5GANj

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
94
structure length
94
Chain Sequence
RAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 15
structure length 94
sequence length 94
chains with identical sequence m
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ganj00
4PJOD 2DVEA 5CAIA 1I5LA 3SWNC 2FYKA 4NL3A 3GIBA 1HK9A 4M78C 5GMKh 4OP0A 4XU0A 1B34B 4XTXA 1B34A 3JCMh 4M75A 4M77B 2DZ9A 4M77A 5GAN5 2K57A 4M7AB 4C8QC 4C92G 5GAOr 3AHUA 3JCMf 4M7AA 2ZGWA 4F7UF 1TH7A 2VXEA 4RCBA 5GAOm 2Y90A 1LOJA 5GMKl 5LJ5e 4EMKB 4C92E 4EMKA 5GAOp 1WQ7A 4HT8A 4M7DA 4M7DB 2DXUA 3HSBA 2RB6A 4M78D 1HXDA 3JCMV 5GMKi 2E10A 3FIFA 5GAN2 4PNOA 2E64A 3V8JA 3L2ZA 4M77C 5LJ5g 4JRIA 5GAMf 1WQWA 3JB9D 3JB9G 4M7AC 3JB9F 3EFSA 5GANf 2YLCA 4NOYA 2DXTA 4EMGA 5LJ3d 4XQ3A 1U1TA 3BW1A 2JN0A 1I81A 4NL2A 1MGQA 4PJOG 4JLIA 3RESA 4PJOF 5GAN8 4EMKC 2EJFA 5DY9A 5GAMj 4M7DC 1LJOA 1JBMA 5GMKe 5GANj 3QUIA 3JCMe 3RKWA 1KQ2A 3JCMJ 3RUXA 4M75D 3SB2A 4PJOE 4M75F 1I4K1 2FB7A 4F7UG 1N9RA 3QHSA 4HT9A 3V8KA 4A53A 1Y96B 4XU1A 5LJ5d 4V2SA 3BDUA 4M75E 3JCMg 4XTWA 3JCMW 4F7UE 4M7DD 4M7DF 2DEQA 4M78G 4M78F 4XTVA 5GAOq 4C8QD 4C8QG 5GAMh 4C8QF 5I21A 3BFMA 5GANh 5LJ3h 2CGHA 3INZA 4M78E 2I2LA 2EWNA 5LJ3f 5GAN3 1N9SA 4C8QE 3JCMb 3RKYA 3VU3C 1M5Q1 4C92B 1LNXA 1U1SA 4C92A 1BIAA 4EMHA 4QVDA 3RIRA 5GAN6 4QVCA 3HFNA 5GAMg 3JB9I 5GANg 2DTHA 5LJ3j 5LJ3e 2EAYA 3L1AA 2RA2A 4JRKA 4M75G 3PGGA 1I8FA 3QO3A 2E1HA 3FB9A 4M77D 4M77F 5GMKm 4M7AG 4M7AF 4M7AD 2E65A 5LJ5f 5GAOl 3QSUA 3BY7A 3V7RA 1Y96A 2EJ9A 2VXFA 4M77E 1JRIA 4M7AE 4M7DG 3EFRA 4C92C 4XU2A 5LJ5j 1YCYA 4J6YA 3RERA 2YHTA 3JB9H 2RM4A 5GAMe 3JCMQ 4PJOB 3HFOA 2YLBA 4MMKA 4X9DA 4XTZA 5GANe 4M7DE 3RKXA 4PJOA 1WNLA 3V7SA 1KQ1A 2DZCA 4X9CA 4WF2A 5GAN4 3JCMc 2RD1A 4M75B 2VC8A 4XU3A 2QTXA 4C92D 4N0AA 4MMLA 4C92F 4F7UB 4F7UA 2EJGA 2DKGA 2E41A 5LJ3g 4XTYA 3JCMd 4RCCA 4HA8A 5GAN7 2HNIA 3V8LA 5LJ5h 4M77G 2DTOA 4JUVA 3SWNB 1D3BB 3SWNA 1D3BA 4J6XA 4M78B 5GMKj 4M78A 4PJOC 3JCMP 4A54A 4DQ2A 3M4GA 4XTUA 4C8QB 4C8QA 3V7CA 1WPYA 4J6WA 3JB9J 3JCMX 4J5YA 3FJPA 4M75C 2DJZA 4N0AC 1BIBA 2DTIA 5GAOn 5GAMd 5GANd 1M8VA 4Y91A 1H641 1X01A
chains in the Genus database with same CATH superfamily
1W2BP 3I5SA 3CC4Q 1OPLA 2RNAA 3E9GA 2XMFA 1EZZB 2M1HA 4L59A 1RI0A 2FL7A 1TH7A 2X9HA 2HL5C 2QG9B 2LT4A 4EPCA 5LJ5e 2K2VA 2DILA 2HZYA 3D7SB 4JJCA 2NUZA 4XK8E 2OI3A 4FYYB 2GFAA 1KC8R 4E7HA 3OS5A 3M0TA 2YUPA 4PFOA 4F14A 3M57A 4A53A 1Q86R 2E5KA 4XTWA 1NJIC 2EW3A 1ZA2B 2CZ6B 4C8QF 2BUDA 2EFIA 3AT1B 2FRWA 3A8GB 3CCUT 1XTDA 1TUGB 3L1AA 1PG5B 2ZPIB 4MDWA 1HYOA 3BDLA 2BZ8A 3OW2A 1TXQA 1G3WA 3CCEA 5IT9E 3CXCS 3PFSA 1VQ9Q 4P5NA 4FL6A 4KGXB 3X24B 1QWEA 1N6AA 2OTLA 1RL2A 1YI2A 5GAMe 1BCMA 2LT1A 4XTZA 2CSQA 5KYYA 4C5IA 1QVFS 1YITT 1UGPB 2A36A 2CKKA 1YJWA 2RD1A 3UF4A 1UE9A 2BKDN 2P84A 4FT2A 3C94A 3U23A 3JSCA 1T0HA 2A08A 4M78A 2FVUA 4PJOC 3NTIA 4DBRA 4DQ2A 2KMTA 1WFWA 2PQWA 2VKNA 2X3XD 2PTKA 4D8DA 4J7FA 2VVKA 4LDXA 4AG2C 1ZUUA 1I5LA 2A28A 1VQMT 1WYXA 2O4XA 2JTFA 3QKJA 4XU0A 1NPPA 1D1CA 1ZHIA 2FHDA 1WDXA 4B9XA 2EPDA 1QQJA 3A5ZB 2Y90A 2P0QA 5CIUA 5IXBA 1M27C 2H3JA 3C95A 2GBQA 2EIFA 3LH5A 2LCCA 4KH1B 4IUQA 3G6EQ 4AFZC 3BE3A 2MF2A 1LJOA 2DE0X 2ZAEA 3CCMQ 2QA4A 3ME9A 2CP3A 3RUXA 2FPDA 4KT0E 5HCKA 1YJ9A 5LJ5d 1MMGA 4M75E 2HMAA 1SHGA 2K5FA 2K5LA 1WJRA 1KC8U 2ECZA 1PKSA 3QWXX 3KBGA 4CRIA 4OGCA 2CGHA 3UT1A 3RMQA 1K0SA 2DXCA 1LNXA 3HPWA 1RAHB 3RIRA 3EG2A 3JB9I 3CCST 1VQKT 3H41A 3CPWS 2BIVA 2AK5A 2DM1A 3ER0A 3EFRA 2JT4A 4GBQA 1YCYA 3OYMA 3R6OA 1JU5C 2RHUA 4PJOB 2KYBA 3RKXA 1V1CA 2YUOA 1TUCA 3LWIA 2DYBA 1ZUYA 1YWOA 1EIFA 2O88A 1G2BA 3CCJQ 1ZSZA 3CCQQ 1YIJQ 2E41A 3JCMd 1TTHB 1ZA1B 4IUVA 1QVGA 4VUBA 2NLUA 3OYDA 4JUVA 5GMKj 3MKDA 3DLLA 3VS7A 1KQSA 3EG9A 2JTEA 3O8VA 2EYWA 1K9AA 2CREA 2RO0A 4A4GA 3ZL7C 3SD4A 2HDAA 1I07A 5GAMd 2HAXA 1VQ7T 4PFPA 2PUOB 3GIBA 4IIOA 2GNCA 2K57A 4M7AA 2ZGWA 3ZEHA 1VQ4A 4F7UF 3G4ST 5FU6C 1Y07A 4JRQA 3P8DA 1AT1B 4DBFA 1OYXA 4BI4A 2WSCE 1WQWA 3MO8A 3FC3A 3PT9A 2NUPA 3MCAB 4WCIA 3S3NA 4J9IA 2JNGA 1YNZA 8ATCB 1UGQB 2M0OA 1OZ3A 3PMIA 2AHJB 1R77A 1I0CA 2X4JA 4B6MA 3H8ZA 4OB0B 1NYFA 9ATCB 2EKHA 1KD1C 1M3BA 3M58A 1TS9A 5FW9A 1BI2A 4KGVB 4YTLA 2C0TA 4C92A 5FROA 1U1SA 1YJNA 1W6XA 3G71Q 2JZ2A 1M2VB 2PU9B 4KRTA 1B7TA 4M77F 3I55Q 2RF0A 1IO6A 1DJ7B 2E65A 5LJ5f 3PIPA 1VQ8A 2X4YA 2HEQA 3CCLT 3CC7A 3OW2P 1JJ2A 4A4HA 2EQJA 4N4HA 2J6OA 3OYCA 1VQPA 4PLLA 2OTJT 2OX7A 1FMKA 4M7DE 3M0UA 2HKNA 3I56A 4WF2A 3X25B 3CCRQ 1RAGB 2QTXA 4F7UB 4TVRA 2DKGA 2H8HA 4XTYA 5CKDA 3CCVQ 2KYMA 3MEUA 4ZTJA 1M8MA 2LC4A 1BI1A 1WJSA 1VQNT 3CD6Q 4FYVB 4C0ZA 4XTUA 2K9GA 4J6WA 3JB9J 5CKBA 3VRYA 2EQKA 2ROTA 1S72A 2DTIA 2EGAA 3CC4T 5LJ3e 1KSWA 1VQLQ 1VQOT 2FYKA 2VB6A 4PJJA 3EAEA 1WHKA 1FMWA 2QEXA 1B34A 1C0MA 4M75A 3JCMf 1I1JA 2VXEA 1YCSB 4JS4A 2IPOB 4Z8AA 2QQBA 1CKAA 3GBQA 4HT8A 2G6FX 4ZTFA 5L23A 3NFCA 5GAMf 1FXXA 4EMGA 3A8OB 3FRNA 1MGQA 4X1VA 3OMCA 5GAN8 2HQHA 5GANj 3ZFJA 4J9FA 1AWWA 1MMNA 3SB2A 3CC2Q 4OMQA 2P0PA 4KUIA 2EQUA 1NZ9A 2RI2A 5EG2A 3VS5A 4IURA 4R56A 3E2UA 3M9QA 4EIKA 3TCJA 1SRMA 3ULRB 4Z89A 1JXOA 2NUTB 4XAXB 3JCMb 3GOXA 4WTOB 2DBMA 3HFNA 1KK7A 4OGEA 1UFFA 3E19A 4O5VA 3PNWC 1VQ9T 3QO3A 4M7AD 4DEYA 2DRKA 4ZGJB 2P0KA 1B3QA 3M4YA 4LDUA 5D6XA 4R55A 2BE9B 4XU2A 1ARKA 3DKMA 1Y71A 4FU6A 1ZUKA 4MMKA 2HBWA 1RACB 5CCAA 1KIKA 2X35A 1KD1R 3UDCA 1NE8A 5HK0A 2HNIA 3F70A 2IG0A 1YITA 5GJWB 3JCMP 2QXFA 4FIBA 4C8QA 1QKWA 3C12A 1QVGP 3OYEA 3HL8A 1KQSP 3RNJA 2FZCB 1H641 2L3QA 1X6GA 1E6HA 2IIMA 5GMKh 3X20B 3JCMh 3EH2A 3N5BB 3META 2ZPHB 3RR6A 5GAOp 1NG2A 2V26A 1VQMA 5GMKi 5C0MA 1RADB 1IGQA 1KC8C 2XDBA 1O75A 2E12A 4RTVA 3JB9D 2YT6A 5LJ3d 3RESA 1TG0A 1M90U 2L89A 3QPHA 4QQDA 2EJFA 2MMPA 1SPKA 1X2QA 1KHCA 4AMCA 2EYYA 5I2MA 2K2MA 2CH4A 2F1LA 3LGFA 2KBTA 4UC4A 1H8KA 3GNGA 3QJ6A 5A0DA 1M1KR 2XK0A 1QW1A 3DB4A 2EYXA 3G1JA 4M78E 3IQLA 4LE9A 4FW1A 1W1FA 3RKYA 2X3WD 3VU3C 2M9UA 2DJQA 1OX8A 3S3MA 3GP8A 1Q95G 4DOWA 3L2RA 2QDLA 2WACA 1F1BB 3CCSA 4BD3A 3JRZA 2FZGB 3VS1A 3NGPA 2CUBA 4IIMA 4II1A 2DZCA 1YIJT 3CBMA 2QQSA 1U3OA 4LXCA 3UA7A 3M56A 1TUDA 4LD6A 2EYQA 1NEBA 2RH2A 2K3YA 1U06A 2HL3A 4M75C 3A98A 3CEYA 5HY6A 1TOVA 2RPNA 3CMAT 2NUPB 1KD1U 2GF7A 1VQ5T 2DVEA 3ZBDA 4CC2A 2M02A 3FEOA 2F5TX 4XTXA 2O2OA 4RTUA 4Y92A 1YHQA 3QJYA 1VQ7A 1SEMA 5IHKA 2YUQA 4E47A 3JCMV 5KCOA 3EGXA 1GXIE 1WIEA 2E64A 3VYGA 3H0IA 3G4SA 4C0DC 3CCEQ 4OB2B 5FU7C 3ASKA 5GJVB 4PJOG 1WGSA 2COZA 3RKWA 1H3HA 1WA7A 2B8AA 2MIOA 2ROLA 2OTLQ 2J6FA 2CP7A 1YI2Q 4JDSA 2XKOC 3V8KA 1WXTA 2BTTA 1Y0MA 2KI7A 5KH6A 1YJWQ 2KE9A 2ZPFB 4C8QD 5GANh 1VOMA 2LX9A 4BE1A 5LJ3f 2F2WA 1UGSB 3M0PA 4QVDA 1VQ6A 2RI3A 2DD5A 1UUEA 5GANg 3I55T 2XI9A 1M1KU 3PGGA 2JMAA 2LQWA 2RQVA 1K8AC 3VV0A 1X69A 2ED1A 2LMJA 1KG1A 