5GANj

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
94
structure length
94
Chain Sequence
RAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords U4 snRNA
total genus 15
structure length 94
sequence length 94
chains with identical sequence m
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ganj00
2DZCA 2E41A 4C92A 3RESA 2CGHA 4PJOA 4C8QF 2K57A 4NL3A 4M77D 4F7UE 4HT9A 4J5YA 1KQ1A 2DVEA 1WQWA 5GMKh 5GMKj 2ZGWA 3RIRA 4EMGA 5GAOn 3BDUA 3JCMX 1WNLA 3FJPA 4M78D 1I8FA 4F7UA 3JCMP 2VC8A 4JRIA 4PJOF 5LJ5g 4X9DA 4C8QC 1HXDA 4N0AC 4DQ2A 2E64A 2DTHA 2VXFA 5GAMf 4PJOC 1D3BA 1YCYA 3V7RA 2E65A 5GAMe 3M4GA 4F7UF 2EWNA 5GAN5 4J6XA 4J6YA 2EJ9A 3JCMf 5I21A 3BY7A 4EMKC 5GAOm 3JB9I 2JN0A 4NL2A 3HFOA 4RCBA 5GAMj 4M77C 4M78F 4XU0A 2Y90A 5LJ3h 3V7CA 4M75B 3V8LA 5CAIA 4NOYA 5LJ5h 3EFRA 3JCMW 5GAOr 5GANg 4QVDA 3JCMb 5GAN4 4M78C 4M77F 3V8KA 4M75C 2DTOA 2DKGA 3JCMJ 5GAMd 2EJFA 4C92F 3L2ZA 3RKXA 2DJZA 4M75E 3FB9A 4A54A 4M75F 4M7DG 4A53A 3JCMg 2FB7A 5GAOq 3JCMQ 4N0AA 4HA8A 4OP0A 3SWNB 3PGGA 4C92C 1BIBA 2EAYA 1BIAA 4M7AA 5GANf 2DTIA 4X9CA 4PJOG 3JCMV 1WPYA 3GIBA 5GMKe 2VXEA 4XU2A 4C8QE 1WQ7A 4J6WA 4C8QA 2DEQA 4M7AD 5LJ3g 4M7AG 3QUIA 4XTUA 4JRKA 4F7UG 2DXUA 4HT8A 3JB9F 3QHSA 3AHUA 3HFNA 5GAN8 4PJOB 3RERA 5GAMh 1Y96A 4XQ3A 2DZ9A 2YLBA 5GAMg 5GAOp 1M5Q1 4M78G 1HK9A 1N9SA 4M75A 1LJOA 4XTZA 5LJ3f 4C8QG 4QVCA 4M75D 4C92D 5LJ5f 3HSBA 1MGQA 1M8VA 2RD1A 3RUXA 3JB9H 3JCMd 4XU3A 5GAOl 3EFSA 5LJ3d 5GANe 1I5LA 2E10A 4M7DA 1JBMA 4M77E 4M7DE 4WF2A 3JB9D 4Y91A 4XTYA 5LJ5e 4C8QD 2I2LA 1B34A 2YLCA 4C8QB 5LJ5j 4PJOE 2FYKA 3BFMA 4XU1A 3V8JA 4C92E 4EMKB 1TH7A 3INZA 3VU3C 2HNIA 1B34B 1U1TA 4M7AE 5GANj 4PNOA 1X01A 3BW1A 4MMLA 3JCMh 2E1HA 4M78B 1H641 2QTXA 1N9RA 4M75G 4M78A 4RCCA 3SB2A 3JCMe 4M7DF 4M7AC 5GANd 3SWNC 4C92B 5GAN2 3QO3A 4XTXA 4M7AF 3L1AA 5GMKl 1KQ2A 4M77B 5DY9A 4XTVA 3RKWA 5GAN6 5GANh 5LJ5d 4F7UB 1U1SA 4XTWA 3V7SA 5LJ3e 4PJOD 3QSUA 1Y96B 4JLIA 1JRIA 1I81A 2EJGA 4M77A 4M7DC 4V2SA 4EMHA 2RM4A 4MMKA 2YHTA 5GMKi 5GAN7 4C92G 1LOJA 4M7AB 3RKYA 5GMKm 5LJ3j 3JB9J 4M7DD 3JB9G 2RB6A 5GAN3 3SWNA 4M7DB 3JCMc 4M78E 1D3BB 1LNXA 1I4K1 2DXTA 4M77G 3FIFA 4JUVA 4EMKA 2RA2A
chains in the Genus database with same CATH superfamily
2K2VA 2CGHA 3EAEA 2VYTA 2EYQA 4HT9A 2XK0A 3OYGA 4OGCA 4EMGA 4F7UA 4ZGJB 4FSXA 1KJWA 1Q82C 1I0CA 2EWNA 4LDVA 1OZ3A 3OS2A 3DLLA 1VQKT 2DMOA 1VQ6T 3LYIA 1GRIA 1GCPA 4VUBA 4E47A 1YJ9Q 2HBPA 1K8AU 3OYBA 1R8OB 2WACA 1ABOA 1VQ9T 4M75E 1H92A 1VQ8A 4OP0A 1JU5C 2M9UA 4L5GA 1VQMA 1GCQA 2F69A 5KE3A 4EDUA 5A0DA 2BZYA 3PNWC 3OYJA 5I22A 3ZL7C 1WJSA 2DX1A 1Y96A 2RMOA 1VYVA 2LC4A 1KC8R 2RPNA 3RUXA 1OPLA 3VS3A 1UB4A 3L2VA 5GANe 5LJ3d 4WTOB 1OYXA 4HKEA 4M77E 4KGXB 1WXUA 3SHWA 1QCNA 8AT1B 1PKSA 5DLQE 1SSFA 4BE0A 2LCLA 3CC4A 2ZPEB 4NS5A 1TH7A 2QQ9A 1U1TA 1AWXA 4F04B 3S3OA 1WI7A 3S6WA 5IXBA 1X01A 3JCMe 2AZSA 3WXMB 2O4XB 3L1AA 2K5FA 4F7UB 4BE1A 4X34A 3QWXX 4Y92A 5GMKi 1U5SA 1X69A 1SRLA 1NM7A 2M0YA 6AT1B 3G4SQ 2JUFA 1YFNA 1YWPA 2K5LA 2O4XA 4NL3A 4RG2A 5GMKh 4C0ZA 1R0CB 1WNLA 1NEBA 4ELYC 2LDMA 3P8BB 4BDZA 4PJOF 2FPFA 1QCFA 1P92A 4X9DA 1SPKA 4ORZA 3CC7A 4RMOA 3G6ET 3MO8A 2RQUA 3JCMf 1JQQA 2KRSA 2KXCA 5GAOm 1VQ5Q 2PVOB 1TU0B 5A0GA 1R77A 4LDUA 3EFRA 2ZPGB 1JJ2A 3M0SA 2DXBA 1MMNA 4PJJA 2F2XA 2HKQB 1VUBA 1QMCA 1GFDA 4Z88A 4N0AA 2EFIA 2PQWA 2XD0A 1BI0A 1K8AR 2A08A 1VQOA 4XU2A 5IN1A 4QQGA 2IVWA 1MNDA 2W10A 4FYWB 3QHSA 3OS5A 5J39A 1NZ9A 4PJOB 4JRPA 1K73C 1OU8A 2MMPA 1BCOA 4BY6C 2F5TX 2RN8A 3CCUT 1B7TA 5IHNA 3C94A 3N5BB 4J9FA 1N6AA 3FEOA 2K3BA 4XU1A 2Y4XA 3VU3C 2H8HA 1B34B 4MMLA 2JTMA 1YJWA 4RCCA 4M7DF 1N9RA 1C6VX 4XK8E 4C92B 4F16A 1D0XA 1FXXA 2GCXA 3RKWA 1D1CA 3BE3A 5LJ5d 1YP5A 4J9HA 4XTWA 1DJ7B 1K73R 3H8ZA 2XDPA 4V2SA 2E12A 2XU8A 4IUQA 1KD1R 3QYHB 1SSHA 1RI9A 2DZCA 2OAWA 4C92A 2A28A 1KQSA 3OW2P 2EGEA 1KQ1A 1D0ZA 2JW4A 3M57A 4OMQA 1ZUUA 2O01E 2I0NA 2LJ0A 2HQEA 5LJ5g 2L2PA 3OMCA 1M90U 1K9MU 2DM1A 1MV3A 4LNPA 2E5QA 3CCUQ 3CCVQ 1JJ2S 5ECAA 2YXYA 2K3XA 2RO0A 1BI3A 5GANg 2YUPA 3RR6A 1NPRA 2DKGA 2DPPB 3HL8A 1QVFP 1YJWT 4C92F 4A54A 4QKUA 1VOMA 1QVFA 3P8HA 3JSCA 2VGMA 1BIAA 2DRMA 4AFQC 2DVJA 3CC7Q 3M5AA 3D7SB 2L0AA 2JM8A 1HD3A 3GBQA 1YN8A 2Y4YA 3QZ5B 3CCQT 3MHXA 3CCJT 2H3JA 2QTVA 2YLBA 5C0MA 2J6OA 1N9SA 3EGUA 5KH6A 5L23A 2IIMA 1WHJA 2D9TA 1X6BA 1T3LA 2IG0A 3EG3A 4ZN1A 2RI5A 4Z02A 2H3EB 3P8DA 2LQWA 3OY9A 1BBZA 3CC2T 5FRMA 2Z0WA 3LWHA 1X2QA 1N27A 3INZA 2HCKA 2HNIA 1RLQC 4E7LA 5GANj 1FX7A 2CP3A 2LQKA 1B3QA 3SWNC 2HQXA 2M1HA 5DY9A 4RG8A 1D1BA 3REAB 3QSUA 2QK0A 2RK2A 3OYNA 3M4YA 1PNJA 1M8MA 1AD5A 1I1JA 2QQRA 5IXFA 1ZUYA 1D3BB 1C0MA 4EMKA 1KC8U 2NUZA 1VQ7A 2K57A 3EGXA 2DAQA 4E2FB 2D6FA 3CMEA 1UG1A 4ZGDB 3VS4A 1M2VB 3EG9A 1D3BA 1UTIA 1ARKA 4CC7A 3I5RA 3CCRA 1OX8A 1RAHB 2DBMA 1ACMB 3BY7A 3U23A 1NJIC 2CZ7B 2PVGB 2AT1B 1UGSB 2FZCB 5CKDA 3EG9B 4J9IA 3G4SA 2XMFA 3GNFB 2GBQA 3L42A 2L3PA 3CXCP 1Q7YU 1OU9A 3I56T 3CXCA 1IGUA 1YHQA 3MEUA 5GANf 5M9OA 4Q5WA 2ATCB 1AZGB 4DEXA 4E7KA 2OX7A 1MV0B 3CCEA 4FW2A 2DXUA 3VS7A 4JJNK 1QVGP 2EKOA 4IUUA 2L8DA 2MPXC 1M90R 4C92D 5LJ5f 1AVZC 3CCLQ 5GAOl 3VYHB 1Q7YC 2L3QA 1I5LA 4AG1C 2RHYA 2M51A 3REBB 1QVPA 2CP6A 2DL4A 2PZ1A 3V8JA 1VQNT 4EMKB 2K5IA 4BUGA 5A0LA 2JMAA 2E5KA 5CKBA 1X75C 3EGXB 3TREA 1KHIA 5KYUB 4C5GA 4P5NA 4PJOD 3QIIA 3OYAA 1RI0A 2HZYA 2O9SA 3LGFA 1KC8C 4M7DD 1G5VA 3SWNA 2HAXA 1WHMA 2F2VA 1AOJA 1LNXA 3SEMA 1Q81C 3OYMA 3EG2A 4FYYB 4BY6B 2J6FA 4C0DB 3CQTA 1VQPA 1RADB 1UJ0A 1TTHB 2OJ2A 4DA4A 1O9SA 2BE7D 2EGCA 5IT9E 3PIOA 1VQ9Q 3OS1A 2GFUA 3G1JA 3JAME 1LPLA 3OW2A 4EIKA 3CC4T 1N8RR 2XHCA 2JN0A 4XU0A 2Y90A 2K2MA 3CD6T 5KCOA 2FVUA 2DTOA 5GAMd 3ASKA 1GXIE 4B9WA 2XKOC 4E7SA 1NPPA 1W70A 1QKXA 1IXDA 2AHJB 3OYDA 4Z89A 2VXEA 4Z8AA 3MP6A 3VS1A 2D8HA 4OVAA 2DFUA 3QYGB 4RTUA 2DD5A 4XTUA 2BUDA 4HT8A 1WIEA 1FWZA 3EGDB 2DERA 3AHUA 2CYZB 5GAN8 2X4XA 4FT4A 4XQ3A 5GAOp 1AWWA 1LJOA 4XTZA 3PVLA 3CCST 3X20B 4WCIA 1YIJQ 1XTDA 1BKBA 3MEVA 2RQWA 3M53A 2FHDA 1OV3A 1H3ZA 5CQYA 2ZPBB 1GCQC 3I56A 2P0QA 1S72T 2MIOA 3CCQQ 3CCEQ 3A5ZB 2W0ZA 4YTLA 4ELZC 4PK4A 2C0IA 5AYFA 1IHVA 1M2VA 1E7OA 1G3TA 1TWBA 4M77B 3E2UA 4IUPA 2RQRA 2QQSA 4EMHA 1VYTA 2B86A 1VQOT 4UC4A 1VQLT 1BI2A 2CUBA 1UDLA 2DILA 4QW2A 1IO6A 2E4HA 1A0NB 2RHUA 4IIMA 2ROTA 1MMGA 4F7UE 4HXJA 4ZNXA 4E7HA 1VQOQ 2A37A 2V1QA 2L3RA 2VC8A 3R6OA 2KT8A 2M02A 4XAXB 1PSEA 1KHCA 2R5MA 2LQNA 3CCMA 4BI8B 4MDXA 1SRMA 2FEIA 4ZGEB 5IHKA 2KY9A 3CC2A 4NL2A 1KD1C 4RCBA 3A8HB 4M78F 5LJ3h 3QDRB 3TQ7P 2PU9B 3OSSC 4OF1A 4OMLA 4QT7A 3S3NA 3VV0A 3NPFA 4Y28E 5D6YA 3CC7T 4C92C 1OEBA 1U06A 3TEEA 3MPUB 2DK3A 3ZFJA 1V1CA 2VVKA 2DA9A 1EZZB 4M7AD 4IUVA 2X4WA 2E70A 4LDWA 3WVDB 1S1NA 1TUGB 3CCJA 1GBRA 4LUDA 2EKHA 3NHNA 4K11A 5DLOA 2COZA 2C0TA 1HJDA 2A3LA 2QDLA 5HK0A 