5GAOl

Head region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
118
structure length
91
Chain Sequence
b'MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPSDNIASLQYINIRGNTIRQIILPDSLNLDSLLVDQKQLNSLRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein-associated protein B
molecule tags Transcription
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
total genus 9
structure length 91
sequence length 118
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
l PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gaol00
2RA2A 5GAOq 1LNXA 4M77A 4N0AA 3EFSA 2YHTA 4NL2A 3SWNA 4Y91A 4M77G 3V8KA 5GANg 2E65A 4PJOC 4X9DA 1Y96A 2E10A 4RCBA 4PJOG 4M7AE 1WQWA 3JCMJ 5GANf 2DTHA 2VC8A 2VXEA 4M77E 4F7UB 3JB9J 1U1SA 4M78G 4M7DD 2I2LA 5LJ5f 4N0AC 3JCMV 2YLCA 5LJ3g 5LJ5g 2EJGA 2FB7A 2DKGA 3HSBA 4F7UF 2HNIA 5LJ5d 4M78B 4XQ3A 5GANj 2JN0A 3QHSA 4M78E 5GAOr 1JRIA 4A53A 5LJ3d 5GMKi 2FYKA 4C8QE 4M77C 2EAYA 1I8FA 3HFOA 3BDUA 5GAN2 3JCMQ 3EFRA 4OP0A 3JB9H 2EJFA 3SWNB 4M7DA 3BY7A 4C8QG 2ZGWA 4C8QA 5GMKe 4HT8A 4M75E 5GAOp 1I81A 3BFMA 4X9CA 3V8LA 4C92D 1M8VA 1I5LA 3AHUA 4XTUA 4HA8A 5LJ5h 4M7AF 1HK9A 3RIRA 1LOJA 1WPYA 5I21A 2DTOA 3RKYA 1M5Q1 4RCCA 2RM4A 1H641 4JRKA 5DY9A 3FB9A 1YCYA 3JCMP 3RKXA 1KQ1A 1U1TA 4F7UE 4M7AG 4PJOE 1LJOA 2CGHA 2DTIA 4EMHA 4QVDA 3V8JA 5GAOn 4EMKC 4JRIA 4M77D 2RB6A 4M75D 4NOYA 3QO3A 2E1HA 4XU0A 1N9SA 4XTVA 4C8QF 1WQ7A 2EJ9A 1HXDA 4DQ2A 3GIBA 5GAMe 5GAOl 2VXFA 2DZCA 4PJOA 4M75G 3INZA 4M7DB 4XTWA 4HT9A 4M7AC 4M7DE 4C92F 1D3BA 3SB2A 4EMGA 2DXUA 4QVCA 1B34A 3FIFA 2K57A 3BW1A 3L1AA 4C8QB 1N9RA 2DJZA 4C92C 5GAMd 2YLBA 3HFNA 3JB9F 2QTXA 4M7AD 4JLIA 5LJ5j 2DVEA 5GAN8 4JUVA 4J5YA 4XTYA 5GAMf 4M75A 4M78C 3JCMf 4V2SA 4EMKB 4PNOA 5CAIA 3JCMb 4M78F 4C92G 4M77F 4J6XA 4M75F 1WNLA 2DZ9A 4PJOF 4A54A 4C8QD 5LJ3e 3JCMe 1KQ2A 3FJPA 4M75C 4M7AA 5GAN3 3RERA 5GAMg 1X01A 1BIAA 3RKWA 5LJ3h 3JCMd 2DXTA 5GMKl 4PJOB 2E64A 4C92A 5GMKm 4XTXA 3JB9D 5LJ5e 4MMLA 3JB9I 1D3BB 1B34B 5GAMj 3JB9G 1BIBA 3QUIA 3VU3C 3JCMg 3L2ZA 5GAN4 1JBMA 5GAMh 3V7SA 4XU3A 1MGQA 2DEQA 3JCMh 4M77B 4M75B 4M78D 4M7DG 3M4GA 4EMKA 5LJ3j 3RESA 3SWNC 4PJOD 1Y96B 4MMKA 3QSUA 3PGGA 3RUXA 2RD1A 4C8QC 4F7UA 2EWNA 3V7RA 4XU1A 5GMKj 4M7AB 4J6YA 5GANh 5LJ3f 3JCMX 4M7DC 5GAN7 3JCMW 4M7DF 2E41A 3JCMc 4C92E 4J6WA 4M78A 4C92B 5GAN5 4NL3A 5GANe 5GAOm 4WF2A 5GAN6 4F7UG 2Y90A 1TH7A 3V7CA 5GMKh 4XTZA 4XU2A 5GANd 1I4K1
chains in the Genus database with same CATH superfamily
2KXCA 4ATOA 1K1ZA 2KSSA 4LDWA 2DERA 2ZPEB 1QVGS 5KE2A 2DBKA 3M59A 4N0AC 1BYMA 2DL8A 2LRQA 3SDZA 1VQ5T 3CCSA 5I2SA 5A2QE 4BDZA 1M2VB 3M58A 1X6GA 4OP0A 1KK7A 4BY6C 5GMKe 1SHGA 1M8VA 4JJCA 1WHHA 4E7IA 5I21A 1K0XA 2CT3A 4JRPA 1W70A 2ROLA 2KGTA 3QWYA 2F5TX 2CGHA 2X4JA 1JJ2S 2L5QA 2E6ZA 5IHNA 3OQ5A 1KSWA 4XTWA 4C92F 3CPFA 1FMVA 3CCQA 3CCJQ 1NYFA 1KC8R 4M7AD 2YWWA 2HQXA 3EGXA 2O9VA 2X4YA 3OYKA 4XTYA 2VKNA 3THKA 2NUPB 4V2SA 2AT1B 3EG0A 3M9QA 5HY6A 4M77F 3LX7A 2KBTA 1KQ2A 2RI5A 1AWJA 2CP0A 1X27A 4LXCA 5L23A 4OMNA 5HK0A 4C0DC 4C92A 1B34B 2X51A 3VU3C 2XD0A 2EGAA 4Z02A 1VYTA 1VQPQ 4KH0B 3M4GA 1NJIC 2HEQA 4L59A 2DD5A 4OB1B 1M1KR 4M7AB 1G3YA 4LUDA 1M2OA 1M1KC 1MV0B 4BI8B 2LTOA 4F17A 3QDFA 1S72T 3EG9B 4NL3A 4D8DA 5GANe 3OYYA 4RKUE 2M02A 3PMIA 5KYXB 5GMKh 4LDUA 1VQOQ 3OYDA 4RTVA 3EG3A 1VQLA 1AT1B 1XOVA 2KYMA 2QQAA 4M77E 6AT1B 4HXJA 1NZ9A 1U1SA 4B9XA 2JNGA 2FPFA 2MCNA 4M78B 3VUZA 4RTZA 2FYKA 4C8QE 4A4KA 1VQ6T 1SF9A 3RMSA 1RL2A 2DFUA 1IRXA 2RJEA 1KD1U 3FDRA 3V8LA 4GLKA 4J83A 2K3XA 3QWXX 3VKIA 2IVWA 2J05A 5KYNA 4J9FA 3G4ST 3FB9A 3G71Q 2AIRB 4M4ZA 2XIDA 1IO6A 1KQSA 4XTVA 4A4GA 4OF1A 2KNBB 2QYZA 1BBZA 2MF2A 2NUTA 2DIQA 3NFCA 4BE1A 5GAMf 1WXTA 1RI0A 3CMET 3QYHB 4JJBA 1WNLA 4A54A 3JCMe 2ED1A 1YIJQ 3OS1A 2CZ7B 4ZGDB 1FYNA 3TSWA 1YI2A 3OA6A 1X69A 4QQGA 3H6ZA 3CC7T 4KGXB 3R6NA 2LNHB 3P8DA 2RQVA 2QDYB 1VQKA 3SFMA 3J81E 2AZSA 2DBMA 3QDRB 2QEXT 4ANJA 3VS1A 2VV5A 4PFPA 3ZFJA 2O88A 1ZA1B 4P5NA 5GAOm 1Q86U 4WF2A 3CD6T 3QBYA 1HYOA 2RA2A 3OYMA 1M90U 2D9TA 3EFSA 3SWNA 4FU6A 4X9DA 3LWHA 4PJOG 8AT1B 3Q1JA 2DKGA 1PRLC 1W2BP 5LJ5d 3I9QA 4PJMA 2JM8A 4M78E 2DRMA 1QP3A 3QXEB 3TSZA 4AFZC 1I8FA 3PE0A 3CBMA 2EJFA 1I5LA 1O75A 3AHUA 4FIBA 3LGFA 3KBGA 4JRQA 3LGLA 1M5Q1 3JCMP 1ZX6A 4PJOE 2DLPA 1BCOA 2DTIA 1VQMT 4AG1C 1K9AA 3HPWA 3MCAB 4C8QF 1QVFP 1WLPB 4M7DB 3INZA 2D8HA 5HKCA 2EQMA 3NTKA 2E6NA 4J9IA 4MZTA 3GP8A 4FT4A 2KXDA 1OULA 4RUGA 2EYZA 3QZ9B 2O4XB 1K73U 1OX8A 2P0QA 1KG1A 2CUDA 2PVDB 2VB6A 3JCMd 3GPLA 2ESWA 2CH4W 5ECAA 3OYCA 5IT9E 5AYFA 1D1BA 5GAMh 1YWPA 3REAB 1XJWB 2LCSA 2MK5A 4UC4A 1YITQ 2OX7A 3CCUA 4Y28E 1FMKA 5D7UA 2EWNA 4J9CA 3SHWA 4OGEA 4Q5WA 3MEUA 5KCHA 3X20B 5LL6S 3DLMA 4HVUA 3UA6A 1ZUYA 2PNIA 3M5AA 4GBQA 1NLOC 2X4XA 3CCJA 3CCQQ 1GCPA 1JB0E 2G3RA 4NL2A 3L2QA 4FL6A 5FU7B 3OS5A 5CKBA 2JJ9A 2HDAA 4OVAA 1KQSP 1N6AA 3FRNA 2CS7A 2W10A 2A36A 4X34A 3CC4Q 1NM7A 2JN0A 1UTIA 2LQNA 5D6YA 2LQKA 1HSQA 3CBPA 4AFUC 1PSEA 4FM4B 5A0DA 2ZGWA 1VQ7Q 3X26B 4RG2A 4A4FA 4EDUA 3OS0A 1UGQB 4ZGJB 2IPOB 4TVRA 2XG8D 5AT1B 3CC4A 1WJQA 4IUPA 3T9NA 1YN8A 2VUBA 1IZ6A 3PVLA 4F16A 3OSVA 2XKOC 2K3YA 2K2MA 2P0KA 1D0ZA 3EGDA 1YJWQ 5GAMe 3KXTA 4A63B 3PVQA 3CXCA 3JB9J 1U8RA 3CCEQ 1PG5B 5GAN8 1WDXA 3CEYA 2VYTA 4CC2A 8ATCB 2O2OA 2ED0A 2WSCE 3JCMb 1YJNT 2EFIA 2EYXA 4OB3B 3E9FA 2L8DA 2KRNA 3RMQA 4L6V5 3RKWA 2HSPA 2V1QA 1VQ5A 2L0AA 3JB9I 2Y4XA 2KVQG 4IUQA 5GAMj 4HCBA 1X6OA 1KJWA 4D6WA 2D1XA 2P84A 4M75B 1NEGA 2QAZA 2LMJA 1AZEA 2VASA 1XTDA 3CCRT 2KMTA 3A8MB 4F7UA 4RTXA 2XDDA 3RBBB 1U06A 3JCMX 1NG2A 1OYXA 3S3MA 4GY5A 1C6VX 1UECA 3JCMW 1D1AA 1JO8A 2DM1A 1D0XA 4F7UG 2V1RA 4PFOA 1I4K1 3G4SA 1NE8A 2XK0A 2HAXA 5M9OA 1VQ4Q 1Y07A 3OYHA 2DL4A 4M7AE 1WQWA 2OI3A 3URGA 2WSFE 1YJWT 1E6HA 1SSFA 1VQKT 3JCMV 5LJ5g 1D0YA 2GTJA 1HJDA 1KC8U 3CCET 4JLGA 5LJ3d 2EVRA 3JAME 2PUKB 1AD5A 3BY7A 3H41A 2RI2A 2GF7A 5GAOp 4BUGA 4BI3A 1LOJA 2VGMA 5C6SA 2LX9A 3RKXA 4M7AG 5EC7A 2XDBA 3V8JA 1VQNT 4Y92A 2EIFA 4ELYC 1HXDA 2FL7A 2HBWA 3HRSA 3LWIA 4PJJA 4M7AC 1QVFA 2L89A 2CZ6B 3MEAA 1NLPC 4E47A 1XQHA 1WXUA 1VQLT 4M75F 2ZZDA 5LJ3e 2BKDN 3FJPA 3VS2A 1VQ8Q 2KR3A 3VS0A 1OEBA 2EQIA 1J3TA 2DETA 3VYGA 1WJSA 2FEIA 1YIJT 3JCMh 2DEQA 4KT0E 2GFAA 3OMGA 3OYBA 1UG1A 1IGQA 2XMFA 2QA4T 4PKCC 1TG0A 5CKHA 2YSQA 3CCLQ 3FLGA 3LW5E 1W2BS 4HVVA 1MMDA 1UHFA 1QCNA 4C5IA 1PRMC 4J9GA 1M2VA 3A8LB 4DA4A 3A8HB 4N4HA 1RAIB 3QYGB 4J9EA 1WJRA 3SD4A 4Y91A 4M77G 2E65A 3G6EQ 1G2BA 3PNWC 3CD6Q 2RHXA 4C5EA 3JRZA 3BE3A 4KBMB 4C0GA 1G83A 4KGVB 3F70A 4BB7A 5A0GA 1K76A 1TUGB 5GMKi 3CCRA 3HFOA 3CQTA 4B6MA 3I55A 3EFRA 1VQ9Q 4MDWA 4CC4B 4LE9A 4CC3A 1QVGA 2RI3A 3BFMA 2P4TA 1WFWA 1PD0A 1HK9A 1M1GA 2DTOA 2OTJA 2DL7A 2CREA 2XI9A 1X2QA 3WXMB 1QVGP 2YUPA 2AHJB 1Q7YR 1U1TA 4QW2A 5GAOn 3CC2T 2RHYA 1KD1R 4EMKC 2CZ0B 1CSKA 