5GANj

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
94
structure length
94
Chain Sequence
RAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords U4 snRNA
total genus 15
structure length 94
sequence length 94
chains with identical sequence m
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ganj00
4XTZA 2VXFA 5CAIA 1LOJA 4JRKA 3QO3A 4XTXA 2RA2A 1I5LA 2DKGA 3JCMb 4PJOG 3FJPA 1YCYA 3INZA 4M7AA 3M4GA 4PJOA 3BDUA 3RUXA 4M7AG 4M75F 4F7UF 5GAN4 3BFMA 3JCMJ 4NOYA 3AHUA 4C92B 4M75D 4M75B 3FB9A 4MMLA 4PNOA 4F7UB 4M75A 3HFNA 4XU1A 3BW1A 4F7UA 5GAN2 1D3BA 2DTOA 3RKYA 5GMKm 3JCMg 3V8JA 3PGGA 3HSBA 4PJOD 3RKWA 4QVDA 2YLCA 4HA8A 4WF2A 5GMKj 2K57A 5GMKh 3JCMQ 4A54A 4M75G 3EFRA 4M77B 4C92C 4F7UG 5GAOm 4EMKC 1B34B 4M78E 5GAN8 4J6YA 4Y91A 5GAOr 2EJGA 1M5Q1 2Y90A 1HK9A 4C8QC 5GMKl 4PJOF 4JRIA 4M78D 3JB9J 2VXEA 4RCBA 1N9SA 3JB9D 4M78F 4XTUA 3JCMV 2DJZA 5GAN6 3JB9F 1LNXA 3SWNA 4M7DA 4XU2A 4C92A 2YLBA 4M7DC 2EWNA 4M77C 5GANe 1WQ7A 4M77E 4M7AB 4M77F 3V7RA 1U1SA 4EMKB 3JCMf 5GAMf 4M75E 4XTVA 3V8LA 2DVEA 4C8QF 4F7UE 3JCMe 2EJFA 4M78G 1M8VA 5LJ3f 5LJ5g 2DXUA 3JB9G 2E10A 4X9DA 4X9CA 1HXDA 2EAYA 2JN0A 3SWNC 1I81A 2E1HA 5GAN7 2VC8A 2YHTA 1I4K1 3JCMc 4A53A 3FIFA 4PJOE 1H641 5GAMh 4C8QA 3BY7A 3JCMh 5GAMj 4M7AC 2DZCA 4M77A 4J6XA 3HFOA 4NL3A 1B34A 2DXTA 5GANd 4PJOB 3SWNB 2DTIA 5LJ3d 4M7DE 3QUIA 5LJ3g 5LJ5f 1Y96A 2DZ9A 2I2LA 2CGHA 1Y96B 4J6WA 4DQ2A 3JCMd 4XU3A 5GAMd 4M7AF 1N9RA 2FB7A 4EMKA 4QVCA 3QSUA 5GMKi 4M75C 5I21A 4JUVA 5GAMe 4JLIA 2DEQA 4EMGA 3V8KA 3JCMP 2E64A 3V7CA 3SB2A 3JCMX 5GAOp 5GAOn 4V2SA 1WNLA 3VU3C 1BIAA 1WQWA 4M78B 5DY9A 5GMKe 5GAOl 3RERA 4PJOC 4XQ3A 2E65A 5LJ3h 4C92E 2ZGWA 5LJ3j 3RESA 5GANh 4NL2A 3V7SA 1U1TA 4C92D 1BIBA 4C8QE 4M7DF 5LJ5j 2RD1A 1JRIA 1LJOA 3L2ZA 4N0AC 4C8QB 5GAN3 4C8QD 3RKXA 5GAOq 4XTWA 2FYKA 3L1AA 4M78C 5GAMg 1WPYA 2E41A 4HT8A 1MGQA 3JB9I 4EMHA 3JCMW 4N0AA 1KQ2A 4HT9A 1I8FA 4RCCA 5GANg 3GIBA 1X01A 2EJ9A 5LJ3e 4C92F 4M7DD 4C92G 4M7DB 4M77D 2QTXA 2RM4A 4M78A 4MMKA 4OP0A 4C8QG 3JB9H 5LJ5d 4XU0A 2RB6A 5GANf 1D3BB 3QHSA 5LJ5e 2DTHA 1JBMA 4J5YA 5GANj 1TH7A 4M7AE 3RIRA 4M7DG 2HNIA 4M77G 5GAN5 5LJ5h 4XTYA 3EFSA 4M7AD 1KQ1A
chains in the Genus database with same CATH superfamily
3L2VA 2L3SA 2LZ6B 4XTXA 2J06A 2PUKB 4BE0A 3INZA 3M4GA 1RUWA 2RPNA 4JZ4A 4M75F 3JCMJ 2DIGA 3VKIA 1KSWA 2PU9B 2OX7A 3BW1A 2EYZA 4TVRA 2DTOA 2X51A 3CD6T 4FL6A 1GRIA 1RAAB 1UJ0A 5FU6B 2DX1A 1R0CB 2XDPA 1VQ9A 2E5QA 1HJDA 1CSKA 3CCJA 1W2BA 4RCBA 4C92A 3OW2A 2YLBA 1SHGA 3OYAA 1SKUB 1QW1A 4BI4A 4JPBW 3OA6A 2H3EB 1XOVA 3JCMe 1Q86C 2X4YA 1U3OA 4QKUA 2L2PA 3O5ZA 1I4K1 1KD1R 3GOXA 3RMQA 2OI3A 3MCAB 2XDBA 2YWWA 4DBRA 3ER0A 4Z89A 5GANd 4KRTA 1Y96B 3OW2S 3GF5A 3P8BB 3V7CA 5AYFA 3MPUB 4PJOC 1D1CA 4FSSA 4AG2C 1IZ6A 1SRLA 1M1KC 3HRSA 1MV3A 4DOWA 2C06A 1TXQA 1PRMC 3MKDA 4JLGA 2DMOA 1Z9ZA 1S72T 2RQWA 1W1FA 1SG5A 1QVFA 3X24B 1LCKA 2ZPHB 4JDSA 3OB9A 5GJWB 3VS1A 2DA9A 5KYYB 3CCJT 1ZHIA 3FJ5A 1UFFA 2MWOA 2CSQA 1UGSB 3U23A 2FEIA 4RTYA 2D6FA 1N6AA 5DLOA 4KT0E 2O9SA 3CD6A 4JRKA 3VUZA 3FJPA 2DL5A 5CIUA 5KYNA 2EQUA 4ZN1A 4F7UF 1WHLA 1M9SA 4XAXB 1UGRB 3CCSQ 3CCRT 4A4FA 2K3XA 4DA4A 2F1LA 4LN2A 3QJYA 1RI0A 2FVUA 4RKUE 3X28B 1FX7A 2ZAEA 2EJGA 2LQNA 2RHXA 2GBQA 4RTWA 4A4GA 1YBYA 2DXUA 4KH0B 2QEXQ 3H0HA 4PJOE 5CCAA 3JCMh 2KAFA 4HCZA 3UA6A 5FU7C 2XHCA 1RLPC 1VQ7A 1R0BG 3ULRB 2HQXA 3HL8A 3M0SA 1ZSZB 1T0HA 2EQKA 2MK5A 4QVCA 5GMKi 2EQMA 4XK8E 2KT1A 2ATCB 5CQXA 9ATCB 3M58A 1N8RR 3P8DA 3G4SQ 1U1TA 4J7FA 3URGA 4C92D 2RD1A 4FYVB 1OEBA 2D1XA 2FPFA 3EGDA 3G4ST 1YFNA 4FM4B 2DE0X 4DEXA 3CCSA 1ZQ1A 3E9GA 1BCOA 4PFZA 3EH2A 1GCQC 2DBKA 2WSFE 1VQNT 1AWOA 3TEEA 2YXYA 1JBMA 3OQ5A 3P8HA 4M7DG 2KI7A 4LDWA 2GTOA 3ME9A 1BI1A 5C6SA 3M57A 2B86A 4AFZC 3L2RA 1YNZA 1IRXA 3QWXX 4ELYC 2MIOA 3EGXA 1YCYA 1RACB 2EPDA 1SSHA 2Y4YA 3AHUA 1T3SA 4NOYA 4C92B 5KYWA 2SRCA 2ZPEB 2RO0A 2JT4A 2HQHA 4PJOD 1GBQA 5CKEA 2RJFA 4O6JA 2YLCA 1OX9A 1QQJA 1VQ7Q 5IN1A 1UGQB 1M3CA 4C8QC 1K8AC 1UB4A 2EFIA 3WVEB 2QI2A 5I11A 3QZ9B 1WQ7A 4M77E 5GAMf 3CCST 2EGAA 3JB9H 3G4SA 1P92A 1U06A 2EAYA 4AG1C 1UECA 2FPEA 3UWNA 2DL7A 2DBMA 5CKHA 2LT4A 4GLKA 1YI2Q 2BE7D 1K0SA 5J3BA 4B9WA 4ZGEB 1MMNA 1QMCA 4FT2A 3META 4J6WA 2MCNA 4M7AF 1WXBA 2K5LA 1XQHA 2FG0A 1BI0A 5KE2A 2W0ZA 3EH1A 1VQOQ 4XQ3A 1NYFA 4PJMA 1VQ8A 3E9FA 4MZTA 3OBYA 3UDCA 2FZCB 4JS5A 1Q86R 1WPYA 4JJNK 2QXFA 7AT1B 2CZ0B 2MYSA 5IAYA 3EG2A 3OS2A 3EHQA 4M7DD 2O9VA 1RABB 2FHDA 3DLLA 1GCQA 3PIPA 3CPWP 3CCUT 4PL6A 4J9GA 4KUIA 4JS4A 3VV0A 1ZBXA 5ECAA 1J3TA 3CCRA 4OB3B 4J9FA 4PJOG 2RQTA 3UA7A 3ZBDA 1ZUUA 3CCLQ 1QKXA 5FWCA 3FB9A 4F7UB 1IREB 3MEVA 3HFNA 4IUPA 2E3IA 3PGGA 4O5VA 1K4US 3TU4K 1OOTA 1YI2T 4OGCA 3SEMA 3JCMQ 3UATA 1QVGP 2F5KA 4C92C 3I5SA 2ZPBB 4EMKC 1AZGB 3CC7T 4J7IA 1HK9A 3HPWA 2AHJB 2DRMA 3X25B 1PHTA 5C0MA 1FXXA 2DYIA 5GANe 3CEYA 2JOYA 1U1SA 5I2MA 1S72A 1NLPC 2LCCA 1OU9A 3OYKA 3HP9A 3CMAT 1Q81U 1UG1A 1G8XA 2RQVA 3HFOA 4HVUA 1QCNA 1SRMA 3D7SB 4PJOB 4M7DE 1HD3A 1JQQA 2O4XA 3JCMd 1PRLC 1QVFS 1D0ZA 1WZOA 3SB2A 3CXCS 2QYZA 4E7SA 4FYXB 2HBWA 4ZTFA 1TTHB 2FRWA 1UE9A 2VASA 1QP2A 4Z8AA 3CCRQ 1LJOA 2X35A 4C8QD 5GAMg 1YJ9Q 1KQ2A 1I8FA 3GLXA 1ZLMA 2RM4A 4LUEA 4M78A 2NUZA 3EAEA 4C8QG 5LJ5d 2FO0A 2VKNA 3CQTA 4KUDK 2VUBA 1QLYA 3S3NA 1VQ9T 1D09B 4M77G 3VS2A 2VB6A 4OF1A 4XTZA 2VXFA 1H3ZA 3E19A 2GGRA 2KSSA 2IG0A 2KYBA 2HAXA 1MUZA 2YUOA 3BDUA 2RI2A 3CC4A 2V8JA 1TWBA 3JV3A 2F2XA 4M75B 2D8HA 4OGEA 3KXTA 3SD4A 1NBEB 5KYYA 4QW2A 1M30A 3L2QA 3LGFA 2QK0A 3A8HB 4Y91A 4DBQA 2D0NA 1MHNA 4C0GA 1K0XA 2LDMA 3AT1B 2PVGB 2MAMA 4M7DC 2EWNA 2KXDA 2HQEA 1I0CA 2DILA 4HVWA 4DEYA 2G6FX 2HL3A 5FLXE 4IUTA 5LJ3f 1JXOA 2E1HA 2VC8A 2YHTA 4OMPA 2LQ8A 1Y57A 3ASKA 4C8QA 3BY7A 4NL3A 2CZ7B 2K6DA 2E6ZA 3OBWA 1I1JA 2DZ9A 2JW4A 1AZEA 5GAMd 3C4SA 1D1AA 1E6HA 1YJNQ 4BE2A 3JCMP 2PUOB 4FT4A 1VQ5T 1V29B 4Q5WA 3CCMT 1BIAA 1WQWA 2RN8A 4IIOA 3RBBB 3OYNA 2HSEB 2YRVA 3I56Q 1YJ9A 5GANh 3M56A 4ANJA 2CH4A 1JRIA 1M8VA 1Q7YR 4BD3A 1MGQA 3G6EA 1RAIB 2L3QA 2XG8D 4WCIA 2DLPA 2FZKB 2JXBA 1VQLT 1M1GA 5GANj 3I9QA 1YJWQ 1TG0A 2QGFB 3M0QA 3NMZC 1KQ1A 1QP3A 1VQOA 5I2SA 2GNCA 2JZ2A 4Z88A 3RUXA 2ED1A 2ZZDA 3FRNA 4MMLA 5CKDA 2HL5C 2M16A 2O01E 2QEXA 1ACMB 3HSBA 1NG2A 3RKWA 1H3HA 1HSQA 1VYVA 5CR2A 1YN8A 4LD6A 1M4ZA 3A5ZB 1AWWA 3FDRA 1NPPA 2L0AA 3NPFA 1O75A 1OZ3A 2DO3A 3VS0A 3RDVA 3UPUA 1PD0A 2L8DA 3CCQT 3VRYA 4M7AB 2KE9A 4M77F 4CRIA 3ZEHA 5HK3A 1XNIA 3CC2T 1I81A 1YP5A 2XD0A 2CZ6B 3CCET 1C1AA 2EW3A 4M77A 3A8OB 5HCKA 3OYCA 3KFVA 2PZ1A 4N4IA 5GJVB 2DF6A 2XK0A 1Y96A 1VQ9Q 4DQ2A 3NTIA 5KYWB 2I0NA 1YJWA 1X2QA 1VQKA 1CKBA 2LNVA 2HDAA 2AK5A 3S3MA 3BE3A 2RJCA 2K3YA 3SHWA 3VUBA 1PSEA 4E7IA 3GP8A 2LVMA 2XDDA 1M1FA 3EG9A 2CT4A 1Y07A 2E41A 2KBTA 4HT9A 3QDFA 4KGXB 5FWBA 3GIBA 