA 1VQLT 4HT8A 4M77D 2DXCA 4FT2A 3P8BB 4L6V5 5IN1A 1PSEA 1UGSB 1YJ9T 3R6OA 3HRSA 4E7JA 3M53A 3J81E 1K73C 1W4SA 5GANg 4M7DG 3V7RA 1K8AC 2EQUA 5GAN6 3JRZA 1G5VA 1U1TA 2R57A 3GP8A 2HBPA 1G3YA 3HPWA 2L5QA 4V2SA 3HP9A 3MEWA 1XNIA 1NJIC 2YLCA 3OBYA 2D6FA 2P0PA 3NTIA 2EFIA 4M7AE 1YBYA 4QVDA 1N8RC 1D3BA 2LCCA 1VQNA 3JB9H 2V8IA 4ZGDB 5CQXA 2DPPB 4BB7A 1OZ3A 5CO7A 5A0LA 1I8FA 4A4EA 2RJFA 5CKBA 3MCAB 1KD1C 4Y91A 4EMKB 4ZGJB 3JAME 3BDUA 4DQ2A 3CMET 2D0QB 4PJOF 5D6WA 3S3MA 4MMLA 1FX7A 1EIFA 3OB9A 3SWNB 5CK9A 1ZQ1A 2O4XA 3G71A 3M59A 4FM4B 2EWNA 4CI0C 2L8DA 4J6WA 4BACA 1YI2T 2E1HA 2DTOA 3URGA 2FL7A 1LJOA 2AHJB 2RHXA 2DD5A 3JSCA 3JCMc 1WQ7A 3QG1A 4A54A 3MP1A 5GANf 4F7UE 5GMKl 3CCLT 4LDYA 4WF2A 5CKDA 3FRNA 3VYHB 2DZCA 2GFAA 2RJEA 3M5AA 4M75E 4DOVA 3PIPA 1S72A 3CMAT 4C92G 3OYJA 2VGMA 1N9SA 3LGLA 4XTVA 4OB1B 5GAMh 1Q7YC 1XQHA 3SDZA 1WJSA 2DO3A 4IUTA 3OYNA 3I55T 5DLQE 2VXEA 4NL3A 2P0KA 4KT0E 2X4JA 1FXXA 3L2ZA 1BKBA 4IURA 4PJOB 4ATOA 4MZMA 5L8RE 5GAMg 5GAN8 1W2BS 2JZ2A 1UEBA 1YIJT 2BKDN 1M5Q1 4ZGEB 1Q81C 4QQ6A 3LWHA 2ZPBB 3QYGB 4M77A 4N4IA 3QZ5B 2YLBA 3G4SA 4PJOC 4XU1A 2K3YA 1BI3A 2CKKA 1JB0E 2K4YA 2LVMA 4TVRA 4C5GA 5LJ3j 1M1KU 4J6XA 2RM4A 4HCBA 3CC7A 5LJ3e 3HHTB 4M78D 1OZ2A 2LTOA 1VQPT 1VUBA 2DIQA 2KQWA 4C92A 1VQKT 3JCMP 4RG2A 3X26B 3C94A 1I4K1 2EQKA 2LT4A 4MDWA 4C0ZA 1BI1A 2VXFA 5FU7C 3V8LA 4C8QA 2IVWA 1JJ2S 4OB3B 1YI2A 1KQSS 3ZFJA 2CS7A 2PU9B 4Q5WA 5GAOm 4PKCC 1IZ6A 5CIUA 1WGSA 2RJCA 1VQ8T 4J83A 4HA8A 4LDWA 4JLGA 1YJWA 5GAMf 3L2RA 3UDCA 5DM7R 4XTXA 1HK9A 2DKGA 2HD0A 3I55A 4XQ3A 1LOJA 4MDXA 3M4GA 2YHTA 3OYLA 2QDYB 1YHQA 5FRMA 2XDPA 2KSSA 1P92A 3DB4A 2XDBA 2JVVA 2E65A 2F5TX 3V8KA 2XD0A 1YIJA 4M7DB 3S3NA 4P5NA 3JB9G 4BD3A 2PVOB 2DJZA 4NL2A 3OYMA 2OTLT 3F70A 2K3XA 3OW2A 1MHNA 3KUFA 4J8OA 4X9CA 3CBOA 3RESA 4CRIA 3JCMQ 4BDZA 4EMGA 4HCZA 2XU8A 4II1A 3MEUA 3MEAA 2RHYA 3HFNA 2QI2A 5GAOq 4DA4A 4KUDK 1BI2A 1KHIA 3ZBDA 4C92F 1VQKA 1B34B 2HQXA 3I56A 4OGEA 3A5ZB 3M56A 3CBPA 1Y07A 1YJNT 4E7KA 2HAXA 3PTAA 3A8LB 3GIBA 4A4FA 3WVDB 3HRTA 3PMTA 4RCBA 5LJ5j 5GAN2 4QQGA 1VQ8A 4M7DD 3GNGA 4RG8A 5LJ5e 4PJOE 3JCMd 2JUFA 3QIIA 2Y90A 3C95A 4M78A 4L59A 3OQ5A 3QHSA 4JRKA 2DVEA 3E9FA 3MP8A 4PL6A 4D6WA 2FYKA 3Q1JA 1M1KC 5EG2A 4BY6B 2KVQG 2DIGA 1YITT 1VIFA 2LX9A 2E6NA 3LLRA 1VIEA 3OS5A 3FEOA 4MMKA 3A8OB 1BIBA 3NFCA 1Y7XA 1U8RA 3RERA 2KAFA 2LQKA 5D6YA 3QUIA 3QJYA 2OTLA 3CC4T 2O01E 2HQEA 1WJRA 4C92C 2M16A 1VQMT 3VYGA 4C5IA 5GAN3 4MZTA 3OY9A 2ZPEB 4BY6C 4ZN3A 2QEXA 3TEEA 1QVGS 1UGPB 4C5HA 2XI9A 1KC8C 4C8QC 3FC3A 4XU3A 4QW2A 4X9DA 2RO0A 4JRPA 4BUGA 1VQ5T 2LC4A 2QTXA 4M75G 5FLXE 1VQ9T 4A53A 5M9OA 1G3SA 3LWIA 4IUPA 4M7AA 3G6ET 2ZGWA 1YJNA 3CCRT 3MO8A 3KBGA 1KHCA 2LNVA 3OMGA 3P8HA 3VU3C 5CR2A 3CCUA 3TU4K 3N5BB 4M77G 1W2BA 2RK1A 5A2QE 1DJ7B 4XAXB 3BY7A 2EQJA 3H8ZA 4OGCA 4OP0A 3CEYA 3JCMX 3JB9F 2X35A 1VQLA 2MF2A 2BIVA 4ZN1A 5I21A 3JCMh 4B9WA 4IUVA 2JTMA 4M7DE 2XKOC 3INZA 3FIFA 3CCJT 3LH0A 1YJ9A 2EJ9A 3QPHA 4LD6A 3VJPA 4ELZC 5HY6A 1M1FA 4FSXA 3ASKA 4C8QG 4N0AA 4ME7A 3OYKA 5GAOl 2L89A 4F7UA 3M57A 2EJGA 3MHXA 5J26A 3JCMg 4R56A 2DAQA 2VGNA 4M75A 3ME9A 2RK2A 2LCLA 3LX7A 2MMPA 1JJ2A 1Y96A 3FJPA 1M4ZA 4C0DC 2XK0A 1KQSA 2ZCFB 2RJDA 3PT9A 4L5GA 4OVAA 3TCJA 4J5YA 2MI6A 4FU6A 5FU7B 4OMFB 4VUBA 3VV0A 3BFMA 4E7IA 2CYZB 3L1AA 2RH2A 2RI5A 2DEQA 2WSEE 2BUDA 2L3RA 5I2SA 3CCST 1VQ5A 3CCET 1SSFA 2EQMA 3X25B 3QJ6A 3M54A 4ZTJA 4EMHA 4M7AF 2RA2A 3E1SA 3G6EA 2GFUA 4RCCA 3PMIA 1QP3A 3OSSC 5LJ3d 4OB2B 3OSVA 3C4SA 4M78C 2PQWA 5DLOA 4PJOD 3ZEHA 3CCVT 5LL6S 2QA4T 2X4XA 3CCLA 2FB7A 3M9QA 3CMEA 1D3BB 3JCMW 2OTJT 4XTZA 3JCMf 2C06A 5J39A 2JNGA 3CMAA 1KC8U 4OF1A 3QBYA 2Y4YA 1M90C 1X6OA 3M4YA 4MZPA 3RIRA 3UPUA 1I81A 2R5MA 3OYYA 5I2MA 3CCQT 2EAYA 3OYGA 4FT4A 5C0MA 1VQOT 3EFSA 2M9UA 5GANj 3NTHA 3L2UA 2F69A 4M75F 2O4XB 1V29B 2QQ9A 2LQ8A 2RHZA 5GANe 1JRIA 2X4YA 1Q82C 3CXCS 5A0GA 3UT1A 4FIBA 1R8OB 4M78G 3CPWS 1VQ6T 2XICA 4M77F 1X01A 3WXMB 4M7AC 2KMTA 2JOYA 3GPLA 2CZ7B 2ZPHB 3HSBA 4QVCA 3FLGA 5GAOr 3JCMJ 1AHJB 4BE1A 4HKEA 1VQPA 1QVFS 5GAN5 4EMKA 2VC8A 4BDYA 5AYFA 5FU6C 3RMQA 3OYCA 2JN0A 4QVZA 3G7ZA 4C8QF 5KE2A 3QZ9B 4PNOA 3OS0A 3T9NA 2CGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SWN A;  4M7A B;  4XTY A;  5LJ3 h;  4F7U F;  5GAN 3;  3RER A;  3RKX A;  5GAO n;  3EFR A;  2K57 A;  4M7D F;  2VXE A;  4M77 B;  4N0A C;  4XU3 A;  2I2L A;  4X9D A;  4C8Q C;  4NL3 A;  3L2Z A;  4PJO B;  2QTX A;  2DXT A;  2RB6 A;  4M75 G;  5LJ3 g;  1JBM A;  4M75 C;  5GAM g;  5GAN d;  5GAN 8;  2E41 A;  4A53 A;  2E10 