1RACB 2K2VA 1KFZA 2EJ9A 2VXFA 1VQOA 1WYXA 1M27C 1D3BA 3EH1A 3FJ5A 1H8KA 4ZNXA 4EIKA 3H9NA 4J5YA 1SEMA 5D6WA 2FO0A 5CAIA 3CCJT 4ZGEB 2VVKA 4C8QD 4M7AA 2QGFB 2LJ3A 1X75C 1QCFA 3ASKA 5D6XA 3QKJA 4LD6A 1T3SA 1MMNA 2D0QB 1R0CB 2AZVA 3EG1A 2BE7D 2HBPA 3L42A 3ZEHA 3CPWP 2DILA 2I0NA 3M0TA 4MMKA 3QSUA 1D09B 4XU1A 4J6YA 1RAHB 2OAUA 4KUIA 1M90R 1NPRA 2XHCA 2DMOA 2X9HA 1FX7A 4CRIA 3VRYA 4Z88A 3C95A 1N27A 2ZPGB 3V8KA 1ZSGA 2ZPHB 1H3HA 4Z89A 1QP2A 1VQ8T 4RCBA 4M78G 1GRIA 2RK2A 5LJ5f 1UUEA 2EGCA 3HSBA 2QQBA 5HK3A 3J7AF 2GGRA 2QA4A 2K9GA 1R0BG 1I0CA 1V1CA 1YHQQ 3A8OB 1YJNA 1VQKQ 3G4SQ 4QVZA 5FU6B 4J8OA 3JV3A 2P0PA 4IUTA 2IIMA 1S1NA 3EFOB 3RKYA 1EIFA 2Z0WA 1YI2Q 2RQWA 2RNAA 1KQ1A 1KD1C 2RH2A 1N8RC 4EPCA 2VWFA 3E2UA 1BCMA 1RABB 2BE9B 2H3JA 3FC3A 2MMPA 4M75G 3UWNA 3FIFA 3BW1A 2DJZA 1K9MU 2OJ2A 1BI1A 4BD3A 1RLQC 2FPEA 2DXCA 4VUBA 4M78F 2QGGA 1GL5A 2QTVA 2EQUA 1K73C 2EGEA 2DXTA 4PLIA 5GMKm 2EBPA 1I07A 3G71A 4XK8E 3L2UA 3QUIA 3HTRA 1JBMA 1S72Q 1Q81C 1ZUKA 1NBEB 2CP3A 3RESA 4PJOD 1M3AA 2FZGB 4F14A 2RD1A 3V7RA 1H3ZA 5I2MA 3DB4A 4LDVA 5GAN7 3EG2A 2L3PA 1ZA2B 1ZSZB 2LCCA 1VYVA 3IQLA 4E7JA 1YJNQ 1VQMQ 2B8AA 1YHQA 1OOTA 3N5BB 2E10A 2KY9A 1PM3A 4IKFA 2SEMA 1C1AA 3CMAA 3ER0A 3UDCA 3I5RA 4F7UF 2PVOB 4A53A 2YRVA 4PJLA 1PC0A 5CQYA 1SG5A 1RAEB 5KYUB 2X3WD 4M7DA 2ENMA 3GBQA 4C8QA 1JXMA 5IXFA 1TOVA 5IHIA 3H0IA 2BZ8A 4DBRA 2MIOA 2JOYA 3R6OA 1V29B 2M51A 2RHIA 1UE9A 1WHJA 3HL8A 1AZGB 1BU1A 1LJOA 3VS4A 3UPUA 1VQ7T 3M57A 4XU0A 3UA7A 1WQ7A 2PTKA 1MNDA 5GAOl 1FXXA 3QZ5B 1U5SA 2DXBA 1YNZA 1N9RA 1KHCA 1R77A 1WHGA 2YLBA 2KT8A 3VS7A 4LDXA 3VS3A 1JJ2A 5L8RE 5CCAA 3WVDB 1YP5A 1R8OB 2K5IA 1M1FA 4J6XA 5C0MA 2K79A 3TREA 5FRNA 1YJWA 4XAXB 1G3WA 1TTHB 3NTIA 1G8XA 1SRMA 2ZPFB 5GMKl 3NPFA 3PIOA 2EQJA 1EX4A 1X2KA 3EGUA 2XDPA 4ORZA 2FPDA 3V7SA 3S6WA 5IHKA 1IB8A 3LYIA 1Q81U 4C8QC 4C0ZA 4RTWA 1I1JA 1VQ4T 2YUQA 2OTJQ 3HHTB 4KUDK 4C92B 3CCSQ 4E7HA 3V7CA 4QKUA 1WHLA 3UF4A 3OYAA 1VQ9A 5GANg 3H0FA 1KC8C 1D1CA 2LT1A 1ABQA 1Y96A 1QWEA 1ABOA 3JCMJ 3E1SA 1S72A 3H0HA 1BI3A 5IAYA 3EG9A 1BK2A 5GAOr 1OPLA 4X1VA 1QKWA 1JRIA 5CQXA 1RI9A 2XU8A 1WA7A 5KYXA 3DB3A 3CD6A 1WXBA 4K11A 2DO3A 3LH5A 1RAGB 3CCUQ 2QASA 3OYFA 4M75E 4C92D 1ARKA 2CUBA 4BI4A 4M7AF 2RQTA 4DEYA 5I22A 2KK4A 4RCCA 1M30A 1N8RR 1VQ6A 1YHQT 2QXFA 1H92A 2E12A 3QJ6A 2RB6A 4E7LA 3OB9A 2LDMA 2MOXA 2MWPA 4PJOA 1F1BB 2IG0A 1MUZA 2V8KA 1W2BA 1T3LA 4JS5A 2DXUA 5GAMd 4OMFB 3EHRA 1PHTA 4EMKB 1ZBJA 2EYWA 4LUEA 5GJVB 3ZL7C 2LC4A 1K9MC 5GAMg 2LX7A 2QA4Q 2K7AA 2Y4YA 2RPNA 3G7ZA 2KEAA 4JJDA 2R57A 2NUTB 3C4SA 2AK5A 5FLXE 4RMOA 1W4SA 4XU3A 4O6JA 2MI6A 3L2WA 1NJIR 1EZZB 2DX1A 2O01E 1PD1A 4DOWA 2K5FA 1BKBA 1FMWA 2DE0X 3M0UA 4KH1B 1JEGA 1WGSA 1QQJA 5GANh 3P8BB 1W1FA 4DBFA 4OMQA 5FWBA 3E19A 1QCOA 2C0TA 1MMGA 3CCMA 2ZPBB 1QMCA 4IIMA 1IGUA 4PJOC 2R5AA 1LPLA 1KHIA 1ZSZC 2P4RA 3OYLA 5DM7R 4ZTFA 5A0LA 1XNIA 2AKLA 2QK0A 4F04B 1V76A 3S3OA 3PMTA 3QG1A 3NMZC 5KH6A 2D8JA 1VQLQ 3BDUA 5GAN2 2JT4A 3CC2Q 2DVJA 1YI2T 3REBB 3L2RA 1RUWA 1Q7YU 3EGXB 2ECZA 1RAFB 3GF5A 2A3LA 4IIOA 4OGCA 1VQ9T 2PZ1A 4F7UE 4R56A 3NGPA 5FWCA 3VJPA 4A4EA 1YITT 4JRIA 4LD9K 1IXDA 3EH2A 2H3EB 2HZYA 2YXYA 1Y7XA 1TSFA 5J39A 4EMGA 4QVCA 1B34A 1VIFA 4PLLA 2F69A 2RQRA 1AWOA 1UDLA 2V26A 2E70A 2FVUA 3M55A 1VQ5Q 1IHWA 2FRYA 1TWBA 4QQ6A 1VIEA 4ZN3A 3CCVQ 1YJ9Q 1P92A 3MJXA 2RHZA 5KYYA 3PT9A 2CKKA 3CCRQ 2F2WA 2A37A 2M1HA 1K8AU 5LJ5e 3A8GB 2L3QA 2WACA 3MP1A 2BZXA 1GCQA 1MGQA 1UHCA 1ACMB 5LJ3j 5KYWA 3OW2A 2ATCB 1YJ9A 2LJ0A 4FW1A 1E6GA 2CP7A 3AT1B 1ZQ1A 4M78A 2HKNA 2JM9A 1X6BA 1ZLMA 3A1PA 5HCKA 4FT2A 3OBYA 4XU2A 3DKMA 2DYBA 2RMOA 3CPWS 1Q82C 4HCCA 3KFVA 2GFUA 1Q86C 2NLUA 5GANf 2CZ1B 2VC8A 2VXEA 4ELZC 1TUCA 2E4HA 4Z8AA 2CT4A 3QIIA 2HNIA 2LQ8A 3QHSA 2CP6A 3P8HA 4AT1B 2GCXA 2DAQA 3CC2A 2DL5A 3CCVT 2FRWA 3CXCP 1VUBA 1NYGA 2OTLT 5CKFA 1VQPA 2GNCA 5FU6C 2BIVA 2RM4A 1H641 3HP9A 3OYIA 1IHVA 2RJFA 3TU4K 3HRUA 3GOXA 5GAOq 1N9SA 1WHKA 3DLLA 1K4US 2X35A 2W0ZA 3GLXA 2K57A 3CC4T 4C92C 3GNGA 3TVTA 4J9BA 1WIEA 4PNOA 2M16A 1UGPB 3HRTA 4C92G 2YUOA 3PFSA 1HD3A 1MMAA 2BZYA 3MP6A 5GAN3 3EGDB 4E2FB 1OPKA 5GJWB 2DNUA 1VQNA 4XTXA 4PFZA 2HL5C 3SEMA 4HVWA 2X3XD 3CMAQ 1K8AC 1TXQA 2BUDA 1GXIE 2E3IA 5DLQE 4DEXA 2C06A 1UGRB 1VQMA 2R58A 3G6ET 2G6FX 1Q82U 4C92E 1DJ7B 4BE0A 4J6WA 3I56Q 2YDLA 2Y90A 1GBQA 1AWXA 3VS6A 3VUBA 4LNPA 1LNXA 4M77A 3BDLA 4C0FA 4CI0C 1X43A 1QLYA 4F7UB 2LVMA 4BY6B 1AWWA 1E7OA 3VRZA 1Y57A 3M0PA 1M8MA 4XQ3A 3CC7Q 4OB0B 2JW4A 5GANj 1UEBA 4AFSC 1CKBA 2X4WA 2B86A 3VYHB 2K4YA 3NTHA 4NS5A 5IN1A 3CCMT 2YT6A 4BACA 4FYVB 1A0NB 3UATA 4X9CA 3OBWA 2KAFA 3CCST 3CCEA 1KIKA 5DY9A 2CSQA 3MHXA 3C94A 5CO7A 2O4XA 4M77D 2E1HA 4FYXB 1JJ2P 4II1A 1NEBA 4PL6A 1BI2A 2QTXA 1AVZC 2DVEA 3I56A 1Z9ZA 1TU0B 3JCMf 4WCIA 1BI0A 2RHUA 1SHFA 2DYIA 3CCUT 2R5MA 3TQ7P 2CH4A 1TUDA 1T0JA 2DK3A 5I11A 1NPPA 2AKKA 3EAEA 3FEOA 1GFDA 3MO8A 9ATCB 1ZSZA 3JCMg 2SRCA 1AEYA 1VQNQ 4AG2C 2NUPA 4KULA 1YFNA 1SRLA 2KI7A 2LQWA 4O5VA 3RR6A 2J6FA 2A08A 3M54A 1BB9A 2KT1A 4MZPA 3ULRB 4B9WA 4RTUA 2RJDA 1OZ3A 2D0NA 2GQVA 4R55A 2DIGA 1YWOA 2QQ9A 5KYUA 2JTEA 1OV3A 4N0AA 3M0SA 4DOVA 4C0DB 3I35A 1K73R 1YITA 1MNEA 3MEVA 1JU5C 2RO0A 4DBQA 4D8KA 2DD4A 2EJGA 1WZOA 4AFQC 1OX9A 3A98A 1Y71A 1UJYA 2M0OA 4JJNK 2EAYA 2RF0A 2RK1A 3CMEQ 3M53A 3LH0A 3MKDA 2JUFA 2JXBA 3RIRA 2EW3A 3PIPA 3M56A 1EFNA 4WTOB 4FSSA 2QG9B 5CK9A 4RTYA 2V8IA 4RTTA 5FU7C 1B7TA 1M3CA 2CP2A 3TCJA 4EMHA 2C0OA 4QVDA 4J7IA 4M75D 1GFCA 4DQ2A 4IUUA 2COWA 3M0QA 3GIBA 2GTOA 4M7DE 1QVPA 3L1AA 1YJ9T 2OTJT 3HFNA 1Q82R 2EYYA 2J7IA 1M9SA 4M75A 3RDVA 1B07A 3S3NA 1FWZA 4IURA 2EKOA 2VGNA 2F5KA 2COYA 2JTFA 3I55Q 2ROTA 2YRCA 1RLPC 2OAWA 1VOMA 5LJ3h 3JB9D 4MMLA 2KE9A 1D3BB 1G3SA 1QVFS 2PUOB 4ESRA 2LT4A 3L2ZA 2HQHA 3OS2A 2DEUA 4M78D 1B3QA 2MWOA 1C0MA 3OSSC 1Y96B 1Q81R 2A28A 3PGGA 2WSEE 4DBHA 1ZUUA 3CCVA 3OYGA 2E41A 3JCMc 3CC7A 1G5VA 2OTLA 5GAN6 2QDLA 2YUNA 1VA7A 3CBOA 3H8ZA 4XTZA 3G1JA 2EPDA 3X25B 1ZHIA 5FW9A 2JZ2A 1Z9QA 1M1KU 2BTTA 2JVVA 3EHQA 3C12A 3WVEB 2YLCA 3MP8A 2ZCFB 2PU9B 4AMCA 1SKUB 4FYWB 2V8JA 4M77C 2J06A 1YIJA 1SPKA 1VQ8A 1OQKA 3JB9H 2NYSA 3SWNB 1PWTA 2MPXC 4C8QG 3LLRA 2L3RA 3ME9A 2HKQB 5DLOA 1PSFA 3MPUB 1LCKA 2E5KA 2A7YA 4ZTJA 4JS4A 4BE2A 1Q7YC 2NWMA 3CMAT 2MAMA 4JZ4A 4NOYA 1LVKA 2DZCA 3VS5A 2KRSA 1WHMA 1YCSB 2LZ6B 3JB9F 4JZ3A 3GNFB 2E5QA 1CKAA 1N5ZA 3OY9A 1I5OB 2RQUA 1U3OA 2DRKA 5EG2A 4PJOF 4RG8A 3M4YA 1K0SA 2DA9A 2H8HA 4MZMA 3OW2P 2RN8A 2XICA 1BIBA 2EKHA 2LNVA 1OI1A 5CKDA 4QQDA 4GLMA 4E7KA 1NJIU 1VQPT 5GMKj 5LJ3f 4BDYA 5FRMA 1ZBXA 2CDTA 1M3BA 1VQOT 5GAN5 2J6KA 1TH7A 2YRDA 5KE3A 5IH2A 2K6DA 3META 5GANd 1UGSB 3OYJA 1QWFA 1PCXA 4C5HA 3X24B 3CMEA 2M0YA 3NHNA 1W6XA 3I55T 2HQEA 2COZA 1AHJB 2DTHA 3A5ZB 1VQ6Q 1VYUA 4E7ZA 1WX6A 2OTLQ 2KRMA 3OW2S 5CR2A 1K9MR 3PTAA 1WI7A 3RNJA 