1I07A 4HVVA 4PFZA 4C8QD 3ER0A 3OYFA 4HCZA 4ME7A 2BTTA 4JDSA 1TXQA 2DL3A 2YUQA 2R5AA 3M0UA 1H641 2R57A 5GANd 2JOYA 1KIKA 2D0NA 3EFOA 2RJEA 3VUBA 2HKNA 1JO8A 2RJFA 2XG8D 1LCKA 5KE2A 3G71Q 4PJLA 3I56Q 4KBMB 1LVKA 4C8QF 3CCQA 1UUEA 4IIOA 2K3YA 4GLKA 3EFOB 3MCAB 4N4IA 3G6EQ 3LH0A 1NE8A 1SHFA 1E6HA 3H9NA 1WYXA 4R0KA 1SG5A 3CPFA 2V8KA 2LX9A 3A1PA 1X43A 1TS9A 3OBYA 4RTWA 2KYMA 2NWMA 4AFSC 1M1GA 3E9FA 1NYGA 2D8JA 1PWTA 2DIGA 4AFZC 3SDZA 3HKSA 3PGGA 4J9CA 1WHKA 3JCMV 2RHZA 4N4HA 4HVUA 3HHTB 1K1ZA 1OZ2A 2F1LA 1NJIR 2D1XA 3TSZA 1KQSS 2DBKA 1M1FA 2CT3A 4C8QG 3JB9H 3J80E 1K73U 1SKUB 2OAUA 4RTZA 1Q81U 1X6GA 1OQKA 2FPEA 5LJ5j 1MNEA 2X3WD 4RTXA 2SRCA 3Q1JA 4ZTFA 1QLYA 2KYBA 2CH4W 2FRWA 2QA4Q 3EHQA 3KFVA 3CCRQ 4XTXA 3G4ST 3CCJQ 5IH2A 3CEYA 1AZEA 1U1SA 3OYKA 3OW2S 2RM4A 1G3YA 3OB9A 3PVQA 4LUEA 4M78E 3CPWS 1YITQ 1VQ8T 4JJDA 3RESA 2L5QA 2FPDA 1MHNA 2KNBB 4LD6A 3EH1A 1ZQ1A 1YHQQ 3H0HA 1ZUKA 3NTHA 3JCMX 1I8FA 4JRIA 3M0QA 1YI2Q 4PFPA 2E64A 3TCJA 5GAMf 1AWOA 4E7IA 2E65A 3JRZA 2X4YA 2RHIA 3JB9I 2RHXA 2EQKA 4M77C 4RTVA 4JPBW 3CCLA 3JCMb 4M75C 3JCMJ 2YT6A 1BCMA 3CMAQ 3RKXA 3OYLA 3M0RA 4QQDA 2CKKA 2ECZA 5GAOq 3G6EA 4J9EA 2HSEB 4HA8A 1VQ4T 1TSFA 2K9GA 3NTIA 2C06A 5EG2A 1ZX6A 4F17A 2P0KA 3EHRA 4M7AG 1UGRB 3QUIA 3G71T 2ED0A 2WSFE 3JB9F 1PRMC 2PNIA 1Y7XA 2KRNA 3PIPA 1W6XA 4C0FA 1N8RC 1UGVA 2DZ9A 1PD0A 2MK5A 1FMVA 2VUBA 3PTAA 5I11A 1YNZA 2COYA 1N5ZA 1K9AA 1UE9A 1VQPQ 1JBMA 1T0HA 5CQXA 4FCYA 4AT1B 4C8QB 5L8RE 3FRNA 5GJVB 1UGPB 4PJNA 1M30A 3BW1A 1VQ9A 4FL6A 4J7FA 1M3CA 4LDXA 2B8AA 4JZ3A 1D1AA 1M27C 2WSCE 5LJ3e 2P84A 2HSPA 4MMKA 3CPWA 2LCSA 5LJ3j 3JB9J 3JCMc 4B6MA 1IZ6A 2BZXA 3FIFA 3CC4Q 1ZA1B 2MCNA 1UHCA 1S72A 4BE2A 2X9HA 1RL2A 2JS0A 4PLIA 3KBGA 4M4ZA 2KK4A 3CCVT 3FJPA 2LRQA 4FSSA 2XDDA 2VXFA 3H6ZA 2KVQG 3V7RA 1VQ5T 1M1KC 2CSQA 1ZSZC 4J6XA 5GAN5 3OA6A 1ZSZB 3HFOA 2EPDA 5CAIA 4QVDA 1RLPC 4KH1B 1Z9QA 2GNCA 4JRQA 1Q82U 2O9VA 2QEXQ 2OTJQ 3FB9A 4M7DG 2MAMA 1G3SA 4JS4A 1SF9A 1BIBA 2J7IA 1V76A 1VA7A 2DTIA 3MP8A 1BI1A 4PJOG 1PSFA 3MEAA 4E6RA 5HKCA 3AT1B 3FC3A 1M1KR 4C8QA 2DLPA 4DOWA 4KH0B 3I55Q 1R0BG 1ZHIA 2M0OA 3H0IA 4D8KA 2C0OA 2AKLA 1B07A 1V29B 5LJ3f 5FU7B 1QP3A 3JCMd 4XU3A 4JJBA 2GF7A 1M1KU 4KRTA 1H3HA 1W1FA 5J26A 1PKTA 1B34A 1MMDA 5CKEA 3E9GA 4C92E 5LL6S 4A4EA 4M78B 1BK2A 4M7AC 3SB2A 2J05A 4RTYA 3RMQA 3CMET 5CKFA 3CCSQ 1X2KA 5GANh 3CMAT 3A8LB 2MWOA 1I81A 1OX9A 1M3AA 1SEMA 4ANJA 1TUCA 1XNIA 4D6WA 1NLOC 1WGSA 2F5KA 1BU1A 1EX4A 4A4FA 5C6SA 4JZ4A 4J5YA 4DBQA 5DM7R 4FW1A 5GAOn 3BDUA 1QWEA 3JCMP 1QWFA 1HXDA 4N0AC 4DBRA 4PJOC 2DJQA 4J9BA 1VQMQ 3M4GA 2DD4A 3QWYA 5I21A 2ZPFB 3RBBB 2DEUA 3CCET 2A36A 2CP0A 1QCOA 3CD6A 1S72Q 5GAN4 5IAYA 3DKMA 4J8OA 2JVVA 4GLMA 4D8DA 4PKCC 3L2ZA 3HPWA 3QJ6A 2JNGA 3NGPA 3CCRT 3J7AF 4B9XA 2XICA 5AT1B 3CBPA 3CCVA 2ZPIB 3HP9A 5LJ3g 3L2QA 2QASA 5D7UA 2KR3A 4E7ZA 4PLLA 3LWIA 1VQKA 2IPOB 4N4GA 5GAMh 5FWCA 5I2MA 4M78G 1TUDA 2QEXA 2JS2A 3ME9A 1JXOA 4RKUE 3HTRA 3OMGA 4R55A 2LT4A 1HSQA 2HD0A 4Y91A 5LJ5e 3CMAA 1AT1B 2D0QB 2HBWA 5HK3A 2ZPHB 1WX6A 2KDSA 4II1A 1Q95G 1O75A 3V7CA 1FYNA 2QTXA 2OTLT 2PTKA 1Q86U 5GAN2 4R56A 4LXCA 4JLGA 1PD1A 1PCXA 2LJ3A 3V7SA 5FLXE 4AFUC 4E7JA 1GFCA 1OULA 2G3RA 4OMFB 2KT1A 3QKJA 1VQLQ 4EMKC 4PJOA 2XDBA 4HCCA 3M55A 4FU6A 5GMKj 1KQSP 2CREA 2J6KA 3CCSA 2QXFA 1CSKA 9ATCB 4OMOA 4DQ2A 2NLUA 1PHTA 4C0GA 4J6YA 3QJYA 2V8IA 4BB7A 2GQVA 4FIBA 2ESWA 3VKIA 2MF2A 5GAMj 1PM3A 2DYBA 2VWFA 4M7DA 4OGEA 3URGA 2MOXA 4M78C 1EIFA 2RK1A 4J9DA 3LX7A 4OB1B 3HRSA 3M59A 1VQ7T 3M58A 3KUFA 2L3SA 3CMEQ 3META 4C5EA 1NYFA 2MI6A 2MWPA 3A8OB 2QDYB 1Q81R 3GIBA 3WVEB 4J6WA 2DEQA 2LT1A 1RACB 1IB8A 2BKDN 1MMAA 3GF5A 1WHLA 2FG0A 1WLPB 1HK9A 4M75D 2JMCA 2LJ1A 3O8VA 1YITA 2JM9A 1M8VA 1C1AA 2JZ2A 4OMMA 3C0CA 2XI9A 5CCAA 1YJNQ 4QQ6A 1VQ4Q 1VIEA 1VQPT 4J83A 4RTTA 3DB3A 1YI2A 1F1BB 2DE0X 1WJRA 2GGRA 2KE9A 2RNAA 2R58A 3X26B 1VQKQ 3HRTA 2RF0A 4BACA 5GMKl 2VB6A 2FZGB 2HL5C 3THKA 4XTVA 1RAIB 2LTOA 2BE9B 3TU4K 1YCSB 4M7DC 2DL8A 3A98A 3MEWA 4O5VA 3CCUA 2KAFA 2VV5A 4IURA 5KYYB 1I4K1 2J06A 3ZBDA 2P0PA 2QYZA 4M77D 2E6NA 2GQIA 1KG1A 4LN2A 2CZ0B 1W2BA 1I5OB 3UF4A 3VJPA 1NBEB 2K7AA 1W2BP 1KK7A 3OBWA 2E3HA 2NYSA 3X28B 3KXTA 1UFFA 2QQBA 2DL7A 1QKWA 4HCKA 3OYHA 1YIJT 3RNJA 3V8LA 2LP5A 3JCMW 1WHHA 5GAOr 1AWJA 2ZAEA 2RJDA 4ZTJA 2M16A 1IHWA 2FO0A 1YHQT 1K76A 1IRXA 2CDTA 5CR2A 3UPUA 1M4ZA 1T3SA 3PMTA 4PJMA 2QGGA 2CP7A 2DXCA 4M7AA 3M0PA 2HDAA 1RAAB 2CZ1B 2OI3A 2EYYA 2PVDB 2LVMA 3NFCA 3PE0A 3PFSA 2X35A 1AHJB 1MUZA 1UGQB 2QG9B 1K8AC 2EVRA 3MKDA 2DRKA 1JXMA 3A8MB 4MZMA 3OQ5A 5I2SA 1M5Q1 4M75A 1MGQA 3LH5A 3CD6Q 1XQHA 4MZPA 4CRIA 1WXTA 3LLRA 3EFSA 2CSIA 2RJCA 3OS0A 1VQ6A 2YLCA 3FLGA 3BFMA 3RMSA 1VQ7Q 4M7AE 3I5SA 2K6DA 4PNOA 1YI2T 3NMZC 1VQNA 2V26A 3QZ9B 4HVWA 3LGLA 1YIJA 1LOJA 3MP1A 1QVGS 2YUNA 3M0TA 4M7DB 3I35A 1IREB 3I55T 1RAEB 3UWNA 4BD3A 2OTJA 2CH4A 3CBOA 1NG2A 4GBQA 2DYIA 3RDVA 3UA6A 1X27A 1X6OA 4F14A 2HL3A 1U8RA 2EYXA 2KSSA 3MJXA 2GTJA 2DTHA 2ED1A 2QEXT 3I55A 5GAMe 1BB9A 1K0XA 3T9NA 2O88A 4OB0B 1FMKA 2RI2A 3L2WA 1WXBA 1NEGA 4JJCA 5KYUA 5D6WA 4M77F 2PUKB 5IHIA 3X24B 2RH2A 1RAGB 1HYOA 1PG5B 4A63B 4A53A 3SWNB 3JV3A 2EAYA 2RQTA 3EG0A 5FU6C 1WPYA 4L6V5 1M9SA 2AZVA 4C5IA 1QVGA 1RABB 3CC2Q 2K79A 1M3BA 3QBYA 3L2UA 2P4RA 5FROA 3ULRB 5D6XA 5KYYA 1JEGA 3VS2A 2KBTA 2E6ZA 3VS6A 5KYNA 4M7DE 4C0DC 1WZOA 2VGNA 5FW9A 4LE9A 2E3IA 3QG1A 1YWOA 2BZ8A 2K4YA 4M75G 2EQIA 2LMJA 5FWBA 3QO3A 1FMWA 3UA7A 2L89A 2JTFA 3ZEHA 4AMCA 4O6JA 3CBMA 3E19A 4CC4B 1VQMT 2RB6A 2X4JA 1ZBJA 3VS0A 2DXTA 2HMAA 3OSVA 1JRIA 2DO3A 2QA4T 1OPKA 3VUZA 4KT0E 2DVEA 2SEMA 1WQWA 3E1SA 2GFAA 5FRNA 2ZGWA 4OB3B 2QAZA 3RIRA 1Y71A 2VKNA 1VQNQ 3OYEA 2EYZA 2AK5A 4ATOA 1YCYA 3VRZA 3GPLA 1KSWA 1JB0E 4L59A 4F7UF 2O31A 2YRCA 4A4GA 3EH2A 3J81E 1JJ2P 3G71A 2WSEE 4M75B 4RUGA 4NOYA 5LJ5h 1BYMA 3OYIA 3V8KA 2RI3A 1ABQA 3UDCA 2PUOB 4M75F 5GJWB 3VYGA 2FB7A 5KYWA 3OYYA 2X3XD 4MZTA 3L2RA 2FRYA 3HRUA 1WQ7A 1TOVA 4KUIA 1SHGA 4BI4A 2DF6A 3S3MA 2A0FB 2QGFB 1G83A 2X51A 5CVIA 3EGDA 1D09B 2EW3A 4QVCA 4JS5A 1VQLA 2YDLA 2KMTA 2DNUA 3VRYA 5CK9A 2E10A 4PL6A 3JB9D 4DOVA 4XTYA 1M90C 1RAFB 2EQMA 4FYXB 5HCKA 5FU7C 3BDLA 1T0JA 3GLXA 3TVTA 1Q7YR 4HCBA 4QVZA 2OTJT 2E1HA 4KGZB 2KEAA 4M7AF 3X25B 5A2QE 3UT1A 2KROA 3GP8A 3CCLT 1UHFA 4JLIA 2EJGA 4M77A 3CCMQ 4C92G 3PT9A 1YJ9A 3FJ5A 1G8XA 2CZ6B 4C5HA 5GAN3 3C12A 2XIDA 4M77G 3H0FA 4JUVA 1NLPC 2RA2A 2E41A 2FZKB 3CCMT 5CIUA 1YJ9T 4LDYA 2AIRB 4TVRA 1WHGA 3VS5A 1GBQA 1UEBA 1VQ6Q 2LQ8A 3TSWA 2CUDA 1WDXA 3F70A 4DEYA 3LW5E 1K0SA 1YJWQ 1RUWA 2NUTA 3R6NA 1W2BS 1QP2A 1VIFA 4ESRA 3H41A 2YSQA 1Z9ZA 3DLMA 1EFNA 2BIVA 1H8KA 1J3TA 1XJWB 1YJNA 2OTLA 2NUTB 2DJZA 5EC7A 1VQ4A 2HQHA 1Y57A 3JCMg 3JCMQ 2COWA 2CS7A 3M56A 4KUDK 4X9CA 3G7ZA 2LX7A 1ZSGA 5GMKe 4C8QE 8ATCB 