4M7AE 2CH4W 4IUUA 3WVDB 1Y7XA 1KQ1A 3CCLA 1OU9A 4M75B 2LNHB 2CP5A 4XU3A 3TREA 4ZGEB 3CCVT 4MMLA 2YXYA 4ELYC 2OTJA 4BDYA 4C5EA 3CD6T 3HP9A 3SWNA 2DL7A 3OYNA 1ZBJA 2A37A 3C4SA 2MPXC 3VUBA 1UG1A 2QA4Q 2H3EB 1VQLT 2MOXA 1PWTA 2JTMA 4PJOD 1YJ9Q 1VQNA 2LTOA 3VUZA 4FCYA 1J3TA 1FYNA 2MK5A 4M77A 5DLQE 1R0CB 3O5ZA 3QG1A 4C0DB 2AIRB 2RQTA 1C1AA 5FU7B 1LOJA 1VIFA 5CK9A 3OW2S 4C92E 1VQOA 1WQ7A 2ENMA 3WXMB 3M59A 1RAFB 2XD0A 5DM7R 3FIFA 1IREB 2AZVA 3G7ZA 4NOYA 1PC0A 4PJOF 4EMKC 4M7DC 1V76A 4Z02A 4OB1B 5CKFA 3CC2T 2P4RA 1O9SA 1NLOC 4CI0C 2OJ2A 3LYIA 4F7UG 1N9RA 3QHSA 3DB3A 4XU1A 4HXJA 3UATA 4M7DF 3HRSA 2KR3A 5LJ3h 1IZ6A 5IAYA 1QP2A 3LGLA 2YSQA 2EWNA 2QGGA 1N9SA 3OYFA 1EX4A 3KUFA 3CMET 4Y28E 1SF9A 3E9FA 1UTIA 2DTHA 3FB9A 4F04B 2DYIA 2FPEA 1OQKA 2CZ7B 2E3IA 1FWZA 3MP8A 5KYWA 5LJ5j 4J6YA 1ZSGA 1YN8A 1WHLA 1VQ4Q 4QW2A 2M51A 2LCLA 4BY6C 2PNIA 5KYUB 1K76A 4LDVA 4KULA 4OVAA 2JS0A 2JM9A 3GF5A 4M77G 1D3BB 4J6XA 1D09B 4PJMA 3OSVA 3J81E 2RK1A 2O9VA 4RTYA 2JXBA 1Z9QA 4HVUA 4J5YA 1OPKA 1K8AR 4N0AC 4JJDA 5GAOn 1M8VA 1PD1A 3DLMA 1M1FA 3OYKA 2J6KA 1M90C 4KBMB 3OBYA 4K11A 5C6SA 1Q81R 5A0GA 2EGCA 3T9NA 5GMKl 4EMKB 3MPUB 4M7DB 4DOVA 2DXUA 3NTKA 4JZ4A 1N8RR 2EVRA 2A3LA 1YJNQ 2CP2A 2ABLA 4PNOA 2XU8A 1X27A 4RTWA 4J9EA 4PK4A 1GCPA 2RHZA 4ELZC 1VYUA 1PM3A 1I81A 1VQ8Q 2NYSA 5DY9A 5GAMj 1JBMA 2LQ8A 3CC7Q 2L3PA 3JCMJ 2RN8A 2HBPA 2MCNA 3VS4A 1ACMB 1SKUB 2EYZA 1VQPQ 2M0YA 1UEBA 1GL5A 2EQMA 2V1QA 2XHCA 1JQQA 5FRNA 5AT1B 1KQSS 1LCKA 2QK0A 1T3SA 4XTVA 1IHVA 2L0AA 5I21A 3QDRB 3INZA 1ZX6A 2I2LA 4C8QE 3REAB 1M5Q1 3OY9A 4QVCA 2CUDA 1K9MU 2LCSA 4IUTA 3MEVA 2KT1A 4M77D 1SG5A 1S72Q 5KE3A 4HKEA 4BY6B 5M9OA 1AWJA 1Y96A 1K73C 2VXFA 4OMLA 2RQWA 5I22A 2DMOA 2C0OA 2QEXQ 3RERA 2CS7A 2ZCFB 4X9DA 3OYAA 3QYGB 5CKEA 3SHWA 2VUBA 2VV5A 2Y4XA 4RCCA 5J26A 3MEWA 1H3ZA 4IUPA 2PVOB 1XOVA 3A8LB 3M4GA 5EC7A 3CXCP 3EGXB 7AT1B 2KQWA 3SDZA 2O9SA 1N27A 3EGDA 1OU8A 5FWCA 1BIBA 1VYVA 2X4WA 2ZZDA 2QGFB 1X01A 1IXDA 2CZ1B 4M78C 1X6BA 2RQUA 3EHQA 1WHJA 2RJCA 3CMAA 1K8AU 3OYHA 1VQ5A 2DL3A 2WSFE 1RUWA 3EFOA 1QCFA 3VS0A 1G5VA 3MP6A 2FPFA 4J9DA 4OMNA 4BE2A 1UGRB 2K79A 4HCBA 1PSFA 1JJ2S 2X51A 1WI7A 1Q81U 1Y57A 2C06A 2HCKA 4NL2A 3LX7A 1WHGA 1AVZC 3QUIA 1N8RU 2OTLT 2D8JA 1QCNA 1OX9A 1GRIA 3I5RA 1M1KC 1K4US 3H6ZA 2MI6A 1Z9ZA 1M90R 3JCMW 4AG1C 3TSZA 2QQAA 5GAOq 4E7LA 4J9GA 1UB4A 1B07A 2DF6A 1YITQ 3PIOA 2E4HA 5GMKm 1NBEB 5GAOl 2IVWA 3HHTB 1RABB 2DXBA 2EGEA 2KRSA 4CC7A 5I2SA 3TQ7P 1W2BS 4A63B 5KYYB 2LX7A 1GCQA 2DBKA 4CC4B 1VIEA 3OBWA 4HVWA 2JS2A 2YDLA 3A8HB 3J80E 2VC8A 1VQMQ 1C6VX 4ESRA 2EJGA 4NS5A 1OZ2A 1LPLA 3RMSA 5LJ5h 1MUZA 4M78B 1AZGB 1WX6A 3CPWP 4FSSA 3V7CA 2DERA 3P8HA 3CCUA 3CCVA 3M54A 4X34A 3FJPA 4M4ZA 1JB0E 5IN1A 4Z88A 1ZSZC 2KXDA 1K73R 1D0ZA 2D6FA 5FLXE 1M30A 3R6NA 1M4ZA 2FZKB 2O4XB 4RG8A 5GAN5 3OA6A 3AHUA 3VS6A 4F17A 4R0KA 3UA6A 1VQLA 2HQXA 2QYZA 2AZSA 1WXBA 2RMOA 2RB6A 3THKA 2RI5A 5D7UA 3TVTA 4AFSC 4RTXA 1MV3A 3L2ZA 1U5SA 4M7AC 2DPPB 2YLCA 2PZ1A 5CAIA 2JM8A 6AT1B 4AFUC 2E70A 5KE2A 2FEIA 3CCSQ 1EFNA 3I9QA 4A4KA 3A1PA 2CZ0B 5CKHA 3RBBB 1UDLA 1HD3A 3JCMg 3CC2A 3G6ET 1BI0A 5GAMh 1YP5A 4EDUA 4JJNK 1M3AA 3M55A 4HCZA 4EMHA 2JUFA 2EKOA 3SFMA 5GAMg 3CCMT 5LJ3j 3L2WA 2EAYA 2ZPEB 1GBQA 2EBPA 4M77E 3CMEA 1K0XA 4C92C 2DX1A 5ECAA 2PVGB 5I11A 5CVIA 4PJOA 3X26B 1NLPC 1YHQQ 3V7SA 3UWNA 1VQ7Q 4X9CA 3GLXA 1RI9A 2KAFA 4QT7A 1ZSZB 4C92F 1AWXA 2J05A 2YRDA 4BB7A 2DFUA 1MMDA 2DRMA 2R5AA 1M3CA 3EG9B 1R0BG 3PTAA 2ESWA 3EGUA 1VQKA 2PUKB 1X43A 2CT4A 3LLRA 1HJDA 2K6DA 3VRZA 4NL3A 3CCJT 3CCQT 4JPBW 3OYBA 2DZ9A 4M7AB 2E5QA 3CQTA 5GAOm 5KCHA 1K73U 4RG2A 1PRMC 2KSSA 1PRLC 1VQ6Q 2E10A 4JS5A 2DEUA 1FX7A 2K3BA 1GBRA 1UHCA 1VQ8T 4BACA 1U1TA 1LVKA 4HVVA 4PL6A 3EHRA 2D0NA 4QQGA 2X4XA 3VS3A 1K9MC 2W10A 5KYXA 3HRTA 1UHFA 4M75F 4LNPA 3GNFB 2CT3A 1Y96B 4V2SA 2DAQA 2V8JA 3REBB 1ZBXA 2DA9A 2YWWA 3BFMA 2CDTA 2OTJQ 1X75C 2QQ9A 4MZPA 4C92B 1BIAA 4LDWA 2E6NA 3TU4K 1I8FA 1NYGA 3HKSA 2KEAA 5A2QE 2DETA 3CBOA 3QSUA 2F5KA 2ZPGB 1VQNQ 5HKCA 4BE0A 4M7DG 5HK3A 1AOJA 1XQHA 2RM4A 3JB9H 1SSHA 5KYNA 1Q7YU 2SEMA 5GAN4 3G71T 1VQOQ 1WLPB 1K1ZA 1JO8A 4F7UA 1G3TA 2K7AA 3VJPA 3EFOB 2Y4YA 3OS0A 2LVMA 5CR2A 4BUGA 4E7SA 3OS2A 1Q81C 2R5MA 3CCRT 1HK9A 1B34B 1D1BA 5CQYA 4C8QC 1N8RC 3CXCA 2JMCA 2KXCA 2RHXA 3MP1A 5D6WA 4E7KA 4L5GA 1HXDA 2A0FB 1R8OB 2KT8A 2RJFA 4JRIA 4DA4A 1QVFA 4J83A 1G83A 4O6JA 3BW1A 2JN0A 3X28B 3OS1A 2D8HA 5GMKe 2BE7D 3TSWA 3JCMe 1PCXA 4KGZB 1D1AA 3H0FA 4N4IA 3CC4A 1QCOA 1WZOA 3L2VA 2KVQG 4M7DD 3H0HA 4LUEA 3EG1A 1RAAB 2Z0WA 4ZN1A 2NUTA 2L3SA 3OYIA 3PE0A 1IHWA 1SRLA 5L8RE 3CBPA 3SEMA 3I35A 2RA2A 4C5GA 4DEXA 5CO7A 2EJ9A 1GFCA 1JRIA 2C0IA 2DL8A 1Q82U 1T3LA 2QASA 3FLGA 4ANJA 1K9MR 2RJDA 1UJ0A 2JVVA 3JCMQ 2K3XA 1MHNA 3MJXA 3CPFA 4LDYA 2HSEB 2KDSA 2M16A 1W4SA 1YFNA 3JV3A 4E7JA 2AT1B 5LJ3g 5CQXA 1OULA 2L5QA 5J3BA 2R58A 4B9WA 3QZ9B 4LD9K 4C8QB 2FRYA 4C5HA 2XDDA 4E2FB 1VQ9A 3C0CA 1M1GA 3QYHB 1H92A 2DL5A 1ZLMA 4PJNA 4BI3A 1BYMA 5FWBA 2XIDA 1QVPA 4BDZA 1PNJA 3CPWA 4LN2A 2VWFA 1NPRA 4RCBA 2HKQB 1N5ZA 5A0LA 1RLQC 2V8IA 1BCOA 3TEEA 3QDFA 3MEAA 3QIIA 1UGVA 1Q86U 2COYA 2LZ6B 1NM7A 5DLOA 4FM4B 4N4GA 2DL4A 2LNVA 1I4K1 2MYSA 2VGMA 3FDRA 3J7AF 4M78G 4FT4A 2FO0A 2I0NA 2DIGA 1ABQA 1IGUA 2K5IA 2GQIA 1NJIR 2RK2A 3OYJA 2J7IA 2OAUA 3G6EA 2QAZA 3E1SA 4MZMA 4E7ZA 3UPUA 1E6GA 1M2OA 4J9BA 1KFZA 1CSKA 3L2QA 1QVGS 2KK4A 2KRMA 4PFZA 1RAEB 3I56Q 3CCMA 2LP5A 4JRPA 2LRQA 3HRUA 2CSIA 2O31A 5J39A 1YHQT 3MHXA 4IKFA 2YLBA 2KGTA 5GANe 1JXMA 4DBQA 4OB3B 3CMAQ 4GLKA 1VQ5Q 3NHNA 2P4TA 3A8MB 4ZGDB 5GAN7 2F69A 5GAN2 1D0YA 3S6WA 4RTTA 4OMOA 4D6WA 3GPLA 2KROA 4ZN3A 3EH1A 3QWYA 4ME7A 4L6V5 1MNDA 1PSEA 4JZ3A 1BK2A 3SWNC 1MNEA 2JOYA 4J8OA 5KYXB 1QWFA 1XNIA 1BI3A 1VQ6T 4M78D 4C0GA 3CCJA 3CCQA 1YIJA 2GTOA 1QP3A 2PVDB 1S1NA 3V8JA 2QI2A 4M77C 3EFSA 4FSXA 2DXTA 2V8KA 4JLIA 1RLPC 1QVFP 2HQEA 1BBZA 4PJOE 1TU0B 1GFDA 1JEGA 2FB7A 1AEYA 2D0QB 3PVLA 2B86A 3BDUA 2V1RA 1ABOA 2E6ZA 4M78F 1IB8A 3CCET 4MDXA 5AYFA 5GAN3 2NWMA 1Q7YC 2CP6A 2KY9A 5GAN6 3CCUQ 4JRKA 1YI2T 2QTVA 3M0RA 4M7AG 2ED0A 2KNBB 2GFUA 1NJIU 2LJ3A 1YJWT 5FRMA 2LQKA 3PMTA 1WHMA 3LW5E 2QDYB 5FU6B 3OYGA 5IXFA 2LQNA 3VYHB 2A7YA 4OF1A 2D9TA 1W70A 3KXTA 4DBHA 3M53A 1A0NB 2L8DA 1YWPA 3OMGA 4PLIA 4D8KA 4ATOA 2R57A 1G3SA 5IHNA 3SWNB 2GQVA 3QBYA 1UECA 2LDMA 4FYWB 4KUDK 3G71A 1WPYA 1W2BA 1TSFA 1G3YA 3I55A 3P8BB 4GY5A 2DO3A 3NMZC 5GANd 2RHYA 2BZYA 2RHIA 4HCKA 4M77B 5GAOr 4C92G 5IH2A 1ZQ1A 2EQIA 1KHIA 1KJWA 3CCRA 1U8RA 3HSBA 4A4FA 2DIQA 2KRNA 3JAME 2BZXA 2QA4T 5LJ5g 1QKXA 2D1XA 3JB9G 1T0JA 1YJ9T 1V29B 3CD6A 1TWBA 3VS2A 2ZPBB 2F2XA 3OB9A 4QKUA 3CMEQ 2K4YA 4HCCA 4FW2A 4JLGA 3L2UA 2E3HA 4AFQC 2LJ0A 4HT9A 2RJEA 3FJ5A 2FG0A 4F7UE 1WXUA 1VYTA 1Q82C 3WVEB 1MV0B 4QVZA 4RKUE 4ORZA 