5KCOA 1K8AR 2LJ1A 3JCMQ 4J9DA 2JS0A 4JDSA 2F1LA 4FW2A 3G71T 1G3TA 5J3BA 3UT1A 1I81A 4HCKA 3TEEA 5FROA 1WPYA 1JQQA 3HKSA 2KQWA 1YCYA 2A0FB 2M9UA 1O9SA 5KYYB 2HD0A 1Y0MA 5IXBA 2O9SA 3G6EA 3X28B 1GCQC 3CXCS 3E9GA 4OB2B 4ME7A 2KDSA 4C8QB 3OYEA 1UJ0A 2HL3A 3ZBDA 2GBQA 2CYZB 4N4IA 2E3HA 4M78C 5KYWB 1VQ7A 3CCLA 2DZ9A 2EQKA 4M75C 5J26A 2L3SA 1X01A 1BIAA 2JMAA 4OMMA 3CPWA 2E64A 4E7SA 1Q86R 5GAN4 4A4HA 5CVIA 3M0RA 1PKSA 3OMCA 3VV0A 4KRTA 2C0IA 5CKEA 1Q95G 4N4GA 2HSEB 2HCKA 3O5ZA 3JSCA 4HCZA 1OZ2A 3KUFA 2O31A 2KYBA 1T0HA 4J9HA 2JS2A 2YHTA 4PK4A 2KROA 3D7SB 1M90C 1GBRA 4LDYA 4CC7A 2CSIA 3I56T 4PJNA 3CCMQ 2ABLA 4M7DD 2I2LA 4HKEA 3EFOA 5LJ3g 2FB7A 3CCQT 2FG0A 2K3BA 1M4ZA 2K5LA 2DL3A 1YBYA 3L2VA 4OMLA 2QEXQ 1OU9A 1UB4A 2PVGB 1QW1A 3MEWA 4HT8A 2LCLA 3J80E 2NUZA 4XTUA 2JTMA 4HA8A 4QT7A 5LJ5h 1KQSS 1IREB 4FSXA 4JRKA 1QKXA 2F2XA 1OU8A 2HMAA 2F2VA 3QPHA 2FHDA 3QO3A 1VQ4A 1MHNA 2MYSA 2DJQA 4KGZB 4HT9A 3SB2A 1UFFA 1PKTA 2JMCA 3O8VA 2ZPIB 4JPBW 4JLIA 5LJ5j 1N8RU 4JUVA 3OYNA 2CP5A 1TS9A 2PQWA 1PNJA 2FZKB 1AOJA 2QEXA 1RADB 2QQRA 3I5SA 4FCYA 3U23A 1RAAB 2J6OA 3RERA 2ZAEA 4R0KA 4PJOB 2GQIA 2QQSA 2QI2A 4J7FA 1SSHA 3JB9G 4M77B 2FZCB 4M7DG 4IUVA 4LN2A 4EMKA 3QJYA 3SWNC 4YTLA 5CIUA 2RJCA 3RUXA 3C0CA 1JXOA 4E6RA 4C5GA 2DF6A 2DPPB 4M7DC 2LP5A 2L2PA 4OMOA 4FYYB 4M7DF 4OMPA 1UGVA 7AT1B 2EYQA 1MV3A 2D6FA 4L5GA 4MDXA 3CCLT 4ZN1A
chains in the Genus database with same CATH topology
1NE8A 2QQ9A 4N0AA 2XK0A 5GANg 4DOVA 1VQ9A 2HAXA 1KC8C 4C0DB 4ATOA 5M9OA 2KSSA 2LT1A 1Y07A 4LDWA 1YITA 1Y96A 3OYHA 2ZPEB 4M7AE 1WQWA 3MEVA 3JCMJ 3URGA 2RO0A 2WSFE 3E1SA 1YJWT 1S72A 5KE2A 1QVGS 1SSFA 1VQKT 3M59A 2DD4A 4N0AC 3JCMV 1BI3A 3G4SA 5LJ5g 2EJGA 2LRQA 3SDZA 1BYMA 5IAYA 1VQ5T 3CCSA 5GAOr 1Y71A 5I2SA 1KC8U 1JRIA 5CQXA 4JLGA 3CCET 2XU8A 5A2QE 5LJ3d 2M0OA 4JJNK 4BDZA 3M58A 2EAYA 3DB3A 3CD6A 2RK1A 2DO3A 2PUKB 4OP0A 3JAME 4BY6C 3M53A 3BY7A 2RI2A 3LH0A 2GF7A 5GMKe 3OYFA 4M75E 2JUFA 5GAOp 1M8VA 4C92D 4BUGA 4M7AF 4BI4A 4BI3A 3RIRA 4E7IA 1LOJA 3PIPA 3M56A 5I21A 2KK4A 2VGMA 4RCCA 5C6SA 4JRPA 1VQ6A 5CK9A 2LX9A 3RKXA 1YHQT 2QXFA 4M7AG 2F5TX 2V8IA 2E12A 2CGHA 5FU7C 4EMHA 3TCJA 4QVDA 3V8JA 2XDBA 3QJ6A 2X4JA 1JJ2S 2L5QA 2RB6A 4J7IA 4M75D 4E7LA 4DQ2A 3OB9A 1VQNT 4ELYC 2EIFA 2MWPA 2LDMA 1HXDA 2E6ZA 4IUUA 2FL7A 3GIBA 3OQ5A 4PJOA 3HRSA 3LWIA 4XTWA 2IG0A 2V8KA 1QVPA 4C92F 1W2BA 2L89A 3CPFA 3CCQA 2DXUA 4JS5A 1QVFA 3L1AA 1YJ9T 4M7AD 5GAMd 2OTJT 3HFNA 2HQXA 4OMFB 2CZ6B 2X4YA 3MEAA 3OYKA 4E47A 1M9SA 4XTYA 1VQ6T 4M75A 1XQHA 4EMKB 1FWZA 3S3NA 4V2SA 4IURA 2EKOA 2VGNA 3M9QA 2F5KA 5HY6A 1VQLT 4M77F 3LX7A 4M75F 2JTFA 2ZZDA 5LJ3e 2BKDN 1KQ2A 2RI5A 3FJPA 2LC4A 1K9MC 5GAMg 5LJ3h 5HK0A 4C0DC 2Y4YA 4C92A 3G7ZA 3JB9D 4MMLA 1D3BB 1G3SA 1B34B 1QVFS 2R57A 3C4SA 5FLXE 2PUOB 3VU3C 2XD0A 2LT4A 3VYGA 1WJSA 3L2ZA 4Z02A 1YIJT 4RMOA 1W4SA 4XU3A 4O6JA 3OS2A 3JCMh 2DEQA 2MI6A 3L2WA 4KT0E 4M78D 4M7DE 2GFAA 2O01E 3OMGA 4DOWA 3M4GA 2MWOA 3OYBA 1NJIC 2QA4T 3OSSC 1Y96B 2DD5A 2K5FA 4L59A 1BKBA 4PKCC 5CKHA 3PGGA 2WSEE 1WGSA 4OB1B 1W2BS 3FLGA 3LW5E 4M7AB 1G3YA 5GANh 3CCVA 3OYGA 1M1KC 3P8BB 4BI8B 2LTOA 2E41A 3JCMc 4C5IA 1S72T 4NL3A 3CC7A 1G5VA 5GANe 2OTLA 3OYYA 4RKUE 5GAN6 3PMIA 3E19A 5GMKh 3A8LB 3CBOA 3H8ZA 2ZPBB 4XTZA 3A8HB 4LDUA 4N4HA 3CCMA 4DA4A 3X25B 3QYGB 3SD4A 1WJRA 1ZHIA 2JZ2A 4Y91A 4M77G 3OYDA 2E65A 1M1KU 3PNWC 2R5AA 4PJOC 1VQLA 2RHXA 1XOVA 2JVVA 2QQAA 1KHIA 4M77E 3OYLA 4C5EA 3JRZA 1NZ9A 3C12A 1U1SA 5DM7R 4ZTFA 3WVEB 4B9XA 2JNGA 2YLCA 4KBMB 5A0LA 3MP8A 1XNIA 4C0GA 2ZCFB 4M78B 2PU9B 3F70A 4BB7A 5A0GA 3VUZA 3CCRA 2V8JA 5GMKi 2FYKA 3PMTA 4C8QE 3QG1A 4M77C 4A4KA 5KH6A 3HFOA 3S3OA 3BDUA 5GAN2 1YIJA 3I55A 3RMSA 1VQ8A 3EFRA 3JB9H 1RL2A 4MDWA 3SWNB 2RJEA 1KD1U 1QVGA 4C8QG 3FDRA 3LLRA 1YI2T 2L3RA 2RI3A 3BFMA 3V8LA 3L2RA 4GLKA 2P4TA 3ME9A 1Q7YU 4J83A 2K3XA 3VKIA 5DLOA 2IVWA 1PSFA 1HK9A 1M1GA 2DTOA 2A3LA 3GF5A 2A7YA 4ZTJA 4JS4A 4BE2A 3G4ST 1Q7YC 2XI9A 3FB9A 3WXMB 4OGCA 2AHJB 1VQ9T 1U1TA 4QW2A 4F7UE 3CMAT 2MAMA 2XIDA 5GAOn 3CC2T 2RHYA 4R56A 3VJPA 4A4EA 4EMKC 1YITT 2CZ0B 4JRIA 4LD9K 1KQSA 4NOYA 2K2VA 4XTVA 2EJ9A 1Y7XA 4A4GA 2VXFA 2DZCA 4OF1A 1VQOA 1D3BA 5J39A 4EMGA 4QVCA 1B34A 1VIFA 2MF2A 4PLLA 3JB9F 2DIQA 2F69A 3GNFB 2E5QA 3M55A 3OY9A 2E70A 2FVUA 3NFCA 4J5YA 4BE1A 5GAMf 5D6WA 1RI0A 3CMET 3QYHB 4QQ6A 1VIEA 4ZN3A 5CAIA 3CCJT 4ZGEB 5EG2A 1P92A 1WNLA 2RHZA 4PJOF 4A54A 4C8QD 4RG8A 3JCMe 4M7AA 3M4YA 1X75C 3PT9A 3OS1A 2CZ7B 2CKKA 4ZGDB 2M1HA 4MZMA 1K8AU 3ASKA 5D6XA 3QKJA 5LJ5e 4LD6A 3A8GB 1YI2A 2XICA 3OA6A 2WACA 1BIBA 3MP1A 4QQGA 2LNVA 3H6ZA 2D0QB 3CC7T 1MGQA 1OI1A 3P8DA 5LJ3j 2HBPA 5CKDA 4QQDA 3OW2A 3L42A 2QDYB 3ZEHA 1VQKA 4MMKA 3SFMA 3QSUA 3J81E 4E7KA 1YJ9A 4XU1A 1VQPT 5GMKj 1NJIU 3QDRB 4J6YA 5LJ3f 2OAUA 2QEXT 1ZBXA 4KUIA 4BDYA 5FRMA 2VV5A 3ZFJA 1ZQ1A 1VQOT 1NPRA 4M78A 5GAN5 4P5NA 5GAOm 1Q86U 4WF2A 3CD6T 3QBYA 2XHCA 1TH7A 4FT2A 1FX7A 4CRIA 3OBYA 5KE3A 3C95A 1N27A 4XU2A 2ZPGB 3DKMA 3META 2RA2A 5GANd 1UGSB 3OYMA 3OYJA 1M90U 3V8KA 2D9TA 3EFSA 3SWNA 4C5HA 2ZPHB 3X24B 3CMEA 1QP2A 3I55T 3CPWS 4FU6A 1Q82C 1VQ8T 2HQEA 4X9DA 4HCCA 4M7AC 4RCBA 3LWHA 4PJOG 2GFUA 1Q86C 1AHJB 2DTHA 2CZ1B 2NLUA 2VC8A 2VXEA 4ELZC 5GANf 3A5ZB 4M78G 2RK2A 3Q1JA 5LJ5f 3QIIA 3HSBA 2QQBA 2DKGA 2HNIA 2LQ8A 5LJ5d 5HK3A 3QHSA 4M78E 3OW2S 5CR2A 3J7AF 3PTAA 2QA4A 1QP3A 3QXEB 5KCOA 1I8FA 3P8HA 2GCXA 3CBMA 3JCMQ 2DAQA 3CC2A 2EJFA 3A8OB 3CCVT 1YJNA 4JDSA 4QVZA 5FU6B 3G71T 1G3TA 5J3BA 4J8OA 3UT1A 1I81A 1VUBA 2OTLT 1I5LA 1O75A 3AHUA 4FIBA 2P0PA 3LGFA 5CKFA 3TEEA 4IUTA 1VQPA 5FROA 3KBGA 4JRQA 1WPYA 3LGLA 5FU6C 3RKYA 1M5Q1 2BIVA 3HKSA 2RM4A 1EIFA 1H641 2KQWA 3HP9A 1YCYA 3JCMP 3OYIA 1KQ1A 4PJOE 2M9UA 2RH2A 1KD1C 1N8RC 2DTIA 1VQMT 1O9SA 2RJFA 4EPCA 2HD0A 3TU4K 3HRUA 3GOXA 3HPWA 5GAOq 3MCAB 3G6EA 1N9SA 3X28B 4C8QF 3DLLA 2H3JA 3FC3A 2MMPA 3INZA 4M75G 3CXCS 2X35A 3E9GA 4OB2B 5HKCA 2EQMA 4M7DB 4ME7A 2KDSA 3FIFA 2K57A 3BW1A 3GLXA 3UWNA 4C8QB 2DJZA 4C92C 3OYEA 3CC4T 1BI1A 1K9MU 3NTKA 3GNGA 2E6NA 3ZBDA 4BD3A 4MZTA 2CYZB 4N4IA 4M78C 3GP8A 2DXCA 4PNOA 2M16A 1VQ7A 1UGPB 3HRTA 4VUBA 4FT4A 4M78F 4C92G 3CCLA 2DZ9A 3PFSA 3QZ9B 2O4XB 1K73U 2EQKA 2P0QA 4M75C 5J26A 1KG1A 3MP6A 5GAN3 2EQUA 2PVDB 1X01A 1BIAA 3JCMd 1K73C 2DXTA 3CPWA 1VQNA 2E64A 4PLIA 5GMKm 4XTXA 3GPLA 3G71A 3OYCA 4XK8E 3L2UA 3OYAA 5IT9E 3QUIA 5AYFA 1K8AC 5GAN4 1JBMA 4A4HA 5GAMh 5CVIA 2BUDA 1GXIE 3OMCA 1Q81C 4R55A 4UC4A 5DLQE 3RESA 3VV0A 4PJOD 3CCUA 4Y28E 2C06A 5CKEA 2RD1A 1UGRB 1VQMA 2EWNA 4N4GA 3V7RA 1H3ZA 5I2MA 4OGEA 2R58A 4Q5WA 3G6ET 3MEUA 3DB4A 4LDVA 5KCHA 1Q82U 5GAN7 3JSCA 4HCZA 3X20B 5LL6S 1DJ7B 3DLMA 4C92E 4J6WA 1OZ2A 4BE0A 3KUFA 3M5AA 2Y90A 2X4XA 3CCJA 2LCCA 3VUBA 4E7JA 1JB0E 1LNXA 2G3RA 4M77A 4NL2A 3L2QA 2YHTA 2B8AA 1YHQA 4FL6A 5FU7B 3BDLA 3OS5A 3N5BB 5CKBA 4C0FA 