5GAOm

Head region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
94
structure length
94
Chain Sequence
b'RAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein-associated protein B
molecule tags Transcription
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
total genus 11
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
m PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gaom00
2E10A 1M5Q1 3RUXA 4M75D 2CGHA 3V8KA 5LJ5e 4PNOA 3JCMe 5GAMd 4M7DA 2HNIA 4RCCA 4PJOG 4PJOA 2FB7A 1WQWA 1N9RA 4C92C 4Y91A 3JB9G 4PJOD 4F7UG 1LJOA 2K57A 4M78B 1WNLA 4M78E 4JRKA 4QVDA 5CAIA 4M7DB 2YLBA 2DZ9A 3SB2A 4M78F 3JCMV 4M7AG 2RD1A 2E41A 4M77E 5LJ3e 3RKWA 3QSUA 5GMKl 3JCMX 2DVEA 3SWNC 1WQ7A 4J6WA 4MMKA 4M77D 5GAN4 4M78C 4XU1A 3RERA 4M7AB 5GMKh 4EMGA 5GANf 3JB9D 3QUIA 4M77G 4PJOE 1JBMA 4PJOC 4C8QB 2DTOA 2VC8A 3JCMf 5LJ3g 3FJPA 3JCMb 4M77F 4C8QA 1KQ2A 4PJOF 5GMKi 3SWNB 5LJ3f 4XTVA 4M75B 4MMLA 5LJ5d 4A54A 1U1TA 2DZCA 3EFRA 1BIAA 1LNXA 4F7UE 4M75A 3EFSA 4A53A 4EMKB 4M75E 4X9CA 4NOYA 3RIRA 4NL3A 1M8VA 1KQ1A 5GAOr 3QO3A 1HK9A 4XTUA 4J6YA 3V8LA 3JB9I 3AHUA 4XQ3A 5GAN2 3JCMQ 4XU3A 4C92A 4M75G 2EJGA 2DTIA 4N0AC 4C92B 4M78G 3JCMg 5GMKm 4M7DE 4M78A 3V8JA 5GANh 2RB6A 2EJ9A 2DJZA 4M7DG 2EAYA 2YHTA 4F7UF 4EMKC 5GAMf 5GMKe 4M7DC 2E65A 4HT8A 5LJ3j 4HT9A 5GANg 2E1HA 5GAN6 3BY7A 4J6XA 4M7AA 1LOJA 3HFOA 2VXEA 5GANj 3JCMW 3INZA 5LJ3d 3HSBA 4JRIA 2RA2A 4HA8A 1B34A 1HXDA 3HFNA 3RKXA 2DXUA 1I81A 3BW1A 4M7AD 5GAN5 4C92F 5GMKj 5LJ5j 4XTXA 1MGQA 2FYKA 4M7AC 4XTZA 4C8QD 1Y96A 3FIFA 4JUVA 3L2ZA 3PGGA 3V7SA 4C92E 4EMKA 4M7AF 3V7CA 3GIBA 4C8QC 1JRIA 3L1AA 4XU0A 5LJ5f 5GAOl 1N9SA 3V7RA 1I8FA 2DEQA 4N0AA 5GAMh 1U1SA 4JLIA 1D3BA 5GAMe 2RM4A 3RKYA 3JCMd 4F7UA 2EWNA 3JCMJ 5GAOm 4C92D 4RCBA 4F7UB 1Y96B 2QTXA 5GAMg 1TH7A 3JCMc 4C8QF 2DXTA 1WPYA 5I21A 5GAMj 2JN0A 5GANd 4M77C 5DY9A 5GAN7 3BFMA 4J5YA 4C92G 3JB9F 3JB9H 