1OOTA 2EGAA 3QXEB 2CP2A 1YBYA 4F7UG 2G6FX 3HFNA 4J7IA 3I9QA 3RERA 4DBHA 4CC2A 5GAMg 2ENMA 1OI1A 1WFWA 2YRDA 1IGQA 2KGTA 2ABLA 1WJQA 2YWWA 1ZA2B 4FM4B 5KYXB 2MYSA 1K9MC 2KI7A 4WF2A 2O2OA 2JTEA 2I2LA 1CKAA 4FYVB 2AKKA 1M2OA 2FYKA 2EBPA 1AEYA 2DETA 3JCMh 4M78A 2V8JA 1KQ2A 3C95A 2CP5A 3C4SA 3CXCS 1K4US 7AT1B 3CPWP 1XOVA 1Y96B 1PRLC 3SD4A 1D0YA 2LCCA 1VYUA 2P4TA 4PFOA 5GAN7 3PMIA 5GMKm 3JB9G 4GY5A 1K9MR 2EIFA 1TG0A 1Q86R 3QDFA 1G3WA 4EPCA 2JXBA 5FU6B 1ZLMA 3A8GB 2LNVA 5KYWB 4A4KA 4M78D 2YRVA 4C8QC 3O5ZA 1YITT 1VQ8Q 2VASA 3QPHA 1UJYA 1G2BA 1NJIU 2YUOA 1ZSZA 2LZ6B 2ROLA 1KD1U 2EJ9A 2HEQA 1GL5A 4DBFA 5HY6A 2JJ9A 4KGVB 4BI3A 4IKFA 1WA7A 1Q86C 2EQJA 2CT4A 4LD9K 2QI2A 1QVFS 2EJFA 3DB4A 1N8RU 5CKHA 5KCHA 2JT4A 3OYCA 4OMNA 1PC0A 3M54A 4CI0C 5KYXA 2KXDA 2NUPB 5J3BA 1QW1A 2LNHB 4JRKA 1U3OA 1QQJA 2QA4A 3NTKA 1W4SA 2OTLQ 2DIQA 2EQUA 3HSBA 2KQWA 5CO7A 3GNGA 2RD1A 1YJNT 2NUPA 2A7YA 2RQVA 1KFZA 4BDYA 4ZN3A 4MDWA 4CC3A 4PJOE 1CKBA 2KRMA 1ZBXA 1UECA 4IUTA 2DL5A 3UATA 2ZZDA 3EG1A 3IQLA 2FL7A 1Y07A 2GTOA 2ZCFB 3SFMA 2V1RA 3GOXA 1Y0MA 3M9QA 4OB2B 2F2WA 4KULA 5GAN6 1Q82R 4X1VA 4AG2C 4FT2A 1E6GA 4A4HA 4OMPA 2YHTA 3FDRA 3RKYA 2EYWA 4M7AB 2QQAA 1VQ5A 4J9GA
chains in the Genus database with same CATH topology
2K2VA 3CBOA 2CGHA 3EAEA 4BY6B 2VYTA 2EYQA 4BE2A 1S72A 4C0DB 1VQPA 1RL2A 4HT9A 2XK0A 4PLIA 3KBGA 3OYGA 1X6OA 2KK4A 4OGCA 4EMGA 3CCVT 3FJPA 4F7UA 1U8RA 2LRQA 4DA4A 1O9SA 2KSSA 4ZGJB 2XDDA 2DTHA 4FSXA 2VXFA 5IT9E 3PIOA 3H6ZA 2QEXT 1Q82C 2KVQG 3V7RA 3I55A 5GAMe 1VQ5T 3OS1A 2GFUA 1M1KC 3JAME 2EWNA 3T9NA 4LDVA 1OZ3A 5GAN5 4J6XA 3OS2A 3OW2A 4OB0B 3OA6A 3DLLA 3CC4T 1VQKT 2RI2A 2XHCA 1VQ6T 2JN0A 3HFOA 3LYIA 3L2WA 4XU0A 2Y90A 5CAIA 3CD6T 5D6WA 4VUBA 4E47A 4QVDA 2HBPA 4M77F 2PUKB 3X24B 5KCOA 2FVUA 2RH2A 1K8AU 2DTOA 3OYBA 1R8OB 5GAMd 2WACA 3ASKA 4B9WA 4JRQA 1Q82U 1VQ9T 1GXIE 2XKOC 4M75E 3FB9A 4M7DG 2MAMA 1G3SA 4JS4A 4A53A 1VQ8A 1NPPA 4OP0A 2M9UA 3SWNB 1BIBA 2EAYA 5FU6C 4L5GA 1VQMA 2DTIA 4PJOG 3MP8A 1BI1A 1WPYA 2AHJB 2F69A 3OYDA 1PSFA 2VXEA 3MEAA 5KE3A 4EDUA 3MP6A 5HKCA 5A0DA 4OVAA 3FC3A 4L6V5 1M9SA 3PNWC 4C8QA 4C5IA 3QYGB 1QVGA 2DD5A 4DOWA 3OYJA 4XTUA 2BUDA 4HT8A 3QBYA 3AHUA 1FWZA 1WJSA 2CYZB 1ZHIA 2M0OA 5GAN8 3L2UA 1Y96A 2X4XA 4FT4A 4XQ3A 5GAOp 2LC4A 1V29B 5LJ3f 5FROA 1LJOA 4XTZA 5D6XA 5FU7B 1QP3A 3RUXA 3JCMd 4XU3A 3CCST 2GF7A 1UB4A 3X20B 5GANe 5LJ3d 2E6ZA 3L2VA 1M1KU 1OYXA 4HKEA 1XTDA 1BKBA 3MEVA 4M77E 4M7DE 3M53A 5J26A 2FHDA 1H3ZA 4C0DC 2VGNA 5DLQE 1SSFA 5CQYA 2ZPBB 1B34A 5CKEA 3I56A 4BE0A 2LCLA 3E9GA 2P0QA 1S72T 2ZPEB 3CC4A 4C92E 4NS5A 1TH7A 5LL6S 3QG1A 2QQ9A 1U1TA 3S3OA 4A4EA 3A5ZB 3S6WA 1X01A 4M78B 2K4YA 4M75G 4YTLA 3SB2A 4ELZC 3JCMe 4M7AC 3WXMB 5AYFA 2O4XB 3QO3A 1G3TA 3RMQA 3L1AA 3CMET 5CKFA 2K5FA 4M77B 5GANh 4F7UB 3CMAT 2L89A 2JTFA 3A8LB 4IUPA 2MWOA 4BE1A 4X34A 3ZEHA 1I81A 2QQSA 4EMHA 4O6JA 3CBMA 5GMKi 1XNIA 3E19A 4D6WA 1VQOT 4UC4A 1VQMT 2RB6A 1VQLT 2X4JA 1BI2A 1WGSA 2F5KA 2DXTA 3OSVA 1JRIA 2JUFA 2DO3A 4QW2A 2RHUA 2K5LA 2O4XA 4A4FA 2QA4T 5C6SA 4RG2A 3VUZA 4KT0E 4F7UE 4NL3A 3OYMA 4J5YA 2DVEA 1WQWA 3E1SA 2GFAA 5GMKh 5DM7R 5FRNA 2ZGWA 4OB3B 3RIRA 4C0ZA 5GAOn 1Y71A 3BDUA 4E7HA 1WNLA 3OYEA 4ELYC 2L3RA 2LDMA 2VC8A 3P8BB 3R6OA 4PJOF 4BDZA 3JCMP 4X9DA 1HXDA 1P92A 4N0AC 4XAXB 4ATOA 4PJOC 1YCYA 3GPLA 3CC7A 1PSEA 1KHCA 2R5MA 3M4GA 4RMOA 2DD4A 1JB0E 4BI8B 3G6ET 3CCMA 4L59A 3MO8A 4F7UF 4MDXA 3JCMf 5I21A 4ZGEB 4A4GA 2KY9A 2ZPFB 5GAOm 3J81E 3CC2A 4NL2A 2PVOB 4RCBA 3G71A 1KD1C 3CCET 3A8HB 2WSEE 5A0GA 4M78F 5LJ3h 3CD6A 4M75B 3QDRB 4LDUA 4NOYA 3EFRA 5LJ5h 5GAN4 2ZPGB 1JJ2A 2PU9B 1BYMA 5IAYA 3V8KA 2DXBA 3OSSC 3DKMA 4OF1A 3OYIA 2OTJA 4J8OA 2JVVA 2RI3A 4PKCC 3L2ZA 3S3NA 3UDCA 2PUOB 1VUBA 4M75F 3HPWA 3VV0A 3QJ6A 2JNGA 2FB7A 3VYGA 4Y28E 3CCRT 5D6YA 4N0AA 2EFIA 3CC7T 3J7AF 4C92C 4B9XA 2PQWA 2XD0A 1BI0A 3OYYA 2XICA 3TEEA 1VQOA 4MZTA 3L2RA 3HRUA 4XU2A 2DK3A 1WQ7A 3ZFJA 4KUIA 5IN1A 3CBPA 2IVWA 4QQGA 2ZPIB 4BI4A 3HP9A 3CCVA 5LJ3g 3L2QA 4IUVA 4M7AD 3S3MA 2X4WA 3LWIA 2E70A 4PLLA 4LDWA 1VQKA 3QHSA 3WVDB 3OS5A 5J39A 1NZ9A 4N4GA 4PJOB 5GAMh 5CVIA 3CCJA 4JRPA 1K73C 2MMPA 4M78G 5I2MA 4QVCA 4BY6C 5DLOA 4JS5A 2QEXA 1VQLA 2F5TX 3ME9A 2KMTA 3CCUT 4RKUE 3OMGA 5CK9A 2A3LA 2E10A 3C94A 3N5BB 4PL6A 5HK0A 1N6AA 4R55A 2LT4A 3JB9D 3FEOA 2HD0A 4Y91A 4XTYA 4DOVA 5LJ5e 2D0QB 3CMAA 1M90C 4C8QD 5HK3A 2ZPHB 2EQMA 3ER0A 4XU1A 2Y4XA 2KDSA 5FU7C 4II1A 3BDLA 3OYFA 3GLXA 3VU3C 4HCBA 1B34B 4HCZA 1O75A 4ME7A 4QVZA 2OTJT 4JDSA 4MMLA 2R5AA 2JTMA 3V7CA 2E1HA 4RCCA 1H641 2QTXA 1N9RA 1YJWA 2R57A 4M7DF 4XK8E 2OTLT 1Q86U 5GANd 4C92B 2JOYA 5GAN2 4R56A 1FXXA 4M7AF 2GCXA 3X25B 4JLGA 3RKWA 5A2QE 3UT1A 3CCLT 3GP8A 5LJ5d 4XTWA 3V7SA 1DJ7B 3H8ZA 2XDPA 4JLIA 5FLXE 2EJGA 2RJEA 4M77A 4V2SA 3VUBA 2E12A 2XU8A 4IUQA 2RJFA 4E7JA 4C92G 3PT9A 1YJ9A 2G3RA 3QYHB 2XG8D 2CZ6B 4C5HA 5GAN3 3C12A 4OMFB 2XIDA 3QKJA 4M77G 4EMKC 4JUVA 5KE2A 2RA2A 2DZCA 2E41A 4KBMB 4C92A 3CCMT 5CIUA 1YJ9T 4LDYA 1KQSA 4PJOA 4C8QF 3CCQA 2XDBA 4HCCA 1KQ1A 3M55A 4TVRA 2K3YA 4FU6A 4GLKA 5GMKj 3M57A 1UEBA 2O01E 2LQ8A 2HQEA 5LJ5g 3MCAB 2QXFA 3CCSA 4N4IA 4DQ2A 3OMCA 3F70A 3LH0A 3LW5E 1M90U 2NLUA 1W2BS 1K9MU 1NE8A 1QP2A 1VIFA 4C0GA 2E5QA 4J6YA 3QJYA 3CPFA 2V8IA 4BB7A 3DLMA 1JJ2S 2GQVA 2LX9A 2V8KA 4FIBA 3VKIA 2MF2A 5GAMj 3OBYA 4M7DA 2K3XA 2RO0A 2BIVA 1BI3A 4OGEA 1M1GA 3URGA 3E9FA 5GANg 4M78C 1EIFA 2RK1A 1NPRA 1YJNA 2DKGA 2DPPB 3LX7A 4OB1B 2OTLA 3HL8A 3HRSA 1YJWT 3M59A 4C92F 1VQ7T 2DIGA 2DJZA 3M58A 3KUFA 1VQ4A 4A54A 3META 3JCMg 4C5EA 1QVFA 3JCMQ 3SDZA 3HKSA 2MI6A 2CS7A 2MWPA 3A8OB 3M56A 3P8HA 3JSCA 3PGGA 2VGMA 1BIAA 4KUDK 2QDYB 3G7ZA 3M5AA 4X9CA 3JCMV 3GIBA 2RHZA 4N4HA 5GMKe 4C8QE 3WVEB 4J6WA 3HHTB 2DEQA 2LT1A 3QXEB 1OZ2A 1YBYA 4F7UG 2Y4YA 3QZ5B 3HFNA 4J7IA 3CCQT 2BKDN 3MHXA 3CCJT 3RERA 2H3JA 2YLBA 5GAMg 1KQSS 3GF5A 5C0MA 1OI1A 1HK9A 1N9SA 1M1FA 4C8QG 3O8VA 4M75D 5KH6A 1YITA 1M8VA 3JB9H 3J80E 1K73U 2D9TA 2JZ2A 1WJQA 2OAUA 2XI9A 5CCAA 4FM4B 2IG0A 1Q81U 1K9MC 4WF2A 2RI5A 4QQ6A 4Z02A 4ZN1A 3P8DA 3OY9A 3CC2T 5FRMA 2I2LA 1VIEA 5LJ5j 1VQPT 3LWHA 2FYKA 4J83A 1N27A 3Q1JA 4ZTFA 3INZA 3DB3A 2HNIA 1YI2A 4E7LA 5GANj 1FX7A 1WJRA 2R58A 3JCMh 3X26B 4M78A 2LQKA 3SWNC 2HQXA 3HRTA 2V8JA 4XTXA 2M1HA 3G4ST 4BACA 5GMKl 1KQ2A 3C95A 3C4SA 5DY9A 4XTVA 3CEYA 4RG8A 3CXCS 2LTOA 1U1SA 3OYKA 3TU4K 1XOVA 3QSUA 1Y96B 3SD4A 4M7DC 2LCCA 3OW2S 2P4TA 2RK2A 2RM4A 1G3YA 3MEWA 3OB9A 3OYNA 3M4YA 5GAN7 3PMIA 4O5VA 5GMKm 2KAFA 2VV5A 3CCUA 3JB9G 4IURA 2QQRA 4GY5A 4M78E 1D3BB 1I4K1 3CPWS 3ZBDA 1VQ8T 2EIFA 4EMKA 1KC8U 2P0PA 1G3WA 4EPCA 3RESA 2L5QA 1VQ7A 1MHNA 2K57A 5FU6B 4LD6A 4M77D 2E6NA 1KG1A 2DAQA 1ZQ1A 3A8GB 2LNVA 2CZ0B 3JCMX 3NTHA 1W2BA 4A4KA 4M78D 1I8FA 2D6FA 4JRIA 3CMEA 4ZGDB 2YRVA 4C8QC 3VJPA 1YITT 2E64A 