4J7IA 2JJ9A 2YUNA 4Q5WA 1OOTA 4RMOA 4M75G 1VQKQ 4PKCC 4M7AF 3OYYA 2MWOA 3BY7A 1G8XA 2YRCA 4F16A 2JW4A 3NPFA 5KYWB 3S3OA 4AT1B 2YHTA 1IRXA 4JJBA 2G3RA 3HFOA 1WNLA 2CP0A 3EG0A 2OAWA 5D6YA 4FYXB 1X6OA 1AHJB 5KYUA 1QMCA 5LL6S 4C92D 4PJLA 4OMFB 1D0XA 1SSFA 4A4EA 4HA8A 3V8LA 2CYZB 1VUBA 1Q7YR 1D3BA 1BKBA 1WJQA 2DNUA 1OI1A 4LUDA 4A54A 1PHTA 1UJYA 3JCMX 2DJZA 1SHFA 1VQ4T 2MWPA 4Y91A 4KH0B 2COWA 2HSPA 1Q86C 1CKBA 2SRCA 4OP0A 4QQ6A 8AT1B 3RDVA 4CC3A 3H9NA 4RTZA 2WSEE 2YRVA 1BB9A 1PD0A 1MMAA 4J9HA 4EMKA 3G4SQ 4M7DA 3HTRA 3L42A 2DVJA 2GGRA 2GCXA 2GTJA 4MZTA 3LH0A 3JB9F 5GANf 1OV3A 1WHHA 4XQ3A 2RQRA 2XDPA 2AKKA 1PKTA 2DLPA 1KQ2A 1RAIB 4M75D 3QXEB 1YBYA 3M5AA 2XG8D 2HD0A 3M0QA 1YJNT 2DEQA 2VASA 2QQRA 2ATCB 1FMVA 4C8QG 3KFVA 2DK3A 2F2VA 1JJ2P 1AD5A 1NEGA 2VYTA 3OYLA 3CC7T 1OEBA 1E7OA 1BU1A 3OQ5A 3LWHA 4J9CA 1AZEA 1VQPT 4OMMA 1XJWB 2E1HA 4OMPA 3VKIA 1QLYA 2AKLA 3V7RA 3I56T 3PVQA 1I5OB 3CCLQ 3EG3A 5IHIA 1P92A 2DD4A 2J06A 2L3RA 3URGA 3Q1JA 1Q82R 3QZ5B 3JCMc 4E6RA 1M9SA 1HSQA 2O01E 4BI8B 4N0AA 4GLMA 1M2VA 2LJ1A 1S72T 1VA7A 2DTOA 1GCQC 4E7IA 4ZNXA 1AWOA 3OSSC 2QEXT 2W0ZA 3EGDB 1X2KA 2VGNA 2XICA 3NTHA 2MAMA 2L2PA 3M0SA 4C0FA 4RUGA
chains in the Genus database with same CATH topology
2CZ1B 4M78C 4BI3A 3X20B 3E9GA 5GMKh 3JCMh 1BYMA 3N5BB 2M1HA 2XIDA 1QVPA 3META 4BDZA 2RJCA 4L59A 3CPWA 1RI0A 2FL7A 2ZPHB 1TH7A 3CMAA 1NPRA 4RCBA 1K8AU 3OYHA 1VQ5A 2LT4A 2WSFE 4EPCA 5A0LA 5LJ5e 5GAOp 2K2VA 2V8IA 1VQMA 1G5VA 3TEEA 3MP6A 5GMKi 5C0MA 4XK8E 4BE2A 1KC8C 1UGRB 4HCBA 2XDBA 1O75A 1PSFA 3MEAA 2E12A 1JJ2S 3QIIA 3JB9D 1Q81U 2C06A 5LJ3d 3RESA 4NL2A 1Q86U 1M90U 2GFAA 2L89A 3LX7A 3QPHA 4QQDA 5DLOA 4E7HA 2EJFA 2MMPA 4FM4B 1KHCA 3OS5A 3QUIA 1N8RU 2OTLT 4N4GA 2LNVA 5I2MA 1I4K1 3M57A 1M1KC 3H6ZA 2MI6A 4A53A 3LGFA 2VGMA 3FDRA 4UC4A 4XTWA 3JCMW 3J7AF 4M78G 1NJIC 3GNGA 3QJ6A 4FT4A 5A0DA 2QQAA 2XK0A 5GAOq 4E7LA 1QW1A 3DB4A 2CZ6B 4C8QF 2BUDA 2EFIA 1UB4A 2DIGA 4M78E 2K5IA 2RK2A 3RKYA 3VU3C 3OYJA 2M9UA 3A8GB 3CCUT 1XTDA 3PIOA 2OAUA 3G6EA 3E1SA 3L1AA 2ZPIB 4MDWA 3S3MA 3BDLA 4MZMA 3OW2A 3GP8A 3CCEA 1G3WA 5GMKm 5IT9E 3CXCS 3PFSA 5GAOl 3UPUA 4DOWA 3L2RA 4P5NA 2IVWA 3L2QA 2WACA 3HHTB 2KK4A 1QVGS 4FL6A 3CCSA 2DXBA 3X24B 4BD3A 3CCMA 1N6AA 2OTLA 1RL2A 4JRPA 3JRZA 2LRQA 3HRUA 5I2SA 1YI2A 5J39A 1YHQT 5GAMe 1W2BS 3MHXA 4IKFA 2LT1A 2YLBA 4XTZA 5GANe 4C5IA 4OB3B 4II1A 4GLKA 1QVFS 1YITT 1UGPB 2CKKA 2DZCA 1VIEA 3OBWA 1YJWA 2RD1A 3A8HB 1YIJT 3J80E 2VC8A 3CBMA 2QQSA 3M56A 2BKDN 2EJGA 4NS5A 2P4TA 1OZ2A 3A8MB 3C94A 4FT2A 4LD6A 4ZGDB 5GAN7 2F69A 2EYQA 3RMSA 3JSCA 5LJ5h 5GAN2 4M78B 4M78A 2FVUA 4PJOC 3NTIA 3S6WA 4DQ2A 2KMTA 2RH2A 2K3YA 3V7CA 4D6WA 3GPLA 3P8HA 4ZN3A 3CCUA 3CCVA 3M54A 4X34A 3FJPA 4M75C 4ME7A 1JB0E 2PQWA 5IN1A 3CEYA 5HY6A 4L6V5 1PSEA 4J7FA 3CMAT 1KD1U 4LDXA 2GF7A 1VQ5T 2D6FA 5FLXE 2DVEA 1I5LA 3ZBDA 3SWNC 1VQMT 1M4ZA 2O4XB 3FEOA 2O4XA 2F5TX 2JTFA 2JOYA 3QKJA 4XTXA 4XU0A 1NPPA 4RG8A 5GAN5 3OA6A 3AHUA 4J8OA 1ZHIA 2FHDA 4B9XA 1VQLA 1YHQA 3QJYA 3A5ZB 1VQ7A 2Y90A 1XNIA 2HQXA 1BI3A 2P0QA 5CIUA 1VQ6T 4E47A 2RB6A 4M78D 3JCMV 4C0GA 5KCOA 3CCJA 3CCQA 2RI5A 2H3JA 3C95A 1YIJA 2EIFA 2LCCA 1GXIE 1QP3A 2PVDB 2E64A 4IUQA 3V8JA 2QI2A 3L2ZA 4M77C 3VYGA 3G4SA 4M7AC 2DPPB 3EFSA 4FSXA 2YLCA 2DXTA 5CAIA 4C0DC 2V8KA 4OB2B 5FU7C 3ASKA 4PJOG 4JLIA 1WGSA 2MF2A 1LJOA 2E70A 2HQEA 5KE2A 3RKWA 2QA4A 2B8AA 3ME9A 3RUXA 4PJOE 4A4KA 2FB7A 3OYDA 4KT0E 1YJ9A 2D0QB 4JDSA 2XKOC 3V8KA 2CZ0B 5CKHA 5LJ5d 3BDUA 4M75E 3JCMg 2K5FA 2K5LA 1WJRA 5KH6A 2E6ZA 4M78F 1KC8U 3KBGA 3CC2A 3G6ET 1BI0A 4CRIA 2ZPFB 4C8QD 5GAMh 4EDUA 4OGCA 5GANh 2CGHA 2LX9A 4JJNK 4BE1A 3M55A 3CCET 4MDXA 3UT1A 5LJ3f 3RMQA 5AYFA 5GAN3 4HCZA 1UGSB 2DXCA 4QVDA 1VQ6A 1LNXA 2DD5A 2RI3A 3HPWA 2KY9A 4EMHA 3RIRA 5GAN6 2JUFA 2EKOA 3SFMA 5GAMg 3JB9I 3CCMT 3CCST 5GANg 5LJ3j 1VQKT 3L2WA 2EAYA 2ZPEB 3I55T 4JRKA 1YI2T 2XI9A 1M1KU 3PGGA 4M7AG 3CPWS 3VV0A 1K8AC 2BIVA 2GFUA 1KG1A 1NJIU 1YJWT 4M77E 3CMEA 2LQKA 3PMTA 3LW5E 5FRMA 4M7AE 3ER0A 2QDYB 3EFRA 5FU6B 4C92C 3OYGA 1YCYA 4IUUA 3OYMA 2PVGB 3R6OA 3VYHB 5CVIA 2RHUA 4PJOB 2A7YA 4OF1A 3WVDB 4PJOA 3X26B 3RKXA 2D9TA 1Y7XA 3KXTA 3V7SA 3UWNA 1KQ1A 4X9CA 3LWIA 3GLXA 3M53A 3CCLA 2KAFA 4M75B 1EIFA 4XU3A 3TREA 4ZGEB 3CCVT 4MMLA 4C92F 2L8DA 2E41A 3OMGA 4PLIA 4BB7A 4ELYC 3JCMd 4IUVA 2R57A 1G3SA 4BDYA 4ATOA 4C5EA 2OTJA 1QVGA 4VUBA 2NLUA 3SWNB 3HP9A 4JUVA 2R5AA 3SWNA 5GMKj 2GQVA 3OYNA 3QBYA 3DLLA 2LDMA 4KUDK 3C4SA 3G71A 1KQSA 3O8VA 1WPYA 3PTAA 1W2BA 2RO0A 4A4GA 1G3YA 1VQKA 3VUBA 3SD4A 2PUKB 3I55A 3P8BB 4GY5A 5GAMd 2DO3A 1VQLT 2HAXA 3LLRA 5GANd 1VQ7T 2JTMA 2RHYA 4PJOD 1VQNA 2RHIA 2PUOB 2LTOA 3VUZA 4NL3A 3GIBA 3CCJT 3CCQT 4M77B 2DZ9A 4M77A 5DLQE 2K57A 4M7AB 3OYBA 4C92G 5GAOr 4M7AA 1ZQ1A 2E5QA 2ZGWA 3ZEHA 1VQ4A 3QG1A 4C0DB 1KHIA 5FU6C 4F7UF 5FU7B 3G4ST 5GAOm 1LOJA 1VIFA 5CK9A 1Y07A 5KCHA 3OW2S 4C92E 1VQOA 1WQ7A 3CCRA 4RG2A 3P8DA 3WXMB 3M59A 4JRQA 1K73U 1U8RA 3HSBA 2KSSA 4A4FA 2DIQA 2XD0A 2E10A 5DM7R 4JS5A 3FIFA 3JAME 1OYXA 4BI4A 2WSCE 2QA4T 1IREB 1FX7A 5LJ5g 1WQWA 3MO8A 3JB9G 3G7ZA 3FC3A 1YJ9T 1V29B 3PT9A 4NOYA 1VQ8T 4BACA 3CD6A 1U1TA 4PL6A 4PJOF 3MCAB 2ZPBB 4EMKC 4M7DC 3OB9A 4Z02A 3S3NA 2JNGA 4OB1B 5CKFA 3CC2T 4QQGA 2K4YA 2X4XA 4HCCA 1O9SA 1K9MC 4JLGA 4CI0C 1UGQB 2M0OA 3HRTA 4M75F 1OZ3A 3L2UA 3GNFB 3LYIA 4F7UG 1N9RA 3QHSA 4HT9A 3DB3A 1Y96B 2RJEA 4XU1A 4V2SA 3PMIA 2DAQA 2V8JA 2AHJB 4F7UE 2X4JA 4M7DF 1Q82C 3H8ZA 3HRSA 1ZBXA 3WVEB 4OB0B 4QVZA 3BFMA 3CD6T 5LJ3h 1IZ6A 4RKUE 1QP2A 3LGLA 5IAYA 1KD1C 4J7IA 1X75C 3M58A 2EWNA 2QQ9A 1N9SA 1BI2A 4MZPA 4YTLA 3OYFA 4Q5WA 4C92B 4C92A 5FROA 1U1SA 3KUFA 1BIAA 3CMET 1YJNA 4LDWA 2E6NA 3E9FA 4Y28E 2JZ2A 2DTHA 2PU9B 1Q7YC 4RMOA 3TU4K 4M75G 1I8FA 3FB9A 3HKSA 4M77F 4PKCC 5A2QE 2E65A 1DJ7B 3PIPA 5LJ5f 3OYYA 4M7AF 3CBOA 2MWOA 3BY7A 1VQ8A 2X4YA 3QSUA 2CZ7B 3CCLT 2F5KA 1FWZA 2ZPGB 3CC7A 5HKCA 3MP8A 4BE0A 4M7DG 1JJ2A 4A4HA 5HK3A 5LJ5j 4J6YA 3S3OA 2EQJA 1XQHA 2RM4A 2YHTA 4N4HA 4PLLA 3OYCA 1VQPA 2G3RA 3JB9H 3HFOA 2OTJT 4M7DE 1WNLA 5D6YA 1X6OA 3I56A 1Q7YU 4QW2A 1AHJB 2LCLA 4WF2A 4BY6C 5GAN4 3X25B 3G71T 4LDVA 2QTXA 5LL6S 4C92D 4F7UB 4F7UA 4OMFB 4TVRA 4KULA 2DKGA 4OVAA 4XTYA 1SSFA 4A4EA 4HA8A 5CKDA 1G3TA 3VJPA 4ZTJA 3MEUA 3V8LA 2CYZB 1VUBA 3GF5A 4M77G 2LC4A 1BI1A 1WJSA 1D3BB 1D3BA 4J6XA 1BKBA 1WJQA 3OSVA 2RK1A 1OI1A 4A54A 3J81E 2Y4YA 1VQNT 3OS0A 4C0ZA 4XTUA 4J6WA 3JB9J 3JCMX 4J5YA 5CKBA 2LVMA 2DJZA 2EQKA 1S72A 4N0AC 2DTIA 5GAOn 1VQ4T 5CR2A 3CC4T 2MWPA 4BUGA 1M8VA 4Y91A 5LJ3e 3DLMA 3OS2A 1Q81C 1M1FA 3OYKA 1VQOT 2R5MA 3CCRT 2FYKA 1Q86C 1M90C 1HK9A 3EAEA 4OP0A 4QQ6A 1B34B 4KBMB 1B34A 2QEXA 4M75A 5CQYA 4C8QC 3OBYA 5C6SA 3JCMf 1N8RC 5A0GA 3CXCA 2VXEA 4JS4A 3T9NA 2RHXA 2WSEE 3MP1A 2YRVA 2QQBA 5GMKl 5D6WA 4EMKB 4M7DB 4EMKA 4M7DA 