4V2SA 3BDUA 1YCYA 4XU2A 3FB9A 2DKGA 5LJ5g 2E64A 3RESA 1H641 3JCMP 2I2LA 2YLCA 5LJ3h 4DQ2A 2DTHA 2ZGWA 3M4GA 5GAOp 2EJFA 4QVCA 1X01A 4M78D 4EMHA 5LJ5h 3JCMh 4WF2A 4XTYA 4M75F 4M77A 2Y90A 4C8QE 4X9DA 4M7DF 4M7DD 4PJOB 4OP0A 1I4K1 4M77B 3JB9J 5GANe 4C8QG 1B34B 2VXFA 3QHSA 4NL2A 5GAN8 5GAN3 5GAOn 3SWNA 4XTWA 1I5LA 4M7AE 4M75C 5GAOq 3VU3C 1BIBA 1D3BB
chains in the Genus database with same CATH superfamily
4OVAA 1D1AA 1V29B 3SD4A 1MNDA 1KHIA 4KUIA 2HNIA 5FU6B 1O9SA 4PJOA 2FZCB 5KYXA 2EQMA 1MNEA 1NJIU 4M78B 2F69A 3X24B 4JRKA 3LWIA 2KT8A 2RMOA 3JCMV 3L2WA 2KVQG 3MEVA 5FWCA 1XNIA 4C5GA 2KMTA 1YJWQ 3QXEB 3A8LB 1Q81U 4M7AB 2ZPHB 2X4YA 1Y71A 6AT1B 1S72Q 1YIJA 2DF6A 1KK7A 4A54A 4QVZA 1SPKA 1K1ZA 2SEMA 3CCJT 1KQ1A 2JOYA 1JB0E 3CQTA 4XQ3A 2M1HA 4RTYA 3I9QA 4M78G 4L59A 1Y0MA 1D0ZA 4F7UF 1PKTA 1K9MC 4HT9A 5GANg 1YITA 3E9FA 3BE3A 2K9GA 5IH2A 4HA8A 1B34A 1HXDA 2LQ8A 1YHQA 2ZPEB 3BW1A 8ATCB 4C92F 4ZN1A 1K0XA 3WVEB 2O9SA 3V7SA 2M0YA 4QQDA 3CC2A 2DEUA 1N9SA 4KULA 1JXOA 2QA4Q 5GAMg 1EIFA 3CC4A 2VGNA 1TS9A 2JN0A 2NUTA 3CBPA 3MPUB 3JAME 1Z9ZA 1UFFA 1T3SA 1QWEA 2X3WD 4RTTA 5I2SA 2ZGWA 5HK0A 2K3YA 3MJXA 4HKEA 3CMAA 2NUZA 4LDVA 2CUBA 5CK9A 3SHWA 2R57A 1OI1A 2C0IA 1RAFB 1VQ9T 3EG9B 2LJ0A 2LJ1A 2P0QA 5LJ5e 2CZ0B 3DB4A 3OY9A 1VQPT 1ZSZB 3BDLA 1QCOA 4O6JA 2CP6A 1VQNA 2EIFA 1QVPA 1YJ9A 3VKIA 2EGCA 4PLIA 1VQ8A 2DL8A 4R0KA 5HY6A 4PJJA 2XHCA 3G71A 2AHJB 2FPDA 2GTJA 3CCQQ 1JEGA 2PVGB 3CC7T 2DIGA 2HBPA 3EGXA 3G71Q 1UJYA 1UB4A 2ZZDA 3KUFA 1Q7YR 2M02A 3CBMA 1ABOA 1QMCA 4EIKA 5GAN2 1YP5A 1JO8A 1WZOA 3MHXA 3OYBA 3QZ5B 5CO7A 2A7YA 1RUWA 4ZN3A 1VQ5Q 3ME9A 1RL2A 1VQKQ 1LPLA 1MHNA 3RBBB 2O88A 4DEYA 1QCNA 3CMAQ 5CVIA 4AFUC 3QJ6A 4RKUE 4N4IA 4C8QC 4KGXB 3JSCA 1D0XA 3D7SB 3V7RA 5J39A 2LQKA 4E7KA 1D3BA 4ZTJA 2GQVA 3H0IA 3EHRA 3JCMd 4AG1C 3PE0A 2QASA 1YJNQ 2DX1A 3CCMQ 2CREA 4ZTFA 2EGEA 3EFOA 4RTVA 1J3TA 1WI7A 2YLCA 5LJ3h 2F5TX 1R8OB 