3TCJA 5GAMf 3QPHA 1D3BA 4E7IA 2E65A 1NJIU 3OBWA 3CCRA 3JRZA 2X4YA 1KD1U 2EJ9A 2RHIA 3X28B 3KXTA 3BY7A 2QQBA 3JB9I 1NJIC 5HY6A 2RHXA 3OYHA 2CZ7B 1YIJT 2PVGB 2EQKA 4M77C 4BI3A 4IKFA 3V8LA 3JCMW 3CCLA 5GAOr 1Q86C 1UGSB 2EQJA 3JCMb 2RJDA 5CKDA 4M75C 4ZTJA 2M16A 4LD9K 3JCMJ 2QI2A 1QVFS 2EJFA 3DB4A 1YHQT 3G4SA 3RKXA 1N8RU 3GNFB 3L42A 3OYLA 1Q7YU 5CR2A 3UPUA 1M4ZA 2CKKA 4QQDA 5CKHA 3PMTA 5KCHA 5GAOq 3OYCA 4HA8A 3G6EA 1VQ4T 3I56T 3M54A 3CXCA 1YHQA 2DXCA 3MEUA 4M7AA 5GANf 5M9OA 4Q5WA 4CI0C 3NTIA 2C06A 5EG2A 2CZ1B 2PVDB 2LVMA 3NFCA 5J3BA 4E7KA 3PFSA 1QW1A 2P0KA 2X35A 1AHJB 3CCEA 4M7AG 1UGRB 3QUIA 3G71T 4JRKA 1UGQB 2DXUA 2WSFE 3JB9F 1K8AC 1Y7XA 4JJNK 3PIPA 2QA4A 4C0FA 3NTKA 2EKOA 1N8RC 4IUUA 1W4SA 3A8MB 2DZ9A 2L8DA 4MZMA 3OQ5A 5I2SA 1M5Q1 4M75A 2DIQA 2EQUA 3HSBA 2KQWA 4C92D 5LJ5f 5CO7A 1MGQA 3GNGA 2RD1A 2VUBA 3PTAA 1YJNT 1XQHA 4MZPA 5GAOl 3VYHB 2A7YA 4CRIA 3LLRA 1Q7YC 3EFSA 1I5LA 4BDYA 1JBMA 5CQXA 2RHYA 4ZN3A 2RJCA 3OS0A 1VQ6A 2YLCA 3FLGA 4MDWA 1QVPA 4C8QB 5L8RE 3FRNA 4PJOE 3BFMA 3RMSA 3V8JA 1VQNT 4EMKB 2K5IA 1ZBXA 1UGPB 4IUTA 4BUGA 5A0LA 4M7AE 2ZZDA 4PNOA 3BW1A 2FL7A 5CKBA 1VQ9A 4FL6A 1Y07A 1X75C 4J7FA 3TREA 1YI2T 2ZCFB 3SFMA 4LDXA 1KHIA 3GOXA 2B8AA 1VQNA 3M9QA 4OB2B 4KULA 5GAN6 2WSCE 4C5GA 4P5NA 5LJ3e 4FT2A 3QIIA 3OYAA 4PJOD 1RI0A 4A4HA 3QZ9B 4MMKA 2YHTA 3FDRA 3CPWA 3LGFA 3LGLA 1YIJA 1LOJA 4M7AB 3RKYA 5LJ3j 3MP1A 3JB9J 1QVGS 1KC8C 4M7DD 1G5VA 4M7DB 2QQAA 3SWNA 2HAXA 3JCMc 1Q81C 1LNXA 1IREB 1IZ6A 3I55T 1VQ5A 3FIFA 3UWNA 4BD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DZC A;  2E41 A;  4C92 A;  3RES A;  2CGH A;  4PJO A;  4C8Q F;  2K57 A;  4NL3 A;  4M77 D;  4F7U E;  4HT9 A;  4J5Y A;  1KQ1 A;  2DVE A;  1WQW A;  5GMK h;  5GMK j;  2ZGW A;  3RIR A;  4EMG A;  5GAO n;  3BDU A;  3JCM X;  1WNL A;  3FJP A;  4M78 D;  1I8F A;  4F7U A;  3JCM P;  2VC8 A;  4JRI A;  4PJO F;  5LJ5 g;  4X9D A;  4C8Q C;  1HXD A;  4N0A C;  4DQ2 A;  2E64 A;  2DTH A;  2VXF A;  5GAM f;  4PJO C;  1D3B A;  1YCY A;  3V7R A;  2E65 A;  5GAM e;  3M4G A;  4F7U F;  2EWN A;  5GAN 5;  4J6X A;  4J6Y A;  2EJ9 A;  3JCM f;  5I21 A;  3BY7 A;  4EMK C;  5GAO m;  3JB9 I;  2JN0 A;  4NL2 A;  3HFO A;  4RCB A;  5GAM j;  4M77 C;  4M78 F;  4XU0 A;  2Y90 A;  5LJ3 h;  3V7C A;  4M75 B;  3V8L A;  5CAI A;  4NOY A;  5LJ5 h;  3EFR A;  3JCM W;  5GAO r;  5GAN g;  4QVD A;  3JCM b;  5GAN 4;  4M78 C;  4M77 F;  3V8K A;  4M75 C;  2DTO A;  2DKG A;  3JCM J;  5GAM d;  2EJF A;  4C92 F;  3L2Z A;  3RKX A;  2DJZ A;  4M75 E;  3FB9 A;  4A54 A;  4M75 F;  4M7D G;  4A53 A;  3JCM g;  2FB7 A;  5GAO q;  3JCM Q;  4N0A A;  4HA8 A;  4OP0 A;  3SWN B;  3PGG A;  4C92 C;  1BIB A;  2EAY A;  1BIA A;  4M7A A;  5GAN f;  2DTI A;  4X9C A;  4PJO G;  3JCM V;  1WPY A;  3GIB A;  5GMK e;  2VXE A;  4XU2 A;  4C8Q E;  1WQ7 A;  4J6W A;  4C8Q A;  2DEQ A;  4M7A D;  5LJ3 g;  4M7A G;  3QUI A;  4XTU A;  4JRK A;  4F7U G;  2DXU A;  4HT8 A;  3JB9 F;  3QHS A;  3AHU A;  3HFN A;  5GAN 8;  4PJO B;  3RER A;  5GAM h;  1Y96 A;  4XQ3 A;  2DZ9 A;  2YLB A;  5GAM g;  5GAO p;  1M5Q 1;  4M78 G;  1HK9 A;  1N9S A;  4M75 A;  1LJO A;  4XTZ A;  5LJ3 f;  4C8Q G;  4QVC A;  4M75 D;  4C92 D;  5LJ5 f;  3HSB A;  1MGQ A;  1M8V A;  2RD1 A;  3RUX A;  3JB9 H;  3JCM d;  4XU3 A;  5GAO l;  3EFS A;  5LJ3 d;  5GAN e;  1I5L A;  2E10 A;  4M7D A;  1JBM A;  4M77 E;  4M7D E;  4WF2 A;  3JB9 D;  4Y91 A;  4XTY A;  5LJ5 e;  4C8Q D;  2I2L A;  1B34 A;  2YLC A;  4C8Q B;  5LJ5 j;  4PJO E;  2FYK A;  3BFM A;  4XU1 A;  3V8J A;  4C92 E;  4EMK B;  1TH7 A;  3INZ A;  3VU3 C;  2HNI A;  1B34 B;  1U1T A;  4M7A E;  5GAN j;  4PNO A;  1X01 A;  3BW1 A;  4MML A;  3JCM h;  2E1H A;  4M78 B;  1H64 1;  2QTX A;  1N9R A;  4M75 G;  4M78 A;  4RCC A;  3SB2 A;  3JCM e;  4M7D F;  4M7A C;  5GAN d;  3SWN C;  4C92 B;  5GAN 2;  3QO3 A;  4XTX A;  4M7A F;  3L1A A;  5GMK l;  1KQ2 A;  4M77 B;  5DY9 A;  4XTV A;  3RKW A;  5GAN 6;  5GAN h;  5LJ5 d;  4F7U B;  1U1S A;  4XTW A;  3V7S A;  5LJ3 e;  4PJO D;  3QSU A;  1Y96 B;  4JLI A;  1JRI A;  1I81 A;  2EJG A;  4M77 A;  4M7D C;  4V2S A;  4EMH A;  2RM4 A;  4MMK A;  2YHT A;  5GMK i;  5GAN 7;  4C92 G;  1LOJ A;  4M7A B;  3RKY A;  5GMK m;  5LJ3 j;  3JB9 J;  4M7D D;  3JB9 G;  2RB6 A;  5GAN 3;  3SWN A;  4M7D B;  3JCM c;  4M78 E;  1D3B B;  1LNX A;  1I4K 1;  2DXT A;  4M77 G;  3FIF A;  4JUV A;  4EMK A;  2RA2 A; 
#chains in the Genus database with same CATH topology
 2K2V A;  2CGH A;  3EAE A;  2VYT A;  2EYQ A;  4HT9 A;  2XK0 A;  3OYG A;  4OGC A;  4EMG A;  4F7U A;  4ZGJ B;  4FSX A;  1KJW A;  1Q82 C;  1I0C A;  2EWN A;  4LDV A;  1OZ3 A;  3OS2 A;  3DLL A;  1VQK T;  2DMO A;  1VQ6 T;  3LYI A;  1GRI A;  1GCP A;  4VUB A;  4E47 A;  1YJ9 Q;  2HBP A;  1K8A U;  3OYB A;  1R8O B;  2WAC A;  1ABO A;  1VQ9 T;  4M75 E;  1H92 A;  1VQ8 A;  4OP0 A;  1JU5 C;  2M9U A;  4L5G A;  1VQM A;  1GCQ A;  2F69 A;  5KE3 A;  4EDU A;  5A0D A;  2BZY A;  3PNW C;  3OYJ A;  5I22 A;  3ZL7 C;  1WJS A;  2DX1 A;  1Y96 A;  2RMO A;  1VYV A;  2LC4 A;  1KC8 R;  2RPN A;  3RUX A;  1OPL A;  3VS3 A;  1UB4 A;  3L2V A;  5GAN e;  5LJ3 d;  4WTO B;  1OYX A;  4HKE A;  4M77 E;  4KGX B;  1WXU A;  3SHW A;  1QCN A;  8AT1 B;  1PKS A;  5DLQ E;  1SSF A;  4BE0 A;  2LCL A;  3CC4 A;  2ZPE B;  4NS5 A;  1TH7 A;  2QQ9 A;  1U1T A;  1AWX A;  4F04 B;  3S3O A;  1WI7 A;  3S6W A;  5IXB A;  1X01 A;  3JCM e;  2AZS A;  3WXM B;  2O4X B;  3L1A A;  2K5F A;  4F7U B;  4BE1 A;  4X34 A;  3QWX X;  4Y92 A;  5GMK i;  1U5S A;  1X69 A;  1SRL A;  1NM7 A;  2M0Y A;  6AT1 B;  3G4S Q;  2JUF A;  1YFN A;  1YWP A;  2K5L A;  2O4X A;  4NL3 A;  4RG2 A;  5GMK h;  4C0Z A;  1R0C B;  1WNL A;  1NEB A;  4ELY C;  2LDM A;  3P8B B;  4BDZ A;  4PJO F;  2FPF A;  1QCF A;  1P92 A;  4X9D A;  1SPK A;  4ORZ A;  3CC7 A;  4RMO A;  3G6E T;  3MO8 A;  2RQU A;  3JCM f;  1JQQ A;  2KRS A;  2KXC A;  5GAO m;  1VQ5 Q;  2PVO B;  1TU0 B;  5A0G A;  1R77 A;  4LDU A;  3EFR A;  2ZPG B;  1JJ2 A;  3M0S A;  2DXB A;  1MMN A;  4PJJ A;  2F2X A;  2HKQ B;  1VUB A;  1QMC A;  1GFD A;  4Z88 A;  4N0A A;  2EFI A;  2PQW A;  2XD0 A;  1BI0 A;  1K8A R;  2A08 A;  1VQO A;  4XU2 A;  5IN1 A;  4QQG A;  2IVW A;  1MND A;  2W10 A;  4FYW B;  3QHS A;  3OS5 A;  5J39 A;  1NZ9 A;  4PJO B;  4JRP A;  1K73 C;  1OU8 A;  2MMP A;  1BCO A;  4BY6 C;  2F5T X;  2RN8 A;  3CCU T;  1B7T A;  5IHN A;  3C94 A;  3N5B B;  4J9F A;  1N6A A;  3FEO A;  2K3B A;  4XU1 A;  2Y4X A;  3VU3 C;  2H8H A;  1B34 B;  4MML A;  2JTM A;  1YJW A;  4RCC A;  4M7D F;  1N9R A;  1C6V X;  4XK8 E;  4C92 B;  4F16 A;  1D0X A;  1FXX A;  2GCX A;  3RKW A;  1D1C A;  3BE3 A;  5LJ5 d;  1YP5 A;  4J9H A;  4XTW A;  1DJ7 B;  1K73 R;  3H8Z A;  2XDP A;  4V2S A;  2E12 A;  2XU8 A;  4IUQ A;  1KD1 R;  3QYH B;  1SSH A;  1RI9 