4DOVA 4E7KA 4HT8A 2DXUA 3NTKA 4L5GA 4ZTFA 1HXDA 3L42A 2GCXA 2A3LA 4MZTA 4PNOA 1R8OB 3LH0A 2XU8A 2RJFA 3NFCA 4JRIA 5GAMf 4DA4A 1QVFA 4J83A 3JB9F 5GANf 1FXXA 4EMGA 3A8OB 2RHZA 4O6JA 3BW1A 4XQ3A 2JN0A 1I81A 2XDPA 1MGQA 3FRNA 3X28B 3OMCA 4ELZC 3OS1A 5GAN8 5DY9A 5GAMj 1JBMA 2LQ8A 3ZFJA 5GMKe 5GANj 3JCMe 1KQ2A 3JCMJ 2HBPA 4M75D 3SB2A 3QXEB 2P0PA 4KUIA 1YBYA 1UEBA 2EQUA 3M5AA 4N4IA 2XG8D 2EQMA 2HD0A 1NZ9A 3CC4A 2XHCA 3L2VA 2KVQG 2RI2A 5EG2A 4R56A 4IURA 1YJNT 5FRNA 2DEQA 4M7DD 2QQRA 3M9QA 1KQSS 4XTVA 4C8QG 2DK3A 3TCJA 5I21A 3QDRB 3INZA 4ZN1A 2I2LA 4XAXB 3OYIA 2VYTA 4C8QE 3JCMb 3GOXA 3OYLA 1M5Q1 3OY9A 3CC7T 5L8RE 4QVCA 3CBPA 3HFNA 1K9MU 4OGEA 3E19A 4IUTA 3MEVA 3OQ5A 2RA2A 3PNWC 4O5VA 4C5GA 3LWHA 1VQ9T 1VQPT 4M77D 3QO3A 2E1HA 4M7AD 3VKIA 5KE3A 4HKEA 4BY6B 5M9OA 3V7RA 5CO7A 1Y96A 2P0KA 4ZGJB 3I56T 1K73C 2EJ9A 2VXFA 1JRIA 3M4YA 4LDUA 5D6XA 4R55A 1Q82U 3FLGA 4XU2A 2RJDA 3DKMA 2JVVA 3RERA 1Y71A 2CS7A 4FU6A 2ZCFB 3JCMQ 2K3XA 1P92A 4MMKA 4X9DA 1MHNA 2DD4A 2L3RA 3CPFA 3URGA 3OYAA 3Q1JA 3QYGB 4LDYA 3QZ5B 5CKEA 3JCMc 5CCAA 1M9SA 2KDSA 2O01E 4BI8B 2M16A 2X35A 1W4SA 4N0AA 4E7JA 2VUBA 2VV5A 2Y4XA 5LJ3g 3UDCA 1NE8A 5CQXA 4RCCA 5J26A 1S72T 3MEWA 5HK0A 2HNIA 1H3ZA 4IUPA 2L5QA 2DTOA 3F70A 2PVOB 1XOVA 2IG0A 5J3BA 2R58A 3A8LB 4B9WA 1YITA 3JCMP 3QZ9B 4LD9K 4E7IA 2QXFA 3M4GA 4C8QB 4FIBA 4C8QA 2KQWA 3SDZA 4C5HA 3OSSC 2QEXT 3C12A 1N27A 2XDDA 2VGNA 3HL8A 2XICA 3OYEA 3NTHA 1BIBA 2MAMA 1VQ9A 2X4WA 4C0FA 2ZZDA 1M1GA 3QYHB 1H641 1X01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJO D;  2DVE A;  5CAI A;  1I5L A;  3SWN C;  2FYK A;  4NL3 A;  3GIB A;  1HK9 A;  4M78 C;  5GMK h;  4OP0 A;  4XU0 A;  1B34 B;  4XTX A;  1B34 A;  3JCM h;  4M75 A;  4M77 B;  2DZ9 A;  4M77 A;  5GAN 5;  2K57 A;  4M7A B;  4C8Q C;  4C92 G;  5GAO r;  3AHU A;  3JCM f;  4M7A A;  2ZGW A;  4F7U F;  1TH7 A;  2VXE A;  4RCB A;  5GAO m;  2Y90 A;  1LOJ A;  5GMK l;  5LJ5 e;  4EMK B;  4C92 E;  4EMK A;  5GAO p;  1WQ7 A;  4HT8 A;  4M7D A;  4M7D B;  2DXU A;  3HSB A;  2RB6 A;  4M78 D;  1HXD A;  3JCM V;  5GMK i;  2E10 A;  3FIF A;  5GAN 2;  4PNO A;  2E64 A;  3V8J A;  3L2Z A;  4M77 C;  5LJ5 g;  4JRI A;  5GAM f;  1WQW A;  3JB9 D;  3JB9 G;  4M7A C;  3JB9 F;  3EFS A;  5GAN f;  2YLC A;  4NOY A;  2DXT A;  4EMG A;  5LJ3 d;  4XQ3 A;  1U1T A;  3BW1 A;  2JN0 A;  1I81 A;  4NL2 A;  1MGQ A;  4PJO G;  4JLI A;  3RES A;  4PJO F;  5GAN 8;  4EMK C;  2EJF A;  5DY9 A;  5GAM j;  4M7D C;  1LJO A;  1JBM A;  5GMK e;  5GAN j;  3QUI A;  3JCM e;  3RKW A;  1KQ2 A;  3JCM J;  3RUX A;  4M75 D;  3SB2 A;  4PJO E;  4M75 F;  1I4K 1;  2FB7 A;  4F7U G;  1N9R A;  3QHS A;  4HT9 A;  3V8K A;  4A53 A;  1Y96 B;  4XU1 A;  5LJ5 d;  4V2S A;  3BDU A;  4M75 E;  3JCM g;  4XTW A;  3JCM W;  4F7U E;  4M7D D;  4M7D F;  2DEQ A;  4M78 G;  4M78 F;  4XTV A;  5GAO q;  4C8Q D;  4C8Q G;  5GAM h;  4C8Q F;  5I21 A;  3BFM A;  5GAN h;  5LJ3 h;  2CGH A;  3INZ A;  4M78 E;  2I2L A;  2EWN A;  5LJ3 f;  5GAN 3;  1N9S A;  4C8Q E;  3JCM b;  3RKY A;  3VU3 C;  1M5Q 1;  4C92 B;  1LNX A;  1U1S A;  4C92 A;  1BIA A;  4EMH A;  4QVD A;  3RIR A;  5GAN 6;  4QVC A;  3HFN A;  5GAM g;  3JB9 I;  5GAN g;  2DTH A;  5LJ3 j;  5LJ3 e;  2EAY A;  3L1A A;  2RA2 A;  4JRK A;  4M75 G;  3PGG A;  1I8F A;  3QO3 A;  2E1H A;  3FB9 A;  4M77 D;  4M77 F;  5GMK m;  4M7A G;  4M7A F;  4M7A D;  2E65 A;  5LJ5 f;  5GAO l;  3QSU A;  3BY7 A;  3V7R A;  1Y96 A;  2EJ9 A;  2VXF A;  4M77 E;  1JRI A;  4M7A E;  4M7D G;  3EFR A;  4C92 C;  4XU2 A;  5LJ5 j;  1YCY A;  4J6Y A;  3RER A;  2YHT A;  3JB9 H;  2RM4 A;  5GAM e;  3JCM Q;  4PJO B;  3HFO A;  2YLB A;  4MMK A;  4X9D A;  4XTZ A;  5GAN e;  4M7D E;  3RKX A;  4PJO A;  1WNL A;  3V7S A;  1KQ1 A;  2DZC A;  4X9C A;  4WF2 A;  5GAN 4;  3JCM c;  2RD1 A;  4M75 B;  2VC8 A;  4XU3 A;  2QTX A;  4C92 D;  4N0A A;  4MML A;  4C92 F;  4F7U B;  4F7U A;  2EJG A;  2DKG A;  2E41 A;  5LJ3 g;  4XTY A;  3JCM d;  4RCC A;  4HA8 A;  5GAN 7;  2HNI A;  3V8L A;  5LJ5 h;  4M77 G;  2DTO A;  4JUV A;  3SWN B;  1D3B B;  3SWN A;  1D3B A;  4J6X A;  4M78 B;  5GMK j;  4M78 A;  4PJO C;  3JCM P;  4A54 A;  4DQ2 A;  3M4G A;  4XTU A;  4C8Q B;  4C8Q A;  3V7C A;  1WPY A;  4J6W A;  3JB9 J;  3JCM X;  4J5Y A;  3FJP A;  4M75 C;  2DJZ A;  4N0A C;  1BIB A;  2DTI A;  5GAO n;  5GAM d;  5GAN d;  1M8V A;  4Y91 A;  1H64 1;  1X01 A; 
#chains in the Genus database with same CATH topology
 1W2B P;  3I5S A;  3CC4 Q;  1OPL A;  2RNA A;  3E9G A;  2XMF A;  1EZZ B;  2M1H A;  4L59 A;  1RI0 A;  2FL7 A;  1TH7 A;  2X9H A;  2HL5 C;  2QG9 B;  2LT4 A;  4EPC A;  5LJ5 e;  2K2V A;  2DIL A;  2HZY A;  3D7S B;  4JJC A;  2NUZ A;  4XK8 E;  2OI3 A;  4FYY B;  2GFA A;  1KC8 R;  4E7H A;  3OS5 A;  3M0T A;  2YUP A;  4PFO A;  4F14 A;  3M57 A;  4A53 A;  1Q86 R;  2E5K A;  4XTW A;  1NJI C;  2EW3 A;  1ZA2 B;  2CZ6 B;  4C8Q F;  2BUD A;  2EFI A;  3AT1 B;  2FRW A;  3A8G B;  3CCU T;  1XTD A;  1TUG B;  3L1A A;  1PG5 B;  2ZPI B;  4MDW A;  1HYO A;  3BDL A;  2BZ8 A;  3OW2 A;  1TXQ A;  1G3W A;  3CCE A;  5IT9 E;  3CXC S;  3PFS A;  1VQ9 Q;  4P5N A;  4FL6 A;  4KGX B;  3X24 B;  1QWE A;  1N6A A;  2OTL A;  1RL2 A;  1YI2 A;  5GAM e;  1BCM A;  2LT1 A;  4XTZ A;  2CSQ A;  5KYY A;  4C5I A;  1QVF S;  1YIT T;  1UGP B;  2A36 A;  2CKK A;  1YJW A;  2RD1 A;  3UF4 A;  1UE9 A;  2BKD N;  2P84 A;  4FT2 A;  3C94 A;  3U23 A;  3JSC A;  1T0H A;  2A08 A;  4M78 A;  2FVU A;  4PJO C;  3NTI A;  4DBR A;  4DQ2 A;  2KMT A;  1WFW A;  2PQW A;  2VKN A;  2X3X D;  2PTK A;  4D8D A;  4J7F A;  2VVK A;  4LDX A;  4AG2 C;  1ZUU A;  1I5L A;  2A28 A;  1VQM T;  1WYX A;  2O4X A;  2JTF A;  3QKJ A;  4XU0 A;  1NPP A;  1D1C A;  1ZHI A;  2FHD A;  1WDX A;  4B9X A;  2EPD A;  1QQJ A;  3A5Z B;  2Y90 A;  2P0Q A;  5CIU A;  5IXB A;  1M27 C;  2H3J A;  3C95 A;  2GBQ A;  2EIF A;  3LH5 A;  2LCC A;  4KH1 B;  4IUQ A;  3G6E Q;  4AFZ C;  3BE3 A;  2MF2 A;  1LJO A;  2DE0 X;  2ZAE A;  3CCM Q;  2QA4 A;  3ME9 A;  2CP3 A;  3RUX A;  2FPD A;  4KT0 E;  5HCK A;  1YJ9 A;  5LJ5 d;  1MMG A;  4M75 E;  2HMA A;  1SHG A;  2K5F A;  2K5L A;  1WJR A;  1KC8 U;  2ECZ A;  1PKS A;  3QWX X;  3KBG A;  4CRI A;  4OGC A;  2CGH A;  3UT1 A;  3RMQ A;  1K0S A;  2DXC A;  1LNX A;  3HPW A;  1RAH B;  3RIR A;  3EG2 A;  3JB9 I;  3CCS T;  1VQK T;  3H41 A;  3CPW S;  2BIV A;  2AK5 A;  2DM1 A;  3ER0 A;  3EFR A;  2JT4 A;  4GBQ A;  1YCY A;  3OYM A;  3R6O A;  1JU5 C;  2RHU A;  4PJO B;  2KYB A;  3RKX A;  1V1C A;  2YUO A;  1TUC A;  3LWI A;  2DYB A;  1ZUY A;  1YWO A;  1EIF A;  2O88 A;  1G2B A;  3CCJ Q;  1ZSZ A;  3CCQ Q;  1YIJ Q;  2E41 A;  3JCM d;  1TTH B;  1ZA1 B;  4IUV A;  1QVG A;  4VUB A;  2NLU A;  3OYD A;  4JUV A;  5GMK j;  3MKD A;  3DLL A;  3VS7 A;  1KQS A;  3EG9 A;  2JTE A;  3O8V