4CI0C 1M90C 2E10A 2KY9A 4LDYA 4F7UB 3I56T 2LVMA 4OVAA 4IKFA 4BY6B 1N6AA 4M7DD 2I2LA 4HKEA 3FRNA 5LJ3g 3CMAA 2CS7A 2FB7A 3ER0A 3CCQT 3UDCA 1M4ZA 2K5LA 4X34A 4F7UF 4XQ3A 4OB0B 5GANj 2JN0A 2PVOB 1UEBA 4A53A 1YBYA 2LQKA 5D6YA 2YRVA 2X4WA 5CQYA 3L2VA 3VYHB 2K4YA 3CBPA 3NTHA 1PSEA 4NS5A 4M7DA 4FM4B 1UB4A 5IN1A 5A0DA 3CCMT 2PVGB 2ZGWA 4BACA 4C8QA 1QW1A 3MEWA 4RG2A 3X26B 4A4FA 4EDUA 4X9CA 3OBWA 3OS0A 4HT8A 1UGQB 2LCLA 4TVRA 4ZGJB 2XG8D 2KAFA 3J80E 4XTUA 2JTMA 4HA8A 5LJ5h 1KQSS 1IREB 3CCST 1WJQA 3CC4A 4IUPA 2JOYA 3R6OA 3T9NA 3CCEA 1V29B 4FSXA 2VUBA 1IZ6A 2RHIA 4JRKA 5DY9A 3OSVA 2XKOC 3HL8A 3MHXA 3C94A 1LJOA 3UPUA 5CO7A 2K3YA 2O4XA 3QPHA 2FHDA 4M77D 1VQ7T 3M57A 4XU0A 2P0KA 3QO3A 2E1HA 1VQ4A 1MHNA 1WQ7A 5GAMe 5GAOl 1FXXA 3KXTA 4II1A 4HT9A 3SB2A 3QZ5B 3CXCA 2DXBA 3JB9J 1U8RA 1N9RA 1KHCA 3O8VA 4PL6A 2YLBA 1BI2A 2QTXA 2ZPIB 4JLIA 5LJ5j 2DVEA 5GAN8 3I56A 1N8RU 4LDXA 4JUVA 3OYNA 3CEYA 2VYTA 2PQWA 1JJ2A 3JCMf 5L8RE 5CCAA 2WSCE 3WVDB 2K5IA 1R8OB 3JCMb 1YJNT 1M1FA 1BI0A 2RHUA 2EFIA 4J6XA 4OB3B 5C0MA 3E9FA 2L8DA 3TREA 2QEXA 5FRNA 2QQRA 4XAXB 1YJWA 1G3WA 3NTIA 3CCUT 3RERA 2R5MA 3RMQA 4L6V5 2DK3A 2ZPFB 3RKWA 4PJOB 5GMKl 1VQ5A 3PIOA 3JB9I 2EQJA 2Y4XA 2KVQG 2QQSA 2QI2A 4IUQA 4J7FA 1NPPA 3FEOA 3EAEA 5GAMj 3JB9G 3MO8A 2XDPA 4HCBA 3JCMg 3V7SA 1X6OA 4D6WA 4M77B 4M75B 3S6WA 4M7DG 4IUVA 4KULA 3LYIA 4EMKA 3QJYA 1XTDA 3SWNC 3CCRT 4O5VA 4YTLA 2KMTA 5CIUA 2RJCA 1Q81U 3RUXA 4C8QC 3A8MB 4F7UA 4C0ZA 4C5GA 2OTJA 2XDDA 2DPPB 3JCMX 1VQ4T 3M54A 4M7DC 1OYXA 3S3MA 4GY5A 3JCMW 4M7DF 3HHTB 4KUDK 4C92B 4E7HA 4MZPA 2EYQA 4B9WA 2D6FA 4F7UG 4L5GA 4MDXA 2RJDA 3CCLT 3V7CA 4ZN1A 1OZ3A 2GQVA 2DIGA 1I4K1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RA2 A;  5GAO q;  1LNX A;  4M77 A;  4N0A A;  3EFS A;  2YHT A;  4NL2 A;  3SWN A;  4Y91 A;  4M77 G;  3V8K A;  5GAN g;  2E65 A;  4PJO C;  4X9D A;  1Y96 A;  2E10 A;  4RCB A;  4PJO G;  4M7A E;  1WQW A;  3JCM J;  5GAN f;  2DTH A;  2VC8 A;  2VXE A;  4M77 E;  4F7U B;  3JB9 J;  1U1S A;  4M78 G;  4M7D D;  2I2L A;  5LJ5 f;  4N0A C;  3JCM V;  2YLC A;  5LJ3 g;  5LJ5 g;  2EJG A;  2FB7 A;  2DKG A;  3HSB A;  4F7U F;  2HNI A;  5LJ5 d;  4M78 B;  4XQ3 A;  5GAN j;  2JN0 A;  3QHS A;  4M78 E;  5GAO r;  1JRI A;  4A53 A;  5LJ3 d;  5GMK i;  2FYK A;  4C8Q E;  4M77 C;  2EAY A;  1I8F A;  3HFO A;  3BDU A;  5GAN 2;  3JCM Q;  3EFR A;  4OP0 A;  3JB9 H;  2EJF A;  3SWN B;  4M7D A;  3BY7 A;  4C8Q G;  2ZGW A;  4C8Q A;  5GMK e;  4HT8 A;  4M75 E;  5GAO p;  1I81 A;  3BFM A;  4X9C A;  3V8L A;  4C92 D;  1M8V A;  1I5L A;  3AHU A;  4XTU A;  4HA8 A;  5LJ5 h;  4M7A F;  1HK9 A;  3RIR A;  1LOJ A;  1WPY A;  5I21 A;  2DTO A;  3RKY A;  1M5Q 1;  4RCC A;  2RM4 A;  1H64 1;  4JRK A;  5DY9 A;  3FB9 A;  1YCY A;  3JCM P;  3RKX A;  1KQ1 A;  1U1T A;  4F7U E;  4M7A G;  4PJO E;  1LJO A;  2CGH A;  2DTI A;  4EMH A;  4QVD A;  3V8J A;  5GAO n;  4EMK C;  4JRI A;  4M77 D;  2RB6 A;  4M75 D;  4NOY A;  3QO3 A;  2E1H A;  4XU0 A;  1N9S A;  4XTV A;  4C8Q F;  1WQ7 A;  2EJ9 A;  1HXD A;  4DQ2 A;  3GIB A;  5GAM e;  5GAO l;  2VXF A;  2DZC A;  4PJO A;  4M75 G;  3INZ A;  4M7D B;  4XTW A;  4HT9 A;  4M7A C;  4M7D E;  4C92 F;  1D3B A;  3SB2 A;  4EMG A;  2DXU A;  4QVC A;  1B34 A;  3FIF A;  2K57 A;  3BW1 A;  3L1A A;  4C8Q B;  1N9R A;  2DJZ A;  4C92 C;  5GAM d;  2YLB A;  3HFN A;  3JB9 F;  2QTX A;  4M7A D;  4JLI A;  5LJ5 j;  2DVE A;  5GAN 8;  4JUV A;  4J5Y A;  4XTY A;  5GAM f;  4M75 A;  4M78 C;  3JCM f;  4V2S A;  4EMK B;  4PNO A;  5CAI A;  3JCM b;  4M78 F;  4C92 G;  4M77 F;  4J6X A;  4M75 F;  1WNL A;  2DZ9 A;  4PJO F;  4A54 A;  4C8Q D;  5LJ3 e;  3JCM e;  1KQ2 A;  3FJP A;  4M75 C;  4M7A A;  5GAN 3;  3RER A;  5GAM g;  1X01 A;  1BIA A;  3RKW A;  5LJ3 h;  3JCM d;  2DXT A;  5GMK l;  4PJO B;  2E64 A;  4C92 A;  5GMK m;  4XTX A;  3JB9 D;  5LJ5 e;  4MML A;  3JB9 I;  1D3B B;  1B34 B;  5GAM j;  3JB9 G;  1BIB A;  3QUI A;  3VU3 C;  3JCM g;  3L2Z A;  5GAN 4;  1JBM A;  5GAM h;  3V7S A;  4XU3 A;  1MGQ A;  2DEQ A;  3JCM h;  4M77 B;  4M75 B;  4M78 D;  4M7D G;  3M4G A;  4EMK A;  5LJ3 j;  3RES A;  3SWN C;  4PJO D;  1Y96 B;  4MMK A;  3QSU A;  3PGG A;  3RUX A;  2RD1 A;  4C8Q C;  4F7U A;  2EWN A;  3V7R A;  4XU1 A;  5GMK j;  4M7A B;  4J6Y A;  5GAN h;  5LJ3 f;  3JCM X;  4M7D C;  5GAN 7;  3JCM W;  4M7D F;  2E41 A;  3JCM c;  4C92 E;  4J6W A;  4M78 A;  4C92 B;  5GAN 5;  4NL3 A;  5GAN e;  5GAO m;  4WF2 A;  5GAN 6;  4F7U G;  2Y90 A;  1TH7 A;  3V7C A;  5GMK h;  4XTZ A;  4XU2 A;  5GAN d;  1I4K 1; 
#chains in the Genus database with same CATH topology
 2KXC A;  4ATO A;  1K1Z A;  2KSS A;  4LDW A;  2DER A;  2ZPE B;  1QVG S;  5KE2 A;  2DBK A;  3M59 A;  4N0A C;  1BYM A;  2DL8 A;  2LRQ A;  3SDZ A;  1VQ5 T;  3CCS A;  5I2S A;  5A2Q E;  4BDZ A;  1M2V B;  3M58 A;  1X6G A;  4OP0 A;  1KK7 A;  4BY6 C;  5GMK e;  1SHG A;  1M8V A;  4JJC A;  1WHH A;  4E7I A;  5I21 A;  1K0X A;  2CT3 A;  4JRP A;  1W70 A;  2ROL A;  2KGT A;  3QWY A;  2F5T X;  2CGH A;  2X4J A;  1JJ2 S;  2L5Q A;  2E6Z A;  5IHN A;  3OQ5 A;  1KSW A;  4XTW A;  4C92 F;  3CPF A;  1FMV A;  3CCQ A;  3CCJ Q;  1NYF A;  1KC8 R;  4M7A D;  2YWW A;  2HQX A;  3EGX A;  2O9V A;  2X4Y A;  3OYK A;  4XTY A;  2VKN A;  3THK A;  2NUP B;  4V2S A;  2AT1 B;  3EG0 A;  3M9Q A;  5HY6 A;  4M77 F;  3LX7 A;  2KBT A;  1KQ2 A;  2RI5 A;  1AWJ A;  2CP0 A;  1X27 A;  4LXC A;  5L23 A;  4OMN A;  5HK0 A;  4C0D C;  4C92 A;  1B34 B;  2X51 A;  3VU3 C;  2XD0 A;  2EGA A;  4Z02 A;  1VYT A;  1VQP Q;  4KH0 B;  3M4G A;  1NJI C;  2HEQ A;  4L59 A;  2DD5 A;  4OB1 B;  1M1K R;  4M7A B;  1G3Y A;  4LUD A;  1M2O A;  1M1K C;  1MV0 B;  4BI8 B;  2LTO A;  4F17 A;  3QDF A;  1S72 T;  3EG9 B;  4NL3 A;  4D8D A;  5GAN e;  3OYY A;  4RKU E;  2M02 A;  3PMI A;  5KYX B;  5GMK h;  4LDU A;  1VQO Q;  3OYD A;  4RTV A;  3EG3 A;  1VQL A;  1AT1 B;  1XOV A;  2KYM A;  2QQA A;  4M77 E;  6AT1 B;  4HXJ A;  1NZ9 A;  1U1S A;  4B9X A;  2JNG A;  2FPF A;  2MCN A;  4M78 B;  3VUZ A;  4RTZ A;  2FYK A;  4C8Q E;  4A4K A;  1VQ6 T;  1SF9 A;  3RMS A;  1RL2 A;  2DFU A;  1IRX A;  2RJE A;  1KD1 U;  3FDR A;  3V8L A;  4GLK A;  4J83 A;  2K3X A;  3QWX X;  3VKI A;  2IVW A;  2J05 A;  5KYN A;  4J9F A;  3G4S T;  3FB9 A;  3G71 Q;  2AIR B;  4M4Z A;  2XID A;  1IO6 A;  1KQS A;  4XTV A;  4A4G A;  4OF1 A;  2KNB B;  2QYZ A;  1BBZ A;  2MF2 A;  2NUT A;  2DIQ A;  3NFC A;  4BE1 A;  5GAM f;  1WXT A;  1RI0 A;  3CME T;  3QYH B;  4JJB A;  1WNL A;  4A54 A;  3JCM e;  2ED1 A;  1YIJ Q;  3OS1 A;  2CZ7 B;  4ZGD B;  1FYN A;  3TSW A;  1YI2 A;  3OA6 A;  1X69 A;  4QQG A;  3H6Z A;  3CC7 T;  4KGX B;  3R6N A;  2LNH B;  3P8D A;  2RQV A;  2QDY B;  1VQK A;  3SFM A;  3J81 E;  2AZS A;  2DBM A;  3QDR B;  2QEX T;  4ANJ A;  3VS1 A;  2VV5 A;  4PFP A;  3ZFJ A;  2O88 