4BI8B 2EGAA 2KE9A 3M57A 2L2PA 3CPWS 1BI2A 5GAN3 4FYYB 3RNJA 3VS6A 4LXCA 1N6AA 1KFZA 2CGHA 3QJYA 4C0DC 2JMAA 3UWNA 2OTLQ 5AT1B 2C0TA 1X27A 2O4XA 3VS5A 2KYBA 5HCKA 4F04B 3OA6A 2NWMA 2QQAA 4F7UG 4M78F 2MI6A 1IHVA 1YFNA 2LT4A 3H0HA 2X9HA 2RHZA 1G83A 4MMKA 1BU1A 2GFUA 2YT6A 3OYNA 4F14A 2JNGA 2RQRA 1M2VA 2KDSA 5GANf 3FJPA 4JLGA 2DK3A 1K8AU 3OMCA 3OW2A 2GFAA 2XG8D 3VS2A 1KD1C 2CH4A 3OYHA 1X2KA 2FRYA 5CQXA 4C92A 1VQ8T 1DJ7B 2EJGA 3EG0A 3OS2A 1ABQA 4M78A 4DBHA 2DD5A 1EZZB 4O5VA 2CDTA 1EX4A 5LJ3j 2LJ3A 3HL8A 4JS4A 3OYAA 5KYUA 3RDVA 3JCMW 2FRWA 1K9MR 3RKXA 4QW2A 3CCEA 3UATA 2FYKA 4FSXA 3REBB 1JRIA 1H3ZA 3I35A 2B86A 3A8GB 2AKKA 1K9AA 2JW4A 3GOXA 2GF7A 3M4YA 1ARKA 4C8QF 1VQ6T 4C0GA 2RF0A 2DXTA 1SSHA 5CKHA 3NGPA 1OEBA 1RI0A 1WA7A 1M90C 2CS7A 2O9VA 2LZ6B 1JQQA 2DM1A 1M1KR 3M9QA 2L5QA 2DRMA 4DBFA 3QZ9B 4BY6C 4J9IA 4WF2A 4B9WA 1PM3A 2BZYA 4OB3B 4OP0A 2K6DA 2QAZA 2RI3A 2XDPA 2PQWA 1W2BP 1VIEA 2WACA 4DEXA 2YUPA 1ZLMA 1VQKT 1R0BG 1O75A 1VQ5T 1WJSA 2FB7A 5KYYB 2ZAEA 2YRCA 2EYYA 4FYWB 2DLPA 2X35A 4KBMB 3RMSA 3I55A 3QSUA 1A0NB 2XDBA 4RG8A 4XU1A 2JUFA 1RADB 4J7IA 1X6GA 2RQTA 5LJ3g 4KH0B 1ZBXA 3G4ST 2HQHA 1VYTA 1VQLQ 4ATOA 3MEAA 1M90U 3Q1JA 1HD3A 3EGDA 2HL3A 3DKMA 2SRCA 4Z02A 1F1BB 2KAFA 2FZGB 1R0CB 3FDRA 2EJ9A 3CCLA 5A0DA 4M7AA 2MCNA 1YNZA 1NG2A 5CR2A 2DXUA 1WX6A 4JUVA 2J05A 3L42A 1I8FA 3E19A 3OMGA 1B7TA 2EPDA 1ZQ1A 4JPBW 2DFUA 1XQHA 4GLKA 3UA7A 1ZUKA 1WPYA 3EH2A 1Q82R 3G6EQ 3MEWA 3JB9F 1BBZA 3FB9A 2DKGA 5KE2A 2YUOA 2CKKA 1FXXA 1ZBJA 1AEYA 3CCET 1PCXA 3THKA 2EQJA 1MV3A 3PVQA 4M77A 2DD4A 3N5BB 1MMAA 3P8DA 4M7AE 2CP2A 1VQMT 1YJ9Q 2XKOC 2V1QA 1I0CA 4IUUA 3CCUQ 1VQ6A 1KJWA 3URGA 2MWOA 4MZPA 3PMIA 5C0MA 1VQLA 5HKCA 1WNLA 2QXFA 4K11A 2ROLA 4M78E 3C4SA 2CUDA 2O2OA 3JCMX 1WHJA 2CSIA 3HKSA 2L89A 4IURA 4HVUA 4YTLA 2RHYA 1YITT 1WIEA 2HBWA 2J6FA 2FPEA 4DA4A 1VQ5A 2DL3A 2R5AA 3HRSA 2F2WA 2D0QB 2KXDA 3L2UA 4AMCA 1Q86R 