A;  2EYW A;  1K9A A;  2CRE A;  2RO0 A;  4A4G A;  3ZL7 C;  3SD4 A;  2HDA A;  1I07 A;  5GAM d;  2HAX A;  1VQ7 T;  4PFP A;  2PUO B;  3GIB A;  4IIO A;  2GNC A;  2K57 A;  4M7A A;  2ZGW A;  3ZEH A;  1VQ4 A;  4F7U F;  3G4S T;  5FU6 C;  1Y07 A;  4JRQ A;  3P8D A;  1AT1 B;  4DBF A;  1OYX A;  4BI4 A;  2WSC E;  1WQW A;  3MO8 A;  3FC3 A;  3PT9 A;  2NUP A;  3MCA B;  4WCI A;  3S3N A;  4J9I A;  2JNG A;  1YNZ A;  8ATC B;  1UGQ B;  2M0O A;  1OZ3 A;  3PMI A;  2AHJ B;  1R77 A;  1I0C A;  2X4J A;  4B6M A;  3H8Z A;  4OB0 B;  1NYF A;  9ATC B;  2EKH A;  1KD1 C;  1M3B A;  3M58 A;  1TS9 A;  5FW9 A;  1BI2 A;  4KGV B;  4YTL A;  2C0T A;  4C92 A;  5FRO A;  1U1S A;  1YJN A;  1W6X A;  3G71 Q;  2JZ2 A;  1M2V B;  2PU9 B;  4KRT A;  1B7T A;  4M77 F;  3I55 Q;  2RF0 A;  1IO6 A;  1DJ7 B;  2E65 A;  5LJ5 f;  3PIP A;  1VQ8 A;  2X4Y A;  2HEQ A;  3CCL T;  3CC7 A;  3OW2 P;  1JJ2 A;  4A4H A;  2EQJ A;  4N4H A;  2J6O A;  3OYC A;  1VQP A;  4PLL A;  2OTJ T;  2OX7 A;  1FMK A;  4M7D E;  3M0U A;  2HKN A;  3I56 A;  4WF2 A;  3X25 B;  3CCR Q;  1RAG B;  2QTX A;  4F7U B;  4TVR A;  2DKG A;  2H8H A;  4XTY A;  5CKD A;  3CCV Q;  2KYM A;  3MEU A;  4ZTJ A;  1M8M A;  2LC4 A;  1BI1 A;  1WJS A;  1VQN T;  3CD6 Q;  4FYV B;  4C0Z A;  4XTU A;  2K9G A;  4J6W A;  3JB9 J;  5CKB A;  3VRY A;  2EQK A;  2ROT A;  1S72 A;  2DTI A;  2EGA A;  3CC4 T;  5LJ3 e;  1KSW A;  1VQL Q;  1VQO T;  2FYK A;  2VB6 A;  4PJJ A;  3EAE A;  1WHK A;  1FMW A;  2QEX A;  1B34 A;  1C0M A;  4M75 A;  3JCM f;  1I1J A;  2VXE A;  1YCS B;  4JS4 A;  2IPO B;  4Z8A A;  2QQB A;  1CKA A;  3GBQ A;  4HT8 A;  2G6F X;  4ZTF A;  5L23 A;  3NFC A;  5GAM f;  1FXX A;  4EMG A;  3A8O B;  3FRN A;  1MGQ A;  4X1V A;  3OMC A;  5GAN 8;  2HQH A;  5GAN j;  3ZFJ A;  4J9F A;  1AWW A;  1MMN A;  3SB2 A;  3CC2 Q;  4OMQ A;  2P0P A;  4KUI A;  2EQU A;  1NZ9 A;  2RI2 A;  5EG2 A;  3VS5 A;  4IUR A;  4R56 A;  3E2U A;  3M9Q A;  4EIK A;  3TCJ A;  1SRM A;  3ULR B;  4Z89 A;  1JXO A;  2NUT B;  4XAX B;  3JCM b;  3GOX A;  4WTO B;  2DBM A;  3HFN A;  1KK7 A;  4OGE A;  1UFF A;  3E19 A;  4O5V A;  3PNW C;  1VQ9 T;  3QO3 A;  4M7A D;  4DEY A;  2DRK A;  4ZGJ B;  2P0K A;  1B3Q A;  3M4Y A;  4LDU A;  5D6X A;  4R55 A;  2BE9 B;  4XU2 A;  1ARK A;  3DKM A;  1Y71 A;  4FU6 A;  1ZUK A;  4MMK A;  2HBW A;  1RAC B;  5CCA A;  1KIK A;  2X35 A;  1KD1 R;  3UDC A;  1NE8 A;  5HK0 A;  2HNI A;  3F70 A;  2IG0 A;  1YIT A;  5GJW B;  3JCM P;  2QXF A;  4FIB A;  4C8Q A;  1QKW A;  3C12 A;  1QVG P;  3OYE A;  3HL8 A;  1KQS P;  3RNJ A;  2FZC B;  1H64 1;  2L3Q A;  1X6G A;  1E6H A;  2IIM A;  5GMK h;  3X20 B;  3JCM h;  3EH2 A;  3N5B B;  3MET A;  2ZPH B;  3RR6 A;  5GAO p;  1NG2 A;  2V26 A;  1VQM A;  5GMK i;  5C0M A;  1RAD B;  1IGQ A;  1KC8 C;  2XDB A;  1O75 A;  2E12 A;  4RTV A;  3JB9 D;  2YT6 A;  5LJ3 d;  3RES A;  1TG0 A;  1M90 U;  2L89 A;  3QPH A;  4QQD A;  2EJF A;  2MMP A;  1SPK A;  1X2Q A;  1KHC A;  4AMC A;  2EYY A;  5I2M A;  2K2M A;  2CH4 A;  2F1L A;  3LGF A;  2KBT A;  4UC4 A;  1H8K A;  3GNG A;  3QJ6 A;  5A0D A;  1M1K R;  2XK0 A;  1QW1 A;  3DB4 A;  2EYX A;  3G1J A;  4M78 E;  3IQL A;  4LE9 A;  4FW1 A;  1W1F A;  3RKY A;  2X3W D;  3VU3 C;  2M9U A;  2DJQ A;  1OX8 A;  3S3M A;  3GP8 A;  1Q95 G;  4DOW A;  3L2R A;  2QDL A;  2WAC A;  1F1B B;  3CCS A;  4BD3 A;  3JRZ A;  2FZG B;  3VS1 A;  3NGP A;  2CUB A;  4IIM A;  4II1 A;  2DZC A;  1YIJ T;  3CBM A;  2QQS A;  1U3O A;  4LXC A;  3UA7 A;  3M56 A;  1TUD A;  4LD6 A;  2EYQ A;  1NEB A;  2RH2 A;  2K3Y A;  1U06 A;  2HL3 A;  4M75 C;  3A98 A;  3CEY A;  5HY6 A;  1TOV A;  2RPN A;  3CMA T;  2NUP B;  1KD1 U;  2GF7 A;  1VQ5 T;  2DVE A;  3ZBD A;  4CC2 A;  2M02 A;  3FEO A;  2F5T X;  4XTX A;  2O2O A;  4RTU A;  4Y92 A;  1YHQ A;  3QJY A;  1VQ7 A;  1SEM A;  5IHK A;  2YUQ A;  4E47 A;  3JCM V;  5KCO A;  3EGX A;  1GXI E;  1WIE A;  2E64 A;  3VYG A;  3H0I A;  3G4S A;  4C0D C;  3CCE Q;  4OB2 B;  5FU7 C;  3ASK A;  5GJV B;  4PJO G;  1WGS A;  2COZ A;  3RKW A;  1H3H A;  1WA7 A;  2B8A A;  2MIO A;  2ROL A;  2OTL Q;  2J6F A;  2CP7 A;  1YI2 Q;  4JDS A;  2XKO C;  3V8K A;  1WXT A;  2BTT A;  1Y0M A;  2KI7 A;  5KH6 A;  1YJW Q;  2KE9 A;  2ZPF B;  4C8Q D;  5GAN h;  1VOM A;  2LX9 A;  4BE1 A;  5LJ3 f;  2F2W A;  1UGS B;  3M0P A;  4QVD A;  1VQ6 A;  2RI3 A;  2DD5 A;  1UUE A;  5GAN g;  3I55 T;  2XI9 A;  1M1K U;  3PGG A;  2JMA A;  2LQW A;  2RQV A;  1K8A C;  3VV0 A;  1X69 A;  2ED1 A;  2LMJ A;  1KG1 A;  4M7A E;  2CH4 W;  4IUU A;  3WVD B;  1Y7X A;  1KQ1 A;  3CCL A;  1OU9 A;  4M75 B;  2LNH B;  2CP5 A;  4XU3 A;  3TRE A;  4ZGE B;  3CCV T;  4MML A;  2YXY A;  4ELY C;  2OTJ A;  4BDY A;  4C5E A;  3CD6 T;  3HP9 A;  3SWN A;  2DL7 A;  3OYN A;  1ZBJ A;  2A37 A;  3C4S A;  2MPX C;  3VUB A;  1UG1 A;  2QA4 Q;  2H3E B;  1VQL T;  2MOX A;  1PWT A;  2JTM A;  4PJO D;  1YJ9 Q;  1VQN A;  2LTO A;  3VUZ A;  4FCY A;  1J3T A;  1FYN A;  2MK5 A;  4M77 A;  5DLQ E;  1R0C B;  3O5Z A;  3QG1 A;  4C0D B;  2AIR B;  2RQT A;  1C1A A;  5FU7 B;  1LOJ A;  1VIF A;  5CK9 A;  3OW2 S;  4C92 E;  1VQO A;  1WQ7 A;  2ENM A;  3WXM B;  3M59 A;  1RAF B;  2XD0 A;  5DM7 R;  3FIF A;  1IRE B;  2AZV A;  3G7Z A;  4NOY A;  1PC0 A;  4PJO F;  4EMK C;  4M7D C;  1V76 A;  4Z02 A;  4OB1 B;  5CKF A;  3CC2 T;  2P4R A;  1O9S A;  1NLO C;  4CI0 C;  2OJ2 A;  3LYI A;  4F7U G;  1N9R A;  3QHS A;  3DB3 A;  4XU1 A;  4HXJ A;  3UAT A;  4M7D F;  3HRS A;  2KR3 A;  5LJ3 h;  1IZ6 A;  5IAY A;  1QP2 A;  3LGL A;  2YSQ A;  2EWN A;  2QGG A;  1N9S A;  3OYF A;  1EX4 A;  3KUF A;  3CME T;  4Y28 E;  1SF9 A;  3E9F A;  1UTI A;  2DTH A;  3FB9 A;  4F04 B;  2DYI A;  2FPE A;  1OQK A;  2CZ7 B;  2E3I A;  1FWZ A;  3MP8 A;  5KYW A;  5LJ5 j;  4J6Y A;  1ZSG A;  1YN8 A;  1WHL A;  1VQ4 Q;  4QW2 A;  2M51 A;  2LCL A;  4BY6 C;  2PNI A;  5KYU B;  1K76 A;  4LDV A;  4KUL A;  4OVA A;  2JS0 A;  2JM9 A;  3GF5 A;  4M77 G;  1D3B B;  4J6X A;  1D09 B;  4PJM A;  3OSV A;  3J81 E;  2RK1 A;  2O9V A;  4RTY A;  2JXB A;  1Z9Q A;  4HVU A;  4J5Y A;  1OPK A;  1K8A R;  4N0A C;  4JJD A;  5GAO n;  1M8V A;  1PD1 A;  3DLM A;  1M1F A;  3OYK A;  2J6K A;  1M90 C;  4KBM B;  3OBY A;  4K11 A;  5C6S A;  1Q81 R;  5A0G A;  2EGC A;  3T9N A;  5GMK l;  4EMK B;  3MPU B;  4M7D B;  4DOV A;  2DXU A;  3NTK A;  4JZ4 A;  1N8R R;  2EVR A;  2A3L A;  1YJN Q;  2CP2 A;  2ABL A;  4PNO A;  2XU8 A;  1X27 A;  4RTW A;  4J9E A;  4PK4 A;  1GCP A;  2RHZ A;  4ELZ C;  1VYU A;  1PM3 A;  1I81 A;  1VQ8 Q;  2NYS A;  5DY9 A;  5GAM j;  1JBM A;  2LQ8 A;  3CC7 Q;  2L3P A;  3JCM J;  2RN8 A;  2HBP A;  2MCN A;  3VS4 A;  1ACM B;  1SKU B;  2EYZ A;  1VQP Q;  2M0Y A;  1UEB A;  1GL5 A;  2EQM A;  2V1Q A;  2XHC A;  1JQQ A;  5FRN A;  5AT1 B;  1KQS S;  1LCK A;  2QK0 A;  1T3S A;  4XTV A;  1IHV A;  2L0A A;  