A;  1ZA1 B;  4P5N A;  5GAO m;  1Q86 U;  4WF2 A;  3CD6 T;  3QBY A;  1HYO A;  2RA2 A;  3OYM A;  1M90 U;  2D9T A;  3EFS A;  3SWN A;  4FU6 A;  4X9D A;  3LWH A;  4PJO G;  8AT1 B;  3Q1J A;  2DKG A;  1PRL C;  1W2B P;  5LJ5 d;  3I9Q A;  4PJM A;  2JM8 A;  4M78 E;  2DRM A;  1QP3 A;  3QXE B;  3TSZ A;  4AFZ C;  1I8F A;  3PE0 A;  3CBM A;  2EJF A;  1I5L A;  1O75 A;  3AHU A;  4FIB A;  3LGF A;  3KBG A;  4JRQ A;  3LGL A;  1M5Q 1;  3JCM P;  1ZX6 A;  4PJO E;  2DLP A;  1BCO A;  2DTI A;  1VQM T;  4AG1 C;  1K9A A;  3HPW A;  3MCA B;  4C8Q F;  1QVF P;  1WLP B;  4M7D B;  3INZ A;  2D8H A;  5HKC A;  2EQM A;  3NTK A;  2E6N A;  4J9I A;  4MZT A;  3GP8 A;  4FT4 A;  2KXD A;  1OUL A;  4RUG A;  2EYZ A;  3QZ9 B;  2O4X B;  1K73 U;  1OX8 A;  2P0Q A;  1KG1 A;  2CUD A;  2PVD B;  2VB6 A;  3JCM d;  3GPL A;  2ESW A;  2CH4 W;  5ECA A;  3OYC A;  5IT9 E;  5AYF A;  1D1B A;  5GAM h;  1YWP A;  3REA B;  1XJW B;  2LCS A;  2MK5 A;  4UC4 A;  1YIT Q;  2OX7 A;  3CCU A;  4Y28 E;  1FMK A;  5D7U A;  2EWN A;  4J9C A;  3SHW A;  4OGE A;  4Q5W A;  3MEU A;  5KCH A;  3X20 B;  5LL6 S;  3DLM A;  4HVU A;  3UA6 A;  1ZUY A;  2PNI A;  3M5A A;  4GBQ A;  1NLO C;  2X4X A;  3CCJ A;  3CCQ Q;  1GCP A;  1JB0 E;  2G3R A;  4NL2 A;  3L2Q A;  4FL6 A;  5FU7 B;  3OS5 A;  5CKB A;  2JJ9 A;  2HDA A;  4OVA A;  1KQS P;  1N6A A;  3FRN A;  2CS7 A;  2W10 A;  2A36 A;  4X34 A;  3CC4 Q;  1NM7 A;  2JN0 A;  1UTI A;  2LQN A;  5D6Y A;  2LQK A;  1HSQ A;  3CBP A;  4AFU C;  1PSE A;  4FM4 B;  5A0D A;  2ZGW A;  1VQ7 Q;  3X26 B;  4RG2 A;  4A4F A;  4EDU A;  3OS0 A;  1UGQ B;  4ZGJ B;  2IPO B;  4TVR A;  2XG8 D;  5AT1 B;  3CC4 A;  1WJQ A;  4IUP A;  3T9N A;  1YN8 A;  2VUB A;  1IZ6 A;  3PVL A;  4F16 A;  3OSV A;  2XKO C;  2K3Y A;  2K2M A;  2P0K A;  1D0Z A;  3EGD A;  1YJW Q;  5GAM e;  3KXT A;  4A63 B;  3PVQ A;  3CXC A;  3JB9 J;  1U8R A;  3CCE Q;  1PG5 B;  5GAN 8;  1WDX A;  3CEY A;  2VYT A;  4CC2 A;  8ATC B;  2O2O A;  2ED0 A;  2WSC E;  3JCM b;  1YJN T;  2EFI A;  2EYX A;  4OB3 B;  3E9F A;  2L8D A;  2KRN A;  3RMQ A;  4L6V 5;  3RKW A;  2HSP A;  2V1Q A;  1VQ5 A;  2L0A A;  3JB9 I;  2Y4X A;  2KVQ G;  4IUQ A;  5GAM j;  4HCB A;  1X6O A;  1KJW A;  4D6W A;  2D1X A;  2P84 A;  4M75 B;  1NEG A;  2QAZ A;  2LMJ A;  1AZE A;  2VAS A;  1XTD A;  3CCR T;  2KMT A;  3A8M B;  4F7U A;  4RTX A;  2XDD A;  3RBB B;  1U06 A;  3JCM X;  1NG2 A;  1OYX A;  3S3M A;  4GY5 A;  1C6V X;  1UEC A;  3JCM W;  1D1A A;  1JO8 A;  2DM1 A;  1D0X A;  4F7U G;  2V1R A;  4PFO A;  1I4K 1;  3G4S A;  1NE8 A;  2XK0 A;  2HAX A;  5M9O A;  1VQ4 Q;  1Y07 A;  3OYH A;  2DL4 A;  4M7A E;  1WQW A;  2OI3 A;  3URG A;  2WSF E;  1YJW T;  1E6H A;  1SSF A;  1VQK T;  3JCM V;  5LJ5 g;  1D0Y A;  2GTJ A;  1HJD A;  1KC8 U;  3CCE T;  4JLG A;  5LJ3 d;  2EVR A;  3JAM E;  2PUK B;  1AD5 A;  3BY7 A;  3H41 A;  2RI2 A;  2GF7 A;  5GAO p;  4BUG A;  4BI3 A;  1LOJ A;  2VGM A;  5C6S A;  2LX9 A;  3RKX A;  4M7A G;  5EC7 A;  2XDB A;  3V8J A;  1VQN T;  4Y92 A;  2EIF A;  4ELY C;  1HXD A;  2FL7 A;  2HBW A;  3HRS A;  3LWI A;  4PJJ A;  4M7A C;  1QVF A;  2L89 A;  2CZ6 B;  3MEA A;  1NLP C;  4E47 A;  1XQH A;  1WXU A;  1VQL T;  4M75 F;  2ZZD A;  5LJ3 e;  2BKD N;  3FJP A;  3VS2 A;  1VQ8 Q;  2KR3 A;  3VS0 A;  1OEB A;  2EQI A;  1J3T A;  2DET A;  3VYG A;  1WJS A;  2FEI A;  1YIJ T;  3JCM h;  2DEQ A;  4KT0 E;  2GFA A;  3OMG A;  3OYB A;  1UG1 A;  1IGQ A;  2XMF A;  2QA4 T;  4PKC C;  1TG0 A;  5CKH A;  2YSQ A;  3CCL Q;  3FLG A;  3LW5 E;  1W2B S;  4HVV A;  1MMD A;  1UHF A;  1QCN A;  4C5I A;  1PRM C;  4J9G A;  1M2V A;  3A8L B;  4DA4 A;  3A8H B;  4N4H A;  1RAI B;  3QYG B;  4J9E A;  1WJR A;  3SD4 A;  4Y91 A;  4M77 G;  2E65 A;  3G6E Q;  1G2B A;  3PNW C;  3CD6 Q;  2RHX A;  4C5E A;  3JRZ A;  3BE3 A;  4KBM B;  4C0G A;  1G83 A;  4KGV B;  3F70 A;  4BB7 A;  5A0G A;  1K76 A;  1TUG B;  5GMK i;  3CCR A;  3HFO A;  3CQT A;  4B6M A;  3I55 A;  3EFR A;  1VQ9 Q;  4MDW A;  4CC4 B;  4LE9 A;  4CC3 A;  1QVG A;  2RI3 A;  3BFM A;  2P4T A;  1WFW A;  1PD0 A;  1HK9 A;  1M1G A;  2DTO A;  2OTJ A;  2DL7 A;  2CRE A;  2XI9 A;  1X2Q A;  3WXM B;  1QVG P;  2YUP A;  2AHJ B;  1Q7Y R;  1U1T A;  4QW2 A;  5GAO n;  3CC2 T;  2RHY A;  1KD1 R;  4EMK C;  2CZ0 B;  1CSK A;  1RAC B;  2K2V A;  1KFZ A;  2EJ9 A;  2VXF A;  1VQO A;  1WYX A;  1M27 C;  1D3B A;  3EH1 A;  3FJ5 A;  1H8K A;  4ZNX A;  4EIK A;  3H9N A;  4J5Y A;  1SEM A;  5D6W A;  2FO0 A;  5CAI A;  3CCJ T;  4ZGE B;  2VVK A;  4C8Q D;  4M7A A;  2QGF B;  2LJ3 A;  1X75 C;  1QCF A;  3ASK A;  5D6X A;  3QKJ A;  4LD6 A;  1T3S A;  1MMN A;  2D0Q B;  1R0C B;  2AZV A;  3EG1 A;  2BE7 D;  2HBP A;  3L42 A;  3ZEH A;  3CPW P;  2DIL A;  2I0N A;  3M0T A;  4MMK A;  3QSU A;  1D09 B;  4XU1 A;  4J6Y A;  1RAH B;  2OAU A;  4KUI A;  1M90 R;  1NPR A;  2XHC A;  2DMO A;  2X9H A;  1FX7 A;  4CRI A;  3VRY A;  4Z88 A;  3C95 A;  1N27 A;  2ZPG B;  3V8K A;  1ZSG A;  2ZPH B;  1H3H A;  4Z89 A;  1QP2 A;  1VQ8 T;  4RCB A;  4M78 G;  1GRI A;  2RK2 A;  5LJ5 f;  1UUE A;  2EGC A;  3HSB A;  2QQB A;  5HK3 A;  3J7A F;  2GGR A;  2QA4 A;  2K9G A;  1R0B G;  1I0C A;  1V1C A;  1YHQ Q;  3A8O B;  1YJN A;  1VQK Q;  3G4S Q;  4QVZ A;  5FU6 B;  4J8O A;  3JV3 A;  2P0P A;  4IUT A;  2IIM A;  1S1N A;  3EFO B;  3RKY A;  1EIF A;  2Z0W A;  1YI2 Q;  2RQW A;  2RNA A;  1KQ1 A;  1KD1 C;  2RH2 A;  1N8R C;  4EPC A;  2VWF A;  3E2U A;  1BCM A;  1RAB B;  2BE9 B;  2H3J A;  3FC3 A;  2MMP A;  4M75 G;  3UWN A;  3FIF A;  3BW1 A;  2DJZ A;  1K9M U;  2OJ2 A;  1BI1 A;  4BD3 A;  1RLQ C;  2FPE A;  2DXC A;  4VUB A;  4M78 F;  2QGG A;  1GL5 A;  2QTV A;  2EQU A;  1K73 C;  2EGE A;  2DXT A;  4PLI A;  5GMK m;  2EBP A;  1I07 A;  3G71 A;  4XK8 E;  3L2U A;  3QUI A;  3HTR A;  1JBM A;  1S72 Q;  1Q81 C;  1ZUK A;  1NBE B;  2CP3 A;  3RES A;  4PJO D;  1M3A A;  2FZG B;  4F14 A;  2RD1 A;  3V7R A;  1H3Z A;  5I2M A;  3DB4 A;  4LDV A;  5GAN 7;  3EG2 A;  2L3P A;  1ZA2 B;  1ZSZ B;  2LCC A;  1VYV A;  3IQL A;  4E7J A;  1YJN Q;  1VQM Q;  2B8A A;  1YHQ A;  1OOT A;  3N5B B;  2E10 A;  2KY9 A;  1PM3 A;  4IKF A;  2SEM A;  1C1A A;  3CMA A;  3ER0 A;  3UDC A;  3I5R A;  4F7U F;  2PVO B;  4A53 A;  2YRV A;  4PJL A;  1PC0 A;  5CQY A;  1SG5 A;  1RAE B;  5KYU B;  2X3W D;  4M7D A;  2ENM A;  3GBQ A;  4C8Q A;  1JXM A;  5IXF A;  1TOV A;  5IHI A;  3H0I A;  2BZ8 A;  4DBR A;  2MIO A;  2JOY A;  3R6O A;  1V29 B;  2M51 A;  2RHI A;  1UE9 A;  1WHJ A;  3HL8 A;  1AZG B;  1BU1 A;  1LJO A;  3VS4 A;  3UPU A;  1VQ7 T;  3M57 A;  4XU0 A;  3UA7 A;  1WQ7 A;  2PTK A;  1MND A;  5GAO l;  1FXX A;  3QZ5 B;  1U5S A;  2DXB A;  1YNZ A;  1N9R A;  1KHC A;  1R77 A;  1WHG A;  2YLB A;  2KT8 A;  3VS7 A;  4LDX A;  3VS3 A;  1JJ2 A;  5L8R E;  5CCA A;  3WVD B;  1YP5 A;  1R8O B;  2K5I A;  1M1F A;  4J6X A;  5C0M A;  2K79 A;  3TRE A;  