2EQJA 4RMOA 1SSFA 4C92F 2KXCA 2QGGA 2CZ1B 4MZPA 1B07A 2VYTA 1NEGA 3PE0A 2DXBA 2LX7A 2DPPB 3EFSA 2MPXC 1OZ2A 4BUGA 1VQ6T 2X4JA 1EX4A 5D6XA 3EFOB 4IKFA 2VGNA 3LWHA 2GCXA 4PJOA 1M2VA 2XKOC 1C6VX 4RTZA 4F7UA 2KROA 2LJ1A 2F2VA 4D8DA 1VQLQ 2EGEA 3LH0A 3EG3A 4DBFA 4OB2B 5GMKh 8AT1B 2DIQA 4AMCA 4II1A 4CI0C 4PJOF 3LX7A 3JB9J 2QQSA 3M4YA 2DJZA 3FLGA 3OS1A 1LNXA 2E70A 1VQKQ 4RG8A 2YUNA 1E6GA 1OYXA 5KYXA 2YRCA 4M78G 3G71T 3VS7A 3M5AA 4FU6A 1AD5A 4QQ6A 5GAMh 4M7AC 1IHWA 4F04B 1YJNT 3R6NA 1FMWA 4HCBA 2AIRB 4OB0B 3SWNB 2MOXA 1G83A 1PWTA 1N9RA 5I21A 2QAZA 4JJDA 1X6GA 2QQAA 2Y4XA 4C5EA 2MWPA 5LJ3h 4C5HA 1YITT 4PFOA 1JJ2A 4XTWA 1WLPB 4EMHA 2JM9A 4QT7A 3CMAQ 2DRKA 1JU5C 2QTXA 1RADB 3QBYA 1AHJB 1WXTA 4L5GA 1WA7A 4K11A 3QYHB 4E7ZA 4J5YA 4LXCA 4M7AE 2HMAA 1KQSP 2DD5A 4KH1B 2KEAA 3DB4A 3PMIA 2WSCE 2DFUA 4OMFB 1TU0B 2MF2A 3QO3A 1VQMT 4PLLA 2DM1A 1NE8A 1VQ5Q 3A8GB 1X43A 1F1BB 1MNEA 1BK2A 2EGCA 3PVLA 3QIIA 4QQDA 4HXJA 3OYMA 1PNJA 2DETA 2RQUA 2RHIA 3QZ5B 2K57A 3M0TA 3CCLT 4FCYA 3VS5A 1M3BA 1G3TA 4C0DC 5GMKl 1TUCA 1WGSA 3CXCA 1I07A 3JB9F 5FU6C 3E2UA 2QDLA 4ZN3A 1NEBA 4OVAA 5LJ5h 4LE9A 4FSXA 1MMDA 3V8LA 2J6OA 1IGUA 3CCVA 2E12A 1UHCA 5GAN7 2JTMA 3OYIA 2AZVA 2LMJA 2OTJQ 2EBPA 3CMEA 1NPRA 1VQPA 4FYYB 4PK4A 1BU1A 1KK7A 1WJQA 1B7TA 4XU3A 4E7HA 3CXCP 4M75C 4JUVA 2LRQA 5GAMe 4JJCA 2GF7A 2CREA 1WDXA 1FMKA 3LGLA 1W4SA 2QQ9A 1Q81C 4N0AC 5GAOq 2HD0A 1PKTA 1OPKA 1TOVA 1K73U 4RTTA 2GQIA 5GANg 4DBHA 2CP3A 1K1ZA 3TVTA 2FL7A 2X4XA 2ZPGB 1Q7YC 1IGQA 3OYDA 1TH7A 2P4TA 4J9HA 2CUBA 2QG9B 3OSSC 1M90R 2K9GA 1M3AA 4M7AD 4FYWB 2F69A 3J81E 4HKEA 1KHIA 2JJ9A 1Z9QA 4M4ZA 2BZ8A 2RI5A 2R57A 1TUDA 2E4HA 4FW1A 4HA8A 3L2UA 4F7UG 1B3QA 2CP2A 1C0MA 1FWZA 4XU2A 1EIFA 2K4YA 3OY9A 4M75E 1NJIR 1VQNQ 1U5SA 5LJ5g 2E10A 2PVDB 5CQYA 5CKBA 2LQKA 3MHXA 4Y92A 2QA4T 4J6XA 1A0NB 2FZGB 2BTTA 5A0LA 2JMCA 1JEGA 1QVFP 1WHMA 5LJ3d 1N8RC 3VS6A 2O4XB 3CPFA 2CGHA 1KFZA 3I56A 3CCJQ 2OJ2A 5KH6A 2WACA 3VJPA 2CYZB 5FU7B 3LLRA 3V8KA 1H8KA 1AT1B 2COZA 3OW2P 5DY9A 3N5BB 4FIBA 2QA4A 3V7SA 4IUUA 1YIJA 1Q82U 2OTJT 3L1AA 2LJ3A 3JB9I 3Q1JA 4N0AA 1OULA 2DXCA 3PT9A 3CPWA 3J80E 2KT8A 2E5KA 2HKNA 3DKMA 2L3RA 1CKAA 2C0IA 1IO6A 3TSZA 3X26B 1QCOA 5IHNA 4RTXA 4VUBA 4ZTJA 1ZX6A 2HSPA 4GY5A 1UTIA 2K7AA 2O88A 1GBRA 2QQBA 1ABOA 1Q82C 2LCSA 5CAIA 4AFQC 2HEQA 2P4RA 2OAWA 3QKJA 2D9TA 4X34A 1QVGA 1KQSA 3NFCA 3BFMA 4M75D 4PNOA 4OMLA 1M2VB 5KCOA 1U8RA 2H8HA 4M75G 4HCKA 1E7OA 1M5Q1 5CK9A 2P0QA 4M78D 3OMCA 4C5GA 3JCMV 3LH5A 2NUTB 4CC7A 5CKFA 1PM3A 4AFSC 4NS5A 1I5LA 2QA4Q 4PKCC 2K79A 3I55A 4FW2A 1ZA2B 1HXDA 2A36A 3CCEQ 4B9XA 1VQMQ 3C0CA 1WYXA 5KCHA 3RNJA 3CBPA 2DZCA 3H6ZA 2QTVA 1S72Q 2OTLA 3EG1A 1Y0MA 4RTVA 2I2LA 4A4KA 1VQ4T 3QSUA 2B8AA 1DJ7B 5IH2A 1D1BA 2XI9A 2E64A 3MP1A 2V26A 4J9DA 3MJXA 4L6V5 2YSQA 1KG1A 1MMGA 1KIKA 4NL2A 2W10A 4J83A 4JJBA 3L2ZA 3QYGB 2MI6A 2CP6A 2ZCFB 1YHQA 1LVKA 2JNGA 3OYBA 4PJLA 3IQLA 4AT1B 1X01A 2KVQG 4QQGA 5LJ3e 2V8IA 4R0KA 3M0RA 2DJQA 5AT1B 2M1HA 4GLMA 2YT6A 3TSWA 4QVZA 2K2VA 3QHSA 3QXEB 4C0FA 5LJ5e 1K9AA 1VQ4Q 4J8OA 2VWFA 4BB7A 4F16A 4XTYA 3CCLA 2IVWA 2X9HA 1PKSA 2FPDA 2M51A 2NYSA 4M7AA 1OPLA 2R58A 2P0PA 1W70A 2NUPB 2BUDA 2LP5A 2RF0A 4F17A 2C0TA 2X3XD 1W2BS 2M0YA 3G1JA 2A37A 5CVIA 1YIJQ 1W6XA 4D6WA 3NTHA 2JS2A 1PD1A 2F2WA 4BI3A 2QQRA 2YDLA 4M78F 3I55Q 4M7DA 3SWNA 4Y28E 4GBQA 3OSVA 2LC4A 4EMKB 1OV3A 2JMAA 3CBOA 1UGPB 1YHQT 4X9CA 1G5VA 1AVZC 2JN0A 3SFMA 2L3PA 2ECZA 3H0FA 1ZSZC 4HVVA 4WTOB 2KMTA 1WXUA 3LW5E 2X3WD 5D6YA 1B34A 5LJ3g 3OYYA 1RL2A 1Y7XA 1VQ4A 4F14A 5FW9A 3KBGA 1UGVA 5GAOn 3NHNA 4RTUA 1WHGA 2OTLT 1SHFA 3ZL7C 1YJNA 4EPCA 3LYIA 4JZ3A 2FYKA 1QWFA 4M78C 1WHHA 4ATOA 2CP0A 3JCMW 3I55T 4D8KA 1BB9A 2AKKA 2A3LA 1ABQA 4PJJA 4C92G 2RNAA 4CC2A 4JRQA 4LDYA 2JVVA 4ZGDB 2RMOA 1RAHB 3MEWA 2RK1A 2RB6A 1Q95G 5IT9E 3CD6Q 3FEOA 5IXBA 1IHVA 1YWPA 2KK4A 5GAN5 2GFUA 1WHKA 2RQRA 2LCLA 2K5IA 2ED0A 2ZPIB 1JO8A 3PNWC 1KC8R 4X1VA 1QKWA 3PTAA 1K8AU 1AWJA 1X75C 2J05A 1G3SA 3X20B 4PFPA 1PG5B 2IPOB 1EZZB 1QVPA 1AWXA 2M0OA 5LL6S 5GAN4 2ROTA 2K3BA 1M90C 4XU1A 1D3BA 4ORZA 3RKYA 3JCMg 2PQWA 1QWEA 2DERA 1VQ6A 4QVDA 5GMKj 4R56A 2COYA 4OMNA 4A54A 2LNHB 2VV5A 4M77B 4C5IA 1X6BA 2KGTA 5GAOm 1H92A 2LT1A 5GAOr 1K76A 2A7YA 4JRIA 4ESRA 1AOJA 1PC0A 4UC4A 1RAEB 2O31A 1N8RU 2HCKA 4RG2A 4ME7A 4OMQA 3HRUA 1QCFA 2KDSA 4LDUA 1KQSS 2DVEA 2RJEA 3OYEA 2OTJA 2YUPA 1VYUA 5EC7A 2NWMA 2KQWA 1YIJT 2PVOB 3LWIA 5A0GA 1N27A 1MV0B 1GFDA 2DXTA 1NJIC 3MP8A 3QUIA 3PVQA 3CBMA 1KD1U 3I56T 3QWYA 2ENMA 3JCMX 1IXDA 3CCMQ 1S1NA 1VA7A 4C92E 2WSEE 3G7ZA 4CC4B 3G6EQ 1BIBA 4J9BA 3M9QA 2G3RA 1I5OB 4AFUC 2NUTA 4LD9K 4OP0A 3MO8A 1M1KR 3EGUA 5GANf 2DTHA 2AKLA 2VGMA 2RJDA 2HNIA 5DLQE 2PNIA 4A4HA 1LOJA 3A8LB 1WHJA 2D0QB 2AZSA 8ATCB 2KRNA 2PTKA 3SDZA 4YTLA 5GAN2 5FRMA 1X2KA 2EYYA 4LUDA 2CP7A 3V8JA 2BKDN 1Q7YU 3GPLA 1GXIE 3MEUA 4WF2A 3C95A 3JSCA 2EIFA 1Y71A 4J6YA 1WJSA 1VIEA 2KRSA 2VXEA 2VVKA 5GAN6 2C0OA 1R8OB 2HBPA 2EQIA 3F70A 3MP6A 4M77C 3V7RA 4XTVA 3GBQA 2EJFA 3WVDB 2XU8A 2RH2A 1UDLA 3CC2Q 4A53A 1GL5A 3JCMc 1OQKA 1UJYA 1R77A 1YJ9T 1TSFA 2CDTA 3HRTA 2HKQB 2IIMA 1YWOA 3M0UA 4OB1B 5KYXB 3S3OA 1VQ8Q 2K2MA 2DNUA 2DEQA 2EVRA 1VQPT 2V1RA 2DL8A 4ZNXA 3CMET 3E1SA 3S6WA 1K73R 3OYJA 2ZGWA 2BZYA 3A98A 1NYGA 3VRZA 1AEYA 3WXMB 1WJRA 4C8QE 2RHZA 1OI1A 3M53A 5IHIA 5CO7A 2NLUA 1EFNA 1RAGB 1QVGS 3RKXA 1BI2A 3M55A 3CCVT 2BZXA 2YRDA 3FC3A 4RCCA 2A28A 1KD1C 2EJ9A 4M7DB 1M8MA 1ZSGA 3OYGA 3GNFB 1SF9A 5KYUB 5A0DA 2V8KA 3I5RA 2F5TX 3CCVQ 2QDYB 2COWA 3I35A 4L59A 5IHKA 3EFOA 3OS0A 4RUGA 2QASA 3CPWS 1NLOC 3CC7Q 1VUBA 1G3YA 3EGXB 1BYMA 4JRPA 2XIDA 3CC4T 2EKHA 2DL4A 3G71Q 1VQMA 2BE9B 3L42A 3M54A 3GNGA 1UUEA 3TCJA 5D6WA 2KYMA 5J26A 3H8ZA 3T9NA 1TUGB 3EFRA 5GAN8 1O9SA 1N9SA 4XTUA 2A0FB 2DK3A 4J9IA 1X69A 4E7KA 1M2OA 4LDXA 1G2BA 3CCUQ 1Q81R 1VIFA 3JCMf 1XJWB 2LX9A 1KJWA 1M27C 3OMGA 1GCPA 3JB9G 4X9DA 2EYWA 2JS0A 4A4EA 2DD4A 1YITA 1M1KU 1T0JA 2V1QA 2LJ0A 2DVJA 3R6OA 4KBMB 2L89A 2LQWA 3TREA 4PLIA 3QDRB 4MDWA 3JRZA 4ELZC 4IURA 2KRMA 3O8VA 1WNLA 4KGZB 4V2SA 5IXFA 1LPLA 2J6FA 4M78B 4E6RA 4B6MA 1VQPQ 3UT1A 5LJ3j 1XTDA 3THKA 3CMAA 1JJ2S 5GAN3 4PJNA 4C0DB 3BDLA 2L5QA 4N4HA 1WI7A 4HT8A 3G71A 3TQ7P 1NM7A 4M77D 2GFAA 2R5MA 4MMKA 1M90U 2DAQA 3OYLA 4E7LA 5I22A 4R55A 2E3HA 4OMMA 3CC7A 4Z02A 4KULA 4P5NA 3CC4Q 1YI2A 4EDUA 2RA2A 2DYBA 2CT3A 3JCMb 3HTRA 4OMOA 2CUDA 4MDXA 4M7AG 1W2BP 1ARKA 3NGPA 1KC8U 1UEBA 2O2OA 5KE3A 2RK2A 1PCXA 3C94A 1PSFA 1MNDA 2EKOA 3CCUA 1MMAA 4ZGJB 4IUQA 3PIOA 2CS7A 1WX6A 1RAFB 3JB9D 2ESWA 2JM8A 3UF4A 1RI9A 3QJ6A 1HYOA 3PMTA 2AT1B 3J7AF 4C8QF 4LNPA 3JAME 1NZ9A 3EHRA 3FIFA 1H641 2ABLA 2DL3A 3RMSA 2GTJA 3NTKA 5GAMj 1ZUYA 1VQ8T 4BACA 5J39A 1V1CA 1V76A 2XMFA 6AT1B 3DLMA 2DTIA 1IB8A 5LJ5f 1VQKT 1YJWT 1VOMA 2FB7A 4EMKA 2JUFA 