A;  2DZC A;  2OAW A;  4C92 A;  2A28 A;  1KQS A;  3OW2 P;  2EGE A;  1KQ1 A;  1D0Z A;  2JW4 A;  3M57 A;  4OMQ A;  1ZUU A;  2O01 E;  2I0N A;  2LJ0 A;  2HQE A;  5LJ5 g;  2L2P A;  3OMC A;  1M90 U;  1K9M U;  2DM1 A;  1MV3 A;  4LNP A;  2E5Q A;  3CCU Q;  3CCV Q;  1JJ2 S;  5ECA A;  2YXY A;  2K3X A;  2RO0 A;  1BI3 A;  5GAN g;  2YUP A;  3RR6 A;  1NPR A;  2DKG A;  2DPP B;  3HL8 A;  1QVF P;  1YJW T;  4C92 F;  4A54 A;  4QKU A;  1VOM A;  1QVF A;  3P8H A;  3JSC A;  2VGM A;  1BIA A;  2DRM A;  4AFQ C;  2DVJ A;  3CC7 Q;  3M5A A;  3D7S B;  2L0A A;  2JM8 A;  1HD3 A;  3GBQ A;  1YN8 A;  2Y4Y A;  3QZ5 B;  3CCQ T;  3MHX A;  3CCJ T;  2H3J A;  2QTV A;  2YLB A;  5C0M A;  2J6O A;  1N9S A;  3EGU A;  5KH6 A;  5L23 A;  2IIM A;  1WHJ A;  2D9T A;  1X6B A;  1T3L A;  2IG0 A;  3EG3 A;  4ZN1 A;  2RI5 A;  4Z02 A;  2H3E B;  3P8D A;  2LQW A;  3OY9 A;  1BBZ A;  3CC2 T;  5FRM A;  2Z0W A;  3LWH A;  1X2Q A;  1N27 A;  3INZ A;  2HCK A;  2HNI A;  1RLQ C;  4E7L A;  5GAN j;  1FX7 A;  2CP3 A;  2LQK A;  1B3Q A;  3SWN C;  2HQX A;  2M1H A;  5DY9 A;  4RG8 A;  1D1B A;  3REA B;  3QSU A;  2QK0 A;  2RK2 A;  3OYN A;  3M4Y A;  1PNJ A;  1M8M A;  1AD5 A;  1I1J A;  2QQR A;  5IXF A;  1ZUY A;  1D3B B;  1C0M A;  4EMK A;  1KC8 U;  2NUZ A;  1VQ7 A;  2K57 A;  3EGX A;  2DAQ A;  4E2F B;  2D6F A;  3CME A;  1UG1 A;  4ZGD B;  3VS4 A;  1M2V B;  3EG9 A;  1D3B A;  1UTI A;  1ARK A;  4CC7 A;  3I5R A;  3CCR A;  1OX8 A;  1RAH B;  2DBM A;  1ACM B;  3BY7 A;  3U23 A;  1NJI C;  2CZ7 B;  2PVG B;  2AT1 B;  1UGS B;  2FZC B;  5CKD A;  3EG9 B;  4J9I A;  3G4S A;  2XMF A;  3GNF B;  2GBQ A;  3L42 A;  2L3P A;  3CXC P;  1Q7Y U;  1OU9 A;  3I56 T;  3CXC A;  1IGU A;  1YHQ A;  3MEU A;  5GAN f;  5M9O A;  4Q5W A;  2ATC B;  1AZG B;  4DEX A;  4E7K A;  2OX7 A;  1MV0 B;  3CCE A;  4FW2 A;  2DXU A;  3VS7 A;  4JJN K;  1QVG P;  2EKO A;  4IUU A;  2L8D A;  2MPX C;  1M90 R;  4C92 D;  5LJ5 f;  1AVZ C;  3CCL Q;  5GAO l;  3VYH B;  1Q7Y C;  2L3Q A;  1I5L A;  4AG1 C;  2RHY A;  2M51 A;  3REB B;  1QVP A;  2CP6 A;  2DL4 A;  2PZ1 A;  3V8J A;  1VQN T;  4EMK B;  2K5I A;  4BUG A;  5A0L A;  2JMA A;  2E5K A;  5CKB A;  1X75 C;  3EGX B;  3TRE A;  1KHI A;  5KYU B;  4C5G A;  4P5N A;  4PJO D;  3QII A;  3OYA A;  1RI0 A;  2HZY A;  2O9S A;  3LGF A;  1KC8 C;  4M7D D;  1G5V A;  3SWN A;  2HAX A;  1WHM A;  2F2V A;  1AOJ A;  1LNX A;  3SEM A;  1Q81 C;  3OYM A;  3EG2 A;  4FYY B;  4BY6 B;  2J6F A;  4C0D B;  3CQT A;  1VQP A;  1RAD B;  1UJ0 A;  1TTH B;  2OJ2 A;  4DA4 A;  1O9S A;  2BE7 D;  2EGC A;  5IT9 E;  3PIO A;  1VQ9 Q;  3OS1 A;  2GFU A;  3G1J A;  3JAM E;  1LPL A;  3OW2 A;  4EIK A;  3CC4 T;  1N8R R;  2XHC A;  2JN0 A;  4XU0 A;  2Y90 A;  2K2M A;  3CD6 T;  5KCO A;  2FVU A;  2DTO A;  5GAM d;  3ASK A;  1GXI E;  4B9W A;  2XKO C;  4E7S A;  1NPP A;  1W70 A;  1QKX A;  1IXD A;  2AHJ B;  3OYD A;  4Z89 A;  2VXE A;  4Z8A A;  3MP6 A;  3VS1 A;  2D8H A;  4OVA A;  2DFU A;  3QYG B;  4RTU A;  2DD5 A;  4XTU A;  2BUD A;  4HT8 A;  1WIE A;  1FWZ A;  3EGD B;  2DER A;  3AHU A;  2CYZ B;  5GAN 8;  2X4X A;  4FT4 A;  4XQ3 A;  5GAO p;  1AWW A;  1LJO A;  4XTZ A;  3PVL A;  3CCS T;  3X20 B;  4WCI A;  1YIJ Q;  1XTD A;  1BKB A;  3MEV A;  2RQW A;  3M53 A;  2FHD A;  1OV3 A;  1H3Z A;  5CQY A;  2ZPB B;  1GCQ C;  3I56 A;  2P0Q A;  1S72 T;  2MIO A;  3CCQ Q;  3CCE Q;  3A5Z B;  2W0Z A;  4YTL A;  4ELZ C;  4PK4 A;  2C0I A;  5AYF A;  1IHV A;  1M2V A;  1E7O A;  1G3T A;  1TWB A;  4M77 B;  3E2U A;  4IUP A;  2RQR A;  2QQS A;  4EMH A;  1VYT A;  2B86 A;  1VQO T;  4UC4 A;  1VQL T;  1BI2 A;  2CUB A;  1UDL A;  2DIL A;  4QW2 A;  1IO6 A;  2E4H A;  1A0N B;  2RHU A;  4IIM A;  2ROT A;  1MMG A;  4F7U E;  4HXJ A;  4ZNX A;  4E7H A;  1VQO Q;  2A37 A;  2V1Q A;  2L3R A;  2VC8 A;  3R6O A;  2KT8 A;  2M02 A;  4XAX B;  1PSE A;  1KHC A;  2R5M A;  2LQN A;  3CCM A;  4BI8 B;  4MDX A;  1SRM A;  2FEI A;  4ZGE B;  5IHK A;  2KY9 A;  3CC2 A;  4NL2 A;  1KD1 C;  4RCB A;  3A8H B;  4M78 F;  5LJ3 h;  3QDR B;  3TQ7 P;  2PU9 B;  3OSS C;  4OF1 A;  4OML A;  4QT7 A;  3S3N A;  3VV0 A;  3NPF A;  4Y28 E;  5D6Y A;  3CC7 T;  4C92 C;  1OEB A;  1U06 A;  3TEE A;  3MPU B;  2DK3 A;  3ZFJ A;  1V1C A;  2VVK A;  2DA9 A;  1EZZ B;  4M7A D;  4IUV A;  2X4W A;  2E70 A;  4LDW A;  3WVD B;  1S1N A;  1TUG B;  3CCJ A;  1GBR A;  4LUD A;  2EKH A;  3NHN A;  4K11 A;  5DLO A;  2COZ A;  2C0T A;  1HJD A;  2A3L A;  2QDL A;  5HK0 A;  1I07 A;  4HVV A;  4PFZ A;  4C8Q D;  3ER0 A;  3OYF A;  4HCZ A;  4ME7 A;  2BTT A;  4JDS A;  1TXQ A;  2DL3 A;  2YUQ A;  2R5A A;  3M0U A;  1H64 1;  2R57 A;  5GAN d;  2JOY A;  1KIK A;  2D0N A;  3EFO A;  2RJE A;  3VUB A;  2HKN A;  1JO8 A;  2RJF A;  2XG8 D;  1LCK A;  5KE2 A;  3G71 Q;  4PJL A;  3I56 Q;  4KBM B;  1LVK A;  4C8Q F;  3CCQ A;  1UUE A;  4IIO A;  2K3Y A;  4GLK A;  3EFO B;  3MCA B;  4N4I A;  3G6E Q;  3LH0 A;  1NE8 A;  1SHF A;  1E6H A;  3H9N A;  1WYX A;  4R0K A;  1SG5 A;  3CPF A;  2V8K A;  2LX9 A;  3A1P A;  1X43 A;  1TS9 A;  3OBY A;  4RTW A;  2KYM A;  2NWM A;  4AFS C;  1M1G A;  3E9F A;  1NYG A;  2D8J A;  1PWT A;  2DIG A;  4AFZ C;  3SDZ A;  3HKS A;  3PGG A;  4J9C A;  1WHK A;  3JCM V;  2RHZ A;  4N4H A;  4HVU A;  3HHT B;  1K1Z A;  1OZ2 A;  2F1L A;  1NJI R;  2D1X A;  3TSZ A;  1KQS S;  2DBK A;  1M1F A;  2CT3 A;  4C8Q G;  3JB9 H;  3J80 E;  1K73 U;  1SKU B;  2OAU A;  4RTZ A;  1Q81 U;  1X6G A;  1OQK A;  2FPE A;  5LJ5 j;  1MNE A;  2X3W D;  4RTX A;  2SRC A;  3Q1J A;  4ZTF A;  1QLY A;  2KYB A;  2CH4 W;  2FRW A;  2QA4 Q;  3EHQ A;  3KFV A;  3CCR Q;  4XTX A;  3G4S T;  3CCJ Q;  5IH2 A;  3CEY A;  1AZE A;  1U1S A;  3OYK A;  3OW2 S;  2RM4 A;  1G3Y A;  3OB9 A;  3PVQ A;  4LUE A;  4M78 E;  3CPW S;  1YIT Q;  1VQ8 T;  4JJD A;  3RES A;  2L5Q A;  2FPD A;  1MHN A;  2KNB B;  4LD6 A;  3EH1 A;  1ZQ1 A;  1YHQ Q;  3H0H A;  1ZUK A;  3NTH A;  3JCM X;  1I8F A;  4JRI A;  3M0Q A;  1YI2 Q;  4PFP A;  2E64 A;  3TCJ A;  5GAM f;  1AWO A;  4E7I A;  2E65 A;  3JRZ A;  2X4Y A;  2RHI A;  3JB9 I;  2RHX A;  2EQK A;  4M77 C;  4RTV A;  4JPB W;  3CCL A;  3JCM b;  4M75 C;  3JCM J;  2YT6 A;  1BCM A;  3CMA Q;  3RKX A;  3OYL A;  3M0R A;  4QQD A;  2CKK A;  2ECZ A;  5GAO q;  3G6E A;  4J9E A;  2HSE B;  4HA8 A;  1VQ4 T;  1TSF A;  2K9G A;  3NTI A;  2C06 A;  5EG2 A;  1ZX6 A;  4F17 A;  2P0K A;  3EHR A;  4M7A G;  1UGR B;  3QUI A;  3G71 T;  2ED0 A;  2WSF E;  3JB9 F;  1PRM C;  2PNI A;  1Y7X A;  2KRN A;  3PIP A;  1W6X A;  4C0F A;  1N8R C;  1UGV A;  2DZ9 A;  1PD0 A;  2MK5 A;  1FMV A;  2VUB A;  3PTA A;  5I11 A;  1YNZ A;  2COY A;  1N5Z A;  1K9A A;  1UE9 A;  1VQP Q;  1JBM A;  1T0H A;  5CQX A;  4FCY A;  4AT1 B;  4C8Q B;  5L8R E;  3FRN A;  5GJV B;  1UGP B;  4PJN A;  1M30 A;  3BW1 A;  1VQ9 A;  4FL6 A;  4J7F A;  1M3C A;  