1YCSB 5GAOr 3M0UA 5IHIA 1M4ZA 2NYSA 2KR3A 4N0AC 1TTHB 2RHIA 4RTZA 1BB9A 3CCQA 4F16A 5GAMf 4J9GA 2HSEB 5GAN6 3BY7A 1X6BA 5LJ3d 2D6FA 1D0YA 2QQSA 2WSCE 1AWXA 5KE3A 3G4SA 2QYZA 4FT4A 1MGQA 3R6OA 1BI3A 3PGGA 2E3IA 3CCJA 3CCSQ 4Q5WA 5LJ5f 2AZVA 1Q7YC 1VYUA 2IG0A 4FL6A 2KXCA 2HEQA 1I1JA 1H8KA 3GF5A 2MYSA 3BDUA 3CCST 4XU2A 1YWOA 5FRMA 2DPPB 1KIKA 3OS1A 2EJFA 4QVCA 5HK3A 4M75F 5FRNA 1UGRB 4PJOB 1I4K1 3LYIA 3NMZC 5GAOn 2ZCFB 2GNCA 1WHGA 1NE8A 4GBQA 4M75C 4FYXB 4M75D 2FEIA 4PNOA 2NUPA 2A08A 2LTOA 3VS3A 2DXBA 4CI0C 3EAEA 2VVKA 3PFSA 3H41A 4A4KA 1M27C 2PU9B 3JB9G 4L5GA 1NJIC 5CAIA 1VUBA 2JT4A 3LH0A 2X3XD 1TWBA 2R5MA 3OYFA 3CC2Q 1Q82C 4J6WA 1QP2A 1TOVA 2DVJA 4M77D 3UT1A 4IUTA 4A4FA 3DLLA 3O5ZA 2EQKA 2E70A 4M77F 2EBPA 4EDUA 3QPHA 4MMLA 1U1TA 1IZ6A 1AZEA 4LE9A 3LWHA 4E2FB 2ZPIB 2PZ1A 3V8LA 1KQSP 1QLYA 2MOXA 3O8VA 2CP0A 1PSFA 3G1JA 3KXTA 2LNHB 4M7DE 2DAQA 2E3HA 4R56A 4Z89A 4ANJA 1OX8A 2DL7A 1NLPC 2X51A 4M7AD 2H3EB 1G3SA 3CPFA 4M7AC 1G2BA 2EW3A 3VRYA 2XK0A 4C92E 2MAMA 3SDZA 2NUTB 1UDLA 1UEBA 2D0NA 3MCAB 4F7UB 3MP6A 3QIIA 3JCMc 4OB2B 3CD6A 4PJNA 5GAMj 1PD1A 4J5YA 4V2SA 5LJ5g 1H641 2J06A 5KYNA 2YSQA 1XOVA 3M4GA 4C0DB 4JRPA 1UJ0A 3S3MA 1B34B 3QHSA 1BYMA 4OB1B 2LNVA 1D3BB 4M7AF 2GBQA 4FSSA 3REAB 2XDDA 2K5LA 1M3CA 2LCCA 3S3OA 1OPLA 3NHNA 4C92C 1VYVA 5M9OA 2DE0X 2RNAA 2DMOA 4JS5A 5FLXE 1UTIA 4NS5A 2F2VA 3X20B 3G4SQ 3TREA 4A4EA 4LD9K 2RJFA 3H9NA 3DLMA 3CBOA 2COWA 2ENMA 4J8OA 3J81E 4XK8E 2KBTA 1AZGB 4RMOA 2FL7A 2MK5A 1AD5A 2LT1A 2L8DA 4DOVA 5LJ3f 3EFRA 1YJNA 4FCYA 4P5NA 4DOWA 4NOYA 3L2RA 4ELZC 1PHTA 2D9TA 3QO3A 2FG0A 4FIBA 5GJWB 3ER0A 2BTTA 2JZ2A 4M75G 4PKCC 5CQYA 2ZPFB 2DO3A 3M0TA 2HSPA 2EAYA 3QDRB 2V8KA 3FLGA 2COZA 4Y28E 4JRIA 3CCRA 1WXUA 4N4GA 2P4RA 2X4WA 5LJ5j 4XTXA 4RG2A 4D6WA 4JDSA 3V7CA 5L23A 1HSQA 2JTFA 5GAOl 1WGSA 3QG1A 1KQSS 3S3NA 3GP8A 2QQ9A 3JCMJ 4J9FA 5DLQE 4BY6B 2EYQA 4CC2A 3G6EA 2DBMA 1NEBA 