1G3WA 3VYHB 1BBZA 1SPKA 3DB3A 2NUPA 1FYNA 5GMKe 5GAOl 5FRNA 5HY6A 5EG2A 1K9MR 1BCMA 3RESA 4LDVA 3CCEA 1RLQC 4M7DF 5LJ5j 2H3JA 1GFCA 3EGDB 3CC2A 2ZPFB 4BDZA 4BY6B 1YCSB 1D0YA 4DOVA 4E7JA 3KUFA 1OU8A 2RHYA 3CCQA 2OAUA 3REBB 4BDYA 2MMPA 1WFWA 2P0KA 2XICA 2KR3A 2LTOA 1D3BB 3HKSA 1KHCA 1SEMA 2DEUA 2Z0WA 4MZMA 2HZYA 4J9EA 5M9OA 3A1PA 2R5AA 1FMVA 4IIMA 2YUQA 2SEMA 2OTLQ 4C0ZA 4A63B 2DKGA 1K73C 1JJ2P 2QEXT 3EG0A 3VS3A 2M9UA 1UHFA 3A8MB 2D8JA 4M75A 4E47A 1Q86U 5HKCA 1ZUKA 5GMKm 2P84A 5KYUA 5HK0A 2RI3A 4EIKA 1VQOT 2KY9A 2E6NA 4J9CA 5D7UA 3CMEQ 3OS5A 1B34B 4M78E 1N5ZA 2EYXA 2Y90A 1VQLA 2J7IA 1VQNA 1ZSZA 4BE1A 1D0XA 3QG1A 3HHTB 5L8RE 2CH4W 4F7UE 3G6ET 3OYHA 1KC8C 1BI3A 3H41A 3SWNC 1ZBJA 3REAB 2CP5A 1X6OA 3ZFJA 2J6KA 1JB0E 2M02A 3M0PA 2ROLA 4BI8B 3OYFA 3CCMA 3EG9B 3PFSA 4N4GA 2JTFA 3M59A 3CCQQ 1VQ5A 1K9MU 2CKKA 3H0IA 1BKBA 3MEAA 1OX8A 4JLIA 2CSIA 4EMGA 1X27A 4IUVA 5GAOp 2A08A 3VU3C 5L23A 1VQ6Q 3RERA 1T3LA 1VQ7T 2X4WA 2E65A 4E2FB 3VYGA 1ZA1B 4C8QB 1YITQ 1TS9A 1VYTA 2JTEA 3QPHA 1JXMA 2EYQA 1NJIU 2KNBB 1K9MC 1Q82R 2BIVA 2GQVA 1YHQQ 3H9NA 2FRYA 4XU0A 4BY6C 2K5FA 1K8AR 2RHUA 4CC3A 3RR6A 3VS4A 4KGVB 3RIRA 1WIEA 3L2WA 3C12A 4HCCA 5FROA 5A2QE 5DM7R
chains in the Genus database with same CATH topology
4XTZA 2VXFA 1LOJA 3L2VA 1H3ZA 3J81E 3A8LB 4XTXA 3E19A 4HKEA 1KHIA 2KSSA 2PUKB 2IG0A 2D0QB 4BE0A 2HAXA 3INZA 3M4GA 3BDUA 2RI2A 3CC4A 4M75F 2V8JA 3JCMJ 2DIGA 3VKIA 4M75B 3SDZA 2PU9B 4OGEA 4YTLA 2RI5A 3BW1A 5GAN2 5FRMA 3KXTA 4TVRA 2DTOA 3SD4A 2R57A 3V8JA 2BKDN 3CD6T 1Q7YU 3GPLA 4FL6A 1GXIE 3MEUA 4HA8A 4WF2A 5FU6B 3C95A 3JSCA 3L2UA 4QW2A 3L2QA 3LGFA 2EIFA 4F7UG 2XDPA 1VQ9A 1Y71A 4J6YA 1VIEA 1WJSA 2E5QA 3A8HB 4Y91A 3CCJA 1W2BA 1VQ5T 1MHNA 2VXEA 4RCBA 4C0GA 5GAN6 2LDMA 1R8OB 1FWZA 2PVGB 2MAMA 4XU2A 4C92A 2HBPA 1EIFA 3OW2A 2YLBA 4M7DC 2EWNA 3F70A 3MP6A 2HQEA 1QW1A 4M77C 4BI4A 3OYAA 2K4YA 3V7RA 3OA6A 3OY9A 4M75E 4XTVA 1XOVA 3JCMe 5FLXE 2EJFA 3WVDB 1Q86C 4IUTA 5LJ3f 2XU8A 5LJ5g 2E10A 2RH2A 2PVDB 2X4YA 5CQYA 2E1HA 2VC8A 2YHTA 1I4K1 5CKBA 3JCMc 4A53A 2LQKA 3MHXA 2LQ8A 3ASKA 3RMQA 3GOXA 4C8QA 3BY7A 3MCAB 2XDBA 1VQPT 2QA4T 4J6XA 1YJ9T 4NL3A 2CZ7B 5A0LA 3ER0A 5GANd 2E6ZA 5LJ3d 3HRTA 1N8RC 3OBWA 2O4XB 2DZ9A 3CPFA 2CGHA 1Y96B 5GAMd 4OB1B 3C4SA 3I56A 3S3OA 3OW2S 5KH6A 2WACA 3VJPA 3GF5A 4BE2A 2CYZB 2DEQA 5FU7B 2PUOB 3LLRA 3P8BB 4FT4A 1V29B 3V7CA 4Q5WA 5AYFA 3V8KA 3E1SA 3CMET 3CCMT 1BIAA 1WQWA 5DY9A 3S6WA 3OYJA 4PJOC 3OYNA 2YRVA 3N5BB 1YJ9A 2ZGWA 4FIBA 2QA4A 5GANh 3V7SA 3M56A 1IZ6A 4IUUA 3WXMB 1WJRA 1YIJA 3HRSA 4C8QE 1M1KC 2RHZA 4DOWA 1OI1A 3M53A 2C06A 5CO7A 1Q82U 1JRIA 2NLUA 1M8VA 1QVGS 4JLGA 4RMOA 3RKXA 2OTJT 3L1AA 4BD3A 1BI2A 3M55A 1MGQA 3JB9I 3CCVT 1S72T 3Q1JA 4N0AA 2DXCA 3PT9A 3FC3A 3G6EA 4RCCA 3J80E 3CPWA 1KD1C 2EJ9A 3DKMA 4M7DB 2L3RA 2XG8D 1QVFA 3X24B 2ZPHB 4JDSA 3OB9A 3OYGA 3GNFB 5A0DA 2V8KA 3X26B 2F5TX 4VUBA 1M1GA 3CCJT 4ZTJA 1VQLT 1ZHIA 5GANj 2QDYB 4GY5A 2MWOA 1UGSB 2QQBA 1KQ1A 4L59A 2D6FA 1QP3A 1Q82C 1N6AA 1VQOA 5DLOA 5I2SA 5CAIA 4KT0E 3OS0A 3CPWS 3CD6A 4JRKA 3VUZA 1VUBA 2JZ2A 3FJPA 3QKJA 2D9TA 1G3YA 2EQUA 4X34A 5CIUA 3RUXA 1QVGA 1KQSA 1BYMA 3NFCA 4ZN1A 4F7UF 4JRPA 2XIDA 1M9SA 2ZZDA 3BFMA 3FRNA 3CC4T 4M75D 4MMLA 4PNOA 5CKDA 2M16A 2O01E 2QEXA 5KCOA 4XAXB 1UGRB 1U8RA 3HSBA 3CCRT 1VQMA 4A4FA 3L42A 3M54A 3GNGA 3RKWA 2K3XA 3TCJA 5CR2A 4DA4A 4LD6A 1M4ZA 5D6WA 3A5ZB 3QJYA 5J26A 3H8ZA 3FDRA 3T9NA 4M75G 3EFRA 1RI0A 2FVUA 4RKUE 3X28B 1NPPA 1FX7A 1O9SA 5GAN8 1M5Q1 2EJGA 1O75A 2P0QA 5CK9A 1OZ3A 4M78D 3OMCA 1N9SA 4XTUA 3JCMV 4C5GA 2DK3A 2RHXA 2DO3A 5CKFA 4E7KA 4LDXA 3UPUA 2L8DA 3CCQT 4NS5A 1I5LA 4M7AB 1VIFA 4M77F 3JCMf 4PKCC 4CRIA 2LX9A 1YBYA 4A4GA 2DXUA 3OMGA 3ZEHA 5HK3A 3I55A 3JB9G 1XNIA 4X9DA 1HXDA 3CC2T 1I81A 4B9XA 4PJOE 2XD0A 4A4EA 2DD4A 5KCHA 2CZ6B 1YITA 5CCAA 1M1KU 3JCMh 3CCET 3CBPA 2DZCA 2KAFA 3A8OB 3H6ZA 4HCZA 4M77A 3OYCA 3R6OA 4KBMB 5FU7C 2OTLA 4N4IA 2XHCA 1VQ7A 2L89A 2HQXA 3HL8A 2XK0A 3TREA 1Y96A 2I2LA 4A4KA 2EQKA 4DQ2A 4PLIA 3QDRB 3NTIA 1VQ4T 4QVCA 3QSUA 2B8AA 4MDWA 3JRZA 5GMKi 1DJ7B 4ELZC 4IURA 2XI9A 1YJWA 1VQKA 2E64A 2EQMA 2LNVA 4XK8E 3O8VA 4V2SA 1WNLA 4M78B 3MP1A 4L6V5 3S3MA 1KG1A 5CQXA 3UT1A 5LJ3j 1XTDA 2RJCA 4NL2A 3M58A 3CMAA 3P8DA 1U1TA 2K3YA 4J7FA 3URGA 4C92D 1JJ2S 2RD1A 3VUBA 4J83A 1PSEA 4E7IA 3GP8A 2LVMA 5GAN3 3L2ZA 1M1FA 3QYGB 2MI6A 4C0DB 3BDLA 2XDDA 2L5QA 2ZCFB 4N4HA 1YHQA 4HT8A 1Y07A 2E41A 4HT9A 2JNGA 3OYBA 3G4ST 3G71A 3GIBA 2EQJA 1X01A 1SSFA 2KVQG 1ZQ1A 4FM4B 4QQGA 2V8IA 4C92F 5LJ3e 3CCSA 4M77D 2GFAA 3E9GA 2R5MA 4MMKA 1M90U 2CZ1B 4MZPA 2M1HA 2VYTA 2WSFE 2DXBA 4QVZA 1VQNT 2DAQA 2K2VA 3TEEA 3QHSA 3QXEB 3OYLA 2DPPB 4C0FA 5LJ5e 4R55A 4J8OA 1JBMA 3OQ5A 3CC7A 3P8HA 4M7DG 4LDWA 4BB7A 4Z02A 4KULA 4P5NA 4XTYA 3EFSA 3CCLA 3ME9A 1OZ2A 1BI1A 4BUGA 1YI2A 2IVWA 4EDUA 3M57A 5C6SA 1VQ6T 2X4JA 3L2RA 2RA2A 5D6XA 3JCMb 4IKFA 4ELYC 2VGNA 3LWHA 2GCXA 1YCYA 4M7AA 4PJOA 4MDXA 4M7AG 2R58A 2Y4YA 3AHUA 4NOYA 4C92B 2P0PA 2XKOC 2ZPEB 4F7UA 2RO0A 2BUDA 1KC8U 4PJOD 1UEBA 5CKEA 2RJFA 3LH0A 5KE3A 2RK2A 1W2BS 4O6JA 2YLCA 3C94A 5CVIA 4OB2B 1PSFA 5GMKh 2EKOA 4D6WA 3NTHA 2DIQA 3CCUA 4ZGJB 4IUQA 4II1A 4CI0C 5IN1A 1UGQB 4C8QC 4PJOF 4BI3A 2QQRA 3LX7A 2CS7A 3PIOA 2QQSA 3JB9J 1K8AC 3JB9D 4M78F 3M4YA 2DJZA 1UB4A 2EFIA 1LNXA 3FLGA 3SWNA 3OS1A 4M7DA 2E70A 3WVEB 3QJ6A 4Y28E 4RG8A 3PMTA 2QI2A 3OSVA 1WQ7A 2LC4A 3QZ9B 4M77E 4EMKB 1OYXA 5GAMf 3CCST 3J7AF 3JB9H 4C8QF 4M78G 3G4SA 3G71T 3CBOA 3M5AA 1P92A 1UGPB 3JAME 1NZ9A 1YHQT 4X9CA 4FU6A 2EAYA 1G5VA 2JN0A 3SFMA 4E7LA 3FIFA 1H641 3RMSA 3UWNA 4QQ6A 5GAMh 5GAMj 2KMTA 2LT4A 3NTKA 4GLKA 5CKHA 1YJNT 3LW5E 1VQ8T 4M7AC 4BACA 4HCBA 5J39A 5D6YA 5J3BA 1B34A 4B9WA 4ZGEB 4OB0B 3DLMA 3SWNB 2DTIA 4FT2A 5LJ3g 5LJ5f 3META 3OYYA 1VQKT 1RL2A 4J6WA 1YJWT 1Y7XA 4M7AF 1N9RA 2FB7A 4EMKA 2JUFA 1VQ4A 1G3WA 3VYHB 5I21A 2K5LA 3KBGA 3DB3A 1XQHA 5GAOn 1BI0A 5KE2A 5GMKe 5GAOl 5FRNA 5HY6A 2QQAA 5EG2A 2Y4XA 4C5EA 2OTLT 4XQ3A 2MWPA 5LJ3h 3RESA 1YJNA 4LDVA 1VQ8A 3E9FA 4MZTA 4C5HA 3CCEA 1YITT 1JJ2A 3OBYA 4EPCA 3UDCA 5LJ5j 4M7DF 3JCMP 2H3JA 4JS5A 3LYIA 2ZPFB 4BDZA 4BY6B 4XTWA 3CC2A 2FYKA 4M78C 1WPYA 4ATOA 4DOVA 2QXFA 4EMHA 2CZ0B 4JJNK 4E7JA 3I55T 3JCMW 3KUFA 5IAYA 3OS2A 2A3LA 2RHYA 4C92G 4M7DD 3CCQA 4JRQA 2OAUA 4LDYA 2JVVA 2MMPA 2QTXA 3QBYA 4ZGDB 4BDYA 2P0KA 2XICA 1AHJB 2RK1A 2RB6A 3MEWA 2LTOA 4L5GA 5IT9E 1D3BB 3HKSA 1KHCA 2FHDA 3DLLA 3QYHB 4J5YA 3FEOA 3PIPA 4M7AE 2DD5A 2KK4A 3CCUT 4PL6A 4MZMA 5GAN5 4KUIA 2GFUA 3DB4A 3PMIA 4JS4A 2LCLA 2WSCE 3VV0A 1ZBXA 2K5IA 5M9OA 2ZPIB 2R5AA 4OMFB 3PNWC 4C0ZA 2MF2A 3QO3A 3PTAA 3CCRA 4PLLA 4OB3B 2DKGA 1VQMT 1K73C 1NE8A 4PJOG 1K8AU 3A8GB 3ZBDA 2QEXT 1X75C 1G3SA 3X20B 2M9UA 5LL6S 1QVPA 5GAN4 2M0OA 4F7UB 3FB9A 1IREB 3A8MB 3MEVA 3HFNA 4IUPA 4M75A 