4LDX A;  2B8A A;  4JZ3 A;  1D1A A;  1M27 C;  2WSC E;  5LJ3 e;  2P84 A;  2HSP A;  4MMK A;  3CPW A;  2LCS A;  5LJ3 j;  3JB9 J;  3JCM c;  4B6M A;  1IZ6 A;  2BZX A;  3FIF A;  3CC4 Q;  1ZA1 B;  2MCN A;  1UHC A;  1S72 A;  4BE2 A;  2X9H A;  1RL2 A;  2JS0 A;  4PLI A;  3KBG A;  4M4Z A;  2KK4 A;  3CCV T;  3FJP A;  2LRQ A;  4FSS A;  2XDD A;  2VXF A;  3H6Z A;  2KVQ G;  3V7R A;  1VQ5 T;  1M1K C;  2CSQ A;  1ZSZ C;  4J6X A;  5GAN 5;  3OA6 A;  1ZSZ B;  3HFO A;  2EPD A;  5CAI A;  4QVD A;  1RLP C;  4KH1 B;  1Z9Q A;  2GNC A;  4JRQ A;  1Q82 U;  2O9V A;  2QEX Q;  2OTJ Q;  3FB9 A;  4M7D G;  2MAM A;  1G3S A;  4JS4 A;  1SF9 A;  1BIB A;  2J7I A;  1V76 A;  1VA7 A;  2DTI A;  3MP8 A;  1BI1 A;  4PJO G;  1PSF A;  3MEA A;  4E6R A;  5HKC A;  3AT1 B;  3FC3 A;  1M1K R;  4C8Q A;  2DLP A;  4DOW A;  4KH0 B;  3I55 Q;  1R0B G;  1ZHI A;  2M0O A;  3H0I A;  4D8K A;  2C0O A;  2AKL A;  1B07 A;  1V29 B;  5LJ3 f;  5FU7 B;  1QP3 A;  3JCM d;  4XU3 A;  4JJB A;  2GF7 A;  1M1K U;  4KRT A;  1H3H A;  1W1F A;  5J26 A;  1PKT A;  1B34 A;  1MMD A;  5CKE A;  3E9G A;  4C92 E;  5LL6 S;  4A4E A;  4M78 B;  1BK2 A;  4M7A C;  3SB2 A;  2J05 A;  4RTY A;  3RMQ A;  3CME T;  5CKF A;  3CCS Q;  1X2K A;  5GAN h;  3CMA T;  3A8L B;  2MWO A;  1I81 A;  1OX9 A;  1M3A A;  1SEM A;  4ANJ A;  1TUC A;  1XNI A;  4D6W A;  1NLO C;  1WGS A;  2F5K A;  1BU1 A;  1EX4 A;  4A4F A;  5C6S A;  4JZ4 A;  4J5Y A;  4DBQ A;  5DM7 R;  4FW1 A;  5GAO n;  3BDU A;  1QWE A;  3JCM P;  1QWF A;  1HXD A;  4N0A C;  4DBR A;  4PJO C;  2DJQ A;  4J9B A;  1VQM Q;  3M4G A;  2DD4 A;  3QWY A;  5I21 A;  2ZPF B;  3RBB B;  2DEU A;  3CCE T;  2A36 A;  2CP0 A;  1QCO A;  3CD6 A;  1S72 Q;  5GAN 4;  5IAY A;  3DKM A;  4J8O A;  2JVV A;  4GLM A;  4D8D A;  4PKC C;  3L2Z A;  3HPW A;  3QJ6 A;  2JNG A;  3NGP A;  3CCR T;  3J7A F;  4B9X A;  2XIC A;  5AT1 B;  3CBP A;  3CCV A;  2ZPI B;  3HP9 A;  5LJ3 g;  3L2Q A;  2QAS A;  5D7U A;  2KR3 A;  4E7Z A;  4PLL A;  3LWI A;  1VQK A;  2IPO B;  4N4G A;  5GAM h;  5FWC A;  5I2M A;  4M78 G;  1TUD A;  2QEX A;  2JS2 A;  3ME9 A;  1JXO A;  4RKU E;  3HTR A;  3OMG A;  4R55 A;  2LT4 A;  1HSQ A;  2HD0 A;  4Y91 A;  5LJ5 e;  3CMA A;  1AT1 B;  2D0Q B;  2HBW A;  5HK3 A;  2ZPH B;  1WX6 A;  2KDS A;  4II1 A;  1Q95 G;  1O75 A;  3V7C A;  1FYN A;  2QTX A;  2OTL T;  2PTK A;  1Q86 U;  5GAN 2;  4R56 A;  4LXC A;  4JLG A;  1PD1 A;  1PCX A;  2LJ3 A;  3V7S A;  5FLX E;  4AFU C;  4E7J A;  1GFC A;  1OUL A;  2G3R A;  4OMF B;  2KT1 A;  3QKJ A;  1VQL Q;  4EMK C;  4PJO A;  2XDB A;  4HCC A;  3M55 A;  4FU6 A;  5GMK j;  1KQS P;  2CRE A;  2J6K A;  3CCS A;  2QXF A;  1CSK A;  9ATC B;  4OMO A;  4DQ2 A;  2NLU A;  1PHT A;  4C0G A;  4J6Y A;  3QJY A;  2V8I A;  4BB7 A;  2GQV A;  4FIB A;  2ESW A;  3VKI A;  2MF2 A;  5GAM j;  1PM3 A;  2DYB A;  2VWF A;  4M7D A;  4OGE A;  3URG A;  2MOX A;  4M78 C;  1EIF A;  2RK1 A;  4J9D A;  3LX7 A;  4OB1 B;  3HRS A;  3M59 A;  1VQ7 T;  3M58 A;  3KUF A;  2L3S A;  3CME Q;  3MET A;  4C5E A;  1NYF A;  2MI6 A;  2MWP A;  3A8O B;  2QDY B;  1Q81 R;  3GIB A;  3WVE B;  4J6W A;  2DEQ A;  2LT1 A;  1RAC B;  1IB8 A;  2BKD N;  1MMA A;  3GF5 A;  1WHL A;  2FG0 A;  1WLP B;  1HK9 A;  4M75 D;  2JMC A;  2LJ1 A;  3O8V A;  1YIT A;  2JM9 A;  1M8V A;  1C1A A;  2JZ2 A;  4OMM A;  3C0C A;  2XI9 A;  5CCA A;  1YJN Q;  4QQ6 A;  1VQ4 Q;  1VIE A;  1VQP T;  4J83 A;  4RTT A;  3DB3 A;  1YI2 A;  1F1B B;  2DE0 X;  1WJR A;  2GGR A;  2KE9 A;  2RNA A;  2R58 A;  3X26 B;  1VQK Q;  3HRT A;  2RF0 A;  4BAC A;  5GMK l;  2VB6 A;  2FZG B;  2HL5 C;  3THK A;  4XTV A;  1RAI B;  2LTO A;  2BE9 B;  3TU4 K;  1YCS B;  4M7D C;  2DL8 A;  3A98 A;  3MEW A;  4O5V A;  3CCU A;  2KAF A;  2VV5 A;  4IUR A;  5KYY B;  1I4K 1;  2J06 A;  3ZBD A;  2P0P A;  2QYZ A;  4M77 D;  2E6N A;  2GQI A;  1KG1 A;  4LN2 A;  2CZ0 B;  1W2B A;  1I5O B;  3UF4 A;  3VJP A;  1NBE B;  2K7A A;  1W2B P;  1KK7 A;  3OBW A;  2E3H A;  2NYS A;  3X28 B;  3KXT A;  1UFF A;  2QQB A;  2DL7 A;  1QKW A;  4HCK A;  3OYH A;  1YIJ T;  3RNJ A;  3V8L A;  2LP5 A;  3JCM W;  1WHH A;  5GAO r;  1AWJ A;  2ZAE A;  2RJD A;  4ZTJ A;  2M16 A;  1IHW A;  2FO0 A;  1YHQ T;  1K76 A;  1IRX A;  2CDT A;  5CR2 A;  3UPU A;  1M4Z A;  1T3S A;  3PMT A;  4PJM A;  2QGG A;  2CP7 A;  2DXC A;  4M7A A;  3M0P A;  2HDA A;  1RAA B;  2CZ1 B;  2OI3 A;  2EYY A;  2PVD B;  2LVM A;  3NFC A;  3PE0 A;  3PFS A;  2X35 A;  1AHJ B;  1MUZ A;  1UGQ B;  2QG9 B;  1K8A C;  2EVR A;  3MKD A;  2DRK A;  1JXM A;  3A8M B;  4MZM A;  3OQ5 A;  5I2S A;  1M5Q 1;  4M75 A;  1MGQ A;  3LH5 A;  3CD6 Q;  1XQH A;  4MZP A;  4CRI A;  1WXT A;  3LLR A;  3EFS A;  2CSI A;  2RJC A;  3OS0 A;  1VQ6 A;  2YLC A;  3FLG A;  3BFM A;  3RMS A;  1VQ7 Q;  4M7A E;  3I5S A;  2K6D A;  4PNO A;  1YI2 T;  3NMZ C;  1VQN A;  2V26 A;  3QZ9 B;  4HVW A;  3LGL A;  1YIJ A;  1LOJ A;  3MP1 A;  1QVG S;  2YUN A;  3M0T A;  4M7D B;  3I35 A;  1IRE B;  3I55 T;  1RAE B;  3UWN A;  4BD3 A;  2OTJ A;  2CH4 A;  3CBO A;  1NG2 A;  4GBQ A;  2DYI A;  3RDV A;  3UA6 A;  1X27 A;  1X6O A;  4F14 A;  2HL3 A;  1U8R A;  2EYX A;  2KSS A;  3MJX A;  2GTJ A;  2DTH A;  2ED1 A;  2QEX T;  3I55 A;  5GAM e;  1BB9 A;  1K0X A;  3T9N A;  2O88 A;  4OB0 B;  1FMK A;  2RI2 A;  3L2W A;  1WXB A;  1NEG A;  4JJC A;  5KYU A;  5D6W A;  4M77 F;  2PUK B;  5IHI A;  3X24 B;  2RH2 A;  1RAG B;  1HYO A;  1PG5 B;  4A63 B;  4A53 A;  3SWN B;  3JV3 A;  2EAY A;  2RQT A;  3EG0 A;  5FU6 C;  1WPY A;  4L6V 5;  1M9S A;  2AZV A;  4C5I A;  1QVG A;  1RAB B;  3CC2 Q;  2K79 A;  1M3B A;  3QBY A;  3L2U A;  2P4R A;  5FRO A;  3ULR B;  5D6X A;  5KYY A;  1JEG A;  3VS2 A;  2KBT A;  2E6Z A;  3VS6 A;  5KYN A;  4M7D E;  4C0D C;  1WZO A;  2VGN A;  5FW9 A;  4LE9 A;  2E3I A;  3QG1 A;  1YWO A;  2BZ8 A;  2K4Y A;  4M75 G;  2EQI A;  2LMJ A;  5FWB A;  3QO3 A;  1FMW A;  3UA7 A;  2L89 A;  2JTF A;  3ZEH A;  4AMC A;  4O6J A;  3CBM A;  3E19 A;  4CC4 B;  1VQM T;  2RB6 A;  2X4J A;  1ZBJ A;  3VS0 A;  2DXT A;  2HMA A;  3OSV A;  1JRI A;  2DO3 A;  2QA4 T;  1OPK A;  3VUZ A;  4KT0 E;  2DVE A;  2SEM A;  1WQW A;  3E1S A;  2GFA A;  5FRN A;  2ZGW A;  4OB3 B;  2QAZ A;  3RIR A;  1Y71 A;  2VKN A;  1VQN Q;  3OYE A;  2EYZ A;  2AK5 A;  4ATO A;  1YCY A;  3VRZ A;  3GPL A;  1KSW A;  1JB0 E;  4L59 A;  4F7U F;  2O31 A;  2YRC A;  4A4G A;  3EH2 A;  3J81 E;  1JJ2 P;  3G71 A;  2WSE E;  4M75 B;  4RUG A;  4NOY A;  5LJ5 h;  1BYM A;  3OYI A;  3V8K A;  2RI3 A;  1ABQ A;  3UDC A;  2PUO B;  4M75 F;  5GJW B;  3VYG A;  2FB7 A;  5KYW A;  3OYY A;  2X3X D;  4MZT A;  3L2R A;  2FRY A;  3HRU A;  1WQ7 A;  1TOV A;  4KUI A;  1SHG A;  4BI4 A;  2DF6 A;  3S3M A;  2A0F B;  2QGF B;  1G83 A;  2X51 A;  5CVI A;  3EGD A;  1D09 B;  2EW3 A;  4QVC A;  4JS5 A;  1VQL A;  2YDL A;  2KMT A;  2DNU A;  