5FRN A;  1YJW A;  4XAX B;  1G3W A;  1TTH B;  3NTI A;  1G8X A;  1SRM A;  2ZPF B;  5GMK l;  3NPF A;  3PIO A;  2EQJ A;  1EX4 A;  1X2K A;  3EGU A;  2XDP A;  4ORZ A;  2FPD A;  3V7S A;  3S6W A;  5IHK A;  1IB8 A;  3LYI A;  1Q81 U;  4C8Q C;  4C0Z A;  4RTW A;  1I1J A;  1VQ4 T;  2YUQ A;  2OTJ Q;  3HHT B;  4KUD K;  4C92 B;  3CCS Q;  4E7H A;  3V7C A;  4QKU A;  1WHL A;  3UF4 A;  3OYA A;  1VQ9 A;  5GAN g;  3H0F A;  1KC8 C;  1D1C A;  2LT1 A;  1ABQ A;  1Y96 A;  1QWE A;  1ABO A;  3JCM J;  3E1S A;  1S72 A;  3H0H A;  1BI3 A;  5IAY A;  3EG9 A;  1BK2 A;  5GAO r;  1OPL A;  4X1V A;  1QKW A;  1JRI A;  5CQX A;  1RI9 A;  2XU8 A;  1WA7 A;  5KYX A;  3DB3 A;  3CD6 A;  1WXB A;  4K11 A;  2DO3 A;  3LH5 A;  1RAG B;  3CCU Q;  2QAS A;  3OYF A;  4M75 E;  4C92 D;  1ARK A;  2CUB A;  4BI4 A;  4M7A F;  2RQT A;  4DEY A;  5I22 A;  2KK4 A;  4RCC A;  1M30 A;  1N8R R;  1VQ6 A;  1YHQ T;  2QXF A;  1H92 A;  2E12 A;  3QJ6 A;  2RB6 A;  4E7L A;  3OB9 A;  2LDM A;  2MOX A;  2MWP A;  4PJO A;  1F1B B;  2IG0 A;  1MUZ A;  2V8K A;  1W2B A;  1T3L A;  4JS5 A;  2DXU A;  5GAM d;  4OMF B;  3EHR A;  1PHT A;  4EMK B;  1ZBJ A;  2EYW A;  4LUE A;  5GJV B;  3ZL7 C;  2LC4 A;  1K9M C;  5GAM g;  2LX7 A;  2QA4 Q;  2K7A A;  2Y4Y A;  2RPN A;  3G7Z A;  2KEA A;  4JJD A;  2R57 A;  2NUT B;  3C4S A;  2AK5 A;  5FLX E;  4RMO A;  1W4S A;  4XU3 A;  4O6J A;  2MI6 A;  3L2W A;  1NJI R;  1EZZ B;  2DX1 A;  2O01 E;  1PD1 A;  4DOW A;  2K5F A;  1BKB A;  1FMW A;  2DE0 X;  3M0U A;  4KH1 B;  1JEG A;  1WGS A;  1QQJ A;  5GAN h;  3P8B B;  1W1F A;  4DBF A;  4OMQ A;  5FWB A;  3E19 A;  1QCO A;  2C0T A;  1MMG A;  3CCM A;  2ZPB B;  1QMC A;  4IIM A;  1IGU A;  4PJO C;  2R5A A;  1LPL A;  1KHI A;  1ZSZ C;  2P4R A;  3OYL A;  5DM7 R;  4ZTF A;  5A0L A;  1XNI A;  2AKL A;  2QK0 A;  4F04 B;  1V76 A;  3S3O A;  3PMT A;  3QG1 A;  3NMZ C;  5KH6 A;  2D8J A;  1VQL Q;  3BDU A;  5GAN 2;  2JT4 A;  3CC2 Q;  2DVJ A;  1YI2 T;  3REB B;  3L2R A;  1RUW A;  1Q7Y U;  3EGX B;  2ECZ A;  1RAF B;  3GF5 A;  2A3L A;  4IIO A;  4OGC A;  1VQ9 T;  2PZ1 A;  4F7U E;  4R56 A;  3NGP A;  5FWC A;  3VJP A;  4A4E A;  1YIT T;  4JRI A;  4LD9 K;  1IXD A;  3EH2 A;  2H3E B;  2HZY A;  2YXY A;  1Y7X A;  1TSF A;  5J39 A;  4EMG A;  4QVC A;  1B34 A;  1VIF A;  4PLL A;  2F69 A;  2RQR A;  1AWO A;  1UDL A;  2V26 A;  2E70 A;  2FVU A;  3M55 A;  1VQ5 Q;  1IHW A;  2FRY A;  1TWB A;  4QQ6 A;  1VIE A;  4ZN3 A;  3CCV Q;  1YJ9 Q;  1P92 A;  3MJX A;  2RHZ A;  5KYY A;  3PT9 A;  2CKK A;  3CCR Q;  2F2W A;  2A37 A;  2M1H A;  1K8A U;  5LJ5 e;  3A8G B;  2L3Q A;  2WAC A;  3MP1 A;  2BZX A;  1GCQ A;  1MGQ A;  1UHC A;  1ACM B;  5LJ3 j;  5KYW A;  3OW2 A;  2ATC B;  1YJ9 A;  2LJ0 A;  4FW1 A;  1E6G A;  2CP7 A;  3AT1 B;  1ZQ1 A;  4M78 A;  2HKN A;  2JM9 A;  1X6B A;  1ZLM A;  3A1P A;  5HCK A;  4FT2 A;  3OBY A;  4XU2 A;  3DKM A;  2DYB A;  2RMO A;  3CPW S;  1Q82 C;  4HCC A;  3KFV A;  2GFU A;  1Q86 C;  2NLU A;  5GAN f;  2CZ1 B;  2VC8 A;  2VXE A;  4ELZ C;  1TUC A;  2E4H A;  4Z8A A;  2CT4 A;  3QII A;  2HNI A;  2LQ8 A;  3QHS A;  2CP6 A;  3P8H A;  4AT1 B;  2GCX A;  2DAQ A;  3CC2 A;  2DL5 A;  3CCV T;  2FRW A;  3CXC P;  1VUB A;  1NYG A;  2OTL T;  5CKF A;  1VQP A;  2GNC A;  5FU6 C;  2BIV A;  2RM4 A;  1H64 1;  3HP9 A;  3OYI A;  1IHV A;  2RJF A;  3TU4 K;  3HRU A;  3GOX A;  5GAO q;  1N9S A;  1WHK A;  3DLL A;  1K4U S;  2X35 A;  2W0Z A;  3GLX A;  2K57 A;  3CC4 T;  4C92 C;  3GNG A;  3TVT A;  4J9B A;  1WIE A;  4PNO A;  2M16 A;  1UGP B;  3HRT A;  4C92 G;  2YUO A;  3PFS A;  1HD3 A;  1MMA A;  2BZY A;  3MP6 A;  5GAN 3;  3EGD B;  4E2F B;  1OPK A;  5GJW B;  2DNU A;  1VQN A;  4XTX A;  4PFZ A;  2HL5 C;  3SEM A;  4HVW A;  2X3X D;  3CMA Q;  1K8A C;  1TXQ A;  2BUD A;  1GXI E;  2E3I A;  5DLQ E;  4DEX A;  2C06 A;  1UGR B;  1VQM A;  2R58 A;  3G6E T;  2G6F X;  1Q82 U;  4C92 E;  1DJ7 B;  4BE0 A;  4J6W A;  3I56 Q;  2YDL A;  2Y90 A;  1GBQ A;  1AWX A;  3VS6 A;  3VUB A;  4LNP A;  1LNX A;  4M77 A;  3BDL A;  4C0F A;  4CI0 C;  1X43 A;  1QLY A;  4F7U B;  2LVM A;  4BY6 B;  1AWW A;  1E7O A;  3VRZ A;  1Y57 A;  3M0P A;  1M8M A;  4XQ3 A;  3CC7 Q;  4OB0 B;  2JW4 A;  5GAN j;  1UEB A;  4AFS C;  1CKB A;  2X4W A;  2B86 A;  3VYH B;  2K4Y A;  3NTH A;  4NS5 A;  5IN1 A;  3CCM T;  2YT6 A;  4BAC A;  4FYV B;  1A0N B;  3UAT A;  4X9C A;  3OBW A;  2KAF A;  3CCS T;  3CCE A;  1KIK A;  5DY9 A;  2CSQ A;  3MHX A;  3C94 A;  5CO7 A;  2O4X A;  4M77 D;  2E1H A;  4FYX B;  1JJ2 P;  4II1 A;  1NEB A;  4PL6 A;  1BI2 A;  2QTX A;  1AVZ C;  2DVE A;  3I56 A;  1Z9Z A;  1TU0 B;  3JCM f;  4WCI A;  1BI0 A;  2RHU A;  1SHF A;  2DYI A;  3CCU T;  2R5M A;  3TQ7 P;  2CH4 A;  1TUD A;  1T0J A;  2DK3 A;  5I11 A;  1NPP A;  2AKK A;  3EAE A;  3FEO A;  1GFD A;  3MO8 A;  9ATC B;  1ZSZ A;  3JCM g;  2SRC A;  1AEY A;  1VQN Q;  4AG2 C;  2NUP A;  4KUL A;  1YFN A;  1SRL A;  2KI7 A;  2LQW A;  4O5V A;  3RR6 A;  2J6F A;  2A08 A;  3M54 A;  1BB9 A;  2KT1 A;  4MZP A;  3ULR B;  4B9W A;  4RTU A;  2RJD A;  1OZ3 A;  2D0N A;  2GQV A;  4R55 A;  2DIG A;  1YWO A;  2QQ9 A;  5KYU A;  2JTE A;  1OV3 A;  4N0A A;  3M0S A;  4DOV A;  4C0D B;  3I35 A;  1K73 R;  1YIT A;  1MNE A;  3MEV A;  1JU5 C;  2RO0 A;  4DBQ A;  4D8K A;  2DD4 A;  2EJG A;  1WZO A;  4AFQ C;  1OX9 A;  3A98 A;  1Y71 A;  1UJY A;  2M0O A;  4JJN K;  2EAY A;  2RF0 A;  2RK1 A;  3CME Q;  3M53 A;  3LH0 A;  3MKD A;  2JUF A;  2JXB A;  3RIR A;  2EW3 A;  3PIP A;  3M56 A;  1EFN A;  4WTO B;  4FSS A;  2QG9 B;  5CK9 A;  4RTY A;  2V8I A;  4RTT A;  5FU7 C;  1B7T A;  1M3C A;  2CP2 A;  3TCJ A;  4EMH A;  2C0O A;  4QVD A;  4J7I A;  4M75 D;  1GFC A;  4DQ2 A;  4IUU A;  2COW A;  3M0Q A;  3GIB A;  2GTO A;  4M7D E;  1QVP A;  3L1A A;  1YJ9 T;  2OTJ T;  3HFN A;  1Q82 R;  2EYY A;  2J7I A;  1M9S A;  4M75 A;  3RDV A;  1B07 A;  3S3N A;  1FWZ A;  4IUR A;  2EKO A;  2VGN A;  2F5K A;  2COY A;  2JTF A;  3I55 Q;  2ROT A;  2YRC A;  1RLP C;  2OAW A;  1VOM A;  5LJ3 h;  3JB9 D;  4MML A;  2KE9 A;  1D3B B;  1G3S A;  1QVF S;  2PUO B;  4ESR A;  2LT4 A;  3L2Z A;  2HQH A;  3OS2 A;  2DEU A;  4M78 D;  1B3Q A;  2MWO A;  1C0M A;  3OSS C;  1Y96 B;  1Q81 R;  2A28 A;  3PGG A;  2WSE E;  4DBH A;  1ZUU A;  3CCV A;  3OYG A;  2E41 A;  3JCM c;  3CC7 A;  1G5V A;  2OTL A;  5GAN 6;  2QDL A;  2YUN A;  1VA7 A;  3CBO A;  3H8Z A;  4XTZ A;  3G1J A;  2EPD A;  3X25 B;  1ZHI A;  5FW9 A;  2JZ2 A;  1Z9Q A;  1M1K U;  2BTT A;  2JVV A;  3EHQ A;  3C12 A;  3WVE B;  2YLC A;  3MP8 A;  2ZCF B;  2PU9 B;  4AMC A;  1SKU B;  4FYW B;  2V8J A;  4M77 C;  2J06 A;  1YIJ A;  1SPK A;  1VQ8 A;  1OQK A;  3JB9 H;  2NYS A;  3SWN B;  1PWT A;  2MPX C;  4C8Q G;  3LLR A;  2L3R A;  3ME9 A;  2HKQ B;  5DLO A;  1PSF A;  3MPU B;  1LCK A;  2E5K A;  2A7Y A;  4ZTJ A;  4JS4 A;  4BE2 A;  1Q7Y C;  2NWM A;  