4XU1A 4E47A 1M90C 1Q86U 1D3BA 3RKYA 5HKCA 5GMKm 3QIIA 2PQWA 4O5VA 3PGGA 4QQDA 3JCMg 3OYMA 5HK0A 1VQ6A 2RI3A 4QVDA 3TU4K 1VQOT 2KY9A 2RHIA 2E6NA 1YI2T 3QZ5B 5GMKj 2K57A 4OGCA 3JCMQ 4R56A 3CCLT 4A54A 2F5KA 2VV5A 4M77B 4C5IA 4C92C 2ZPBB 5GAOm 3OS5A 4EMKC 1B34B 2LT1A 4M78E 3CC7T 5GAOr 1G3TA 4J7IA 2A7YA 2Y90A 1HK9A 4C0DC 1WGSA 5GMKl 4JRIA 1VQLA 3CXCA 3HPWA 1VQNA 4UC4A 4BE1A 1N8RU 2AHJB 3JB9F 5FU6C 3X25B 5C0MA 4ZN3A 4RG2A 3QG1A 1FXXA 3HHTB 4ME7A 3HRUA 5L8RE 5GANe 4OVAA 5LJ5h 2KDSA 3CEYA 2JOYA 1U1SA 4FSXA 5I2MA 4LDUA 3V8LA 4F7UE 2DVEA 3G6ET 1KQSS 2RJEA 3OYEA 3OYHA 1S72A 1KC8C 3CCVA 1BI3A 2OTJA 2E12A 3SWNC 5GAN7 2LCCA 2JTMA 2KQWA 1YIJT 1X6OA 3OYKA 3HP9A 3ZFJA 3OYIA 1Q81U 2PVOB 3CMAT 3LWIA 5A0GA 3HFOA 1JB0E 1N27A 4BI8B 2DXTA 3OYFA 4PJOB 1NJIC 3CCMA 3CMEA 1NPRA 3MP8A 3PFSA 3QUIA 2JTFA 3M59A 4N4GA 1VQPA 1VQ5A 3JCMd 2O4XA 1WJQA 3CBMA 4XU3A 1KD1U 1K9MU 2CKKA 1QVFS 4E7HA 1BKBA 3MEAA 3I56T 4M75C 4JUVA 2LRQA 5GAMe 4JLIA 4EMGA 3JCMX 2GF7A 3SB2A 4IUVA 5GAOp 3VU3C 3CXCS 3RERA 1VQ7T 2X4WA 2E65A 4C92E 3LGLA 4ZTFA 1W4SA 2WSEE 3G7ZA 3VYGA 2QQ9A 1BIBA 1Q81C 1QP2A 3M9QA 1LJOA 2G3RA 2X35A 4N0AC 4C8QB 4C8QD 2HD0A 5GAOq 5GAMg 3QPHA 2EYQA 1K73U 1NJIU 1KQ2A 1I8FA 5GANg 4M7DE 3GLXA 1K9MC 2BIVA 2GQVA 2RM4A 4LD9K 4M78A 4OP0A 3EAEA 2FL7A 4C8QG 3MO8A 4XU0A 4BY6C 2X4XA 5LJ5d 2ZPGB 2K5FA 2RHUA 5GANf 2DTHA 1Q7YC 4KUDK 3OYDA 1TH7A 2P4TA 2VGMA 2RJDA 2VUBA 3RIRA 3L2WA 2HNIA 3OSSC 4M77G 3S3NA 3C12A 1VQ9T 5DLQE 4HCCA 5FROA 4M7AD 5A2QE 5DM7R 2F69A 4OF1A 4A4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XTZ A;  2VXF A;  5CAI A;  1LOJ A;  4JRK A;  3QO3 A;  4XTX A;  2RA2 A;  1I5L A;  2DKG A;  3JCM b;  4PJO G;  3FJP A;  1YCY A;  3INZ A;  4M7A A;  3M4G A;  4PJO A;  3BDU A;  3RUX A;  4M7A G;  4M75 F;  4F7U F;  5GAN 4;  3BFM A;  3JCM J;  4NOY A;  3AHU A;  4C92 B;  4M75 D;  4M75 B;  3FB9 A;  4MML A;  4PNO A;  4F7U B;  4M75 A;  3HFN A;  4XU1 A;  3BW1 A;  4F7U A;  5GAN 2;  1D3B A;  2DTO A;  3RKY A;  5GMK m;  3JCM g;  3V8J A;  3PGG A;  3HSB A;  4PJO D;  3RKW A;  4QVD A;  2YLC A;  4HA8 A;  4WF2 A;  5GMK j;  2K57 A;  5GMK h;  3JCM Q;  4A54 A;  4M75 G;  3EFR A;  4M77 B;  4C92 C;  4F7U G;  5GAO m;  4EMK C;  1B34 B;  4M78 E;  5GAN 8;  4J6Y A;  4Y91 A;  5GAO r;  2EJG A;  1M5Q 1;  2Y90 A;  1HK9 A;  4C8Q C;  5GMK l;  4PJO F;  4JRI A;  4M78 D;  3JB9 J;  2VXE A;  4RCB A;  1N9S A;  3JB9 D;  4M78 F;  4XTU A;  3JCM V;  2DJZ A;  5GAN 6;  3JB9 F;  1LNX A;  3SWN A;  4M7D A;  4XU2 A;  4C92 A;  2YLB A;  4M7D C;  2EWN A;  4M77 C;  5GAN e;  1WQ7 A;  4M77 E;  4M7A B;  4M77 F;  3V7R A;  1U1S A;  4EMK B;  3JCM f;  5GAM f;  4M75 E;  4XTV A;  3V8L A;  2DVE A;  4C8Q F;  4F7U E;  3JCM e;  2EJF A;  4M78 G;  1M8V A;  5LJ3 f;  5LJ5 g;  2DXU A;  3JB9 G;  2E10 A;  4X9D A;  4X9C A;  1HXD A;  2EAY A;  2JN0 A;  3SWN C;  1I81 A;  2E1H A;  5GAN 7;  2VC8 A;  2YHT A;  1I4K 1;  3JCM c;  4A53 A;  3FIF A;  4PJO E;  1H64 1;  5GAM h;  4C8Q A;  3BY7 A;  3JCM h;  5GAM j;  4M7A C;  2DZC A;  4M77 A;  4J6X A;  3HFO A;  4NL3 A;  1B34 A;  2DXT A;  5GAN d;  4PJO B;  3SWN B;  2DTI A;  5LJ3 d;  4M7D E;  3QUI A;  5LJ3 g;  5LJ5 f;  1Y96 A;  2DZ9 A;  2I2L A;  2CGH A;  1Y96 B;  4J6W A;  4DQ2 A;  3JCM d;  4XU3 A;  5GAM d;  4M7A F;  1N9R A;  2FB7 A;  4EMK A;  4QVC A;  3QSU A;  5GMK i;  4M75 C;  5I21 A;  4JUV A;  5GAM e;  4JLI A;  2DEQ A;  4EMG A;  3V8K A;  3JCM P;  2E64 A;  3V7C A;  3SB2 A;  3JCM X;  5GAO p;  5GAO n;  4V2S A;  1WNL A;  3VU3 C;  1BIA A;  1WQW A;  4M78 B;  5DY9 A;  5GMK e;  5GAO l;  3RER A;  4PJO C;  4XQ3 A;  2E65 A;  5LJ3 h;  4C92 E;  2ZGW A;  5LJ3 j;  3RES A;  5GAN h;  4NL2 A;  3V7S A;  1U1T A;  4C92 D;  1BIB A;  4C8Q E;  4M7D F;  5LJ5 j;  2RD1 A;  1JRI A;  1LJO A;  3L2Z A;  4N0A C;  4C8Q B;  5GAN 3;  4C8Q D;  3RKX A;  5GAO q;  4XTW A;  2FYK A;  3L1A A;  4M78 C;  5GAM g;  1WPY A;  2E41 A;  4HT8 A;  1MGQ A;  3JB9 I;  4EMH A;  3JCM W;  4N0A A;  1KQ2 A;  4HT9 A;  1I8F A;  4RCC A;  5GAN g;  3GIB A;  1X01 A;  2EJ9 A;  5LJ3 e;  4C92 F;  4M7D D;  4C92 G;  4M7D B;  4M77 D;  2QTX A;  2RM4 A;  4M78 A;  4MMK A;  4OP0 A;  4C8Q G;  3JB9 H;  5LJ5 d;  4XU0 A;  2RB6 A;  5GAN f;  1D3B B;  3QHS A;  5LJ5 e;  2DTH A;  1JBM A;  4J5Y A;  5GAN j;  1TH7 A;  4M7A E;  3RIR A;  4M7D G;  2HNI A;  4M77 G;  5GAN 5;  5LJ5 h;  4XTY A;  3EFS A;  4M7A D;  1KQ1 A; 
#chains in the Genus database with same CATH topology
 3L2V A;  2L3S A;  2LZ6 B;  4XTX A;  2J06 A;  2PUK B;  4BE0 A;  3INZ A;  3M4G A;  1RUW A;  2RPN A;  4JZ4 A;  4M75 F;  3JCM J;  2DIG A;  3VKI A;  1KSW A;  2PU9 B;  2OX7 A;  3BW1 A;  2EYZ A;  4TVR A;  2DTO A;  2X51 A;  3CD6 T;  4FL6 A;  1GRI A;  1RAA B;  1UJ0 A;  5FU6 B;  2DX1 A;  1R0C B;  2XDP A;  1VQ9 A;  2E5Q A;  1HJD A;  1CSK A;  3CCJ A;  1W2B A;  4RCB A;  4C92 A;  3OW2 A;  2YLB A;  1SHG A;  3OYA A;  1SKU B;  1QW1 A;  4BI4 A;  4JPB W;  3OA6 A;  2H3E B;  1XOV A;  3JCM e;  1Q86 C;  2X4Y A;  1U3O A;  4QKU A;  2L2P A;  3O5Z A;  1I4K 1;  1KD1 R;  3GOX A;  3RMQ A;  2OI3 A;  3MCA B;  2XDB A;  2YWW A;  4DBR A;  3ER0 A;  4Z89 A;  5GAN d;  4KRT A;  1Y96 B;  3OW2 S;  3GF5 A;  3P8B B;  3V7C A;  5AYF A;  3MPU B;  4PJO C;  1D1C A;  4FSS A;  4AG2 C;  1IZ6 A;  1SRL A;  1M1K C;  3HRS A;  1MV3 A;  4DOW A;  2C06 A;  1TXQ A;  1PRM C;  3MKD A;  4JLG A;  2DMO A;  1Z9Z A;  1S72 T;  2RQW A;  1W1F A;  1SG5 A;  1QVF A;  3X24 B;  1LCK A;  2ZPH B;  4JDS A;  3OB9 A;  5GJW B;  3VS1 A;  2DA9 A;  5KYY B;  3CCJ T;  1ZHI A;  3FJ5 A;  1UFF A;  2MWO A;  2CSQ A;  1UGS B;  3U23 A;  2FEI A;  4RTY A;  2D6F A;  1N6A A;  5DLO A;  4KT0 E;  2O9S A;  3CD6 A;  4JRK A;  3VUZ A;  3FJP A;  2DL5 A;  5CIU A;  5KYN A;  2EQU A;  4ZN1 A;  4F7U F;  1WHL A;  1M9S A;  4XAX B;  1UGR B;  3CCS Q;  3CCR T;  4A4F A;  2K3X A;  4DA4 A;  2F1L A;  4LN2 A;  3QJY A;  1RI0 A;  2FVU A;  4RKU E;  3X28 B;  1FX7 A;  2ZAE A;  2EJG A;  2LQN A;  2RHX A;  2GBQ A;  4RTW A;  4A4G A;  1YBY A;  2DXU A;  4KH0 B;  2QEX Q;  3H0H A;  4PJO E;  5CCA A;  3JCM h;  2KAF A;  4HCZ A;  3UA6 A;  5FU7 C;  2XHC A;  1RLP C;  1VQ7 A;  1R0B G;  3ULR B;  2HQX A;  3HL8 A;  3M0S A;  1ZSZ B;  1T0H A;  2EQK A;  2MK5 A;  4QVC A;  5GMK i;  2EQM A;  4XK8 E;  2KT1 A;  2ATC B;  5CQX A;  9ATC B;  3M58 A;  1N8R R;  3P8D A;  3G4S Q;  1U1T A;  4J7F A;  3URG A;  4C92 D;  2RD1 A;  4FYV B;  1OEB A;  2D1X A;  2FPF A;  3EGD A;  3G4S T;  1YFN A;  4FM4 B;  2DE0 X;  4DEX A;  3CCS A;  1ZQ1 A;  3E9G A;  1BCO A;  4PFZ A;  3EH2 A;  1GCQ C;  2DBK A;  2WSF E;  1VQN T;  1AWO A;  3TEE A;  2YXY A;  1JBM A;  3OQ5 A;  3P8H A;  4M7D G;  2KI7 A;  4LDW A;  2GTO A;  3ME9 A;  1BI1 A;  5C6S A;  3M57 A;  2B86 A;  4AFZ C;  3L2R A;  1YNZ A;  1IRX A;  3QWX X;  4ELY C;  2MIO