A;  1M5Q 1;  3JCM b;  4M7A A;  4M7A G;  1M8V A;  2ZGW A;  5LJ5 d;  4C92 B;  1KQ1 A;  1WQW A;  2DZ9 A;  3VU3 C;  5GMK h;  5GAM h;  4M77 G;  4M77 A;  4M77 C;  4JRI A;  4PJO G;  2YLB A;  4PJO A;  4C8Q B;  3BY7 A;  4XU1 A;  4PJO C;  1H64 1;  3JB9 I;  4OP0 A;  4F7U B;  5LJ3 j;  4NOY A;  3JCM X;  3JB9 F;  4J6X A;  2RM4 A;  4M75 B;  5I21 A;  1MGQ A;  4J6Y A;  4M78 D;  3JCM h;  5LJ3 e;  1I5L A;  5GMK i;  4C92 A;  3V7S A;  4M7D E;  3INZ A;  1Y96 B;  3FB9 A;  3FIF A;  4M7A D;  2EJ9 A;  3V8J A;  3JCM P;  3RKW A;  1I4K 1;  1N9R A;  4JUV A;  2EJF A;  3QSU A;  4XTV A;  4C8Q G;  4N0A A;  2VXF A;  3V8L A;  4C8Q A;  2E64 A;  5GAO l;  4F7U G;  4F7U A;  2EJG A;  3JCM g;  5GAO m;  4M75 A;  4M7D C;  3JB9 J;  4HA8 A;  1Y96 A;  3QO3 A;  3JCM V;  3FJP A;  5GAM f;  5GAN 4;  5GAO p;  4C92 D;  5LJ3 f;  3AHU A;  3V7C A;  4HT9 A;  4XTX A;  1HK9 A;  2DKG A;  4J5Y A;  1LOJ A;  4XQ3 A;  3M4G A;  3RKY A;  2YHT A;  1YCY A;  4C8Q D;  3BFM A;  3L1A A;  4M78 E;  5GAM j;  2DEQ A;  1HXD A;  1LNX A;  2E65 A;  3JCM e;  4M75 D;  5GAM e;  1TH7 A;  3V8K A;  4M78 F;  4M7D B;  5GAN 7;  4EMH A;  4M7A F;  2RA2 A;  5GAN h;  4RCC A;  2DTH A;  3JB9 G;  3SB2 A;  1WPY A;  4XTU A;  5GAM d;  4HT8 A;  5LJ5 h;  5LJ3 d;  2DJZ A;  4NL2 A;  3BW1 A;  4M77 D;  4XU2 A;  4M78 C;  4PJO D;  3RES A;  4JLI A;  4X9C A;  3JCM Q;  4EMG A;  5GMK j;  2HNI A;  2FB7 A;  5GAN g;  3JCM W;  1D3B B;  3V7R A;  4M7D A;  4M7D G;  3HFN A;  4XTZ A;  3JCM f;  5GAN 6;  5GAO q;  4XTW A;  5GMK e;  1U1T A;  5LJ5 g;  4C92 F;  4XU0 A;  1B34 B;  2DXU A;  4EMK C;  5DY9 A;  4V2S A;  3RIR A;  1I81 A;  2EAY A;  2YLC A;  3RUX A;  4M78 B;  3EFS A;  2RD1 A;  3SWN C;  5GAN j;  4QVD A;  3GIB A;  1D3B A;  3JB9 H;  4M7A E;  4M75 F;  1U1S A;  4RCB A;  5GAN e;  5LJ5 j;  5GAN 2;  5CAI A;  4M7D D;  1I8F A;  1KQ2 A;  4M77 E;  1B34 A;  3PGG A;  1JRI A;  1BIA A;  5LJ5 e;  3HFO A;  3JCM d;  4PJO E;  4Y91 A;  4EMK B;  2Y90 A;  1WNL A;  4M78 G;  4M78 A;  4M77 F;  3BDU A;  1X01 A;  4DQ2 A;  3QHS A;  4JRK A;  2DVE A;  4PJO F;  4M7A C;  2FYK A;  4MML A;  4C92 E;  3SWN B;  3HSB A;  4QVC A;  5GAO r;  3JCM J;  2EWN A;  4J6W A;  2E1H A;  2DTO A;  4MMK A;  1LJO A;  1BIB A;  3JCM c;  4A54 A;  4C8Q E;  4EMK A;  1WQ7 A;  2VC8 A;  5GAN f;  5GAN 5;  4F7U E;  5GMK l;  3JB9 D;  4WF2 A;  5LJ5 f;  3QUI A;  2JN0 A;  2DZC A;  4M75 E;  5GMK m;  4C8Q F;  4C92 G;  2DTI A;  4PNO A;  1N9S A;  4C92 C;  2CGH A; 
#chains in the Genus database with same CATH topology
 4F16 A;  2JM8 A;  5GAO n;  1WHK A;  2CZ1 B;  2I2L A;  2LDM A;  1X69 A;  1RAE B;  4M75 C;  4M7A G;  1M8V A;  5HK3 A;  1UGR B;  1WJQ A;  1QCN A;  4PJO A;  2BE7 D;  3DKM A;  2K5F A;  2G3R A;  3V7S A;  2DK3 A;  2YXY A;  2P0Q A;  2F1L A;  3QSU A;  1WZO A;  4IUU A;  2MWP A;  4F7U G;  2YUQ A;  4FW2 A;  3CC2 T;  2DL3 A;  2V8K A;  1B07 A;  2PVG B;  3P8D A;  2QQA A;  5GAO p;  4HT9 A;  4C92 D;  3ER0 A;  2A37 A;  3FDR A;  4C8Q D;  3PNW C;  1ARK A;  1B3Q A;  1AVZ C;  2QAZ A;  4BI3 A;  1HXD A;  4KH0 B;  1QVP A;  2SRC A;  4M78 F;  4FYV B;  1M30 A;  7AT1 B;  1YJ9 Q;  2J6F A;  2B8A A;  4A4K A;  3CC7 T;  4JJC A;  1K76 A;  4DOW A;  1WHM A;  2QXF A;  1GBR A;  1M2O A;  2MAM A;  3CC4 A;  2DXU A;  2VV5 A;  4EMK C;  5DY9 A;  2DD4 A;  2VVK A;  1PKS A;  2CSI A;  3HL8 A;  1Y57 A;  4M78 B;  1Y71 A;  3CC2 A;  2RD1 A;  3BE3 A;  5CAI A;  4LDU A;  1B34 A;  3PGG A;  1BIA A;  4BE0 A;  3GNF B;  3LW5 E;  1WNL A;  1SEM A;  3L2W A;  1YI2 Q;  1NZ9 A;  1ZX6 A;  1RLP C;  2WSC E;  2DJQ A;  3CPW A;  3CCL Q;  1E7O A;  3CME Q;  2AZV A;  2FPF A;  3CMA Q;  3JB9 D;  2COZ A;  2DYB A;  2DF6 A;  3UA7 A;  2DTI A;  3SFM A;  5KE3 A;  5FRO A;  3RKX A;  5CKE A;  4R0K A;  5KH6 A;  2K57 A;  1FWZ A;  2M0O A;  4FL6 A;  1NJI U;  2CZ6 B;  2JM9 A;  2PUO B;  1N8R U;  2XDD A;  2E10 A;  1K73 R;  2QGG A;  2DIL A;  2FG0 A;  2F5K A;  3CCS A;  1OX9 A;  1RLQ C;  1HSQ A;  1I07 A;  3HKS A;  5IHN A;  1PRL C;  3NHN A;  3QKJ A;  1OX8 A;  1QMC A;  4Z02 A;  2FEI A;  4O6J A;  5FWC A;  2QA4 A;  3RNJ A;  1GRI A;  1KD1 R;  2DER A;  2KXD A;  3A8G B;  3X24 B;  2YRC A;  1PWT A;  3CCQ A;  2D1X A;  3SHW A;  2K2V A;  3DLM A;  2ZPG B;  2M1H A;  2GF7 A;  1HD3 A;  6AT1 B;  1YWO A;  1YNZ A;  1TG0 A;  4M78 E;  5CCA A;  1Q7Y R;  3KXT A;  4M75 D;  1VQ6 A;  2IG0 A;  1TH7 A;  4KUL A;  4DEY A;  4EPC A;  5GAN 7;  1RAA B;  2DTH A;  3QXE B;  2J6K A;  1S72 T;  4HT8 A;  1XOV A;  5KYX B;  5IN1 A;  1PSE A;  1UGS B;  1YJ9 T;  3R6O A;  4E7J A;  1JU5 C;  1UG1 A;  1UJ0 A;  3J81 