3CMA T;  2MAM A;  4JZ4 A;  4NOY A;  1LVK A;  2DZC A;  3VS5 A;  2KRS A;  1WHM A;  1YCS B;  2LZ6 B;  3JB9 F;  4JZ3 A;  3GNF B;  2E5Q A;  1CKA A;  1N5Z A;  3OY9 A;  1I5O B;  2RQU A;  1U3O A;  2DRK A;  5EG2 A;  4PJO F;  4RG8 A;  3M4Y A;  1K0S A;  2DA9 A;  2H8H A;  4MZM A;  3OW2 P;  2RN8 A;  2XIC A;  1BIB A;  2EKH A;  2LNV A;  1OI1 A;  5CKD A;  4QQD A;  4GLM A;  4E7K A;  1NJI U;  1VQP T;  5GMK j;  5LJ3 f;  4BDY A;  5FRM A;  1ZBX A;  2CDT A;  1M3B A;  1VQO T;  5GAN 5;  2J6K A;  1TH7 A;  2YRD A;  5KE3 A;  5IH2 A;  2K6D A;  3MET A;  5GAN d;  1UGS B;  3OYJ A;  1QWF A;  1PCX A;  4C5H A;  3X24 B;  3CME A;  2M0Y A;  3NHN A;  1W6X A;  3I55 T;  2HQE A;  2COZ A;  1AHJ B;  2DTH A;  3A5Z B;  1VQ6 Q;  1VYU A;  4E7Z A;  1WX6 A;  2OTL Q;  2KRM A;  3OW2 S;  5CR2 A;  1K9M R;  3PTA A;  1WI7 A;  3RNJ A;  5KCO A;  1K8A R;  2LJ1 A;  3JCM Q;  4J9D A;  2JS0 A;  4JDS A;  2F1L A;  4FW2 A;  3G71 T;  1G3T A;  5J3B A;  3UT1 A;  1I81 A;  4HCK A;  3TEE A;  5FRO A;  1WPY A;  1JQQ A;  3HKS A;  2KQW A;  1YCY A;  2A0F B;  2M9U A;  1O9S A;  5KYY B;  2HD0 A;  1Y0M A;  5IXB A;  2O9S A;  3G6E A;  3X28 B;  1GCQ C;  3CXC S;  3E9G A;  4OB2 B;  4ME7 A;  2KDS A;  4C8Q B;  3OYE A;  1UJ0 A;  2HL3 A;  3ZBD A;  2GBQ A;  2CYZ B;  4N4I A;  2E3H A;  4M78 C;  5KYW B;  1VQ7 A;  3CCL A;  2DZ9 A;  2EQK A;  4M75 C;  5J26 A;  2L3S A;  1X01 A;  1BIA A;  2JMA A;  4OMM A;  3CPW A;  2E64 A;  4E7S A;  1Q86 R;  5GAN 4;  4A4H A;  5CVI A;  3M0R A;  1PKS A;  3OMC A;  3VV0 A;  4KRT A;  2C0I A;  5CKE A;  1Q95 G;  4N4G A;  2HSE B;  2HCK A;  3O5Z A;  3JSC A;  4HCZ A;  1OZ2 A;  3KUF A;  2O31 A;  2KYB A;  1T0H A;  4J9H A;  2JS2 A;  2YHT A;  4PK4 A;  2KRO A;  3D7S B;  1M90 C;  1GBR A;  4LDY A;  4CC7 A;  2CSI A;  3I56 T;  4PJN A;  3CCM Q;  2ABL A;  4M7D D;  2I2L A;  4HKE A;  3EFO A;  5LJ3 g;  2FB7 A;  3CCQ T;  2FG0 A;  2K3B A;  1M4Z A;  2K5L A;  2DL3 A;  1YBY A;  3L2V A;  4OML A;  2QEX Q;  1OU9 A;  1UB4 A;  2PVG B;  1QW1 A;  3MEW A;  4HT8 A;  2LCL A;  3J80 E;  2NUZ A;  4XTU A;  2JTM A;  4HA8 A;  4QT7 A;  5LJ5 h;  1KQS S;  1IRE B;  4FSX A;  4JRK A;  1QKX A;  2F2X A;  1OU8 A;  2HMA A;  2F2V A;  3QPH A;  2FHD A;  3QO3 A;  1VQ4 A;  1MHN A;  2MYS A;  2DJQ A;  4KGZ B;  4HT9 A;  3SB2 A;  1UFF A;  1PKT A;  2JMC A;  3O8V A;  2ZPI B;  4JPB W;  4JLI A;  5LJ5 j;  1N8R U;  4JUV A;  3OYN A;  2CP5 A;  1TS9 A;  2PQW A;  1PNJ A;  2FZK B;  1AOJ A;  2QEX A;  1RAD B;  2QQR A;  3I5S A;  4FCY A;  3U23 A;  1RAA B;  2J6O A;  3RER A;  2ZAE A;  4R0K A;  4PJO B;  2GQI A;  2QQS A;  2QI2 A;  4J7F A;  1SSH A;  3JB9 G;  4M77 B;  2FZC B;  4M7D G;  4IUV A;  4LN2 A;  4EMK A;  3QJY A;  3SWN C;  4YTL A;  5CIU A;  2RJC A;  3RUX A;  3C0C A;  1JXO A;  4E6R A;  4C5G A;  2DF6 A;  2DPP B;  4M7D C;  2LP5 A;  2L2P A;  4OMO A;  4FYY B;  4M7D F;  4OMP A;  1UGV A;  7AT1 B;  2EYQ A;  1MV3 A;  2D6F A;  4L5G A;  4MDX A;  3CCL T;  4ZN1 A; 
#chains in the Genus database with same CATH homology
 1NE8 A;  2QQ9 A;  4N0A A;  2XK0 A;  5GAN g;  4DOV A;  1VQ9 A;  2HAX A;  1KC8 C;  4C0D B;  4ATO A;  5M9O A;  2KSS A;  2LT1 A;  1Y07 A;  4LDW A;  1YIT A;  1Y96 A;  3OYH A;  2ZPE B;  4M7A E;  1WQW A;  3MEV A;  3JCM J;  3URG A;  2RO0 A;  2WSF E;  3E1S A;  1YJW T;  1S72 A;  5KE2 A;  1QVG S;  1SSF A;  1VQK T;  3M59 A;  2DD4 A;  4N0A C;  3JCM V;  1BI3 A;  3G4S A;  5LJ5 g;  2EJG A;  2LRQ A;  3SDZ A;  1BYM A;  5IAY A;  1VQ5 T;  3CCS A;  5GAO r;  1Y71 A;  5I2S A;  1KC8 U;  1JRI A;  5CQX A;  4JLG A;  3CCE T;  2XU8 A;  5A2Q E;  5LJ3 d;  2M0O A;  4JJN K;  4BDZ A;  3M58 A;  2EAY A;  3DB3 A;  3CD6 A;  2RK1 A;  2DO3 A;  2PUK B;  4OP0 A;  3JAM E;  4BY6 C;  3M53 A;  3BY7 A;  2RI2 A;  3LH0 A;  2GF7 A;  5GMK e;  3OYF A;  4M75 E;  2JUF A;  5GAO p;  1M8V A;  4C92 D;  4BUG A;  4M7A F;  4BI4 A;  4BI3 A;  3RIR A;  4E7I A;  1LOJ A;  3PIP A;  3M56 A;  5I21 A;  2KK4 A;  2VGM A;  4RCC A;  5C6S A;  4JRP A;  1VQ6 A;  5CK9 A;  2LX9 A;  3RKX A;  1YHQ T;  2QXF A;  4M7A G;  2F5T X;  2V8I A;  2E12 A;  2CGH A;  5FU7 C;  4EMH A;  3TCJ A;  4QVD A;  3V8J A;  2XDB A;  3QJ6 A;  2X4J A;  1JJ2 S;  2L5Q A;  2RB6 A;  4J7I A;  4M75 D;  4E7L A;  4DQ2 A;  3OB9 A;  1VQN T;  4ELY C;  2EIF A;  2MWP A;  2LDM A;  1HXD A;  2E6Z A;  4IUU A;  2FL7 A;  3GIB A;  3OQ5 A;  4PJO A;  3HRS A;  3LWI A;  4XTW A;  2IG0 A;  2V8K A;  1QVP A;  4C92 F;  1W2B A;  2L89 A;  3CPF A;  3CCQ A;  2DXU A;  4JS5 A;  1QVF A;  3L1A A;  1YJ9 T;  4M7A D;  5GAM d;  2OTJ T;  3HFN A;  2HQX A;  4OMF B;  2CZ6 B;  2X4Y A;  3MEA A;  3OYK A;  4E47 A;  1M9S A;  4XTY A;  1VQ6 T;  4M75 A;  1XQH A;  4EMK B;  1FWZ A;  3S3N A;  4V2S A;  4IUR A;  2EKO A;  2VGN A;  3M9Q A;  2F5K A;  5HY6 A;  1VQL T;  4M77 F;  3LX7 A;  4M75 F;  2JTF A;  2ZZD A;  5LJ3 e;  2BKD N;  1KQ2 A;  2RI5 A;  3FJP A;  2LC4 A;  1K9M C;  5GAM g;  5LJ3 h;  5HK0 A;  4C0D C;  2Y4Y A;  4C92 A;  3G7Z A;  3JB9 D;  4MML A;  1D3B B;  1G3S A;  1B34 B;  1QVF S;  2R57 A;  3C4S A;  5FLX E;  2PUO B;  3VU3 C;  2XD0 A;  2LT4 A;  3VYG A;  1WJS A;  3L2Z A;  4Z02 A;  1YIJ T;  4RMO A;  1W4S A;  4XU3 A;  4O6J A;  3OS2 A;  3JCM h;  2DEQ A;  2MI6 A;  3L2W A;  4KT0 E;  4M78 D;  4M7D E;  2GFA A;  2O01 E;  3OMG A;  4DOW A;  3M4G A;  2MWO A;  3OYB A;  1NJI C;  2QA4 T;  3OSS C;  1Y96 B;  2DD5 A;  2K5F A;  4L59 A;  1BKB A;  4PKC C;  5CKH A;  3PGG A;  2WSE E;  1WGS A;  4OB1 B;  1W2B S;  3FLG A;  3LW5 E;  4M7A B;  1G3Y A;  5GAN h;  3CCV A;  3OYG A;  1M1K C;  3P8B B;  4BI8 B;  2LTO A;  2E41 A;  3JCM c;  4C5I A;  1S72 T;  4NL3 A;  3CC7 A;  1G5V A;  5GAN e;  2OTL A;  3OYY A;  4RKU E;  5GAN 6;  3PMI A;  3E19 A;  5GMK h;  3A8L B;  3CBO A;  3H8Z A;  2ZPB B;  4XTZ A;  3A8H B;  4LDU A;  4N4H A;  3CCM A;  4DA4 A;  3X25 B;  3QYG B;  3SD4 A;  1WJR A;  1ZHI A;  2JZ2 A;  4Y91 A;  4M77 G;  3OYD A;  2E65 A;  1M1K U;  3PNW C;  2R5A A;  4PJO C;  1VQL A;  2RHX A;  1XOV A;  2JVV A;  2QQA A;  1KHI A;  4M77 E;  3OYL A;  4C5E A;  3JRZ A;  1NZ9 A;  3C12 A;  1U1S A;  5DM7 R;  4ZTF A;  3WVE B;  4B9X A;  2JNG A;  2YLC A;  4KBM B;  5A0L A;  3MP8 A;  1XNI A;  4C0G A;  2ZCF B;  4M78 B;  2PU9 B;  3F70 A;  4BB7 A;  5A0G A;  3VUZ A;  3CCR A;  2V8J A;  5GMK i;  2FYK A;  3PMT A;  4C8Q E;  3QG1 A;  4M77 C;  4A4K A;  5KH6 A;  3HFO A;  3S3O A;  3BDU A;  5GAN 2;  1YIJ A;  3I55 A;  3RMS A;  1VQ8 A;  3EFR A;  3JB9 H;  1RL2 A;  4MDW A;  3SWN B;  2RJE A;  1KD1 U;  1QVG A;  4C8Q G;  3FDR A;  3LLR A;  1YI2 T;  2L3R A;  2RI3 A;  3BFM A;  3V8L A;  3L2R A;  4GLK A;  2P4T A;  3ME9 A;  1Q7Y U;  4J83 A;  2K3X A;  3VKI A;  5DLO A;  2IVW A;  1PSF A;  1HK9 A;  1M1G A;  2DTO A;  2A3L A;  3GF5 A;  2A7Y A;  4ZTJ A;  4JS4 A;  4BE2 A;  3G4S T;  1Q7Y C;  2XI9 A;  3FB9 A;  3WXM B;  4OGC A;  2AHJ B;  1VQ9 