A;  3EGX A;  1YCY A;  1RAC B;  2EPD A;  1SSH A;  2Y4Y A;  3AHU A;  1T3S A;  4NOY A;  4C92 B;  5KYW A;  2SRC A;  2ZPE B;  2RO0 A;  2JT4 A;  2HQH A;  4PJO D;  1GBQ A;  5CKE A;  2RJF A;  4O6J A;  2YLC A;  1OX9 A;  1QQJ A;  1VQ7 Q;  5IN1 A;  1UGQ B;  1M3C A;  4C8Q C;  1K8A C;  1UB4 A;  2EFI A;  3WVE B;  2QI2 A;  5I11 A;  3QZ9 B;  1WQ7 A;  4M77 E;  5GAM f;  3CCS T;  2EGA A;  3JB9 H;  3G4S A;  1P92 A;  1U06 A;  2EAY A;  4AG1 C;  1UEC A;  2FPE A;  3UWN A;  2DL7 A;  2DBM A;  5CKH A;  2LT4 A;  4GLK A;  1YI2 Q;  2BE7 D;  1K0S A;  5J3B A;  4B9W A;  4ZGE B;  1MMN A;  1QMC A;  4FT2 A;  3MET A;  4J6W A;  2MCN A;  4M7A F;  1WXB A;  2K5L A;  1XQH A;  2FG0 A;  1BI0 A;  5KE2 A;  2W0Z A;  3EH1 A;  1VQO Q;  4XQ3 A;  1NYF A;  4PJM A;  1VQ8 A;  3E9F A;  4MZT A;  3OBY A;  3UDC A;  2FZC B;  4JS5 A;  1Q86 R;  1WPY A;  4JJN K;  2QXF A;  7AT1 B;  2CZ0 B;  2MYS A;  5IAY A;  3EG2 A;  3OS2 A;  3EHQ A;  4M7D D;  2O9V A;  1RAB B;  2FHD A;  3DLL A;  1GCQ A;  3PIP A;  3CPW P;  3CCU T;  4PL6 A;  4J9G A;  4KUI A;  4JS4 A;  3VV0 A;  1ZBX A;  5ECA A;  1J3T A;  3CCR A;  4OB3 B;  4J9F A;  4PJO G;  2RQT A;  3UA7 A;  3ZBD A;  1ZUU A;  3CCL Q;  1QKX A;  5FWC A;  3FB9 A;  4F7U B;  1IRE B;  3MEV A;  3HFN A;  4IUP A;  2E3I A;  3PGG A;  4O5V A;  1K4U S;  3TU4 K;  1OOT A;  1YI2 T;  4OGC A;  3SEM A;  3JCM Q;  3UAT A;  1QVG P;  2F5K A;  4C92 C;  3I5S A;  2ZPB B;  4EMK C;  1AZG B;  3CC7 T;  4J7I A;  1HK9 A;  3HPW A;  2AHJ B;  2DRM A;  3X25 B;  1PHT A;  5C0M A;  1FXX A;  2DYI A;  5GAN e;  3CEY A;  2JOY A;  1U1S A;  5I2M A;  1S72 A;  1NLP C;  2LCC A;  1OU9 A;  3OYK A;  3HP9 A;  3CMA T;  1Q81 U;  1UG1 A;  1G8X A;  2RQV A;  3HFO A;  4HVU A;  1QCN A;  1SRM A;  3D7S B;  4PJO B;  4M7D E;  1HD3 A;  1JQQ A;  2O4X A;  3JCM d;  1PRL C;  1QVF S;  1D0Z A;  1WZO A;  3SB2 A;  3CXC S;  2QYZ A;  4E7S A;  4FYX B;  2HBW A;  4ZTF A;  1TTH B;  2FRW A;  1UE9 A;  2VAS A;  1QP2 A;  4Z8A A;  3CCR Q;  1LJO A;  2X35 A;  4C8Q D;  5GAM g;  1YJ9 Q;  1KQ2 A;  1I8F A;  3GLX A;  1ZLM A;  2RM4 A;  4LUE A;  4M78 A;  2NUZ A;  3EAE A;  4C8Q G;  5LJ5 d;  2FO0 A;  2VKN A;  3CQT A;  4KUD K;  2VUB A;  1QLY A;  3S3N A;  1VQ9 T;  1D09 B;  4M77 G;  3VS2 A;  2VB6 A;  4OF1 A;  4XTZ A;  2VXF A;  1H3Z A;  3E19 A;  2GGR A;  2KSS A;  2IG0 A;  2KYB A;  2HAX A;  1MUZ A;  2YUO A;  3BDU A;  2RI2 A;  3CC4 A;  2V8J A;  1TWB A;  3JV3 A;  2F2X A;  4M75 B;  2D8H A;  4OGE A;  3KXT A;  3SD4 A;  1NBE B;  5KYY A;  4QW2 A;  1M30 A;  3L2Q A;  3LGF A;  2QK0 A;  3A8H B;  4Y91 A;  4DBQ A;  2D0N A;  1MHN A;  4C0G A;  1K0X A;  2LDM A;  3AT1 B;  2PVG B;  2MAM A;  4M7D C;  2EWN A;  2KXD A;  2HQE A;  1I0C A;  2DIL A;  4HVW A;  4DEY A;  2G6F X;  2HL3 A;  5FLX E;  4IUT A;  5LJ3 f;  1JXO A;  2E1H A;  2VC8 A;  2YHT A;  4OMP A;  2LQ8 A;  1Y57 A;  3ASK A;  4C8Q A;  3BY7 A;  4NL3 A;  2CZ7 B;  2K6D A;  2E6Z A;  3OBW A;  1I1J A;  2DZ9 A;  2JW4 A;  1AZE A;  5GAM d;  3C4S A;  1D1A A;  1E6H A;  1YJN Q;  4BE2 A;  3JCM P;  2PUO B;  4FT4 A;  1VQ5 T;  1V29 B;  4Q5W A;  3CCM T;  1BIA A;  1WQW A;  2RN8 A;  4IIO A;  3RBB B;  3OYN A;  2HSE B;  2YRV A;  3I56 Q;  1YJ9 A;  5GAN h;  3M56 A;  4ANJ A;  2CH4 A;  1JRI A;  1M8V A;  1Q7Y R;  4BD3 A;  1MGQ A;  3G6E A;  1RAI B;  2L3Q A;  2XG8 D;  4WCI A;  2DLP A;  2FZK B;  2JXB A;  1VQL T;  1M1G A;  5GAN j;  3I9Q A;  1YJW Q;  1TG0 A;  2QGF B;  3M0Q A;  3NMZ C;  1KQ1 A;  1QP3 A;  1VQO A;  5I2S A;  2GNC A;  2JZ2 A;  4Z88 A;  3RUX A;  2ED1 A;  2ZZD A;  3FRN A;  4MML A;  5CKD A;  2HL5 C;  2M16 A;  2O01 E;  2QEX A;  1ACM B;  3HSB A;  1NG2 A;  3RKW A;  1H3H A;  1HSQ A;  1VYV A;  5CR2 A;  1YN8 A;  4LD6 A;  1M4Z A;  3A5Z B;  1AWW A;  3FDR A;  1NPP A;  2L0A A;  3NPF A;  1O75 A;  1OZ3 A;  2DO3 A;  3VS0 A;  3RDV A;  3UPU A;  1PD0 A;  2L8D A;  3CCQ T;  3VRY A;  4M7A B;  2KE9 A;  4M77 F;  4CRI A;  3ZEH A;  5HK3 A;  1XNI A;  3CC2 T;  1I81 A;  1YP5 A;  2XD0 A;  2CZ6 B;  3CCE T;  1C1A A;  2EW3 A;  4M77 A;  3A8O B;  5HCK A;  3OYC A;  3KFV A;  2PZ1 A;  4N4I A;  5GJV B;  2DF6 A;  2XK0 A;  1Y96 A;  1VQ9 Q;  4DQ2 A;  3NTI A;  5KYW B;  2I0N A;  1YJW A;  1X2Q A;  1VQK A;  1CKB A;  2LNV A;  2HDA A;  2AK5 A;  3S3M A;  3BE3 A;  2RJC A;  2K3Y A;  3SHW A;  3VUB A;  1PSE A;  4E7I A;  3GP8 A;  2LVM A;  2XDD A;  1M1F A;  3EG9 A;  2CT4 A;  1Y07 A;  2E41 A;  2KBT A;  4HT9 A;  3QDF A;  4KGX B;  5FWB A;  3GIB A;  2EQJ A;  4RMO A;  1SSF A;  4C92 F;  2KXC A;  2QGG A;  2CZ1 B;  4MZP A;  1B07 A;  2VYT A;  1NEG A;  3PE0 A;  2DXB A;  2LX7 A;  2DPP B;  3EFS A;  2MPX C;  1OZ2 A;  4BUG A;  1VQ6 T;  2X4J A;  1EX4 A;  5D6X A;  3EFO B;  4IKF A;  2VGN A;  3LWH A;  2GCX A;  4PJO A;  1M2V A;  2XKO C;  1C6V X;  4RTZ A;  4F7U A;  2KRO A;  2LJ1 A;  2F2V A;  4D8D A;  1VQL Q;  2EGE A;  3LH0 A;  3EG3 A;  4DBF A;  4OB2 B;  5GMK h;  8AT1 B;  2DIQ A;  4AMC A;  4II1 A;  4CI0 C;  4PJO F;  3LX7 A;  3JB9 J;  2QQS A;  3M4Y A;  2DJZ A;  3FLG A;  3OS1 A;  1LNX A;  2E70 A;  1VQK Q;  4RG8 A;  2YUN A;  1E6G A;  1OYX A;  5KYX A;  2YRC A;  4M78 G;  3G71 T;  3VS7 A;  3M5A A;  4FU6 A;  1AD5 A;  4QQ6 A;  5GAM h;  4M7A C;  1IHW A;  4F04 B;  1YJN T;  3R6N A;  1FMW A;  4HCB A;  2AIR B;  4OB0 B;  3SWN B;  2MOX A;  1G83 A;  1PWT A;  1N9R A;  5I21 A;  2QAZ A;  4JJD A;  1X6G A;  2QQA A;  2Y4X A;  4C5E A;  2MWP A;  5LJ3 h;  4C5H A;  1YIT T;  4PFO A;  1JJ2 A;  4XTW A;  1WLP B;  4EMH A;  2JM9 A;  4QT7 A;  3CMA Q;  2DRK A;  1JU5 C;  2QTX A;  1RAD B;  3QBY A;  1AHJ B;  1WXT A;  4L5G A;  1WA7 A;  4K11 A;  3QYH B;  4E7Z A;  4J5Y A;  4LXC A;  4M7A E;  2HMA A;  1KQS P;  2DD5 A;  4KH1 B;  2KEA A;  3DB4 A;  3PMI A;  2WSC E;  2DFU A;  4OMF B;  1TU0 B;  2MF2 A;  3QO3 A;  1VQM T;  4PLL A;  2DM1 A;  1NE8 A;  1VQ5 Q;  3A8G B;  1X43 A;  1F1B B;  1MNE A;  1BK2 A;  2EGC A;  3PVL A;  3QII A;  4QQD A;  4HXJ A;  3OYM A;  1PNJ A;  2DET A;  2RQU A;  2RHI A;  3QZ5 B;  2K57 A;  3M0T A;  3CCL T;  4FCY A;  3VS5 A;  1M3B A;  1G3T A;  4C0D C;  5GMK l;  1TUC A;  1WGS A;  3CXC A;  1I07 A;  3JB9 F;  5FU6 C;  3E2U A;  2QDL A;  4ZN3 A;  1NEB A;  4OVA A;  5LJ5 h;  4LE9 A;  4FSX A;  1MMD A;  3V8L A;  2J6O A;  1IGU A;  3CCV A;  2E12 A;  1UHC A;  5GAN 7;  2JTM A;  3OYI A;  2AZV A;  2LMJ A;  2OTJ Q;  2EBP A;  3CME A;  1NPR A;  1VQP A;  4FYY B;  4PK4 A;  1BU1 A;  1KK7 A;  1WJQ A;  1B7T A;  4XU3 A;  4E7H A;  3CXC P;  4M75 C;  4JUV A;  2LRQ A;  5GAM e;  4JJC A;  2GF7 A;  2CRE A;  1WDX A;  1FMK A;  3LGL A;  1W4S A;  2QQ9 A;  1Q81 C;  4N0A C;  5GAO q;  2HD0 A;  1PKT A;  1OPK A;  1TOV A;  1K73 U;  4RTT A;  2GQI A;  5GAN g;  4DBH A;  2CP3 A;  1K1Z A;  3TVT A;  2FL7 A;  2X4X A;  2ZPG B;  1Q7Y C;  1IGQ A;  3OYD A;  1TH7 A;  2P4T A;  4J9H A;  2CUB A;  