E;  1UEC A;  1K73 C;  2KRO A;  3HPW A;  2YLC A;  3OBY A;  2GBQ A;  1FYN A;  2HEQ A;  4RTW A;  3JB9 H;  1SHG A;  1PKT A;  5CO7 A;  5A0L A;  5KYY A;  4IIO A;  3GBQ A;  4A4E A;  2RJF A;  1KD1 C;  4LE9 A;  2QYZ A;  1YIT Q;  4PJO F;  5D6W A;  4J9E A;  4MML A;  3OB9 A;  2VB6 A;  4CI0 C;  2QTV A;  4BAC A;  1YI2 T;  2FL7 A;  4HCB A;  2DD5 A;  1WQ7 A;  3QG1 A;  5IHI A;  3CCL T;  2H3E B;  5GMK l;  3REB B;  3CME T;  3FRN A;  1S72 A;  2DZC A;  2RJE A;  2CT3 A;  3CMA T;  3OYJ A;  2LMJ A;  1Q7Y C;  1W6X A;  3SDZ A;  2DO3 A;  4IUT A;  4HVU A;  3H0I A;  4NL3 A;  4KT0 E;  2X4J A;  3L2Z A;  4PJO B;  1BKB A;  4IUR A;  4MZM A;  3CCR Q;  1SF9 A;  2KRM A;  3LWH A;  4M77 A;  4N4I A;  1XJW B;  3G4S A;  4PJO C;  2K3Y A;  1GFD A;  4TVR A;  1M1K U;  1JB0 E;  2LVM A;  1AT1 B;  3HHT B;  4M78 D;  1OZ2 A;  2COW A;  4C92 A;  4C0Z A;  5FU7 C;  4C8Q A;  1QVG P;  1YI2 A;  1KQS S;  2CS7 A;  1LCK A;  5CIU A;  1WGS A;  2RJC A;  4LDW A;  4JLG A;  2DKG A;  2K2M A;  4MDX A;  3CCE Q;  1YHQ A;  1ZUY A;  2XDP A;  3DB4 A;  2E65 A;  1YWP A;  3V8K A;  1VQ7 Q;  3IQL A;  3CCV Q;  3OYM A;  2OTL T;  2K3X A;  2L0A A;  4CRI A;  2ED1 A;  3MEA A;  2ECZ A;  1PD0 A;  4DA4 A;  1TSF A;  2J05 A;  1BI2 A;  1KHI A;  2KT8 A;  1B34 B;  2HQX A;  1PNJ A;  1VQO Q;  3M56 A;  1UHC A;  1OU8 A;  2X3W D;  1Y07 A;  1YJN T;  4A4F A;  2E3H A;  4F04 B;  2CH4 A;  4RG8 A;  4PJO E;  1U06 A;  2ABL A;  3QII A;  2F2W A;  1OUL A;  4JRK A;  5IXB A;  1IRX A;  2KVQ G;  1YIT T;  2E6N A;  1VIE A;  3OS5 A;  1NM7 A;  4KGX B;  3QJY A;  2OTL A;  2HQE A;  1WJR A;  5GAN 3;  3EHR A;  2ZPE B;  1VQN Q;  4C5H A;  2XI9 A;  4K11 A;  2RO0 A;  1WXB A;  1MNE A;  1MMD A;  4IUP A;  1YJN A;  3CCR T;  1KHC A;  3VU3 C;  3TU4 K;  4LXC A;  3CCU A;  1UJY A;  1M90 R;  5HCK A;  3BY7 A;  2EQJ A;  2FRW A;  4OGC A;  4OP0 A;  1QVF P;  3JCM X;  2X35 A;  5KYU A;  3JCM h;  4IUV A;  2XKO C;  2DMO A;  3VJP A;  5KYW A;  2EVR A;  1Q82 R;  5GAO l;  1D1C A;  3M57 A;  3JCM g;  2HBW A;  2DAQ A;  2RQV A;  3EG1 A;  4M75 A;  2FPE A;  3ME9 A;  1U3O A;  2LJ3 A;  4OVA A;  4FU6 A;  3VV0 A;  4E7I A;  1C1A A;  2BUD A;  1KJW A;  2F2V A;  3PVQ A;  3CCE T;  2CRE A;  2HL3 A;  4ZTJ A;  4M7A F;  3E1S A;  4RCC A;  1QP3 A;  2OI3 A;  5LJ3 d;  2LQW A;  1IGU A;  4PJO D;  3CCV T;  4JZ3 A;  1UE9 A;  4GLM A;  2X4X A;  2ZAE A;  3M9Q A;  1ZSZ C;  3JCM W;  4F17 A;  3JCM f;  2O88 A;  2C06 A;  2JNG A;  4OF1 A;  5KYY B;  1M90 C;  3RIR A;  3UPU A;  1I81 A;  2R5M A;  3OYY A;  1M3C A;  2E5K A;  4FT4 A;  1VQO T;  5GAN j;  2RNA A;  3NTH A;  2QAS A;  4E2F B;  4RTY A;  1Q82 C;  3QWX X;  1R8O B;  2J06 A;  4M77 F;  2XMF A;  4M7A C;  3M0P A;  2ZPH B;  3FLG A;  4QT7 A;  1K4U S;  1BK2 A;  5GAN 5;  4DBQ A;  4EMK A;  2VC8 A;  4BDY A;  2O2O A;  5FU6 C;  2DBM A;  3I56 Q;  4QVZ A;  3G7Z A;  4C8Q F;  4PNO A;  4XTY A;  3CCV A;  2A28 A;  2QQS A;  2WAC A;  2DXB A;  2ZPI B;  3QDF A;  4M77 B;  4N0A C;  4UC4 A;  1TUD A;  1VQN T;  3QYH B;  2P4R A;  1QVG A;  3M58 A;  5LJ5 d;  4C92 B;  1Q95 G;  3RMS A;  2KXC A;  1O9S A;  4M77 C;  2GTJ A;  4C8Q B;  2J7I A;  4E7L A;  1H64 1;  4JDS A;  1BBZ A;  1QP2 A;  4J6Y A;  5FRN A;  2LJ1 A;  1M90 U;  3RKW A;  4C0G A;  1WHJ A;  2E64 A;  3UWN A;  1NYG A;  1Q86 U;  1GXI E;  1VYU A;  2F2X A;  3OYD A;  2X4W A;  3M0T A;  4XK8 E;  1ZUK A;  5GAN 4;  3O5Z A;  1NPP A;  2K3B A;  4IIM A;  2MYS A;  3J7A F;  2L3Q A;  3O8V A;  1D0Y A;  1K9M R;  4JS5 A;  2KY9 A;  4RMO A;  2AKK A;  4E47 A;  4C0D B;  3EGD B;  1QCO A;  1FMV A;  4XTU A;  4OB0 B;  3A8M B;  1C0M A;  4XU2 A;  3CQT A;  2RI3 A;  4JLI A;  5D6X A;  4J7F A;  1UTI A;  2GQV A;  1BCM A;  2MWO A;  4O5V A;  2JMA A;  3GOX A;  1VQM A;  3VRY A;  2R5A A;  2KK4 A;  4BI8 B;  2VYT A;  4AMC A;  5C6S A;  3PFS A;  2V1R A;  4RTV A;  3SWN C;  1YP5 A;  2EIF A;  2FHD A;  2GTO A;  2PVD B;  3VS0 A;  1RAI B;  1MUZ A;  4M77 E;  2E6Z A;  2ZZD A;  2A3L A;  1IRE B;  2KEA A;  3WVE B;  4DBF A;  3M55 A;  1AWW A;  4C92 E;  1UB4 A;  1OYX A;  2MK5 A;  1N6A A;  1XTD A;  4C8Q E;  1G2B A;  3CCJ A;  4PLL A;  1K9M C;  2V8J A;  5GMK m;  1QVF A;  1HYO A;  3I56 T;  3EFR A;  3A8H B;  2X9H A;  2OAU A;  4YTL A;  2DVJ A;  1WXT A;  2NLU A;  4OMN A;  2DFU A;  2D0N A;  2E41 A;  3EGU A;  5KYU B;  3H0H A;  2E5Q A;  4JRQ A;  3RDV A;  2KR3 A;  3E19 A;  5KYW B;  4JRI A;  1RAC B;  4N4H A;  3EG9 A;  1NJI R;  1PCX A;  4Y28 E;  2CP7 A;  4NOY A;  4BE2 A;  3S6W A;  3S3O A;  4M75 B;  1N8R R;  3OYE A;  4GY5 A;  4M7A D;  4JZ4 A;  4A4H A;  1G83 A;  1VQ8 Q;  