3VRY A;  5CK9 A;  2E10 A;  4PL6 A;  3JB9 D;  4DOV A;  4XTY A;  1M90 C;  1RAF B;  2EQM A;  4FYX B;  5HCK A;  5FU7 C;  3BDL A;  1T0J A;  3GLX A;  3TVT A;  1Q7Y R;  4HCB A;  4QVZ A;  2OTJ T;  2E1H A;  4KGZ B;  2KEA A;  4M7A F;  3X25 B;  5A2Q E;  3UT1 A;  2KRO A;  3GP8 A;  3CCL T;  1UHF A;  4JLI A;  2EJG A;  4M77 A;  3CCM Q;  4C92 G;  3PT9 A;  1YJ9 A;  3FJ5 A;  1G8X A;  2CZ6 B;  4C5H A;  5GAN 3;  3C12 A;  2XID A;  4M77 G;  3H0F A;  4JUV A;  1NLP C;  2RA2 A;  2E41 A;  2FZK B;  3CCM T;  5CIU A;  1YJ9 T;  4LDY A;  2AIR B;  4TVR A;  1WHG A;  3VS5 A;  1GBQ A;  1UEB A;  1VQ6 Q;  2LQ8 A;  3TSW A;  2CUD A;  1WDX A;  3F70 A;  4DEY A;  3LW5 E;  1K0S A;  1YJW Q;  1RUW A;  2NUT A;  3R6N A;  1W2B S;  1QP2 A;  1VIF A;  4ESR A;  3H41 A;  2YSQ A;  1Z9Z A;  3DLM A;  1EFN A;  2BIV A;  1H8K A;  1J3T A;  1XJW B;  1YJN A;  2OTL A;  2NUT B;  2DJZ A;  5EC7 A;  1VQ4 A;  2HQH A;  1Y57 A;  3JCM g;  3JCM Q;  2COW A;  2CS7 A;  3M56 A;  4KUD K;  4X9C A;  3G7Z A;  2LX7 A;  1ZSG A;  5GMK e;  4C8Q E;  8ATC B;  1OOT A;  2EGA A;  3QXE B;  2CP2 A;  1YBY A;  4F7U G;  2G6F X;  3HFN A;  4J7I A;  3I9Q A;  3RER A;  4DBH A;  4CC2 A;  5GAM g;  2ENM A;  1OI1 A;  1WFW A;  2YRD A;  1IGQ A;  2KGT A;  2ABL A;  1WJQ A;  2YWW A;  1ZA2 B;  4FM4 B;  5KYX B;  2MYS A;  1K9M C;  2KI7 A;  4WF2 A;  2O2O A;  2JTE A;  2I2L A;  1CKA A;  4FYV B;  2AKK A;  1M2O A;  2FYK A;  2EBP A;  1AEY A;  2DET A;  3JCM h;  4M78 A;  2V8J A;  1KQ2 A;  3C95 A;  2CP5 A;  3C4S A;  3CXC S;  1K4U S;  7AT1 B;  3CPW P;  1XOV A;  1Y96 B;  1PRL C;  3SD4 A;  1D0Y A;  2LCC A;  1VYU A;  2P4T A;  4PFO A;  5GAN 7;  3PMI A;  5GMK m;  3JB9 G;  4GY5 A;  1K9M R;  2EIF A;  1TG0 A;  1Q86 R;  3QDF A;  1G3W A;  4EPC A;  2JXB A;  5FU6 B;  1ZLM A;  3A8G B;  2LNV A;  5KYW B;  4A4K A;  4M78 D;  2YRV A;  4C8Q C;  3O5Z A;  1YIT T;  1VQ8 Q;  2VAS A;  3QPH A;  1UJY A;  1G2B A;  1NJI U;  2YUO A;  1ZSZ A;  2LZ6 B;  2ROL A;  1KD1 U;  2EJ9 A;  2HEQ A;  1GL5 A;  4DBF A;  5HY6 A;  2JJ9 A;  4KGV B;  4BI3 A;  4IKF A;  1WA7 A;  1Q86 C;  2EQJ A;  2CT4 A;  4LD9 K;  2QI2 A;  1QVF S;  2EJF A;  3DB4 A;  1N8R U;  5CKH A;  5KCH A;  2JT4 A;  3OYC A;  4OMN A;  1PC0 A;  3M54 A;  4CI0 C;  5KYX A;  2KXD A;  2NUP B;  5J3B A;  1QW1 A;  2LNH B;  4JRK A;  1U3O A;  1QQJ A;  2QA4 A;  3NTK A;  1W4S A;  2OTL Q;  2DIQ A;  2EQU A;  3HSB A;  2KQW A;  5CO7 A;  3GNG A;  2RD1 A;  1YJN T;  2NUP A;  2A7Y A;  2RQV A;  1KFZ A;  4BDY A;  4ZN3 A;  4MDW A;  4CC3 A;  4PJO E;  1CKB A;  2KRM A;  1ZBX A;  1UEC A;  4IUT A;  2DL5 A;  3UAT A;  2ZZD A;  3EG1 A;  3IQL A;  2FL7 A;  1Y07 A;  2GTO A;  2ZCF B;  3SFM A;  2V1R A;  3GOX A;  1Y0M A;  3M9Q A;  4OB2 B;  2F2W A;  4KUL A;  5GAN 6;  1Q82 R;  4X1V A;  4AG2 C;  4FT2 A;  1E6G A;  4A4H A;  4OMP A;  2YHT A;  3FDR A;  3RKY A;  2EYW A;  4M7A B;  2QQA A;  1VQ5 A;  4J9G A; 
#chains in the Genus database with same CATH homology
 2K2V A;  3CBO A;  2CGH A;  3EAE A;  4BY6 B;  2VYT A;  2EYQ A;  4BE2 A;  1S72 A;  4C0D B;  1VQP A;  1RL2 A;  4HT9 A;  2XK0 A;  4PLI A;  3KBG A;  3OYG A;  1X6O A;  2KK4 A;  4OGC A;  4EMG A;  3CCV T;  3FJP A;  4F7U A;  1U8R A;  2LRQ A;  4DA4 A;  1O9S A;  2KSS A;  4ZGJ B;  2XDD A;  2DTH A;  4FSX A;  2VXF A;  5IT9 E;  3PIO A;  3H6Z A;  2QEX T;  1Q82 C;  2KVQ G;  3V7R A;  3I55 A;  5GAM e;  1VQ5 T;  3OS1 A;  2GFU A;  1M1K C;  3JAM E;  2EWN A;  3T9N A;  4LDV A;  1OZ3 A;  5GAN 5;  4J6X A;  3OS2 A;  3OW2 A;  4OB0 B;  3OA6 A;  3DLL A;  3CC4 T;  1VQK T;  2RI2 A;  2XHC A;  1VQ6 T;  2JN0 A;  3HFO A;  3LYI A;  3L2W A;  4XU0 A;  2Y90 A;  5CAI A;  3CD6 T;  5D6W A;  4VUB A;  4E47 A;  4QVD A;  2HBP A;  4M77 F;  2PUK B;  3X24 B;  5KCO A;  2FVU A;  2RH2 A;  1K8A U;  2DTO A;  3OYB A;  1R8O B;  5GAM d;  2WAC A;  3ASK A;  4B9W A;  4JRQ A;  1Q82 U;  1VQ9 T;  1GXI E;  2XKO C;  4M75 E;  3FB9 A;  4M7D G;  2MAM A;  1G3S A;  4JS4 A;  4A53 A;  1VQ8 A;  1NPP A;  4OP0 A;  2M9U A;  3SWN B;  1BIB A;  2EAY A;  5FU6 C;  4L5G A;  1VQM A;  2DTI A;  4PJO G;  3MP8 A;  1BI1 A;  1WPY A;  2AHJ B;  2F69 A;  3OYD A;  1PSF A;  2VXE A;  3MEA A;  5KE3 A;  4EDU A;  3MP6 A;  5HKC A;  5A0D A;  4OVA A;  3FC3 A;  4L6V 5;  1M9S A;  3PNW C;  4C8Q A;  4C5I A;  3QYG B;  1QVG A;  2DD5 A;  4DOW A;  3OYJ A;  4XTU A;  2BUD A;  4HT8 A;  3QBY A;  3AHU A;  1FWZ A;  1WJS A;  2CYZ B;  1ZHI A;  2M0O A;  5GAN 8;  3L2U A;  1Y96 A;  2X4X A;  4FT4 A;  4XQ3 A;  5GAO p;  2LC4 A;  1V29 B;  5LJ3 f;  5FRO A;  1LJO A;  4XTZ A;  5D6X A;  5FU7 B;  1QP3 A;  3RUX A;  3JCM d;  4XU3 A;  3CCS T;  2GF7 A;  1UB4 A;  3X20 B;  5GAN e;  5LJ3 d;  2E6Z A;  3L2V A;  1M1K U;  1OYX A;  4HKE A;  1XTD A;  1BKB A;  3MEV A;  4M77 E;  4M7D E;  3M53 A;  5J26 A;  2FHD A;  1H3Z A;  4C0D C;  2VGN A;  5DLQ E;  1SSF A;  5CQY A;  2ZPB B;  1B34 A;  5CKE A;  3I56 A;  4BE0 A;  2LCL A;  3E9G A;  2P0Q A;  1S72 T;  2ZPE B;  3CC4 A;  4C92 E;  4NS5 A;  1TH7 A;  5LL6 S;  3QG1 A;  2QQ9 A;  1U1T A;  3S3O A;  4A4E A;  3A5Z B;  3S6W A;  1X01 A;  4M78 B;  2K4Y A;  4M75 G;  4YTL A;  3SB2 A;  4ELZ C;  3JCM e;  4M7A C;  3WXM B;  5AYF A;  2O4X B;  3QO3 A;  1G3T A;  3RMQ A;  3L1A A;  3CME T;  5CKF A;  2K5F A;  4M77 B;  5GAN h;  4F7U B;  3CMA T;  2L89 A;  2JTF A;  3A8L B;  4IUP A;  2MWO A;  4BE1 A;  4X34 A;  3ZEH A;  1I81 A;  2QQS A;  4EMH A;  4O6J A;  3CBM A;  5GMK i;  1XNI A;  3E19 A;  4D6W A;  1VQO T;  4UC4 A;  1VQM T;  2RB6 A;  1VQL T;  2X4J A;  1BI2 A;  1WGS A;  2F5K A;  2DXT A;  3OSV A;  1JRI A;  2JUF A;  2DO3 A;  4QW2 A;  2RHU A;  2K5L A;  2O4X A;  4A4F A;  2QA4 T;  5C6S A;  4RG2 A;  3VUZ A;  4KT0 E;  4F7U E;  4NL3 A;  3OYM A;  4J5Y A;  2DVE A;  1WQW A;  3E1S A;  2GFA A;  5GMK h;  5DM7 R;  5FRN A;  2ZGW A;  4OB3 B;  3RIR A;  4C0Z A;  5GAO n;  1Y71 A;  3BDU A;  4E7H A;  1WNL A;  3OYE A;  4ELY C;  2L3R A;  2LDM A;  2VC8 A;  3P8B B;  3R6O A;  4PJO F;  4BDZ A;  3JCM P;  4X9D A;  1HXD A;  1P92 A;  4N0A C;  4XAX B;  4ATO A;  4PJO C;  1YCY A;  3GPL A;  3CC7 A;  1PSE A;  1KHC A;  2R5M A;  3M4G A;  4RMO A;  2DD4 A;  1JB0 E;  4BI8 B;  3G6E T;  3CCM A;  4L59 A;  3MO8 A;  4F7U F;  4MDX A;  3JCM f;  5I21 A;  4ZGE B;  4A4G A;  2KY9 A;  2ZPF B;  5GAO m;  3J81 E;  3CC2 A;  4NL2 A;  2PVO B;  4RCB A;  3G71 A;  1KD1 C;  3CCE T;  3A8H B;  2WSE E;  5A0G A;  4M78 F;  5LJ3 h;  3CD6 A;  4M75 B;  3QDR B;  4LDU A;  4NOY A;  3EFR A;  5LJ5 h;  5GAN 4;  2ZPG B;  1JJ2 A;  2PU9 B;  1BYM A;  5IAY A;  3V8K A;  2DXB A;  3OSS C;  3DKM A;  4OF1 A;  3OYI A;  2OTJ A;  4J8O A;  2JVV A;  2RI3 A;  4PKC C;  3L2Z A;  3S3N A;  3UDC A;  2PUO B;  1VUB A;  4M75 F;  3HPW A;  3VV0 A;  3QJ6 A;  2JNG A;  2FB7 A;  3VYG A;  4Y28 E;  3CCR T;  5D6Y A;  4N0A A;  2EFI A;  3CC7 T;  3J7A