5I21 A;  3QDR B;  3INZ A;  1ZX6 A;  2I2L A;  4C8Q E;  3REA B;  1M5Q 1;  3OY9 A;  4QVC A;  2CUD A;  1K9M U;  2LCS A;  4IUT A;  3MEV A;  2KT1 A;  4M77 D;  1SG5 A;  1S72 Q;  5KE3 A;  4HKE A;  4BY6 B;  5M9O A;  1AWJ A;  1Y96 A;  1K73 C;  2VXF A;  4OML A;  2RQW A;  5I22 A;  2DMO A;  2C0O A;  2QEX Q;  3RER A;  2CS7 A;  2ZCF B;  4X9D A;  3OYA A;  3QYG B;  5CKE A;  3SHW A;  2VUB A;  2VV5 A;  2Y4X A;  4RCC A;  5J26 A;  3MEW A;  1H3Z A;  4IUP A;  2PVO B;  1XOV A;  3A8L B;  3M4G A;  5EC7 A;  3CXC P;  3EGX B;  7AT1 B;  2KQW A;  3SDZ A;  2O9S A;  1N27 A;  3EGD A;  1OU8 A;  5FWC A;  1BIB A;  1VYV A;  2X4W A;  2ZZD A;  2QGF B;  1X01 A;  1IXD A;  2CZ1 B;  4M78 C;  1X6B A;  2RQU A;  3EHQ A;  1WHJ A;  2RJC A;  3CMA A;  1K8A U;  3OYH A;  1VQ5 A;  2DL3 A;  2WSF E;  1RUW A;  3EFO A;  1QCF A;  3VS0 A;  1G5V A;  3MP6 A;  2FPF A;  4J9D A;  4OMN A;  4BE2 A;  1UGR B;  2K79 A;  4HCB A;  1PSF A;  1JJ2 S;  2X51 A;  1WI7 A;  1Q81 U;  1Y57 A;  2C06 A;  2HCK A;  4NL2 A;  3LX7 A;  1WHG A;  1AVZ C;  3QUI A;  1N8R U;  2OTL T;  2D8J A;  1QCN A;  1OX9 A;  1GRI A;  3I5R A;  1M1K C;  1K4U S;  3H6Z A;  2MI6 A;  1Z9Z A;  1M90 R;  3JCM W;  4AG1 C;  3TSZ A;  2QQA A;  5GAO q;  4E7L A;  4J9G A;  1UB4 A;  1B07 A;  2DF6 A;  1YIT Q;  3PIO A;  2E4H A;  5GMK m;  1NBE B;  5GAO l;  2IVW A;  3HHT B;  1RAB B;  2DXB A;  2EGE A;  2KRS A;  4CC7 A;  5I2S A;  3TQ7 P;  1W2B S;  4A63 B;  5KYY B;  2LX7 A;  1GCQ A;  2DBK A;  4CC4 B;  1VIE A;  3OBW A;  4HVW A;  2JS2 A;  2YDL A;  3A8H B;  3J80 E;  2VC8 A;  1VQM Q;  1C6V X;  4ESR A;  2EJG A;  4NS5 A;  1OZ2 A;  1LPL A;  3RMS A;  5LJ5 h;  1MUZ A;  4M78 B;  1AZG B;  1WX6 A;  3CPW P;  4FSS A;  3V7C A;  2DER A;  3P8H A;  3CCU A;  3CCV A;  3M54 A;  4X34 A;  3FJP A;  4M4Z A;  1JB0 E;  5IN1 A;  4Z88 A;  1ZSZ C;  2KXD A;  1K73 R;  1D0Z A;  2D6F A;  5FLX E;  1M30 A;  3R6N A;  1M4Z A;  2FZK B;  2O4X B;  4RG8 A;  5GAN 5;  3OA6 A;  3AHU A;  3VS6 A;  4F17 A;  4R0K A;  3UA6 A;  1VQL A;  2HQX A;  2QYZ A;  2AZS A;  1WXB A;  2RMO A;  2RB6 A;  3THK A;  2RI5 A;  5D7U A;  3TVT A;  4AFS C;  4RTX A;  1MV3 A;  3L2Z A;  1U5S A;  4M7A C;  2DPP B;  2YLC A;  2PZ1 A;  5CAI A;  2JM8 A;  6AT1 B;  4AFU C;  2E70 A;  5KE2 A;  2FEI A;  3CCS Q;  1EFN A;  3I9Q A;  4A4K A;  3A1P A;  2CZ0 B;  5CKH A;  3RBB B;  1UDL A;  1HD3 A;  3JCM g;  3CC2 A;  3G6E T;  1BI0 A;  5GAM h;  1YP5 A;  4EDU A;  4JJN K;  1M3A A;  3M55 A;  4HCZ A;  4EMH A;  2JUF A;  2EKO A;  3SFM A;  5GAM g;  3CCM T;  5LJ3 j;  3L2W A;  2EAY A;  2ZPE B;  1GBQ A;  2EBP A;  4M77 E;  3CME A;  1K0X A;  4C92 C;  2DX1 A;  5ECA A;  2PVG B;  5I11 A;  5CVI A;  4PJO A;  3X26 B;  1NLP C;  1YHQ Q;  3V7S A;  3UWN A;  1VQ7 Q;  4X9C A;  3GLX A;  1RI9 A;  2KAF A;  4QT7 A;  1ZSZ B;  4C92 F;  1AWX A;  2J05 A;  2YRD A;  4BB7 A;  2DFU A;  1MMD A;  2DRM A;  2R5A A;  1M3C A;  3EG9 B;  1R0B G;  3PTA A;  2ESW A;  3EGU A;  1VQK A;  2PUK B;  1X43 A;  2CT4 A;  3LLR A;  1HJD A;  2K6D A;  3VRZ A;  4NL3 A;  3CCJ T;  3CCQ T;  4JPB W;  3OYB A;  2DZ9 A;  4M7A B;  2E5Q A;  3CQT A;  5GAO m;  5KCH A;  1K73 U;  4RG2 A;  1PRM C;  2KSS A;  1PRL C;  1VQ6 Q;  2E10 A;  4JS5 A;  2DEU A;  1FX7 A;  2K3B A;  1GBR A;  1UHC A;  1VQ8 T;  4BAC A;  1U1T A;  1LVK A;  4HVV A;  4PL6 A;  3EHR A;  2D0N A;  4QQG A;  2X4X A;  3VS3 A;  1K9M C;  2W10 A;  5KYX A;  3HRT A;  1UHF A;  4M75 F;  4LNP A;  3GNF B;  2CT3 A;  1Y96 B;  4V2S A;  2DAQ A;  2V8J A;  3REB B;  1ZBX A;  2DA9 A;  2YWW A;  3BFM A;  2CDT A;  2OTJ Q;  1X75 C;  2QQ9 A;  4MZP A;  4C92 B;  1BIA A;  4LDW A;  2E6N A;  3TU4 K;  1I8F A;  1NYG A;  3HKS A;  2KEA A;  5A2Q E;  2DET A;  3CBO A;  3QSU A;  2F5K A;  2ZPG B;  1VQN Q;  5HKC A;  4BE0 A;  4M7D G;  5HK3 A;  1AOJ A;  1XQH A;  2RM4 A;  3JB9 H;  1SSH A;  5KYN A;  1Q7Y U;  2SEM A;  5GAN 4;  3G71 T;  1VQO Q;  1WLP B;  1K1Z A;  1JO8 A;  4F7U A;  1G3T A;  2K7A A;  3VJP A;  3EFO B;  2Y4Y A;  3OS0 A;  2LVM A;  5CR2 A;  4BUG A;  4E7S A;  3OS2 A;  1Q81 C;  2R5M A;  3CCR T;  1HK9 A;  1B34 B;  1D1B A;  5CQY A;  4C8Q C;  1N8R C;  3CXC A;  2JMC A;  2KXC A;  2RHX A;  3MP1 A;  5D6W A;  4E7K A;  4L5G A;  1HXD A;  2A0F B;  1R8O B;  2KT8 A;  2RJF A;  4JRI A;  4DA4 A;  1QVF A;  4J83 A;  1G83 A;  4O6J A;  3BW1 A;  2JN0 A;  3X28 B;  3OS1 A;  2D8H A;  5GMK e;  2BE7 D;  3TSW A;  3JCM e;  1PCX A;  4KGZ B;  1D1A A;  3H0F A;  4N4I A;  3CC4 A;  1QCO A;  1WZO A;  3L2V A;  2KVQ G;  4M7D D;  3H0H A;  4LUE A;  3EG1 A;  1RAA B;  2Z0W A;  4ZN1 A;  2NUT A;  2L3S A;  3OYI A;  3PE0 A;  1IHW A;  1SRL A;  5L8R E;  3CBP A;  3SEM A;  3I35 A;  2RA2 A;  4C5G A;  4DEX A;  5CO7 A;  2EJ9 A;  1GFC A;  1JRI A;  2C0I A;  2DL8 A;  1Q82 U;  1T3L A;  2QAS A;  3FLG A;  4ANJ A;  1K9M R;  2RJD A;  1UJ0 A;  2JVV A;  3JCM Q;  2K3X A;  1MHN A;  3MJX A;  3CPF A;  4LDY A;  2HSE B;  2KDS A;  2M16 A;  1W4S A;  1YFN A;  3JV3 A;  4E7J A;  2AT1 B;  5LJ3 g;  5CQX A;  1OUL A;  2L5Q A;  5J3B A;  2R58 A;  4B9W A;  3QZ9 B;  4LD9 K;  4C8Q B;  2FRY A;  4C5H A;  2XDD A;  4E2F B;  1VQ9 A;  3C0C A;  1M1G A;  3QYH B;  1H92 A;  2DL5 A;  1ZLM A;  4PJN A;  4BI3 A;  1BYM A;  5FWB A;  2XID A;  1QVP A;  4BDZ A;  1PNJ A;  3CPW A;  4LN2 A;  2VWF A;  1NPR A;  4RCB A;  2HKQ B;  1N5Z A;  5A0L A;  1RLQ C;  2V8I A;  1BCO A;  3TEE A;  3QDF A;  3MEA A;  3QII A;  1UGV A;  1Q86 U;  2COY A;  2LZ6 B;  1NM7 A;  5DLO A;  4FM4 B;  4N4G A;  2DL4 A;  2LNV A;  1I4K 1;  2MYS A;  2VGM A;  3FDR A;  3J7A F;  4M78 G;  4FT4 A;  2FO0 A;  2I0N A;  2DIG A;  1ABQ A;  1IGU A;  2K5I A;  2GQI A;  1NJI R;  2RK2 A;  3OYJ A;  2J7I A;  2OAU A;  3G6E A;  2QAZ A;  3E1S A;  4MZM A;  4E7Z A;  3UPU A;  1E6G A;  1M2O A;  4J9B A;  1KFZ A;  1CSK A;  3L2Q A;  1QVG S;  2KK4 A;  2KRM A;  4PFZ A;  1RAE B;  3I56 Q;  3CCM A;  2LP5 A;  4JRP A;  2LRQ A;  3HRU A;  2CSI A;  2O31 A;  5J39 A;  1YHQ T;  3MHX A;  4IKF A;  2YLB A;  2KGT A;  5GAN e;  1JXM A;  4DBQ A;  4OB3 B;  3CMA Q;  4GLK A;  1VQ5 Q;  3NHN A;  2P4T A;  3A8M B;  4ZGD B;  5GAN 7;  2F69 A;  5GAN 2;  1D0Y A;  3S6W A;  4RTT A;  4OMO A;  4D6W A;  3GPL A;  2KRO A;  4ZN3 A;  3EH1 A;  3QWY A;  4ME7 A;  4L6V 5;  1MND A;  1PSE A;  4JZ3 A;  1BK2 A;  3SWN C;  1MNE A;  2JOY A;  4J8O A;  5KYX B;  1QWF A;  1XNI A;  1BI3 A;  1VQ6 T;  4M78 D;  4C0G A;  3CCJ A;  3CCQ A;  1YIJ A;  2GTO A;  1QP3 A;  2PVD B;  1S1N A;  3V8J A;  2QI2 A;  4M77 C;  3EFS A;  4FSX A;  2DXT A;  2V8K A;  4JLI A;  1RLP C;  1QVF P;  2HQE A;  1BBZ A;  4PJO E;  1TU0 B;  1GFD A;  1JEG A;  2FB7 A;  1AEY A;  2D0Q B;  3PVL A;  2B86 A;  3BDU A;  2V1R A;  1ABO A;  2E6Z A;  4M78 F;  1IB8 A;  3CCE T;  4MDX A;  5AYF A;  5GAN 3;  2NWM A;  1Q7Y C;  2CP6 A;  2KY9 A;  5GAN 6;  3CCU Q;  4JRK A;  1YI2 