3I5R A;  2LNH B;  1RI0 A;  4J9C A;  3J80 E;  3UAT A;  4DBR A;  4J9I A;  1OI1 A;  1W1F A;  2K5L A;  4PJM A;  1UDL A;  5CQY A;  1Q81 U;  2L2P A;  3LH5 A;  5GAM e;  2XG8 D;  3OW2 S;  2KDS A;  5GAN h;  2HKQ B;  3SB2 A;  1WPY A;  3DLL A;  1K9M U;  1GBQ A;  4M77 D;  2DXC A;  4L6V 5;  4HVV A;  3JV3 A;  3HRS A;  1KQS P;  5GAN g;  4M7D G;  1VYT A;  2MCN A;  4PJL A;  1FMK A;  3JRZ A;  2R57 A;  3GP8 A;  4PK4 A;  1X2K A;  1NJI C;  2D6F A;  3NTI A;  1YBY A;  1N8R C;  2LCC A;  2V8I A;  1AWJ A;  5CQX A;  4BB7 A;  2EYW A;  3TSZ A;  1N5Z A;  3MCA B;  4Y91 A;  4EMK B;  2FZG B;  4ZGJ B;  3D7S B;  2HKN A;  3S3M A;  5CK9 A;  1ZQ1 A;  1X2Q A;  2L8D A;  2E1H A;  3URG A;  3JCM c;  2AHJ B;  5GAN f;  3OA6 A;  2COY A;  2AKL A;  3M5A A;  4DOV A;  4M75 E;  3PIP A;  3PE0 A;  4C92 G;  3LGL A;  4RTZ A;  5GAM h;  4CC3 A;  4Z89 A;  3OYN A;  3I55 T;  4JJB A;  2DBK A;  1VQ9 Q;  1FXX A;  4KGV B;  5GAM g;  2NUP A;  2JZ2 A;  1UEB A;  2GNC A;  4KGZ B;  3I9Q A;  4ZGE B;  4RTT A;  2RN8 A;  4AFS C;  1ABO A;  4PFZ A;  1JXO A;  2EKH A;  2KI7 A;  3CC7 A;  5LJ3 e;  2KQW A;  1RAF B;  1FMW A;  4RG2 A;  2EW3 A;  1I4K 1;  2EQK A;  2YT6 A;  3V8L A;  2IVW A;  4CC4 B;  2PU9 B;  5GAO m;  4PKC C;  1X27 A;  1M1K R;  4LN2 A;  1VQ8 T;  5GAM f;  5DM7 R;  4XTX A;  1RAD B;  3I55 A;  4XQ3 A;  3M4G A;  2LP5 A;  2GQI A;  2QDY B;  4HXJ A;  4OMO A;  2W10 A;  3EHQ A;  1Z9Z A;  2QDL A;  3JB9 G;  5D7U A;  2DJZ A;  2OTJ Q;  4LNP A;  3VS2 A;  3RES A;  4X9C A;  3CBO A;  4EMG A;  4PJN A;  3HFN A;  3MKD A;  3ZBD A;  4FYX B;  1IO6 A;  2IIM A;  3A5Z B;  3TQ7 P;  1X6B A;  3GIB A;  2GGR A;  3HRT A;  4Y92 A;  4RCB A;  5GAN 2;  4QQG A;  1VQ8 A;  5LJ5 e;  2JUF A;  5GJW B;  2OJ2 A;  2DVE A;  4D6W A;  3Q1J A;  1K9A A;  1M1K C;  5EG2 A;  1ZSZ A;  3VS3 A;  2LX9 A;  2K79 A;  2V1Q A;  3A8O B;  1Y7X A;  1RUW A;  2LQK A;  2DRK A;  3OY9 A;  4ZN3 A;  2CUB A;  1UGV A;  2RF0 A;  1UGP B;  4JPB W;  2PNI A;  3VS7 A;  3CCM Q;  4CC2 A;  3EG9 B;  4M75 G;  1S1N A;  5FLX E;  1VQ9 T;  2O9S A;  4M7A A;  2NYS A;  1WHL A;  3OMG A;  3MJX A;  3N5B B;  3EG3 A;  1K1Z A;  1ZA1 B;  2ROL A;  2HSE B;  5A2Q E;  1DJ7 B;  2BIV A;  5I21 A;  4B9W A;  4DBH A;  3FIF A;  1YJ9 A;  2QGF B;  3LH0 A;  4LD6 A;  5HY6 A;  1M1F A;  3ASK A;  4N0A A;  1I0C A;  4ME7 A;  2KRS A;  4F7U A;  1I5O B;  4E7S A;  2VGN A;  2JS2 A;  2LCL A;  1Y96 A;  2BTT A;  3RR6 A;  4DEX A;  1M4Z A;  1EZZ B;  1KQS A;  2SEM A;  2ZCF B;  3TCJ A;  1MV3 A;  5FU7 B;  2CYZ B;  3VRZ A;  2RI5 A;  2DEQ A;  5I2S A;  4PFP A;  1I1J A;  1SSF A;  4EMH A;  1UUE A;  1VOM A;  3OSS C;  2JTE A;  4OB2 B;  4RUG A;  1TTH B;  5LL6 S;  3CCL A;  3A98 A;  2FB7 A;  2OTJ T;  3CME A;  5IHK A;  5J39 A;  3CMA A;  1YJW Q;  3QBY A;  4MZP A;  2EAY A;  1TXQ A;  3OYG A;  5C0M A;  2M9U A;  1NLP C;  2KBT A;  2RHZ A;  2EGC A;  1JRI A;  1B7T A;  3CXC S;  4FIB A;  4M78 G;  1WDX A;  3GPL A;  5GAO r;  2LCS A;  3M0U A;  4BE1 A;  1IHW A;  4HKE A;  4J9G A;  5AYF A;  2NUP B;  5KE2 A;  2JS0 A;  1AZE A;  1I5L A;  3SWN A;  1V1C A;  3L2Q A;  1Z9Q A;  1QCF A;  3CD6 Q;  1PM3 A;  5CVI A;  1JBM A;  3CCM T;  1D0X A;  1K0S A;  4J9H A;  2D9T A;  1D1A A;  4B6M A;  2RMO A;  2M51 A;  3X20 B;  3TRE A;  5L23 A;  3NGP A;  4OMM A;  1ZBX A;  2WSF E;  2M02 A;  4JUV A;  2QEX Q;  3THK A;  4HCC A;  2DE0 X;  2K9G A;  5A0D A;  3C0C A;  4HCK A;  2H3J A;  2FPD A;  5HKC A;  3QO3 A;  4V2S A;  2DL7 A;  4EDU A;  4LUE A;  2EGA A;  4BI4 A;  3HRU A;  1SG5 A;  2PUK B;  3PVL A;  2P4T A;  1SSH A;  1CSK A;  1Q86 R;  3NTK A;  3CCM A;  1R0C B;  4JJN K;  1VQL Q;  1NPR A;  2FRY A;  3BW1 A;  2YRV A;  3OBW A;  1YIT A;  1BB9 A;  4GBQ A;  4ZTF A;  1SRM A;  3H6Z A;  2HNI A;  5ECA A;  4WTO B;  2CZ0 B;  4XTW A;  5GMK e;  1WYX A;  4PLI A;  3LGF A;  3RUX A;  1YJW T;  2BE9 B;  4RKU E;  2EBP A;  3OS2 A;  5FW9 A;  3BDL A;  2EKO A;  3L2V A;  1ZSZ B;  1VQ5 Q;  3OW2 P;  2JW4 A;  3CCR A;  3CPF A;  1PSF A;  1VQ7 T;  3LYI A;  2JTF A;  1BYM A;  1M3A A;  4Z88 A;  2XID A;  3OYF A;  3OYI A;  4LDX A;  1OQK A;  1T3L A;  3CBM A;  1PRM C;  1PHT A;  1QWF A;  1K8A U;  1E6H A;  2R58 A;  1Q86 C;  2GCX A;  2K7A A;  4M7A B;  4F7U F;  4LDV A;  2K5I A;  4M7D F;  2EGE A;  1GCQ C;  1YIJ Q;  2DXT A;  2RB6 A;  5FU6 B;  3PIO A;  3CD6 T;  1MV0 B;  3GF5 A;  2DET A;  3QDR B;  3VUZ A;  1OOT A;  2AT1 B;  1KQ1 A;  1WQW A;  5GMK h;  4E6R A;  3CCE A;  4KBM B;  1AWO A;  4PJO G;  1VQP Q;  4F7U B;  2QK0 A;  1VQK Q;  4D8K A;  1VQ7 A;  1MGQ A;  5HK0 A;  1Y96 B;  1H3Z A;  2VUB A;  2RI2 A;  