T;  1U1T A;  4QW2 A;  4F7U E;  3CMA T;  2MAM A;  2XID A;  5GAO n;  3CC2 T;  2RHY A;  4R56 A;  3VJP A;  4A4E A;  4EMK C;  1YIT T;  2CZ0 B;  4JRI A;  4LD9 K;  1KQS A;  4NOY A;  2K2V A;  4XTV A;  2EJ9 A;  1Y7X A;  4A4G A;  2VXF A;  2DZC A;  4OF1 A;  1VQO A;  1D3B A;  5J39 A;  4EMG A;  4QVC A;  1B34 A;  1VIF A;  2MF2 A;  4PLL A;  3JB9 F;  2DIQ A;  2F69 A;  3GNF B;  2E5Q A;  3M55 A;  3OY9 A;  2E70 A;  2FVU A;  3NFC A;  4J5Y A;  4BE1 A;  5GAM f;  5D6W A;  1RI0 A;  3CME T;  3QYH B;  4QQ6 A;  1VIE A;  4ZN3 A;  5CAI A;  3CCJ T;  4ZGE B;  5EG2 A;  1P92 A;  1WNL A;  2RHZ A;  4PJO F;  4A54 A;  4C8Q D;  4RG8 A;  3JCM e;  4M7A A;  3M4Y A;  1X75 C;  3PT9 A;  3OS1 A;  2CZ7 B;  2CKK A;  4ZGD B;  2M1H A;  4MZM A;  1K8A U;  3ASK A;  5D6X A;  3QKJ A;  5LJ5 e;  4LD6 A;  3A8G B;  1YI2 A;  2XIC A;  3OA6 A;  2WAC A;  1BIB A;  3MP1 A;  4QQG A;  2LNV A;  3H6Z A;  2D0Q B;  3CC7 T;  1MGQ A;  1OI1 A;  3P8D A;  5LJ3 j;  2HBP A;  5CKD A;  4QQD A;  3OW2 A;  3L42 A;  2QDY B;  3ZEH A;  1VQK A;  4MMK A;  3SFM A;  3QSU A;  3J81 E;  4E7K A;  1YJ9 A;  4XU1 A;  1VQP T;  5GMK j;  1NJI U;  3QDR B;  4J6Y A;  5LJ3 f;  2OAU A;  2QEX T;  1ZBX A;  4KUI A;  4BDY A;  5FRM A;  2VV5 A;  3ZFJ A;  1ZQ1 A;  1VQO T;  1NPR A;  4M78 A;  5GAN 5;  4P5N A;  5GAO m;  1Q86 U;  4WF2 A;  3CD6 T;  3QBY A;  2XHC A;  1TH7 A;  4FT2 A;  1FX7 A;  4CRI A;  3OBY A;  5KE3 A;  3C95 A;  1N27 A;  4XU2 A;  2ZPG B;  3DKM A;  3MET A;  2RA2 A;  5GAN d;  1UGS B;  3OYM A;  3OYJ A;  1M90 U;  3V8K A;  2D9T A;  3EFS A;  3SWN A;  4C5H A;  2ZPH B;  3X24 B;  3CME A;  1QP2 A;  3I55 T;  3CPW S;  4FU6 A;  1Q82 C;  1VQ8 T;  2HQE A;  4X9D A;  4HCC A;  4M7A C;  4RCB A;  3LWH A;  4PJO G;  2GFU A;  1Q86 C;  1AHJ B;  2DTH A;  2CZ1 B;  2NLU A;  2VC8 A;  2VXE A;  4ELZ C;  5GAN f;  3A5Z B;  4M78 G;  2RK2 A;  3Q1J A;  5LJ5 f;  3QII A;  3HSB A;  2QQB A;  2DKG A;  2HNI A;  2LQ8 A;  5LJ5 d;  5HK3 A;  3QHS A;  4M78 E;  3OW2 S;  5CR2 A;  3J7A F;  3PTA A;  2QA4 A;  1QP3 A;  3QXE B;  5KCO A;  1I8F A;  3P8H A;  2GCX A;  3CBM A;  3JCM Q;  2DAQ A;  3CC2 A;  2EJF A;  3A8O B;  3CCV T;  1YJN A;  4JDS A;  4QVZ A;  5FU6 B;  3G71 T;  1G3T A;  5J3B A;  4J8O A;  3UT1 A;  1I81 A;  1VUB A;  2OTL T;  1I5L A;  1O75 A;  3AHU A;  4FIB A;  2P0P A;  3LGF A;  5CKF A;  3TEE A;  4IUT A;  1VQP A;  5FRO A;  3KBG A;  4JRQ A;  1WPY A;  3LGL A;  5FU6 C;  3RKY A;  1M5Q 1;  2BIV A;  3HKS A;  2RM4 A;  1EIF A;  1H64 1;  2KQW A;  3HP9 A;  1YCY A;  3JCM P;  3OYI A;  1KQ1 A;  4PJO E;  2M9U A;  2RH2 A;  1KD1 C;  1N8R C;  2DTI A;  1VQM T;  1O9S A;  2RJF A;  4EPC A;  2HD0 A;  3TU4 K;  3HRU A;  3GOX A;  3HPW A;  5GAO q;  3MCA B;  3G6E A;  1N9S A;  3X28 B;  4C8Q F;  3DLL A;  2H3J A;  3FC3 A;  2MMP A;  3INZ A;  4M75 G;  3CXC S;  2X35 A;  3E9G A;  4OB2 B;  5HKC A;  2EQM A;  4M7D B;  4ME7 A;  2KDS A;  3FIF A;  2K57 A;  3BW1 A;  3GLX A;  3UWN A;  4C8Q B;  2DJZ A;  4C92 C;  3OYE A;  3CC4 T;  1BI1 A;  1K9M U;  3NTK A;  3GNG A;  2E6N A;  3ZBD A;  4BD3 A;  4MZT A;  2CYZ B;  4N4I A;  4M78 C;  3GP8 A;  2DXC A;  4PNO A;  2M16 A;  1VQ7 A;  1UGP B;  3HRT A;  4VUB A;  4FT4 A;  4M78 F;  4C92 G;  3CCL A;  2DZ9 A;  3PFS A;  3QZ9 B;  2O4X B;  1K73 U;  2EQK A;  2P0Q A;  4M75 C;  5J26 A;  1KG1 A;  3MP6 A;  5GAN 3;  2EQU A;  2PVD B;  1X01 A;  1BIA A;  3JCM d;  1K73 C;  2DXT A;  3CPW A;  1VQN A;  2E64 A;  4PLI A;  5GMK m;  4XTX A;  3GPL A;  3G71 A;  3OYC A;  4XK8 E;  3L2U A;  3OYA A;  5IT9 E;  3QUI A;  5AYF A;  1K8A C;  5GAN 4;  1JBM A;  4A4H A;  5GAM h;  5CVI A;  2BUD A;  1GXI E;  3OMC A;  1Q81 C;  4R55 A;  4UC4 A;  5DLQ E;  3RES A;  3VV0 A;  4PJO D;  3CCU A;  4Y28 E;  2C06 A;  5CKE A;  2RD1 A;  1UGR B;  1VQM A;  2EWN A;  4N4G A;  3V7R A;  1H3Z A;  5I2M A;  4OGE A;  2R58 A;  4Q5W A;  3G6E T;  3MEU A;  3DB4 A;  4LDV A;  5KCH A;  1Q82 U;  5GAN 7;  3JSC A;  4HCZ A;  3X20 B;  5LL6 S;  1DJ7 B;  3DLM A;  4C92 E;  4J6W A;  1OZ2 A;  4BE0 A;  3KUF A;  3M5A A;  2Y90 A;  2X4X A;  3CCJ A;  2LCC A;  3VUB A;  4E7J A;  1JB0 E;  1LNX A;  2G3R A;  4M77 A;  4NL2 A;  3L2Q A;  2YHT A;  2B8A A;  1YHQ A;  4FL6 A;  5FU7 B;  3BDL A;  3OS5 A;  3N5B B;  5CKB A;  4C0F A;  4CI0 C;  1M90 C;  2E10 A;  2KY9 A;  4LDY A;  4F7U B;  3I56 T;  2LVM A;  4OVA A;  4IKF A;  4BY6 B;  1N6A A;  4M7D D;  2I2L A;  4HKE A;  3FRN A;  5LJ3 g;  3CMA A;  2CS7 A;  2FB7 A;  3ER0 A;  3CCQ T;  3UDC A;  1M4Z A;  2K5L A;  4X34 A;  4F7U F;  4XQ3 A;  4OB0 B;  5GAN j;  2JN0 A;  2PVO B;  1UEB A;  4A53 A;  1YBY A;  2LQK A;  5D6Y A;  2YRV A;  2X4W A;  5CQY A;  3L2V A;  3VYH B;  2K4Y A;  3CBP A;  3NTH A;  1PSE A;  4NS5 A;  4M7D A;  4FM4 B;  1UB4 A;  5IN1 A;  5A0D A;  3CCM T;  2PVG B;  2ZGW A;  4BAC A;  4C8Q A;  1QW1 A;  3MEW A;  4RG2 A;  3X26 B;  4A4F A;  4EDU A;  4X9C A;  3OBW A;  3OS0 A;  4HT8 A;  1UGQ B;  2LCL A;  4TVR A;  4ZGJ B;  2XG8 D;  2KAF A;  3J80 E;  4XTU A;  2JTM A;  4HA8 A;  5LJ5 h;  1KQS S;  1IRE B;  3CCS T;  1WJQ A;  3CC4 A;  4IUP A;  2JOY A;  3R6O A;  3T9N A;  3CCE A;  1V29 B;  4FSX A;  2VUB A;  1IZ6 A;  2RHI A;  4JRK A;  5DY9 A;  3OSV A;  2XKO C;  3HL8 A;  3MHX A;  3C94 A;  1LJO A;  3UPU A;  5CO7 A;  2K3Y A;  2O4X A;  3QPH A;  2FHD A;  4M77 D;  1VQ7 T;  3M57 A;  4XU0 A;  2P0K A;  3QO3 A;  2E1H A;  1VQ4 A;  1MHN A;  1WQ7 A;  5GAM e;  5GAO l;  1FXX A;  3KXT A;  4II1 A;  4HT9 A;  3SB2 A;  3QZ5 B;  3CXC A;  2DXB A;  3JB9 J;  1U8R A;  1N9R A;  1KHC A;  3O8V A;  4PL6 A;  2YLB A;  1BI2 A;  2QTX A;  2ZPI B;  4JLI A;  5LJ5 j;  2DVE A;  5GAN 8;  3I56 A;  1N8R U;  4LDX A;  4JUV A;  3OYN A;  3CEY A;  2VYT A;  2PQW A;  1JJ2 A;  3JCM f;  5L8R E;  5CCA A;  2WSC E;  3WVD B;  2K5I A;  1R8O B;  3JCM b;  1YJN T;  1M1F A;  1BI0 A;  2RHU A;  2EFI A;  4J6X A;  4OB3 B;  5C0M A;  3E9F A;  2L8D A;  3TRE A;  2QEX A;  5FRN A;  2QQR A;  4XAX B;  1YJW A;  1G3W A;  3NTI A;  3CCU T;  3RER A;  2R5M A;  3RMQ A;  4L6V 5;  2DK3 A;  2ZPF B;  3RKW A;  4PJO B;  5GMK l;  1VQ5 A;  3PIO A;  3JB9 I;  2EQJ A;  2Y4X A;  2KVQ G;  2QQS A;  2QI2 A;  4IUQ A;  4J7F A;  1NPP A;  3FEO A;  3EAE A;  5GAM j;  3JB9 G;  3MO8 A;  2XDP A;  4HCB A;  3JCM g;  3V7S A;  1X6O A;  4D6W A;  4M77 B;  4M75 B;  3S6W A;  4M7D G;  4IUV A;  4KUL A;  3LYI A;  4EMK A;  3QJY A;  1XTD A;  3SWN C;  3CCR T;  4O5V A;  4YTL A;  2KMT A;  5CIU A;  2RJC A;  1Q81 U;  3RUX A;  4C8Q C;  3A8M B;  4F7U A;  4C0Z A;  4C5G A;  2OTJ A;  2XDD A;  2DPP B;  3JCM X;  1VQ4 T;  3M54 A;  4M7D C;  1OYX A;  3S3M A;  4GY5 A;  3JCM W;  4M7D F;  3HHT B;  4KUD K;  4C92 B;  4E7H A;  4MZP A;  2EYQ A;  4B9W A;  2D6F A;  4F7U G;  4L5G A;  4MDX A;  2RJD A;  3CCL T;  3V7C A;  4ZN1 A;  1OZ3 A;  2GQV A;  2DIG A;  1I4K 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...