T;  2QTV A;  3M0R A;  4M7A G;  2ED0 A;  2KNB B;  2GFU A;  1NJI U;  2LJ3 A;  1YJW T;  5FRM A;  2LQK A;  3PMT A;  1WHM A;  3LW5 E;  2QDY B;  5FU6 B;  3OYG A;  5IXF A;  2LQN A;  3VYH B;  2A7Y A;  4OF1 A;  2D9T A;  1W70 A;  3KXT A;  4DBH A;  3M53 A;  1A0N B;  2L8D A;  1YWP A;  3OMG A;  4PLI A;  4D8K A;  4ATO A;  2R57 A;  1G3S A;  5IHN A;  3SWN B;  2GQV A;  3QBY A;  1UEC A;  2LDM A;  4FYW B;  4KUD K;  3G71 A;  1WPY A;  1W2B A;  1TSF A;  1G3Y A;  3I55 A;  3P8B B;  4GY5 A;  2DO3 A;  3NMZ C;  5GAN d;  2RHY A;  2BZY A;  2RHI A;  4HCK A;  4M77 B;  5GAO r;  4C92 G;  5IH2 A;  1ZQ1 A;  2EQI A;  1KHI A;  1KJW A;  3CCR A;  1U8R A;  3HSB A;  4A4F A;  2DIQ A;  2KRN A;  3JAM E;  2BZX A;  2QA4 T;  5LJ5 g;  1QKX A;  2D1X A;  3JB9 G;  1T0J A;  1YJ9 T;  1V29 B;  3CD6 A;  1TWB A;  3VS2 A;  2ZPB B;  2F2X A;  3OB9 A;  4QKU A;  3CME Q;  2K4Y A;  4HCC A;  4FW2 A;  4JLG A;  3L2U A;  2E3H A;  4AFQ C;  2LJ0 A;  4HT9 A;  2RJE A;  3FJ5 A;  2FG0 A;  4F7U E;  1WXU A;  1VYT A;  1Q82 C;  3WVE B;  1MV0 B;  4QVZ A;  4RKU E;  4ORZ A;  4J7I A;  2JJ9 A;  2YUN A;  4Q5W A;  1OOT A;  4RMO A;  4M75 G;  1VQK Q;  4PKC C;  4M7A F;  3OYY A;  2MWO A;  3BY7 A;  1G8X A;  2YRC A;  4F16 A;  2JW4 A;  3NPF A;  5KYW B;  3S3O A;  4AT1 B;  2YHT A;  1IRX A;  4JJB A;  2G3R A;  3HFO A;  1WNL A;  2CP0 A;  3EG0 A;  2OAW A;  5D6Y A;  4FYX B;  1X6O A;  1AHJ B;  5KYU A;  1QMC A;  5LL6 S;  4C92 D;  4PJL A;  4OMF B;  1D0X A;  1SSF A;  4A4E A;  4HA8 A;  3V8L A;  2CYZ B;  1VUB A;  1Q7Y R;  1D3B A;  1BKB A;  1WJQ A;  2DNU A;  1OI1 A;  4LUD A;  4A54 A;  1PHT A;  1UJY A;  3JCM X;  2DJZ A;  1SHF A;  1VQ4 T;  2MWP A;  4Y91 A;  4KH0 B;  2COW A;  2HSP A;  1Q86 C;  1CKB A;  2SRC A;  4OP0 A;  4QQ6 A;  8AT1 B;  3RDV A;  4CC3 A;  3H9N A;  4RTZ A;  2WSE E;  2YRV A;  1BB9 A;  1PD0 A;  1MMA A;  4J9H A;  4EMK A;  3G4S Q;  4M7D A;  3HTR A;  3L42 A;  2DVJ A;  2GGR A;  2GCX A;  2GTJ A;  4MZT A;  3LH0 A;  3JB9 F;  5GAN f;  1OV3 A;  1WHH A;  4XQ3 A;  2RQR A;  2XDP A;  2AKK A;  1PKT A;  2DLP A;  1KQ2 A;  1RAI B;  4M75 D;  3QXE B;  1YBY A;  3M5A A;  2XG8 D;  2HD0 A;  3M0Q A;  1YJN T;  2DEQ A;  2VAS A;  2QQR A;  2ATC B;  1FMV A;  4C8Q G;  3KFV A;  2DK3 A;  2F2V A;  1JJ2 P;  1AD5 A;  1NEG A;  2VYT A;  3OYL A;  3CC7 T;  1OEB A;  1E7O A;  1BU1 A;  3OQ5 A;  3LWH A;  4J9C A;  1AZE A;  1VQP T;  4OMM A;  1XJW B;  2E1H A;  4OMP A;  3VKI A;  1QLY A;  2AKL A;  3V7R A;  3I56 T;  3PVQ A;  1I5O B;  3CCL Q;  3EG3 A;  5IHI A;  1P92 A;  2DD4 A;  2J06 A;  2L3R A;  3URG A;  3Q1J A;  1Q82 R;  3QZ5 B;  3JCM c;  4E6R A;  1M9S A;  1HSQ A;  2O01 E;  4BI8 B;  4N0A A;  4GLM A;  1M2V A;  2LJ1 A;  1S72 T;  1VA7 A;  2DTO A;  1GCQ C;  4E7I A;  4ZNX A;  1AWO A;  3OSS C;  2QEX T;  2W0Z A;  3EGD B;  1X2K A;  2VGN A;  2XIC A;  3NTH A;  2MAM A;  2L2P A;  3M0S A;  4C0F A;  4RUG A; 
#chains in the Genus database with same CATH homology
 2CZ1 B;  4M78 C;  4BI3 A;  3X20 B;  3E9G A;  5GMK h;  3JCM h;  1BYM A;  3N5B B;  2M1H A;  2XID A;  1QVP A;  3MET A;  4BDZ A;  2RJC A;  4L59 A;  3CPW A;  1RI0 A;  2FL7 A;  2ZPH B;  1TH7 A;  3CMA A;  1NPR A;  4RCB A;  1K8A U;  3OYH A;  1VQ5 A;  2LT4 A;  2WSF E;  4EPC A;  5A0L A;  5LJ5 e;  5GAO p;  2K2V A;  2V8I A;  1VQM A;  1G5V A;  3TEE A;  3MP6 A;  5GMK i;  5C0M A;  4XK8 E;  4BE2 A;  1KC8 C;  1UGR B;  4HCB A;  2XDB A;  1O75 A;  1PSF A;  3MEA A;  2E12 A;  1JJ2 S;  3QII A;  3JB9 D;  1Q81 U;  2C06 A;  5LJ3 d;  3RES A;  4NL2 A;  1Q86 U;  1M90 U;  2GFA A;  2L89 A;  3LX7 A;  3QPH A;  4QQD A;  5DLO A;  4E7H A;  2EJF A;  2MMP A;  4FM4 B;  1KHC A;  3OS5 A;  3QUI A;  1N8R U;  2OTL T;  4N4G A;  2LNV A;  5I2M A;  1I4K 1;  3M57 A;  1M1K C;  3H6Z A;  2MI6 A;  4A53 A;  3LGF A;  2VGM A;  3FDR A;  4UC4 A;  4XTW A;  3JCM W;  3J7A F;  4M78 G;  1NJI C;  3GNG A;  3QJ6 A;  4FT4 A;  5A0D A;  2QQA A;  2XK0 A;  5GAO q;  4E7L A;  1QW1 A;  3DB4 A;  2CZ6 B;  4C8Q F;  2BUD A;  2EFI A;  1UB4 A;  2DIG A;  4M78 E;  2K5I A;  2RK2 A;  3RKY A;  3VU3 C;  3OYJ A;  2M9U A;  3A8G B;  3CCU T;  1XTD A;  3PIO A;  2OAU A;  3G6E A;  3E1S A;  3L1A A;  2ZPI B;  4MDW A;  3S3M A;  3BDL A;  4MZM A;  3OW2 A;  3GP8 A;  3CCE A;  1G3W A;  5GMK m;  5IT9 E;  3CXC S;  3PFS A;  5GAO l;  3UPU A;  4DOW A;  3L2R A;  4P5N A;  2IVW A;  3L2Q A;  2WAC A;  3HHT B;  2KK4 A;  1QVG S;  4FL6 A;  3CCS A;  2DXB A;  3X24 B;  4BD3 A;  3CCM A;  1N6A A;  2OTL A;  1RL2 A;  4JRP A;  3JRZ A;  2LRQ A;  3HRU A;  5I2S A;  1YI2 A;  5J39 A;  1YHQ T;  5GAM e;  1W2B S;  3MHX A;  4IKF A;  2LT1 A;  2YLB A;  4XTZ A;  5GAN e;  4C5I A;  4OB3 B;  4II1 A;  4GLK A;  1QVF S;  1YIT T;  1UGP B;  2CKK A;  2DZC A;  1VIE A;  3OBW A;  1YJW A;  2RD1 A;  3A8H B;  1YIJ T;  3J80 E;  2VC8 A;  3CBM A;  2QQS A;  3M56 A;  2BKD N;  2EJG A;  4NS5 A;  2P4T A;  1OZ2 A;  3A8M B;  3C94 A;  4FT2 A;  4LD6 A;  4ZGD B;  5GAN 7;  2F69 A;  2EYQ A;  3RMS A;  3JSC A;  5LJ5 h;  5GAN 2;  4M78 B;  4M78 A;  2FVU A;  4PJO C;  3NTI A;  3S6W A;  4DQ2 A;  2KMT A;  2RH2 A;  2K3Y A;  3V7C A;  4D6W A;  3GPL A;  3P8H A;  4ZN3 A;  3CCU A;  3CCV A;  3M54 A;  4X34 A;  3FJP A;  4M75 C;  4ME7 A;  1JB0 E;  2PQW A;  5IN1 A;  3CEY A;  5HY6 A;  4L6V 5;  1PSE A;  4J7F A;  3CMA T;  1KD1 U;  4LDX A;  2GF7 A;  1VQ5 T;  2D6F A;  5FLX E;  2DVE A;  1I5L A;  3ZBD A;  3SWN C;  1VQM T;  1M4Z A;  2O4X B;  3FEO A;  2O4X A;  2F5T X;  2JTF A;  2JOY A;  3QKJ A;  4XTX A;  4XU0 A;  1NPP A;  4RG8 A;  5GAN 5;  3OA6 A;  3AHU A;  4J8O A;  1ZHI A;  2FHD A;  4B9X A;  1VQL A;  1YHQ A;  3QJY A;  3A5Z B;  1VQ7 A;  2Y90 A;  1XNI A;  2HQX A;  1BI3 A;  2P0Q A;  5CIU A;  1VQ6 T;  4E47 A;  2RB6 A;  4M78 D;  3JCM V;  4C0G A;  5KCO A;  3CCJ A;  3CCQ A;  2RI5 A;  2H3J A;  3C95 A;  1YIJ A;  2EIF A;  2LCC A;  1GXI E;  1QP3 A;  2PVD B;  2E64 A;  4IUQ A;  3V8J A;  2QI2 A;  3L2Z A;  4M77 C;  3VYG A;  3G4S A;  4M7A C;  2DPP B;  3EFS A;  4FSX A;  2YLC A;  2DXT A;  5CAI A;  4C0D C;  2V8K A;  4OB2 B;  5FU7 C;  3ASK A;  4PJO G;  4JLI A;  1WGS A;  2MF2 A;  1LJO A;  2E70 A;  2HQE A;  5KE2 A;  3RKW A;  2QA4 A;  2B8A A;  3ME9 A;  3RUX A;  4PJO E;  4A4K A;  2FB7 A;  3OYD A;  4KT0 E;  1YJ9 A;  2D0Q B;  4JDS A;  2XKO C;  3V8K A;  2CZ0 B;  5CKH A;  5LJ5 d;  3BDU A;  4M75 E;  3JCM g;  2K5F A;  2K5L A;  1WJR A;  5KH6 A;  2E6Z A;  4M78 F;  1KC8 U;  3KBG A;  3CC2 A;  3G6E T;  1BI0 A;  4CRI A;  2ZPF B;  4C8Q D;  5GAM h;  4EDU A;  4OGC A;  5GAN h;  2CGH A;  2LX9 A;  4JJN K;  4BE1 A;  3M55 A;  3CCE T;  4MDX A;  3UT1 A;  5LJ3 f;  3RMQ A;  5AYF A;  5GAN 3;  4HCZ A;  1UGS B;  2DXC A;  4QVD A;  1VQ6 A;  1LNX A;  2DD5 A;  2RI3 A;  3HPW A;  2KY9 A;  4EMH A;  3RIR A;  5GAN 6;  2JUF A;  2EKO A;  3SFM A;  5GAM g;  3JB9 I;  