3SD4 A;  4E7H A;  3C12 A;  2LT1 A;  2QEX T;  3E2U A;  4M7D C;  2AZS A;  2BZY A;  2DLP A;  1G8X A;  1VQO A;  1WHG A;  1YCY A;  3VUB A;  4C5E A;  1TUC A;  5GAM j;  2EYQ A;  3CD6 A;  3MEV A;  4NS5 A;  3QWY A;  1UGQ B;  2K6D A;  2HDA A;  1VQL T;  5CKF A;  2YWW A;  3P8B B;  3EFO A;  2DM1 A;  1NEG A;  2RQT A;  4OML A;  1Q81 R;  3V7R A;  2EQU A;  1NBE B;  2RQU A;  5GAN 6;  1H92 A;  2HBP A;  1G3Y A;  1SHF A;  2L5Q A;  3HP9 A;  3MEW A;  1XNI A;  2P0P A;  1E6G A;  3VS1 A;  1RAB B;  2EFI A;  1ZA2 B;  4M7A E;  4QVD A;  1VQN A;  1OEB A;  4AG1 C;  4FYY B;  1I8F A;  5CKB A;  2G6F X;  2CSQ A;  3BDU A;  2D0Q B;  3R6N A;  4EIK A;  3ULR B;  1FX7 A;  3SWN B;  2O4X A;  2HQH A;  3M59 A;  2O31 A;  4J6W A;  4FCY A;  3EH1 A;  2RHX A;  3CC4 Q;  3I5S A;  4F7U E;  5CKD A;  2E4H A;  3VYH B;  1ZLM A;  2VGM A;  4XTV A;  4OB1 B;  2L3P A;  1WJS A;  4J9D A;  4F14 A;  3CC2 Q;  2CP6 A;  2VXE A;  1KK7 A;  3G6E Q;  1WA7 A;  1YN8 A;  1W2B S;  1YIJ T;  3U23 A;  3TSW A;  1Q81 C;  4QQ6 A;  2FO0 A;  2ZPB B;  2JT4 A;  3QZ5 B;  2YLB A;  4XU1 A;  2OX7 A;  1BI3 A;  2DL4 A;  2K4Y A;  5LJ3 j;  4J6X A;  1OPK A;  3A1P A;  1VQP T;  1VUB A;  1VQK T;  3JCM P;  2VKN A;  1BI1 A;  1JJ2 S;  1D09 B;  2O9V A;  1M27 C;  4OB3 B;  1X43 A;  5AT1 B;  1IZ6 A;  2CH4 W;  1QKX A;  1AZG B;  3CCS Q;  1LOJ A;  4HVW A;  1CKA A;  3OYL A;  2KSS A;  2HCK A;  2F5T X;  1YIJ A;  4P5N A;  1BU1 A;  1T3S A;  3I35 A;  2QA4 Q;  3OW2 A;  4J8O A;  3JCM Q;  2EYZ A;  1EX4 A;  2ESW A;  3TVT A;  2XU8 A;  3H0F A;  3MEU A;  2RHY A;  3CCQ Q;  5KYN A;  1VQK A;  3I56 A;  1JO8 A;  1QKW A;  2CDT A;  1CKB A;  1H3H A;  4E7K A;  2HAX A;  3PTA A;  3WVD B;  1MMN A;  3M0S A;  5LJ5 j;  1VQ6 Q;  4M7D D;  4AFZ C;  1JQQ A;  3JCM d;  4WCI A;  2M0Y A;  2Y90 A;  5GJV B;  3OQ5 A;  3E9F A;  3MP8 A;  1T0J A;  1QWE A;  2X51 A;  1J3T A;  2JJ9 A;  2DIG A;  1GFC A;  3LLR A;  1VIF A;  1WXU A;  4MMK A;  3RER A;  3NFC A;  1U8R A;  5EC7 A;  5D6Y A;  2PZ1 A;  3CC4 T;  2M16 A;  3VYG A;  4C5I A;  1TOV A;  3FC3 A;  4X9D A;  4JRP A;  4RTU A;  2LC4 A;  4AFU C;  5I11 A;  1UHF A;  3CXC P;  4A53 A;  4QKU A;  3G6E T;  3VS6 A;  3MO8 A;  3KBG A;  2LNV A;  4Z8A A;  5CR2 A;  2KE9 A;  4D8D A;  1IGQ A;  4M77 G;  1K0X A;  2MF2 A;  1S72 Q;  2JTM A;  3QPH A;  4ELZ C;  4FSX A;  4C8Q G;  2L89 A;  3KFV A;  5J26 A;  2HSP A;  3ZL7 C;  4R56 A;  2MPX C;  4CC7 A;  2KYB A;  2RK2 A;  3LX7 A;  2XK0 A;  2RJD A;  4L5G A;  2MI6 A;  4VUB A;  2WSE E;  2RH2 A;  3G4S Q;  3EFO B;  2L3R A;  3CCS T;  1MMA A;  3QJ6 A;  2YUP A;  2RA2 A;  3G6E A;  2GFU A;  3PMI A;  4ANJ A;  2KT1 A;  3OSV A;  3C4S A;  4M78 C;  2PQW A;  5DLO A;  2A36 A;  4FSS A;  2QA4 T;  1KIK A;  4XTZ A;  1T0H A;  2KYM A;  2OAW A;  2X3X D;  4KRT A;  3M4Y A;  1GCP A;  4J9B A;  2AIR B;  5I2M A;  3CCQ T;  4ESR A;  1YHQ Q;  5IH2 A;  2O4X B;  1H8K A;  2Z0W A;  1VQ6 T;  3CPW S;  1KSW A;  2KMT A;  2JOY A;  2CZ7 B;  3HSB A;  4QVC A;  3JCM J;  2EYY A;  2DEU A;  2KRN A;  4J9F A;  2MIO A;  3RMQ A;  3OYC A;  1NEB A;  2JN0 A;  1PD1 A;  1VQ4 Q;  3T9N A;  4PFO A;  5LJ3 h;  5KCO A;  4ZNX A;  2E12 A;  1VA7 A;  1PC0 A;  1ZSG A;  2CUD A;  1N27 A;  1OV3 A;  4A4G A;  5LJ3 g;  3AT1 B;  2DRM A;  2BZ8 A;  1V76 A;  1MND A;  2DZ9 A;  1ZHI A;  5IAY A;  1TS9 A;  3JB9 I;  1NYF A;  1O75 A;  1IHV A;  2Y4X A;  2MOX A;  4JS4 A;  1AEY A;  2BZX A;  1X75 C;  3EG0 A;  2OTL Q;  3FB9 A;  3V8J A;  1M3B A;  3FJ5 A;  1GCQ A;  1WI7 A;  2A7Y A;  4OMP A;  5J3B A;  2W0Z A;  1IB8 A;  3VS5 A;  1M9S A;  2FVU A;  3AHU A;  3JCM V;  2PTK A;  4ORZ A;  5LJ3 f;  1WFW A;  1YJN Q;  2CP5 A;  1R0B G;  3G71 Q;  3CCU Q;  4C0F A;  4RTX A;  1BI0 A;  3X28 B;  4B9X A;  2CP0 A;  3VS4 A;  1TU0 B;  3G4S T;  3VKI A;  1G3W A;  5LJ5 h;  4AFQ C;  3DB3 A;  5GMK j;  1LVK A;  4M7D A;  3H41 A;  2ZPF B;  1M1G A;  2AK5 A;  5LJ5 g;  1QQJ A;  4XU0 A;  2QG9 B;  2JMC A;  1MMG A;  2KGT A;  1QW1 A;  3EH2 A;  2E70 A;  1M2V A;  1RI9 A;  3OYA A;  1WLP B;  1U1S A;  1YCS B;  1VQ9 A;  1YHQ T;  1KQ2 A;  4IKF A;  3HFO A;  1EFN A;  1TWB A;  2C0I A;  1X6G A;  2FZC B;  4X34 A;  2EQI A;  1RL2 A;  3CXC A;  3G1J A;  3OYH A;  3EGX A;  2LRQ A;  4A63 B;  1F1B B;  5LJ5 f;  1K73 U;  5KCH A;  1NE8 A;  1JXM A;  5FWB A;  2JXB A;  1VQ4 T;  2RQW A;  2D8J A;  4QQD A;  3MET A;  1AOJ A;  2XHC A;  5GAN d;  3JCM b;  1K8A R;  2QQR A;  8ATC B;  2DYI A;  2LQN A;  3MP6 A;  4GLK A;  1KD1 U;  3L42 A;  2QQB A;  1ZUU A;  4R55 A;  4ELY C;  2YUO A;  2ATC B;  8AT1 B;  5GMK i;  1D0Z A;  4LD9 K;  2YUN A;  3OMC A;  