2QG9 B;  3OSS C;  1M90 R;  2K9G A;  1M3A A;  4M7A D;  4FYW B;  2F69 A;  3J81 E;  4HKE A;  1KHI A;  2JJ9 A;  1Z9Q A;  4M4Z A;  2BZ8 A;  2RI5 A;  2R57 A;  1TUD A;  2E4H A;  4FW1 A;  4HA8 A;  3L2U A;  4F7U G;  1B3Q A;  2CP2 A;  1C0M A;  1FWZ A;  4XU2 A;  1EIF A;  2K4Y A;  3OY9 A;  4M75 E;  1NJI R;  1VQN Q;  1U5S A;  5LJ5 g;  2E10 A;  2PVD B;  5CQY A;  5CKB A;  2LQK A;  3MHX A;  4Y92 A;  2QA4 T;  4J6X A;  1A0N B;  2FZG B;  2BTT A;  5A0L A;  2JMC A;  1JEG A;  1QVF P;  1WHM A;  5LJ3 d;  1N8R C;  3VS6 A;  2O4X B;  3CPF A;  2CGH A;  1KFZ A;  3I56 A;  3CCJ Q;  2OJ2 A;  5KH6 A;  2WAC A;  3VJP A;  2CYZ B;  5FU7 B;  3LLR A;  3V8K A;  1H8K A;  1AT1 B;  2COZ A;  3OW2 P;  5DY9 A;  3N5B B;  4FIB A;  2QA4 A;  3V7S A;  4IUU A;  1YIJ A;  1Q82 U;  2OTJ T;  3L1A A;  2LJ3 A;  3JB9 I;  3Q1J A;  4N0A A;  1OUL A;  2DXC A;  3PT9 A;  3CPW A;  3J80 E;  2KT8 A;  2E5K A;  2HKN A;  3DKM A;  2L3R A;  1CKA A;  2C0I A;  1IO6 A;  3TSZ A;  3X26 B;  1QCO A;  5IHN A;  4RTX A;  4VUB A;  4ZTJ A;  1ZX6 A;  2HSP A;  4GY5 A;  1UTI A;  2K7A A;  2O88 A;  1GBR A;  2QQB A;  1ABO A;  1Q82 C;  2LCS A;  5CAI A;  4AFQ C;  2HEQ A;  2P4R A;  2OAW A;  3QKJ A;  2D9T A;  4X34 A;  1QVG A;  1KQS A;  3NFC A;  3BFM A;  4M75 D;  4PNO A;  4OML A;  1M2V B;  5KCO A;  1U8R A;  2H8H A;  4M75 G;  4HCK A;  1E7O A;  1M5Q 1;  5CK9 A;  2P0Q A;  4M78 D;  3OMC A;  4C5G A;  3JCM V;  3LH5 A;  2NUT B;  4CC7 A;  5CKF A;  1PM3 A;  4AFS C;  4NS5 A;  1I5L A;  2QA4 Q;  4PKC C;  2K79 A;  3I55 A;  4FW2 A;  1ZA2 B;  1HXD A;  2A36 A;  3CCE Q;  4B9X A;  1VQM Q;  3C0C A;  1WYX A;  5KCH A;  3RNJ A;  3CBP A;  2DZC A;  3H6Z A;  2QTV A;  1S72 Q;  2OTL A;  3EG1 A;  1Y0M A;  4RTV A;  2I2L A;  4A4K A;  1VQ4 T;  3QSU A;  2B8A A;  1DJ7 B;  5IH2 A;  1D1B A;  2XI9 A;  2E64 A;  3MP1 A;  2V26 A;  4J9D A;  3MJX A;  4L6V 5;  2YSQ A;  1KG1 A;  1MMG A;  1KIK A;  4NL2 A;  2W10 A;  4J83 A;  4JJB A;  3L2Z A;  3QYG B;  2MI6 A;  2CP6 A;  2ZCF B;  1YHQ A;  1LVK A;  2JNG A;  3OYB A;  4PJL A;  3IQL A;  4AT1 B;  1X01 A;  2KVQ G;  4QQG A;  5LJ3 e;  2V8I A;  4R0K A;  3M0R A;  2DJQ A;  5AT1 B;  2M1H A;  4GLM A;  2YT6 A;  3TSW A;  4QVZ A;  2K2V A;  3QHS A;  3QXE B;  4C0F A;  5LJ5 e;  1K9A A;  1VQ4 Q;  4J8O A;  2VWF A;  4BB7 A;  4F16 A;  4XTY A;  3CCL A;  2IVW A;  2X9H A;  1PKS A;  2FPD A;  2M51 A;  2NYS A;  4M7A A;  1OPL A;  2R58 A;  2P0P A;  1W70 A;  2NUP B;  2BUD A;  2LP5 A;  2RF0 A;  4F17 A;  2C0T A;  2X3X D;  1W2B S;  2M0Y A;  3G1J A;  2A37 A;  5CVI A;  1YIJ Q;  1W6X A;  4D6W A;  3NTH A;  2JS2 A;  1PD1 A;  2F2W A;  4BI3 A;  2QQR A;  2YDL A;  4M78 F;  3I55 Q;  4M7D A;  3SWN A;  4Y28 E;  4GBQ A;  3OSV A;  2LC4 A;  4EMK B;  1OV3 A;  2JMA A;  3CBO A;  1UGP B;  1YHQ T;  4X9C A;  1G5V A;  1AVZ C;  2JN0 A;  3SFM A;  2L3P A;  2ECZ A;  3H0F A;  1ZSZ C;  4HVV A;  4WTO B;  2KMT A;  1WXU A;  3LW5 E;  2X3W D;  5D6Y A;  1B34 A;  5LJ3 g;  3OYY A;  1RL2 A;  1Y7X A;  1VQ4 A;  4F14 A;  5FW9 A;  3KBG A;  1UGV A;  5GAO n;  3NHN A;  4RTU A;  1WHG A;  2OTL T;  1SHF A;  3ZL7 C;  1YJN A;  4EPC A;  3LYI A;  4JZ3 A;  2FYK A;  1QWF A;  4M78 C;  1WHH A;  4ATO A;  2CP0 A;  3JCM W;  3I55 T;  4D8K A;  1BB9 A;  2AKK A;  2A3L A;  1ABQ A;  4PJJ A;  4C92 G;  2RNA A;  4CC2 A;  4JRQ A;  4LDY A;  2JVV A;  4ZGD B;  2RMO A;  1RAH B;  3MEW A;  2RK1 A;  2RB6 A;  1Q95 G;  5IT9 E;  3CD6 Q;  3FEO A;  5IXB A;  1IHV A;  1YWP A;  2KK4 A;  5GAN 5;  2GFU A;  1WHK A;  2RQR A;  2LCL A;  2K5I A;  2ED0 A;  2ZPI B;  1JO8 A;  3PNW C;  1KC8 R;  4X1V A;  1QKW A;  3PTA A;  1K8A U;  1AWJ A;  1X75 C;  2J05 A;  1G3S A;  3X20 B;  4PFP A;  1PG5 B;  2IPO B;  1EZZ B;  1QVP A;  1AWX A;  2M0O A;  5LL6 S;  5GAN 4;  2ROT A;  2K3B A;  1M90 C;  4XU1 A;  1D3B A;  4ORZ A;  3RKY A;  3JCM g;  2PQW A;  1QWE A;  2DER A;  1VQ6 A;  4QVD A;  5GMK j;  4R56 A;  2COY A;  4OMN A;  4A54 A;  2LNH B;  2VV5 A;  4M77 B;  4C5I A;  1X6B A;  2KGT A;  5GAO m;  1H92 A;  2LT1 A;  5GAO r;  1K76 A;  2A7Y A;  4JRI A;  4ESR A;  1AOJ A;  1PC0 A;  4UC4 A;  1RAE B;  2O31 A;  1N8R U;  2HCK A;  4RG2 A;  4ME7 A;  4OMQ A;  3HRU A;  1QCF A;  2KDS A;  4LDU A;  1KQS S;  2DVE A;  2RJE A;  3OYE A;  2OTJ A;  2YUP A;  1VYU A;  5EC7 A;  2NWM A;  2KQW A;  1YIJ T;  2PVO B;  3LWI A;  5A0G A;  1N27 A;  1MV0 B;  1GFD A;  2DXT A;  1NJI C;  3MP8 A;  3QUI A;  3PVQ A;  3CBM A;  1KD1 U;  3I56 T;  3QWY A;  2ENM A;  3JCM X;  1IXD A;  3CCM Q;  1S1N A;  1VA7 A;  4C92 E;  2WSE E;  3G7Z A;  4CC4 B;  3G6E Q;  1BIB A;  4J9B A;  3M9Q A;  2G3R A;  1I5O B;  4AFU C;  2NUT A;  4LD9 K;  4OP0 A;  3MO8 A;  1M1K R;  3EGU A;  5GAN f;  2DTH A;  2AKL A;  2VGM A;  2RJD A;  2HNI A;  5DLQ E;  2PNI A;  4A4H A;  1LOJ A;  3A8L B;  1WHJ A;  2D0Q B;  2AZS A;  8ATC B;  2KRN A;  2PTK A;  3SDZ A;  4YTL A;  5GAN 2;  5FRM A;  1X2K A;  2EYY A;  4LUD A;  2CP7 A;  3V8J A;  2BKD N;  1Q7Y U;  3GPL A;  1GXI E;  3MEU A;  4WF2 A;  3C95 A;  3JSC A;  2EIF A;  1Y71 A;  4J6Y A;  1WJS A;  1VIE A;  2KRS A;  2VXE A;  2VVK A;  5GAN 6;  2C0O A;  1R8O B;  2HBP A;  2EQI A;  3F70 A;  3MP6 A;  4M77 C;  3V7R A;  4XTV A;  3GBQ A;  2EJF A;  3WVD B;  2XU8 A;  2RH2 A;  1UDL A;  3CC2 Q;  4A53 A;  1GL5 A;  3JCM c;  1OQK A;  1UJY A;  1R77 A;  1YJ9 T;  1TSF A;  2CDT A;  3HRT A;  2HKQ B;  2IIM A;  1YWO A;  3M0U A;  4OB1 B;  5KYX B;  3S3O A;  1VQ8 Q;  2K2M A;  2DNU A;  2DEQ A;  2EVR A;  1VQP T;  2V1R A;  2DL8 A;  4ZNX A;  3CME T;  3E1S A;  3S6W A;  1K73 R;  3OYJ A;  2ZGW A;  2BZY A;  3A98 A;  1NYG A;  3VRZ A;  1AEY A;  3WXM B;  1WJR A;  4C8Q E;  2RHZ A;  1OI1 A;  3M53 A;  5IHI A;  5CO7 A;  2NLU A;  1EFN A;  1RAG B;  1QVG S;  3RKX A;  1BI2 A;  3M55 A;  3CCV T;  2BZX A;  2YRD A;  3FC3 A;  4RCC A;  2A28 A;  1KD1 C;  2EJ9 A;  4M7D B;  1M8M A;  1ZSG A;  3OYG A;  3GNF B;  1SF9 A;  5KYU B;  5A0D A;  2V8K A;  3I5R A;  2F5T X;  3CCV Q;  2QDY B;  2COW A;  3I35 A;  4L59 A;  5IHK A;  3EFO A;  3OS0 A;  4RUG A;  2QAS A;  3CPW S;  1NLO C;  3CC7 Q;  1VUB A;  1G3Y A;  3EGX B;  1BYM A;  4JRP A;  2XID A;  3CC4 T;  2EKH A;  2DL4 A;  3G71 Q;  1VQM A;  2BE9 B;  3L42 A;  3M54 A;  3GNG A;  1UUE A;  3TCJ A;  5D6W A;  2KYM A;  5J26 A;  3H8Z A;  3T9N A;  1TUG B;  3EFR A;  5GAN 8;  1O9S A;  1N9S A;  4XTU A;  2A0F B;  2DK3 A;  4J9I A;  1X69 A;  4E7K A;  1M2O A;  4LDX A;  1G2B A;  3CCU Q;  1Q81 R;  1VIF A;  3JCM f;  1XJW B;  2LX9 A;  1KJW A;  1M27 C;  3OMG A;  1GCP A;  3JB9 G;  4X9D A;  2EYW A;  2JS0 A;  4A4E A;  2DD4 A;  1YIT A;  1M1K U;  1T0J A;  2V1Q A;  2LJ0 A;  2DVJ A;  3R6O A;  4KBM B;  2L89 A;  2LQW A;  3TRE A;  4PLI A;  3QDR B;  4MDW A;  3JRZ A;  4ELZ C;  4IUR A;  2KRM A;  3O8V A;  1WNL A;  4KGZ B;  4V2S A;  5IXF A;  1LPL A;  2J6F A;  4M78 B;  