3CCM T;  3CCS T;  5GAN g;  5LJ3 j;  1VQK T;  3L2W A;  2EAY A;  2ZPE B;  3I55 T;  4JRK A;  1YI2 T;  2XI9 A;  1M1K U;  3PGG A;  4M7A G;  3CPW S;  3VV0 A;  1K8A C;  2BIV A;  2GFU A;  1KG1 A;  1NJI U;  1YJW T;  4M77 E;  3CME A;  2LQK A;  3PMT A;  3LW5 E;  5FRM A;  4M7A E;  3ER0 A;  2QDY B;  3EFR A;  5FU6 B;  4C92 C;  3OYG A;  1YCY A;  4IUU A;  3OYM A;  2PVG B;  3R6O A;  3VYH B;  5CVI A;  2RHU A;  4PJO B;  2A7Y A;  4OF1 A;  3WVD B;  4PJO A;  3X26 B;  3RKX A;  2D9T A;  1Y7X A;  3KXT A;  3V7S A;  3UWN A;  1KQ1 A;  4X9C A;  3LWI A;  3GLX A;  3M53 A;  3CCL A;  2KAF A;  4M75 B;  1EIF A;  4XU3 A;  3TRE A;  4ZGE B;  3CCV T;  4MML A;  4C92 F;  2L8D A;  2E41 A;  3OMG A;  4PLI A;  4BB7 A;  4ELY C;  3JCM d;  4IUV A;  2R57 A;  1G3S A;  4BDY A;  4ATO A;  4C5E A;  2OTJ A;  1QVG A;  4VUB A;  2NLU A;  3SWN B;  3HP9 A;  4JUV A;  2R5A A;  3SWN A;  5GMK j;  2GQV A;  3OYN A;  3QBY A;  3DLL A;  2LDM A;  4KUD K;  3C4S A;  3G71 A;  1KQS A;  3O8V A;  1WPY A;  3PTA A;  1W2B A;  2RO0 A;  4A4G A;  1G3Y A;  1VQK A;  3VUB A;  3SD4 A;  2PUK B;  3I55 A;  3P8B B;  4GY5 A;  5GAM d;  2DO3 A;  1VQL T;  2HAX A;  3LLR A;  5GAN d;  1VQ7 T;  2JTM A;  2RHY A;  4PJO D;  1VQN A;  2RHI A;  2PUO B;  2LTO A;  3VUZ A;  4NL3 A;  3GIB A;  3CCJ T;  3CCQ T;  4M77 B;  2DZ9 A;  4M77 A;  5DLQ E;  2K57 A;  4M7A B;  3OYB A;  4C92 G;  5GAO r;  4M7A A;  1ZQ1 A;  2E5Q A;  2ZGW A;  3ZEH A;  1VQ4 A;  3QG1 A;  4C0D B;  1KHI A;  5FU6 C;  4F7U F;  5FU7 B;  3G4S T;  5GAO m;  1LOJ A;  1VIF A;  5CK9 A;  1Y07 A;  5KCH A;  3OW2 S;  4C92 E;  1VQO A;  1WQ7 A;  3CCR A;  4RG2 A;  3P8D A;  3WXM B;  3M59 A;  4JRQ A;  1K73 U;  1U8R A;  3HSB A;  2KSS A;  4A4F A;  2DIQ A;  2XD0 A;  2E10 A;  5DM7 R;  4JS5 A;  3FIF A;  3JAM E;  1OYX A;  4BI4 A;  2WSC E;  2QA4 T;  1IRE B;  1FX7 A;  5LJ5 g;  1WQW A;  3MO8 A;  3JB9 G;  3G7Z A;  3FC3 A;  1YJ9 T;  1V29 B;  3PT9 A;  4NOY A;  1VQ8 T;  4BAC A;  3CD6 A;  1U1T A;  4PL6 A;  4PJO F;  3MCA B;  2ZPB B;  4EMK C;  4M7D C;  3OB9 A;  4Z02 A;  3S3N A;  2JNG A;  4OB1 B;  5CKF A;  3CC2 T;  4QQG A;  2K4Y A;  2X4X A;  4HCC A;  1O9S A;  1K9M C;  4JLG A;  4CI0 C;  1UGQ B;  2M0O A;  3HRT A;  4M75 F;  1OZ3 A;  3L2U A;  3GNF B;  3LYI A;  4F7U G;  1N9R A;  3QHS A;  4HT9 A;  3DB3 A;  1Y96 B;  2RJE A;  4XU1 A;  4V2S A;  3PMI A;  2DAQ A;  2V8J A;  2AHJ B;  4F7U E;  2X4J A;  4M7D F;  1Q82 C;  3H8Z A;  3HRS A;  1ZBX A;  3WVE B;  4OB0 B;  4QVZ A;  3BFM A;  3CD6 T;  5LJ3 h;  1IZ6 A;  4RKU E;  1QP2 A;  3LGL A;  5IAY A;  1KD1 C;  4J7I A;  1X75 C;  3M58 A;  2EWN A;  2QQ9 A;  1N9S A;  1BI2 A;  4MZP A;  4YTL A;  3OYF A;  4Q5W A;  4C92 B;  4C92 A;  5FRO A;  1U1S A;  3KUF A;  1BIA A;  3CME T;  1YJN A;  4LDW A;  2E6N A;  3E9F A;  4Y28 E;  2JZ2 A;  2DTH A;  2PU9 B;  1Q7Y C;  4RMO A;  3TU4 K;  4M75 G;  1I8F A;  3FB9 A;  3HKS A;  4M77 F;  4PKC C;  5A2Q E;  2E65 A;  1DJ7 B;  3PIP A;  5LJ5 f;  3OYY A;  4M7A F;  3CBO A;  2MWO A;  3BY7 A;  1VQ8 A;  2X4Y A;  3QSU A;  2CZ7 B;  3CCL T;  2F5K A;  1FWZ A;  2ZPG B;  3CC7 A;  5HKC A;  3MP8 A;  4BE0 A;  4M7D G;  1JJ2 A;  4A4H A;  5HK3 A;  5LJ5 j;  4J6Y A;  3S3O A;  2EQJ A;  1XQH A;  2RM4 A;  2YHT A;  4N4H A;  4PLL A;  3OYC A;  1VQP A;  2G3R A;  3JB9 H;  3HFO A;  2OTJ T;  4M7D E;  1WNL A;  5D6Y A;  1X6O A;  3I56 A;  1Q7Y U;  4QW2 A;  1AHJ B;  2LCL A;  4WF2 A;  4BY6 C;  5GAN 4;  3X25 B;  3G71 T;  4LDV A;  2QTX A;  5LL6 S;  4C92 D;  4F7U B;  4F7U A;  4OMF B;  4TVR A;  4KUL A;  2DKG A;  4OVA A;  4XTY A;  1SSF A;  4A4E A;  4HA8 A;  5CKD A;  1G3T A;  3VJP A;  4ZTJ A;  3MEU A;  3V8L A;  2CYZ B;  1VUB A;  3GF5 A;  4M77 G;  2LC4 A;  1BI1 A;  1WJS A;  1D3B B;  1D3B A;  4J6X A;  1BKB A;  1WJQ A;  3OSV A;  2RK1 A;  1OI1 A;  4A54 A;  3J81 E;  2Y4Y A;  1VQN T;  3OS0 A;  4C0Z A;  4XTU A;  4J6W A;  3JB9 J;  3JCM X;  4J5Y A;  5CKB A;  2LVM A;  2DJZ A;  2EQK A;  1S72 A;  4N0A C;  2DTI A;  5GAO n;  1VQ4 T;  5CR2 A;  3CC4 T;  2MWP A;  4BUG A;  1M8V A;  4Y91 A;  5LJ3 e;  3DLM A;  3OS2 A;  1Q81 C;  1M1F A;  3OYK A;  1VQO T;  2R5M A;  3CCR T;  2FYK A;  1Q86 C;  1M90 C;  1HK9 A;  3EAE A;  4OP0 A;  4QQ6 A;  1B34 B;  4KBM B;  1B34 A;  2QEX A;  4M75 A;  5CQY A;  4C8Q C;  3OBY A;  5C6S A;  3JCM f;  1N8R C;  5A0G A;  3CXC A;  2VXE A;  4JS4 A;  3T9N A;  2RHX A;  2WSE E;  3MP1 A;  2YRV A;  2QQB A;  5GMK l;  5D6W A;  4EMK B;  4M7D B;  4EMK A;  4M7D A;  4DOV A;  4E7K A;  4HT8 A;  2DXU A;  3NTK A;  4L5G A;  4ZTF A;  1HXD A;  3L42 A;  2GCX A;  2A3L A;  4MZT A;  4PNO A;  1R8O B;  3LH0 A;  2XU8 A;  2RJF A;  3NFC A;  4JRI A;  5GAM f;  4DA4 A;  1QVF A;  4J83 A;  3JB9 F;  5GAN f;  1FXX A;  4EMG A;  3A8O B;  2RHZ A;  4O6J A;  3BW1 A;  4XQ3 A;  2JN0 A;  1I81 A;  2XDP A;  1MGQ A;  3FRN A;  3X28 B;  3OMC A;  4ELZ C;  3OS1 A;  5GAN 8;  5DY9 A;  5GAM j;  1JBM A;  2LQ8 A;  3ZFJ A;  5GMK e;  5GAN j;  3JCM e;  1KQ2 A;  3JCM J;  2HBP A;  4M75 D;  3SB2 A;  3QXE B;  2P0P A;  4KUI A;  1YBY A;  1UEB A;  2EQU A;  3M5A A;  4N4I A;  2XG8 D;  2EQM A;  2HD0 A;  1NZ9 A;  3CC4 A;  2XHC A;  3L2V A;  2KVQ G;  2RI2 A;  5EG2 A;  4R56 A;  4IUR A;  1YJN T;  5FRN A;  2DEQ A;  4M7D D;  2QQR A;  3M9Q A;  1KQS S;  4XTV A;  4C8Q G;  2DK3 A;  3TCJ A;  5I21 A;  3QDR B;  3INZ A;  4ZN1 A;  2I2L A;  4XAX B;  3OYI A;  2VYT A;  4C8Q E;  3JCM b;  3GOX A;  3OYL A;  1M5Q 1;  3OY9 A;  3CC7 T;  5L8R E;  4QVC A;  3CBP A;  3HFN A;  1K9M U;  4OGE A;  3E19 A;  4IUT A;  3MEV A;  3OQ5 A;  2RA2 A;  3PNW C;  4O5V A;  4C5G A;  3LWH A;  1VQ9 T;  1VQP T;  4M77 D;  3QO3 A;  2E1H A;  4M7A D;  3VKI A;  5KE3 A;  4HKE A;  4BY6 B;  5M9O A;  3V7R A;  5CO7 A;  1Y96 A;  2P0K A;  4ZGJ B;  3I56 T;  1K73 C;  2EJ9 A;  2VXF A;  1JRI A;  3M4Y A;  4LDU A;  5D6X A;  4R55 A;  1Q82 U;  3FLG A;  4XU2 A;  2RJD A;  3DKM A;  2JVV A;  3RER A;  1Y71 A;  2CS7 A;  4FU6 A;  2ZCF B;  3JCM Q;  2K3X A;  1P92 A;  4MMK A;  4X9D A;  1MHN A;  2DD4 A;  2L3R A;  3CPF A;  3URG A;  3OYA A;  3Q1J A;  3QYG B;  4LDY A;  3QZ5 B;  5CKE A;  3JCM c;  5CCA A;  1M9S A;  2KDS A;  2O01 E;  4BI8 B;  2M16 A;  2X35 A;  1W4S A;  4N0A A;  4E7J A;  2VUB A;  2VV5 A;  2Y4X A;  5LJ3 g;  3UDC A;  1NE8 A;  5CQX A;  4RCC A;  5J26 A;  1S72 T;  3MEW A;  5HK0 A;  2HNI A;  1H3Z A;  4IUP A;  2L5Q A;  2DTO A;  3F70 A;  2PVO B;  1XOV A;  2IG0 A;  5J3B A;  2R58 A;  3A8L B;  4B9W A;  1YIT A;  3JCM P;  3QZ9 B;  4LD9 K;  4E7I A;  2QXF A;  3M4G A;  4C8Q B;  4FIB A;  4C8Q A;  2KQW A;  3SDZ A;  4C5H A;  3OSS C;  2QEX T;  3C12 A;  1N27 A;  2XDD A;  2VGN A;  3HL8 A;  2XIC A;  3OYE A;  3NTH A;  1BIB A;  2MAM A;  1VQ9 A;  2X4W A;  4C0F A;  2ZZD A;  1M1G A;  3QYH B;  1H64 1;  1X01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...