1N9R A;  4N4G A;  2EJF A;  2OTJ A;  1WHH A;  3E9G A;  1Q7Y U;  3EAE A;  3UA6 A;  9ATC B;  1W2B P;  3JB9 J;  3OS1 A;  1LPL A;  3EGD A;  3V7C A;  2DL5 A;  3RKY A;  1VQ4 A;  4KUI A;  1KG1 A;  4J7I A;  1LNX A;  3G71 T;  3CCU T;  3JCM e;  2RHU A;  5CKH A;  3OYB A;  1G3T A;  4PJJ A;  5IT9 E;  3GLX A;  2DNU A;  4IUQ A;  2EYX A;  5GAM d;  2RHI A;  4FW1 A;  2DX1 A;  4FT2 A;  1JJ2 P;  2H8H A;  1BCO A;  3M53 A;  1W4S A;  3HTR A;  1K8A C;  1G5V A;  1U1T A;  2V26 A;  4KH1 B;  3M0R A;  2NUT A;  1D3B A;  4ZGD B;  2DPP B;  1OZ3 A;  1W70 A;  2ENM A;  4AG2 C;  3JAM E;  4DQ2 A;  1WIE A;  1EIF A;  3G71 A;  4FM4 B;  2EWN A;  2LX7 A;  2DTO A;  1LJO A;  3JSC A;  4A54 A;  4KUD K;  3MP1 A;  1VQM Q;  4LDY A;  4WF2 A;  2GFA A;  1N9S A;  2I0N A;  1XQH A;  5DLQ E;  2P0K A;  4ATO A;  5L8R E;  5GAN 8;  4JJD A;  2BKD N;  2CP3 A;  1M5Q 1;  1AD5 A;  3QYG B;  2HL5 C;  4X1V A;  2L3S A;  5IXF A;  4C5G A;  2CKK A;  3CCJ Q;  4E7Z A;  2RM4 A;  2NUZ A;  1SRL A;  2YDL A;  1D1B A;  2LTO A;  2DIQ A;  3X26 B;  3C94 A;  2LT4 A;  4MDW A;  2VXF A;  2DA9 A;  3ZFJ A;  2YSQ A;  4Q5W A;  4J83 A;  4HA8 A;  1YJW A;  2CT4 A;  3L2R A;  3UDC A;  2D8H A;  2CP2 A;  1HK9 A;  2HD0 A;  4OMQ A;  3REA B;  2VAS A;  2YHT A;  5FRM A;  1Y0M A;  1P92 A;  2XDB A;  2JVV A;  2NWM A;  2RPN A;  2XD0 A;  4M7D B;  3S3N A;  2E3I A;  1KC8 R;  4BD3 A;  2PVO B;  4NL2 A;  3F70 A;  3RBB B;  1MHN A;  3KUF A;  4BDZ A;  2VWF A;  1HJD A;  4HCZ A;  4II1 A;  1M2V B;  3MPU B;  2QI2 A;  5GAO q;  1SPK A;  4C92 F;  2KNB B;  2YRD A;  4OGE A;  3CBP A;  3A8L B;  3SEM A;  2LZ6 B;  1TUG B;  2C0T A;  3PMT A;  4FYW B;  3GNG A;  1U5S A;  3EGX B;  3C95 A;  4M78 A;  4L59 A;  1AWX A;  3QHS A;  4PL6 A;  2FYK A;  3UF4 A;  1RAG B;  1YFN A;  4BY6 B;  1NG2 A;  2A08 A;  2P84 A;  3FEO A;  1BIB A;  2IPO B;  2KAF A;  3QUI A;  2O01 E;  4C92 C;  1VQM T;  4MZT A;  4BY6 C;  2QEX A;  3TEE A;  1QVG S;  1KC8 C;  4C8Q C;  4XU3 A;  4LUD A;  4QW2 A;  1WX6 A;  4BUG A;  2QTX A;  1VQ5 T;  3CPW P;  2DL8 A;  5M9O A;  1G3S A;  3LWI A;  2ZGW A;  1KFZ A;  2B86 A;  1Q82 U;  3P8H A;  1W2B A;  2A0F B;  2RK1 A;  4XAX B;  2EPD A;  3H8Z A;  3EG2 A;  3CEY A;  3JB9 F;  1VQL A;  4ZN1 A;  1OU9 A;  4M7D E;  2LJ0 A;  3INZ A;  3CCJ T;  1ACM B;  2EJ9 A;  4M4Z A;  1JEG A;  1ZBJ A;  2RQR A;  3OYK A;  1QLY A;  2EJG A;  3MHX A;  2MMP A;  1JJ2 A;  3FJP A;  4C0D C;  3NMZ C;  2FZK B;  3PT9 A;  4J5Y A;  4OMF B;  3BFM A;  3L1A A;  2ROT A;  2ED0 A;  1M8M A;  1VYV A;  1VQ5 A;  5I22 A;  2EQM A;  3X25 B;  3CC7 Q;  3M54 A;  3NPF A;  1SKU B;  1RAH B;  3ZEH A;  4AT1 B;  2NUT B;  1D3B B;  2J6O A;  1KC8 U;  2HZY A;  2Y4Y A;  1X6O A;  2HMA A;  5KYX A;  3I55 Q;  1UFF A;  1NLO C;  3EFS A;  3L2U A;  2F69 A;  4M75 F;  1V29 B;  2QQ9 A;  2LQ8 A;  5GAN e;  2X4Y A;  3M0Q A;  1R77 A;  5A0G A;  3UT1 A;  2XIC A;  1X01 A;  3WXM B;  1C6V X;  1PG5 B;  1ABQ A;  1A0N B;  2C0O A;  3H9N A;  1AHJ B;  1OPL A;  1VQP A;  1QVF S;  1GL5 A;  1IXD A;  3QZ9 B;  3OS0 A;  2CGH A; 
#chains in the Genus database with same CATH homology
 3SWN A;  5LJ3 h;  4XTY A;  5KCO A;  3L2Q A;  3CCV A;  2QQS A;  5GAO n;  2E12 A;  2DXB A;  2WAC A;  2ZPI B;  4M77 B;  4N0A C;  4UC4 A;  2CZ1 B;  2I2L A;  2LDM A;  1N27 A;  1VQN T;  5CVI A;  3QYH B;  4A4G A;  1JBM A;  4M75 C;  5LJ3 g;  3CCM T;  1QVG A;  3M58 A;  4M7A G;  1M8V A;  5HK3 A;  2D9T A;  5LJ5 d;  4C92 B;  1UGR B;  2DZ9 A;  1ZHI A;  3RMS A;  5IAY A;  1O9S A;  1WJQ A;  4M77 C;  4PJO A;  3X20 B;  3TRE A;  4C8Q B;  4E7L A;  1Q82 U;  1H64 1;  3JB9 I;  3DKM A;  1O75 A;  2Y4X A;  2K5F A;  4JS4 A;  4JDS A;  1ZBX A;  2G3R A;  1QP2 A;  4J6Y A;  1I5L A;  2WSF E;  5FRN A;  1X75 C;  3V7S A;  2DK3 A;  3FB9 A;  3V8J A;  1M90 U;  3RKW A;  4JUV A;  2P0Q A;  4HCC A;  3QSU A;  4C0G A;  2A7Y A;  2E64 A;  4IUU A;  3UWN A;  2MWP A;  4F7U G;  3CC2 T;  1Q86 U;  5A0D A;  1GXI E;  5J3B A;  2H3J A;  3OYD A;  2V8K A;  2PVG B;  2X4W A;  1M9S A;  2FVU A;  2QQA A;  3P8D A;  3QO3 A;  4XK8 E;  3JCM V;  5HKC A;  5GAN 4;  5GAO p;  3AHU A;  1NPP A;  5LJ3 f;  4C92 D;  4HT9 A;  4EDU A;  3ER0 A;  3J7A F;  3FDR A;  4BI4 A;  3HRU A;  3O8V A;  4C0F A;  4C8Q D;  3PNW C;  2PUK B;  2P4T A;  4BI3 A;  1HXD A;  4JS5 A;  1QVP A;  2KY9 A;  3NTK A;  3CCM A;  4RMO A;  1BI0 A;  4JJN K;  4M78 F;  3X28 B;  4B9X A;  3G4S T;  4E47 A;  1NPR A;  3VKI A;  1G3W A;  4C0D B;  2B8A A;  4XTU A;  4A4K A;  4OB0 B;  5LJ5 h;  3CC7 T;  3A8M B;  3BW1 A;  2YRV A;  3OBW A;  3DB3 A;  4XU2 A;  1YIT A;  4DOW A;  2RI3 