4E6R A;  4B6M A;  1VQP Q;  3UT1 A;  5LJ3 j;  1XTD A;  3THK A;  3CMA A;  1JJ2 S;  5GAN 3;  4PJN A;  4C0D B;  3BDL A;  2L5Q A;  4N4H A;  1WI7 A;  4HT8 A;  3G71 A;  3TQ7 P;  1NM7 A;  4M77 D;  2GFA A;  2R5M A;  4MMK A;  1M90 U;  2DAQ A;  3OYL A;  4E7L A;  5I22 A;  4R55 A;  2E3H A;  4OMM A;  3CC7 A;  4Z02 A;  4KUL A;  4P5N A;  3CC4 Q;  1YI2 A;  4EDU A;  2RA2 A;  2DYB A;  2CT3 A;  3JCM b;  3HTR A;  4OMO A;  2CUD A;  4MDX A;  4M7A G;  1W2B P;  1ARK A;  3NGP A;  1KC8 U;  1UEB A;  2O2O A;  5KE3 A;  2RK2 A;  1PCX A;  3C94 A;  1PSF A;  1MND A;  2EKO A;  3CCU A;  1MMA A;  4ZGJ B;  4IUQ A;  3PIO A;  2CS7 A;  1WX6 A;  1RAF B;  3JB9 D;  2ESW A;  2JM8 A;  3UF4 A;  1RI9 A;  3QJ6 A;  1HYO A;  3PMT A;  2AT1 B;  3J7A F;  4C8Q F;  4LNP A;  3JAM E;  1NZ9 A;  3EHR A;  3FIF A;  1H64 1;  2ABL A;  2DL3 A;  3RMS A;  2GTJ A;  3NTK A;  5GAM j;  1ZUY A;  1VQ8 T;  4BAC A;  5J39 A;  1V1C A;  1V76 A;  2XMF A;  6AT1 B;  3DLM A;  2DTI A;  1IB8 A;  5LJ5 f;  1VQK T;  1YJW T;  1VOM A;  2FB7 A;  4EMK A;  2JUF A;  1G3W A;  3VYH B;  1BBZ A;  1SPK A;  3DB3 A;  2NUP A;  1FYN A;  5GMK e;  5GAO l;  5FRN A;  5HY6 A;  5EG2 A;  1K9M R;  1BCM A;  3RES A;  4LDV A;  3CCE A;  1RLQ C;  4M7D F;  5LJ5 j;  2H3J A;  1GFC A;  3EGD B;  3CC2 A;  2ZPF B;  4BDZ A;  4BY6 B;  1YCS B;  1D0Y A;  4DOV A;  4E7J A;  3KUF A;  1OU8 A;  2RHY A;  3CCQ A;  2OAU A;  3REB B;  4BDY A;  2MMP A;  1WFW A;  2P0K A;  2XIC A;  2KR3 A;  2LTO A;  1D3B B;  3HKS A;  1KHC A;  1SEM A;  2DEU A;  2Z0W A;  4MZM A;  2HZY A;  4J9E A;  5M9O A;  3A1P A;  2R5A A;  1FMV A;  4IIM A;  2YUQ A;  2SEM A;  2OTL Q;  4C0Z A;  4A63 B;  2DKG A;  1K73 C;  1JJ2 P;  2QEX T;  3EG0 A;  3VS3 A;  2M9U A;  1UHF A;  3A8M B;  2D8J A;  4M75 A;  4E47 A;  1Q86 U;  5HKC A;  1ZUK A;  5GMK m;  2P84 A;  5KYU A;  5HK0 A;  2RI3 A;  4EIK A;  1VQO T;  2KY9 A;  2E6N A;  4J9C A;  5D7U A;  3CME Q;  3OS5 A;  1B34 B;  4M78 E;  1N5Z A;  2EYX A;  2Y90 A;  1VQL A;  2J7I A;  1VQN A;  1ZSZ A;  4BE1 A;  1D0X A;  3QG1 A;  3HHT B;  5L8R E;  2CH4 W;  4F7U E;  3G6E T;  3OYH A;  1KC8 C;  1BI3 A;  3H41 A;  3SWN C;  1ZBJ A;  3REA B;  2CP5 A;  1X6O A;  3ZFJ A;  2J6K A;  1JB0 E;  2M02 A;  3M0P A;  2ROL A;  4BI8 B;  3OYF A;  3CCM A;  3EG9 B;  3PFS A;  4N4G A;  2JTF A;  3M59 A;  3CCQ Q;  1VQ5 A;  1K9M U;  2CKK A;  3H0I A;  1BKB A;  3MEA A;  1OX8 A;  4JLI A;  2CSI A;  4EMG A;  1X27 A;  4IUV A;  5GAO p;  2A08 A;  3VU3 C;  5L23 A;  1VQ6 Q;  3RER A;  1T3L A;  1VQ7 T;  2X4W A;  2E65 A;  4E2F B;  3VYG A;  1ZA1 B;  4C8Q B;  1YIT Q;  1TS9 A;  1VYT A;  2JTE A;  3QPH A;  1JXM A;  2EYQ A;  1NJI U;  2KNB B;  1K9M C;  1Q82 R;  2BIV A;  2GQV A;  1YHQ Q;  3H9N A;  2FRY A;  4XU0 A;  4BY6 C;  2K5F A;  1K8A R;  2RHU A;  4CC3 A;  3RR6 A;  3VS4 A;  4KGV B;  3RIR A;  1WIE A;  3L2W A;  3C12 A;  4HCC A;  5FRO A;  5A2Q E;  5DM7 R; 
#chains in the Genus database with same CATH homology
 4XTZ A;  2VXF A;  1LOJ A;  3L2V A;  1H3Z A;  3J81 E;  3A8L B;  4XTX A;  3E19 A;  4HKE A;  1KHI A;  2KSS A;  2PUK B;  2IG0 A;  2D0Q B;  4BE0 A;  2HAX A;  3INZ A;  3M4G A;  3BDU A;  2RI2 A;  3CC4 A;  4M75 F;  2V8J A;  3JCM J;  2DIG A;  3VKI A;  4M75 B;  3SDZ A;  2PU9 B;  4OGE A;  4YTL A;  2RI5 A;  3BW1 A;  5GAN 2;  5FRM A;  3KXT A;  4TVR A;  2DTO A;  3SD4 A;  2R57 A;  3V8J A;  2BKD N;  3CD6 T;  1Q7Y U;  3GPL A;  4FL6 A;  1GXI E;  3MEU A;  4HA8 A;  4WF2 A;  5FU6 B;  3C95 A;  3JSC A;  3L2U A;  4QW2 A;  3L2Q A;  3LGF A;  2EIF A;  4F7U G;  2XDP A;  1VQ9 A;  1Y71 A;  4J6Y A;  1VIE A;  1WJS A;  2E5Q A;  3A8H B;  4Y91 A;  3CCJ A;  1W2B A;  1VQ5 T;  1MHN A;  2VXE A;  4RCB A;  4C0G A;  5GAN 6;  2LDM A;  1R8O B;  1FWZ A;  2PVG B;  2MAM A;  4XU2 A;  4C92 A;  2HBP A;  1EIF A;  3OW2 A;  2YLB A;  4M7D C;  2EWN A;  3F70 A;  3MP6 A;  2HQE A;  1QW1 A;  4M77 C;  4BI4 A;  3OYA A;  2K4Y A;  3V7R A;  3OA6 A;  3OY9 A;  4M75 E;  4XTV A;  1XOV A;  3JCM e;  5FLX E;  2EJF A;  3WVD B;  1Q86 C;  4IUT A;  5LJ3 f;  2XU8 A;  5LJ5 g;  2E10 A;  2RH2 A;  2PVD B;  2X4Y A;  5CQY A;  2E1H A;  2VC8 A;  2YHT A;  1I4K 1;  5CKB A;  3JCM c;  4A53 A;  2LQK A;  3MHX A;  2LQ8 A;  3ASK A;  3RMQ A;  3GOX A;  4C8Q A;  3BY7 A;  3MCA B;  2XDB A;  1VQP T;  2QA4 T;  4J6X A;  1YJ9 T;  4NL3 A;  2CZ7 B;  5A0L A;  3ER0 A;  5GAN d;  2E6Z A;  5LJ3 d;  3HRT A;  1N8R C;  3OBW A;  2O4X B;  2DZ9 A;  3CPF A;  2CGH A;  1Y96 B;  5GAM d;  4OB1 B;  3C4S A;  3I56 A;  3S3O A;  3OW2 S;  5KH6 A;  2WAC A;  3VJP A;  3GF5 A;  4BE2 A;  2CYZ B;  2DEQ A;  5FU7 B;  2PUO B;  3LLR A;  3P8B B;  4FT4 A;  1V29 B;  3V7C A;  4Q5W A;  5AYF A;  3V8K A;  3E1S A;  3CME T;  3CCM T;  1BIA A;  1WQW A;  5DY9 A;  3S6W A;  3OYJ A;  4PJO C;  3OYN A;  2YRV A;  3N5B B;  1YJ9 A;  2ZGW A;  4FIB A;  2QA4 A;  5GAN h;  3V7S A;  3M56 A;  1IZ6 A;  4IUU A;  3WXM B;  1WJR A;  1YIJ A;  3HRS A;  4C8Q E;  1M1K C;  2RHZ A;  4DOW A;  1OI1 A;  3M53 A;  2C06 A;  5CO7 A;  1Q82 U;  1JRI A;  2NLU A;  1M8V A;  1QVG S;  4JLG A;  4RMO A;  3RKX A;  2OTJ T;  3L1A A;  4BD3 A;  1BI2 A;  3M55 A;  1MGQ A;  3JB9 I;  3CCV T;  1S72 T;  3Q1J A;  4N0A A;  2DXC A;  3PT9 A;  3FC3 A;  3G6E A;  4RCC A;  3J80 E;  3CPW A;  1KD1 C;  2EJ9 A;  3DKM A;  4M7D B;  2L3R A;  2XG8 D;  1QVF A;  3X24 B;  2ZPH B;  4JDS A;  3OB9 A;  3OYG A;  3GNF B;  5A0D A;  2V8K A;  3X26 B;  2F5T X;  4VUB A;  1M1G A;  3CCJ T;  4ZTJ A;  1VQL T;  1ZHI A;  5GAN j;  2QDY B;  4GY5 A;  2MWO A;  1UGS B;  2QQB A;  1KQ1 A;  4L59 A;  2D6F A;  1QP3 A;  1Q82 C;  1N6A A;  1VQO A;  5DLO A;  5I2S A;  5CAI A;  4KT0 E;  3OS0 A;  3CPW S;  3CD6 A;  4JRK A;  3VUZ A;  1VUB A;  2JZ2 A;  3FJP A;  3QKJ A;  2D9T A;  1G3Y A;  2EQU A;  4X34 A;  5CIU A;  3RUX A;  1QVG A;  1KQS A;  1BYM A;  3NFC A;  4ZN1 A;  4F7U F;  4JRP A;  2XID A;  1M9S A;  2ZZD A;  3BFM A;  3FRN A;  3CC4 T;  4M75 D;  4MML A;  4PNO A;  5CKD A;  2M16 A;  2O01 E;  2QEX A;  5KCO A;  4XAX B;  1UGR B;  1U8R A;  3HSB A;  3CCR T;  1VQM A;  4A4F A;  3L42 A;  3M54 A;  3GNG A;  3RKW A;  2K3X A;  3TCJ A;  5CR2 A;  4DA4 A;  4LD6 A;  1M4Z A;  5D6W A;  3A5Z B;  3QJY A;  5J26 A;  3H8Z A;  3FDR A;  3T9N A;  4M75 G;  3EFR A;  1RI0 A;  2FVU A;  4RKU E;  3X28 B;  1NPP A;  1FX7 A;  1O9S A;  5GAN 8;  1M5Q 1;  2EJG A;  1O75 A;  2P0Q A;  5CK9 A;  1OZ3 A;  4M78 D;  3OMC A;  1N9S A;  4XTU A;  3JCM V;  4C5G A;  2DK3 A;  2RHX A;  2DO3 A;  5CKF A;  4E7K A;  4LDX A;  3UPU A;  2L8D A;  3CCQ T;  4NS5 A;  1I5L A;  4M7A B;  1VIF A;  4M77 F;  3JCM f;  4PKC C;  4CRI A;  2LX9 A;  1YBY A;  4A4G A;  2DXU A;  3OMG A;  3ZEH A;  5HK3 A;  3I55 A;  3JB9 G;  1XNI A;  4X9D A;  1HXD A;  3CC2 T;  1I81 A;  4B9X A;  4PJO E;  2XD0 A;  4A4E A;  2DD4 A;  5KCH A;  2CZ6 B;  1YIT A;  5CCA