F;  4C92 C;  4B9X A;  2PQW A;  2XD0 A;  1BI0 A;  3OYY A;  2XIC A;  3TEE A;  1VQO A;  4MZT A;  3L2R A;  3HRU A;  4XU2 A;  2DK3 A;  1WQ7 A;  3ZFJ A;  4KUI A;  5IN1 A;  3CBP A;  2IVW A;  4QQG A;  2ZPI B;  4BI4 A;  3HP9 A;  3CCV A;  5LJ3 g;  3L2Q A;  4IUV A;  4M7A D;  3S3M A;  2X4W A;  3LWI A;  2E70 A;  4PLL A;  4LDW A;  1VQK A;  3QHS A;  3WVD B;  3OS5 A;  5J39 A;  1NZ9 A;  4N4G A;  4PJO B;  5GAM h;  5CVI A;  3CCJ A;  4JRP A;  1K73 C;  2MMP A;  4M78 G;  5I2M A;  4QVC A;  4BY6 C;  5DLO A;  4JS5 A;  2QEX A;  1VQL A;  2F5T X;  3ME9 A;  2KMT A;  3CCU T;  4RKU E;  3OMG A;  5CK9 A;  2A3L A;  2E10 A;  3C94 A;  3N5B B;  4PL6 A;  5HK0 A;  1N6A A;  4R55 A;  2LT4 A;  3JB9 D;  3FEO A;  2HD0 A;  4Y91 A;  4XTY A;  4DOV A;  5LJ5 e;  2D0Q B;  3CMA A;  1M90 C;  4C8Q D;  5HK3 A;  2ZPH B;  2EQM A;  3ER0 A;  4XU1 A;  2Y4X A;  2KDS A;  5FU7 C;  4II1 A;  3BDL A;  3OYF A;  3GLX A;  3VU3 C;  4HCB A;  1B34 B;  4HCZ A;  1O75 A;  4ME7 A;  4QVZ A;  2OTJ T;  4JDS A;  4MML A;  2R5A A;  2JTM A;  3V7C A;  2E1H A;  4RCC A;  1H64 1;  2QTX A;  1N9R A;  1YJW A;  2R57 A;  4M7D F;  4XK8 E;  2OTL T;  1Q86 U;  5GAN d;  4C92 B;  2JOY A;  5GAN 2;  4R56 A;  1FXX A;  4M7A F;  2GCX A;  3X25 B;  4JLG A;  3RKW A;  5A2Q E;  3UT1 A;  3CCL T;  3GP8 A;  5LJ5 d;  4XTW A;  3V7S A;  1DJ7 B;  3H8Z A;  2XDP A;  4JLI A;  5FLX E;  2EJG A;  2RJE A;  4M77 A;  4V2S A;  3VUB A;  2E12 A;  2XU8 A;  4IUQ A;  2RJF A;  4E7J A;  4C92 G;  3PT9 A;  1YJ9 A;  2G3R A;  3QYH B;  2XG8 D;  2CZ6 B;  4C5H A;  5GAN 3;  3C12 A;  4OMF B;  2XID A;  3QKJ A;  4M77 G;  4EMK C;  4JUV A;  5KE2 A;  2RA2 A;  2DZC A;  2E41 A;  4KBM B;  4C92 A;  3CCM T;  5CIU A;  1YJ9 T;  4LDY A;  1KQS A;  4PJO A;  4C8Q F;  3CCQ A;  2XDB A;  4HCC A;  1KQ1 A;  3M55 A;  4TVR A;  2K3Y A;  4FU6 A;  4GLK A;  5GMK j;  3M57 A;  1UEB A;  2O01 E;  2LQ8 A;  2HQE A;  5LJ5 g;  3MCA B;  2QXF A;  3CCS A;  4N4I A;  4DQ2 A;  3OMC A;  3F70 A;  3LH0 A;  3LW5 E;  1M90 U;  2NLU A;  1W2B S;  1K9M U;  1NE8 A;  1QP2 A;  1VIF A;  4C0G A;  2E5Q A;  4J6Y A;  3QJY A;  3CPF A;  2V8I A;  4BB7 A;  3DLM A;  1JJ2 S;  2GQV A;  2LX9 A;  2V8K A;  4FIB A;  3VKI A;  2MF2 A;  5GAM j;  3OBY A;  4M7D A;  2K3X A;  2RO0 A;  2BIV A;  1BI3 A;  4OGE A;  1M1G A;  3URG A;  3E9F A;  5GAN g;  4M78 C;  1EIF A;  2RK1 A;  1NPR A;  1YJN A;  2DKG A;  2DPP B;  3LX7 A;  4OB1 B;  2OTL A;  3HL8 A;  3HRS A;  1YJW T;  3M59 A;  4C92 F;  1VQ7 T;  2DIG A;  2DJZ A;  3M58 A;  3KUF A;  1VQ4 A;  4A54 A;  3MET A;  3JCM g;  4C5E A;  1QVF A;  3JCM Q;  3SDZ A;  3HKS A;  2MI6 A;  2CS7 A;  2MWP A;  3A8O B;  3M56 A;  3P8H A;  3JSC A;  3PGG A;  2VGM A;  1BIA A;  4KUD K;  2QDY B;  3G7Z A;  3M5A A;  4X9C A;  3JCM V;  3GIB A;  2RHZ A;  4N4H A;  5GMK e;  4C8Q E;  3WVE B;  4J6W A;  3HHT B;  2DEQ A;  2LT1 A;  3QXE B;  1OZ2 A;  1YBY A;  4F7U G;  2Y4Y A;  3QZ5 B;  3HFN A;  4J7I A;  3CCQ T;  2BKD N;  3MHX A;  3CCJ T;  3RER A;  2H3J A;  2YLB A;  5GAM g;  1KQS S;  3GF5 A;  5C0M A;  1OI1 A;  1HK9 A;  1N9S A;  1M1F A;  4C8Q G;  3O8V A;  4M75 D;  5KH6 A;  1YIT A;  1M8V A;  3JB9 H;  3J80 E;  1K73 U;  2D9T A;  2JZ2 A;  1WJQ A;  2OAU A;  2XI9 A;  5CCA A;  4FM4 B;  2IG0 A;  1Q81 U;  1K9M C;  4WF2 A;  2RI5 A;  4QQ6 A;  4Z02 A;  4ZN1 A;  3P8D A;  3OY9 A;  3CC2 T;  5FRM A;  2I2L A;  1VIE A;  5LJ5 j;  1VQP T;  3LWH A;  2FYK A;  4J83 A;  1N27 A;  3Q1J A;  4ZTF A;  3INZ A;  3DB3 A;  2HNI A;  1YI2 A;  4E7L A;  5GAN j;  1FX7 A;  1WJR A;  2R58 A;  3JCM h;  3X26 B;  4M78 A;  2LQK A;  3SWN C;  2HQX A;  3HRT A;  2V8J A;  4XTX A;  2M1H A;  3G4S T;  4BAC A;  5GMK l;  1KQ2 A;  3C95 A;  3C4S A;  5DY9 A;  4XTV A;  3CEY A;  4RG8 A;  3CXC S;  2LTO A;  1U1S A;  3OYK A;  3TU4 K;  1XOV A;  3QSU A;  1Y96 B;  3SD4 A;  4M7D C;  2LCC A;  3OW2 S;  2P4T A;  2RK2 A;  2RM4 A;  1G3Y A;  3MEW A;  3OB9 A;  3OYN A;  3M4Y A;  5GAN 7;  3PMI A;  4O5V A;  5GMK m;  2KAF A;  2VV5 A;  3CCU A;  3JB9 G;  4IUR A;  2QQR A;  4GY5 A;  4M78 E;  1D3B B;  1I4K 1;  3CPW S;  3ZBD A;  1VQ8 T;  2EIF A;  4EMK A;  1KC8 U;  2P0P A;  1G3W A;  4EPC A;  3RES A;  2L5Q A;  1VQ7 A;  1MHN A;  2K57 A;  5FU6 B;  4LD6 A;  4M77 D;  2E6N A;  1KG1 A;  2DAQ A;  1ZQ1 A;  3A8G B;  2LNV A;  2CZ0 B;  3JCM X;  3NTH A;  1W2B A;  4A4K A;  4M78 D;  1I8F A;  2D6F A;  4JRI A;  3CME A;  4ZGD B;  2YRV A;  4C8Q C;  3VJP A;  1YIT T;  2E64 A;  3TCJ A;  5GAM f;  3QPH A;  1D3B A;  4E7I A;  2E65 A;  1NJI U;  3OBW A;  3CCR A;  3JRZ A;  2X4Y A;  1KD1 U;  2EJ9 A;  2RHI A;  3X28 B;  3KXT A;  3BY7 A;  2QQB A;  3JB9 I;  1NJI C;  5HY6 A;  2RHX A;  3OYH A;  2CZ7 B;  1YIJ T;  2PVG B;  2EQK A;  4M77 C;  4BI3 A;  4IKF A;  3V8L A;  3JCM W;  3CCL A;  5GAO r;  1Q86 C;  1UGS B;  2EQJ A;  3JCM b;  2RJD A;  5CKD A;  4M75 C;  4ZTJ A;  2M16 A;  4LD9 K;  3JCM J;  2QI2 A;  1QVF S;  2EJF A;  3DB4 A;  1YHQ T;  3G4S A;  3RKX A;  1N8R U;  3GNF B;  3L42 A;  3OYL A;  1Q7Y U;  5CR2 A;  3UPU A;  1M4Z A;  2CKK A;  4QQD A;  5CKH A;  3PMT A;  5KCH A;  5GAO q;  3OYC A;  4HA8 A;  3G6E A;  1VQ4 T;  3I56 T;  3M54 A;  3CXC A;  1YHQ A;  2DXC A;  3MEU A;  4M7A A;  5GAN f;  5M9O A;  4Q5W A;  4CI0 C;  3NTI A;  2C06 A;  5EG2 A;  2CZ1 B;  2PVD B;  2LVM A;  3NFC A;  5J3B A;  4E7K A;  3PFS A;  1QW1 A;  2P0K A;  2X35 A;  1AHJ B;  3CCE A;  4M7A G;  1UGR B;  3QUI A;  3G71 T;  4JRK A;  1UGQ B;  2DXU A;  2WSF E;  3JB9 F;  1K8A C;  1Y7X A;  4JJN K;  3PIP A;  2QA4 A;  4C0F A;  3NTK A;  2EKO A;  1N8R C;  4IUU A;  1W4S A;  3A8M B;  2DZ9 A;  2L8D A;  4MZM A;  3OQ5 A;  5I2S A;  1M5Q 1;  4M75 A;  2DIQ A;  2EQU A;  3HSB A;  2KQW A;  4C92 D;  5LJ5 f;  5CO7 A;  1MGQ A;  3GNG A;  2RD1 A;  2VUB A;  3PTA A;  1YJN T;  1XQH A;  4MZP A;  5GAO l;  3VYH B;  2A7Y A;  4CRI A;  3LLR A;  1Q7Y C;  3EFS A;  1I5L A;  4BDY A;  1JBM A;  5CQX A;  2RHY A;  4ZN3 A;  2RJC A;  3OS0 A;  1VQ6 A;  2YLC A;  3FLG A;  4MDW A;  1QVP A;  4C8Q B;  5L8R E;  3FRN A;  4PJO E;  3BFM A;  3RMS A;  3V8J A;  1VQN T;  4EMK B;  2K5I A;  1ZBX A;  1UGP B;  4IUT A;  4BUG A;  5A0L A;  4M7A E;  2ZZD A;  4PNO A;  3BW1 A;  2FL7 A;  5CKB A;  1VQ9 A;  4FL6 A;  1Y07 A;  1X75 C;  4J7F A;  3TRE A;  1YI2 T;  2ZCF B;  3SFM A;  4LDX A;  1KHI A;  3GOX A;  2B8A A;  1VQN A;  3M9Q A;  4OB2 B;  4KUL A;  5GAN 6;  2WSC E;  4C5G A;  4P5N A;  5LJ3 e;  4FT2 A;  3QII A;  3OYA A;  4PJO D;  1RI0 A;  4A4H A;  3QZ9 B;  4MMK A;  2YHT A;  3FDR A;  3CPW A;  3LGF A;  3LGL A;  1YIJ A;  1LOJ A;  4M7A B;  3RKY A;  5LJ3 j;  3MP1 A;  3JB9 J;  1QVG S;  1KC8 C;  4M7D D;  1G5V A;  4M7D B;  2QQA A;  3SWN A;  2HAX A;  3JCM c;  1Q81 C;  1LNX A;  1IRE B;  1IZ6 A;  3I55 T;  1VQ5 A;  3FIF A;  3UWN A;  4BD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...