A;  4JLI A;  4ZTF A;  2QXF A;  3H6Z A;  5GMK j;  2HNI A;  5D6X A;  4J7F A;  4M7D A;  2CZ0 B;  2GQV A;  2MWO A;  2ZPF B;  1M1G A;  2MAM A;  4O5V A;  4PLI A;  4XTW A;  5GMK e;  5LJ5 g;  3GOX A;  3CC4 A;  4XU0 A;  1VQM A;  2DXU A;  2VV5 A;  2R5A A;  5DY9 A;  4EMK C;  2KK4 A;  3LGF A;  2VYT A;  4BI8 B;  2DD4 A;  3RUX A;  3HL8 A;  4M78 B;  5C6S A;  1YJW T;  1Y71 A;  4RKU E;  1QW1 A;  3CC2 A;  3PFS A;  2RD1 A;  2E70 A;  3SWN C;  3OS2 A;  2EIF A;  2FHD A;  2PVD B;  3OYA A;  3BDL A;  2EKO A;  3L2V A;  1U1S A;  1VQ9 A;  5CAI A;  4LDU A;  1YHQ T;  1KQ2 A;  4M77 E;  4IKF A;  1B34 A;  3PGG A;  1BIA A;  2E6Z A;  4BE0 A;  3HFO A;  2ZZD A;  3CPF A;  3CCR A;  1PSF A;  3GNF B;  2A3L A;  1IRE B;  1VQ7 T;  3LW5 E;  1WNL A;  3LYI A;  2JTF A;  4X34 A;  3WVE B;  1BYM A;  3L2W A;  3M55 A;  2XID A;  1RL2 A;  1NZ9 A;  4C92 E;  1UB4 A;  1OYX A;  3OYF A;  3OYI A;  2WSC E;  3CXC A;  3CPW A;  4LDX A;  3OYH A;  1N6A A;  2LRQ A;  1XTD A;  4C8Q E;  3CCJ A;  3CBM A;  4PLL A;  3JB9 D;  1K9M C;  2V8J A;  5LJ5 f;  1K73 U;  5KCH A;  1K8A U;  5GMK m;  2R58 A;  1NE8 A;  2DTI A;  3SFM A;  5KE3 A;  1Q86 C;  1QVF A;  2GCX A;  4M7A B;  4F7U F;  4LDV A;  3RKX A;  5CKE A;  5FRO A;  3I56 T;  5KH6 A;  3EFR A;  2K57 A;  1FWZ A;  3A8H B;  2K5I A;  2M0O A;  4FL6 A;  1VQ4 T;  1NJI U;  2OAU A;  4M7D F;  4QQD A;  4YTL A;  2CZ6 B;  2PUO B;  3MET A;  2DXT A;  2RB6 A;  5FU6 B;  2NLU A;  3PIO A;  2XHC A;  2XDD A;  3GF5 A;  5GAN d;  1N8R U;  3CD6 T;  2E41 A;  2E10 A;  3QDR B;  3JCM b;  2QQR A;  3VUZ A;  2E5Q A;  1KQ1 A;  1WQW A;  4JRQ A;  5GMK h;  2F5K A;  3MP6 A;  4GLK A;  3CCS A;  1KD1 U;  3CCE A;  4KBM B;  3E19 A;  3L42 A;  4JRI A;  4PJO G;  2QQB A;  4N4H A;  4R55 A;  4Y28 E;  4F7U B;  4NOY A;  3HKS A;  4ELY C;  4BE2 A;  3S6W A;  3S3O A;  1VQ7 A;  4M75 B;  1MGQ A;  5HK0 A;  5GMK i;  3OYE A;  3QKJ A;  4GY5 A;  4LD9 K;  1Y96 B;  4Z02 A;  4O6J A;  4M7A D;  1H3Z A;  3OMC A;  2VUB A;  2QA4 A;  1N9R A;  2RI2 A;  2EJF A;  4N4G A;  4A4H A;  2OTJ A;  3SD4 A;  3E9G A;  4E7H A;  3C12 A;  3A8G B;  3X24 B;  1Q7Y U;  2LT1 A;  3EAE A;  2QEX T;  3OA6 A;  4M7D C;  3CCQ A;  3OS1 A;  3JB9 J;  3V7C A;  1RI0 A;  1VQO A;  3J80 E;  2K2V A;  3DLM A;  2ZPG B;  2M1H A;  2GF7 A;  1OI1 A;  3RKY A;  1VQ4 A;  1YCY A;  3VUB A;  4C5E A;  2K5L A;  4KUI A;  4M78 E;  5GAM j;  1KG1 A;  5CQY A;  4J7I A;  5CCA A;  1Q81 U;  1LNX A;  2EYQ A;  3G71 T;  3JCM e;  3CCU T;  3KXT A;  2RHU A;  4M75 D;  5GAM e;  2IG0 A;  1VQ6 A;  1TH7 A;  4KUL A;  2XG8 D;  3CD6 A;  3MEV A;  5CKH A;  3OW2 S;  4EPC A;  5GAN 7;  2KDS A;  4NS5 A;  1G3T A;  3OYB A;  5GAN h;  1UGQ B;  2DTH A;  5IT9 E;  3GLX A;  4IUQ A;  3SB2 A;  1WPY A;  3QXE B;  5GAM d;  3DLL A;  1S72 T;  2RHI A;  1K9M U;  1XOV A;  5CKF A;  1VQL T;  4HT8 A;  4M77 D;  2DXC A;  4FT2 A;  3P8B B;  4L6V 5;  5IN1 A;  1PSE A;  1UGS B;  1YJ9 T;  3R6O A;  3HRS A;  4E7J A;  3M53 A;  3J81 E;  1K73 C;  1W4S A;  5GAN g;  4M7D G;  3V7R A;  1K8A C;  2EQU A;  5GAN 6;  3JRZ A;  1G5V A;  1U1T A;  2R57 A;  3GP8 A;  2HBP A;  1G3Y A;  3HPW A;  2L5Q A;  4V2S A;  3HP9 A;  3MEW A;  1XNI A;  1NJI C;  2YLC A;  3OBY A;  2D6F A;  2P0P A;  3NTI A;  2EFI A;  4M7A E;  1YBY A;  4QVD A;  1N8R C;  1D3B A;  2LCC A;  1VQN A;  3JB9 H;  2V8I A;  4ZGD B;  5CQX A;  2DPP B;  4BB7 A;  1OZ3 A;  5CO7 A;  5A0L A;  1I8F A;  4A4E A;  2RJF A;  5CKB A;  3MCA B;  1KD1 C;  4Y91 A;  4EMK B;  4ZGJ B;  3JAM E;  3BDU A;  4DQ2 A;  3CME T;  2D0Q B;  4PJO F;  5D6W A;  3S3M A;  4MML A;  1FX7 A;  1EIF A;  3OB9 A;  3SWN B;  5CK9 A;  1ZQ1 A;  2O4X A;  3G71 A;  3M59 A;  4FM4 B;  2EWN A;  4CI0 C;  2L8D A;  4J6W A;  4BAC A;  1YI2 T;  2E1H A;  2DTO A;  3URG A;  2FL7 A;  1LJO A;  2AHJ B;  2RHX A;  2DD5 A;  3JSC A;  3JCM c;  1WQ7 A;  3QG1 A;  4A54 A;  3MP1 A;  5GAN f;  4F7U E;  5GMK l;  3CCL T;  4LDY A;  4WF2 A;  5CKD A;  3FRN A;  3VYH B;  2DZC A;  2GFA A;  2RJE A;  3M5A A;  4M75 E;  4DOV A;  3PIP A;  1S72 A;  3CMA T;  4C92 G;  3OYJ A;  2VGM A;  1N9S A;  3LGL A;  4XTV A;  4OB1 B;  5GAM h;  1Q7Y C;  1XQH A;  3SDZ A;  1WJS A;  2DO3 A;  4IUT A;  3OYN A;  3I55 T;  5DLQ E;  2VXE A;  4NL3 A;  2P0K A;  4KT0 E;  2X4J A;  1FXX A;  3L2Z A;  1BKB A;  4IUR A;  4PJO B;  4ATO A;  4MZM A;  5L8R E;  5GAM g;  5GAN 8;  1W2B S;  2JZ2 A;  1UEB A;  1YIJ T;  2BKD N;  1M5Q 1;  4ZGE B;  1Q81 C;  4QQ6 A;  3LWH A;  2ZPB B;  3QYG B;  4M77 A;  4N4I A;  3QZ5 B;  2YLB A;  3G4S A;  4PJO C;  4XU1 A;  2K3Y A;  1BI3 A;  2CKK A;  1JB0 E;  2K4Y A;  2LVM