A;  1M1K U;  3JCM h;  3CCE T;  3CBP A;  2DZC A;  2KAF A;  3A8O B;  3H6Z A;  4HCZ A;  4M77 A;  3OYC A;  3R6O A;  4KBM B;  5FU7 C;  2OTL A;  4N4I A;  2XHC A;  1VQ7 A;  2L89 A;  2HQX A;  3HL8 A;  2XK0 A;  3TRE A;  1Y96 A;  2I2L A;  4A4K A;  2EQK A;  4DQ2 A;  4PLI A;  3QDR B;  3NTI A;  1VQ4 T;  4QVC A;  3QSU A;  2B8A A;  4MDW A;  3JRZ A;  5GMK i;  1DJ7 B;  4ELZ C;  4IUR A;  2XI9 A;  1YJW A;  1VQK A;  2E64 A;  2EQM A;  2LNV A;  4XK8 E;  3O8V A;  4V2S A;  1WNL A;  4M78 B;  3MP1 A;  4L6V 5;  3S3M A;  1KG1 A;  5CQX A;  3UT1 A;  5LJ3 j;  1XTD A;  2RJC A;  4NL2 A;  3M58 A;  3CMA A;  3P8D A;  1U1T A;  2K3Y A;  4J7F A;  3URG A;  4C92 D;  1JJ2 S;  2RD1 A;  3VUB A;  4J83 A;  1PSE A;  4E7I A;  3GP8 A;  2LVM A;  5GAN 3;  3L2Z A;  1M1F A;  3QYG B;  2MI6 A;  4C0D B;  3BDL A;  2XDD A;  2L5Q A;  2ZCF B;  4N4H A;  1YHQ A;  4HT8 A;  1Y07 A;  2E41 A;  4HT9 A;  2JNG A;  3OYB A;  3G4S T;  3G71 A;  3GIB A;  2EQJ A;  1X01 A;  1SSF A;  2KVQ G;  1ZQ1 A;  4FM4 B;  4QQG A;  2V8I A;  4C92 F;  5LJ3 e;  3CCS A;  4M77 D;  2GFA A;  3E9G A;  2R5M A;  4MMK A;  1M90 U;  2CZ1 B;  4MZP A;  2M1H A;  2VYT A;  2WSF E;  2DXB A;  4QVZ A;  1VQN T;  2DAQ A;  2K2V A;  3TEE A;  3QHS A;  3QXE B;  3OYL A;  2DPP B;  4C0F A;  5LJ5 e;  4R55 A;  4J8O A;  1JBM A;  3OQ5 A;  3CC7 A;  3P8H A;  4M7D G;  4LDW A;  4BB7 A;  4Z02 A;  4KUL A;  4P5N A;  4XTY A;  3EFS A;  3CCL A;  3ME9 A;  1OZ2 A;  1BI1 A;  4BUG A;  1YI2 A;  2IVW A;  4EDU A;  3M57 A;  5C6S A;  1VQ6 T;  2X4J A;  3L2R A;  2RA2 A;  5D6X A;  3JCM b;  4IKF A;  4ELY C;  2VGN A;  3LWH A;  2GCX A;  1YCY A;  4M7A A;  4PJO A;  4MDX A;  4M7A G;  2R58 A;  2Y4Y A;  3AHU A;  4NOY A;  4C92 B;  2P0P A;  2XKO C;  2ZPE B;  4F7U A;  2RO0 A;  2BUD A;  1KC8 U;  4PJO D;  1UEB A;  5CKE A;  2RJF A;  3LH0 A;  5KE3 A;  2RK2 A;  1W2B S;  4O6J A;  2YLC A;  3C94 A;  5CVI A;  4OB2 B;  1PSF A;  5GMK h;  2EKO A;  4D6W A;  3NTH A;  2DIQ A;  3CCU A;  4ZGJ B;  4IUQ A;  4II1 A;  4CI0 C;  5IN1 A;  1UGQ B;  4C8Q C;  4PJO F;  4BI3 A;  2QQR A;  3LX7 A;  2CS7 A;  3PIO A;  2QQS A;  3JB9 J;  1K8A C;  3JB9 D;  4M78 F;  3M4Y A;  2DJZ A;  1UB4 A;  2EFI A;  1LNX A;  3FLG A;  3SWN A;  3OS1 A;  4M7D A;  2E70 A;  3WVE B;  3QJ6 A;  4Y28 E;  4RG8 A;  3PMT A;  2QI2 A;  3OSV A;  1WQ7 A;  2LC4 A;  3QZ9 B;  4M77 E;  4EMK B;  1OYX A;  5GAM f;  3CCS T;  3J7A F;  3JB9 H;  4C8Q F;  4M78 G;  3G4S A;  3G71 T;  3CBO A;  3M5A A;  1P92 A;  1UGP B;  3JAM E;  1NZ9 A;  1YHQ T;  4X9C A;  4FU6 A;  2EAY A;  1G5V A;  2JN0 A;  3SFM A;  4E7L A;  3FIF A;  1H64 1;  3RMS A;  3UWN A;  4QQ6 A;  5GAM h;  5GAM j;  2KMT A;  2LT4 A;  3NTK A;  4GLK A;  5CKH A;  1YJN T;  3LW5 E;  1VQ8 T;  4M7A C;  4BAC A;  4HCB A;  5J39 A;  5D6Y A;  5J3B A;  1B34 A;  4B9W A;  4ZGE B;  4OB0 B;  3DLM A;  3SWN B;  2DTI A;  4FT2 A;  5LJ3 g;  5LJ5 f;  3MET A;  3OYY A;  1VQK T;  1RL2 A;  4J6W A;  1YJW T;  1Y7X A;  4M7A F;  1N9R A;  2FB7 A;  4EMK A;  2JUF A;  1VQ4 A;  1G3W A;  3VYH B;  5I21 A;  2K5L A;  3KBG A;  3DB3 A;  1XQH A;  5GAO n;  1BI0 A;  5KE2 A;  5GMK e;  5GAO l;  5FRN A;  5HY6 A;  2QQA A;  5EG2 A;  2Y4X A;  4C5E A;  2OTL T;  4XQ3 A;  2MWP A;  5LJ3 h;  3RES A;  1YJN A;  4LDV A;  1VQ8 A;  3E9F A;  4MZT A;  4C5H A;  3CCE A;  1YIT T;  1JJ2 A;  3OBY A;  4EPC A;  3UDC A;  5LJ5 j;  4M7D F;  3JCM P;  2H3J A;  4JS5 A;  3LYI A;  2ZPF B;  4BDZ A;  4BY6 B;  4XTW A;  3CC2 A;  2FYK A;  4M78 C;  1WPY A;  4ATO A;  4DOV A;  2QXF A;  4EMH A;  2CZ0 B;  4JJN K;  4E7J A;  3I55 T;  3JCM W;  3KUF A;  5IAY A;  3OS2 A;  2A3L A;  2RHY A;  4C92 G;  4M7D D;  3CCQ A;  4JRQ A;  2OAU A;  4LDY A;  2JVV A;  2MMP A;  2QTX A;  3QBY A;  4ZGD B;  4BDY A;  2P0K A;  2XIC A;  1AHJ B;  2RK1 A;  2RB6 A;  3MEW A;  2LTO A;  4L5G A;  5IT9 E;  1D3B B;  3HKS A;  1KHC A;  2FHD A;  3DLL A;  3QYH B;  4J5Y A;  3FEO A;  3PIP A;  4M7A E;  2DD5 A;  2KK4 A;  3CCU T;  4PL6 A;  4MZM A;  5GAN 5;  4KUI A;  2GFU A;  3DB4 A;  3PMI A;  4JS4 A;  2LCL A;  2WSC E;  3VV0 A;  1ZBX A;  2K5I A;  5M9O A;  2ZPI B;  2R5A A;  4OMF B;  3PNW C;  4C0Z A;  2MF2 A;  3QO3 A;  3PTA A;  3CCR A;  4PLL A;  4OB3 B;  2DKG A;  1VQM T;  1K73 C;  1NE8 A;  4PJO G;  1K8A U;  3A8G B;  3ZBD A;  2QEX T;  1X75 C;  1G3S A;  3X20 B;  2M9U A;  5LL6 S;  1QVP A;  5GAN 4;  2M0O A;  4F7U B;  3FB9 A;  1IRE B;  3A8M B;  3MEV A;  3HFN A;  4IUP A;  4M75 A;  4XU1 A;  4E47 A;  1M90 C;  1Q86 U;  1D3B A;  3RKY A;  5HKC A;  5GMK m;  3QII A;  2PQW A;  4O5V A;  3PGG A;  4QQD A;  3JCM g;  3OYM A;  5HK0 A;  1VQ6 A;  2RI3 A;  4QVD A;  3TU4 K;  1VQO T;  2KY9 A;  2RHI A;  2E6N A;  1YI2 T;  3QZ5 B;  5GMK j;  2K57 A;  4OGC A;  3JCM Q;  4R56 A;  3CCL T;  4A54 A;  2F5K A;  2VV5 A;  4M77 B;  4C5I A;  4C92 C;  2ZPB B;  5GAO m;  3OS5 A;  4EMK C;  1B34 B;  2LT1 A;  4M78 E;  3CC7 T;  5GAO r;  1G3T A;  4J7I A;  2A7Y A;  2Y90 A;  1HK9 A;  4C0D C;  1WGS A;  5GMK l;  4JRI A;  1VQL A;  3CXC A;  3HPW A;  1VQN A;  4UC4 A;  4BE1 A;  1N8R U;  2AHJ B;  3JB9 F;  5FU6 C;  3X25 B;  5C0M A;  4ZN3 A;  4RG2 A;  3QG1 A;  1FXX A;  3HHT B;  4ME7 A;  3HRU A;  5L8R E;  5GAN e;  4OVA A;  5LJ5 h;  2KDS A;  3CEY A;  2JOY A;  1U1S A;  4FSX A;  5I2M A;  4LDU A;  3V8L A;  4F7U E;  2DVE A;  3G6E T;  1KQS S;  2RJE A;  3OYE A;  3OYH A;  1S72 A;  1KC8 C;  3CCV A;  1BI3 A;  2OTJ A;  2E12 A;  3SWN C;  5GAN 7;  2LCC A;  2JTM A;  2KQW A;  1YIJ T;  1X6O A;  3OYK A;  3HP9 A;  3ZFJ A;  3OYI A;  1Q81 U;  2PVO B;  3CMA T;  3LWI A;  5A0G A;  3HFO A;  1JB0 E;  1N27 A;  4BI8 B;  2DXT A;  3OYF A;  4PJO B;  1NJI C;  3CCM A;  3CME A;  1NPR A;  3MP8 A;  3PFS A;  3QUI A;  2JTF A;  3M59 A;  4N4G A;  1VQP A;  1VQ5 A;  3JCM d;  2O4X A;  1WJQ A;  3CBM A;  4XU3 A;  1KD1 U;  1K9M U;  2CKK A;  1QVF S;  4E7H A;  1BKB A;  3MEA A;  3I56 T;  4M75 C;  4JUV A;  2LRQ A;  5GAM e;  4JLI A;  4EMG A;  3JCM X;  2GF7 A;  3SB2 A;  4IUV A;  5GAO p;  3VU3 C;  3CXC S;  3RER A;  1VQ7 T;  2X4W A;  2E65 A;  4C92 E;  3LGL A;  4ZTF A;  1W4S A;  2WSE E;  3G7Z A;  3VYG A;  2QQ9 A;  1BIB A;  1Q81 C;  1QP2 A;  3M9Q A;  1LJO A;  2G3R A;  2X35 A;  4N0A C;  4C8Q B;  4C8Q D;  2HD0 A;  5GAO q;  5GAM g;  3QPH A;  2EYQ A;  1K73 U;  1NJI U;  1KQ2 A;  1I8F A;  5GAN g;  4M7D E;  3GLX A;  1K9M C;  2BIV A;  2GQV A;  2RM4 A;  4LD9 K;  4M78 A;  4OP0 A;  3EAE A;  2FL7 A;  4C8Q G;  3MO8 A;  4XU0 A;  4BY6 C;  2X4X A;  5LJ5 d;  2ZPG B;  2K5F A;  2RHU A;  5GAN f;  2DTH A;  1Q7Y C;  4KUD K;  3OYD A;  1TH7 A;  2P4T A;  2VGM A;  2RJD A;  2VUB A;  3RIR A;  3L2W A;  2HNI A;  3OSS C;  4M77 G;  3S3N A;  3C12 A;  1VQ9 T;  5DLQ E;  4HCC A;  5FRO A;  4M7A D;  5A2Q E;  5DM7 R;  2F69 A;  4OF1 A;  4A4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...