A;  4TVR A;  4C5G A;  5LJ3 j;  1M1K U;  4J6X A;  2RM4 A;  4HCB A;  3CC7 A;  5LJ3 e;  3HHT B;  4M78 D;  1OZ2 A;  2LTO A;  1VQP T;  1VUB A;  2DIQ A;  2KQW A;  4C92 A;  1VQK T;  3JCM P;  4RG2 A;  3X26 B;  3C94 A;  1I4K 1;  2EQK A;  2LT4 A;  4MDW A;  4C0Z A;  1BI1 A;  2VXF A;  5FU7 C;  3V8L A;  4C8Q A;  2IVW A;  1JJ2 S;  4OB3 B;  1YI2 A;  1KQS S;  3ZFJ A;  2CS7 A;  2PU9 B;  4Q5W A;  5GAO m;  4PKC C;  1IZ6 A;  5CIU A;  1WGS A;  2RJC A;  1VQ8 T;  4J83 A;  4HA8 A;  4LDW A;  4JLG A;  1YJW A;  5GAM f;  3L2R A;  3UDC A;  5DM7 R;  4XTX A;  1HK9 A;  2DKG A;  2HD0 A;  3I55 A;  4XQ3 A;  1LOJ A;  4MDX A;  3M4G A;  2YHT A;  3OYL A;  2QDY B;  1YHQ A;  5FRM A;  2XDP A;  2KSS A;  1P92 A;  3DB4 A;  2XDB A;  2JVV A;  2E65 A;  2F5T X;  3V8K A;  2XD0 A;  1YIJ A;  4M7D B;  3S3N A;  4P5N A;  3JB9 G;  4BD3 A;  2PVO B;  2DJZ A;  4NL2 A;  3OYM A;  2OTL T;  3F70 A;  2K3X A;  3OW2 A;  1MHN A;  3KUF A;  4J8O A;  4X9C A;  3CBO A;  3RES A;  4CRI A;  3JCM Q;  4BDZ A;  4EMG A;  4HCZ A;  2XU8 A;  4II1 A;  3MEU A;  3MEA A;  2RHY A;  3HFN A;  2QI2 A;  5GAO q;  4DA4 A;  4KUD K;  1BI2 A;  1KHI A;  3ZBD A;  4C92 F;  1VQK A;  1B34 B;  2HQX A;  3I56 A;  4OGE A;  3A5Z B;  3M56 A;  3CBP A;  1Y07 A;  1YJN T;  4E7K A;  2HAX A;  3PTA A;  3A8L B;  3GIB A;  4A4F A;  3WVD B;  3HRT A;  3PMT A;  4RCB A;  5LJ5 j;  5GAN 2;  4QQG A;  1VQ8 A;  4M7D D;  3GNG A;  4RG8 A;  5LJ5 e;  4PJO E;  3JCM d;  2JUF A;  3QII A;  2Y90 A;  3C95 A;  4M78 A;  4L59 A;  3OQ5 A;  3QHS A;  4JRK A;  2DVE A;  3E9F A;  3MP8 A;  4PL6 A;  4D6W A;  2FYK A;  3Q1J A;  1M1K C;  5EG2 A;  4BY6 B;  2KVQ G;  2DIG A;  1YIT T;  1VIF A;  2LX9 A;  2E6N A;  3LLR A;  1VIE A;  3OS5 A;  3FEO A;  4MMK A;  3A8O B;  1BIB A;  3NFC A;  1Y7X A;  1U8R A;  3RER A;  2KAF A;  2LQK A;  5D6Y A;  3QUI A;  3QJY A;  2OTL A;  3CC4 T;  2O01 E;  2HQE A;  1WJR A;  4C92 C;  2M16 A;  1VQM T;  3VYG A;  4C5I A;  5GAN 3;  4MZT A;  3OY9 A;  2ZPE B;  4BY6 C;  4ZN3 A;  2QEX A;  3TEE A;  1QVG S;  1UGP B;  4C5H A;  2XI9 A;  1KC8 C;  4C8Q C;  3FC3 A;  4XU3 A;  4QW2 A;  4X9D A;  2RO0 A;  4JRP A;  4BUG A;  1VQ5 T;  2LC4 A;  2QTX A;  4M75 G;  5FLX E;  1VQ9 T;  4A53 A;  5M9O A;  1G3S A;  3LWI A;  4IUP A;  4M7A A;  3G6E T;  2ZGW A;  1YJN A;  3CCR T;  3MO8 A;  3KBG A;  1KHC A;  2LNV A;  3OMG A;  3P8H A;  3VU3 C;  5CR2 A;  3CCU A;  3TU4 K;  3N5B B;  4M77 G;  1W2B A;  2RK1 A;  5A2Q E;  1DJ7 B;  4XAX B;  3BY7 A;  2EQJ A;  3H8Z A;  4OGC A;  4OP0 A;  3CEY A;  3JCM X;  3JB9 F;  2X35 A;  1VQL A;  2MF2 A;  2BIV A;  4ZN1 A;  5I21 A;  3JCM h;  4B9W A;  4IUV A;  2JTM A;  4M7D E;  2XKO C;  3INZ A;  3FIF A;  3CCJ T;  3LH0 A;  1YJ9 A;  2EJ9 A;  3QPH A;  4LD6 A;  3VJP A;  4ELZ C;  5HY6 A;  1M1F A;  4FSX A;  3ASK A;  4C8Q G;  4N0A A;  4ME7 A;  3OYK A;  5GAO l;  2L89 A;  4F7U A;  3M57 A;  2EJG A;  3MHX A;  5J26 A;  3JCM g;  4R56 A;  2DAQ A;  2VGN A;  4M75 A;  3ME9 A;  2RK2 A;  2LCL A;  3LX7 A;  2MMP A;  1JJ2 A;  1Y96 A;  3FJP A;  1M4Z A;  4C0D C;  2XK0 A;  1KQS A;  2ZCF B;  2RJD A;  3PT9 A;  4L5G A;  4OVA A;  3TCJ A;  4J5Y A;  2MI6 A;  4FU6 A;  5FU7 B;  4OMF B;  4VUB A;  3VV0 A;  3BFM A;  4E7I A;  2CYZ B;  3L1A A;  2RH2 A;  2RI5 A;  2DEQ A;  2WSE E;  2BUD A;  2L3R A;  5I2S A;  3CCS T;  1VQ5 A;  3CCE T;  1SSF A;  2EQM A;  3X25 B;  3QJ6 A;  3M54 A;  4ZTJ A;  4EMH A;  4M7A F;  2RA2 A;  3E1S A;  3G6E A;  2GFU A;  4RCC A;  3PMI A;  1QP3 A;  3OSS C;  5LJ3 d;  4OB2 B;  3OSV A;  3C4S A;  4M78 C;  2PQW A;  5DLO A;  4PJO D;  3ZEH A;  3CCV T;  5LL6 S;  2QA4 T;  2X4X A;  3CCL A;  2FB7 A;  3M9Q A;  3CME A;  1D3B B;  3JCM W;  2OTJ T;  4XTZ A;  3JCM f;  2C06 A;  5J39 A;  2JNG A;  3CMA A;  1KC8 U;  4OF1 A;  3QBY A;  2Y4Y A;  1M90 C;  1X6O A;  3M4Y A;  4MZP A;  3RIR A;  3UPU A;  1I81 A;  2R5M A;  3OYY A;  5I2M A;  3CCQ T;  2EAY A;  3OYG A;  4FT4 A;  5C0M A;  1VQO T;  3EFS A;  2M9U A;  5GAN j;  3NTH A;  3L2U A;  2F69 A;  4M75 F;  2O4X B;  1V29 B;  2QQ9 A;  2LQ8 A;  2RHZ A;  5GAN e;  1JRI A;  2X4Y A;  1Q82 C;  3CXC S;  5A0G A;  3UT1 A;  4FIB A;  1R8O B;  4M78 G;  3CPW S;  1VQ6 T;  2XIC A;  4M77 F;  1X01 A;  3WXM B;  4M7A C;  2KMT A;  2JOY A;  3GPL A;  2CZ7 B;  2ZPH B;  3HSB A;  4QVC A;  3FLG A;  5GAO r;  3JCM J;  1AHJ B;  4BE1 A;  4HKE A;  1VQP A;  1QVF S;  5GAN 5;  4EMK A;  2VC8 A;  4BDY A;  5AYF A;  5FU6 C;  3RMQ A;  3OYC A;  2JN0 A;  4QVZ A;  3G7Z A;  4C8Q F;  5KE2 A;  3QZ9 B;  4PNO A;  3OS0 A;  3T9N A;  2CGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...