2RQWA 4MDWA 3OYMA 3G7ZA 4D8KA 4DQ2A 2VV5A 1WHMA 4II1A 3HTRA 4M77B 1M9SA 1QP3A 1OV3A 1M5Q1 3RUXA 2JS2A 1WXBA 2K7AA 5A0LA 3C12A 1UGVA 1QCFA 3A8MB 1UGQB 2O01E 4ESRA 3SB2A 4KH1B 1VQNQ 1BCMA 2K2MA 3R6NA 2DL5A 3WXMB 4OMMA 2HQEA 4OB0B 3I5RA 2JTEA 5EG2A 4JJNK 3VYHB 1KQ2A 2KT1A 1YHQT 2H3JA 3I56Q 5L8RE 1IRXA 4E7HA 2LCSA 2DXCA 4IKFA 3J80E 4XTUA 5IXFA 3I55T 2OTLT 2RN8A 3NPFA 1BI1A 2DJZA 3UA6A 2VWFA 3M0PA 2DERA 2E65A 4KRTA 1NYGA 1VQ7A 2VXEA 1V76A 1YITQ 2ABLA 2E4HA 3HFNA 2O31A 3LW5E 1Q81C 4QT7A 3QBYA 2KYMA 3P8BB 1Y96A 1ZUYA 3A1PA 1M1KU 3GIBA 3CCMT 1X43A 1MV0B 2LCLA 3LGLA 5GJVB 1VQPA 3RMQA 4FU6A 5AYFA 5I2MA 1GCPA 3EG2A 2D1XA 1K73U 3RESA 3GBQA 1YJ9T 1OZ3A 1VQMQ 2M51A 4HCCA 1FMVA 4XTYA 2E5QA 4C8QE 1Q86U 3LH5A 1UG1A 2DYIA 3CCEQ 5KYXB 4LDWA 1I5LA 2HCKA 2HQXA 3G6ET 1Y7XA 2B8AA 4X1VA 1KC8C 2W10A 1WQWA 1LJOA 2L3PA 4A4GA 4QVDA 4AFQC 3I56A 2DZ9A 2RD1A 3ULRB 1NYFA 4CRIA 1PNJA 5GMKl 2HKQB 1OPKA 3CC7Q 2BZXA 1XJWB 5IT9E 3CCQT 1GBRA 2A3LA 7AT1B 1Q82U 1U3OA 4AG2C 5GMKh 3OYJA 4EMGA 4C5EA 5KYUB 2CZ1B 1RLQC 1QKWA 1FX7A 1JJ2P 1CKAA 1QVGP 4A53A 1Q81R 1OQKA 1IO6A 1KQSA 2OI3A 3E2UA 2EQUA 3JCMQ 3X28B 1VQPQ 2LP5A 3L2VA 2LQWA 1IB8A 2V1RA 2EYWA 8AT1B 2K5IA 2BKDN 1TXQA 2EVRA 4WCIA 2JM9A 3M0RA 2E5KA 1YIJQ 3HFOA 2CP7A 2VB6A 1JU5C 3VS7A 5GAN5 2F5KA 5IN1A 1OX9A 1C6VX 1WLPB 2FVUA 3L2ZA 3CCVA 2K4YA 1AVZC 4XU0A 4AT1B 3LLRA 4F7UA 2YUQA 4J9HA 1VQ4A 2QDYB 1GFDA 5IXBA 4PFZA 1AT1B 4JJDA 2IPOB 3VRZA 4OMQA 1VOMA 1PRLC 4FYVB 2VYTA 2JXBA 5CKFA 4J9EA 2CZ6B 3GNFB 5GAOq 2HZYA 3A8HB 2RK1A 1S1NA 4F17A 4M7DA 2RQVA 4E7IA 1SRLA 4C0ZA 5IAYA 2J7IA 2K3BA 1U06A 2EFIA 5DLOA 3CCSA 4PJOD 3DB3A 4C5HA 2EKHA 2PVOB 3PNWC 3OW2P 1K9MU 2DVEA 2M16A 4ORZA 3META 1W2BS 1K4US 1YJWT 1K0SA 1T3LA 4BI3A 4LDYA 3I55Q 1I5OB 1K8AC 4C8QA 3ZEHA 3OQ5A 1GRIA 3PT9A 1LNXA 3MP8A 3EFSA 1N27A 4HCBA 4J9BA 4NL3A 2BIVA 3PIPA 3I56T 1VQ8Q 2X4XA 4ZGEB 4J6YA 2WSEE 2RHXA 3EGXB 5GMKm 5CKDA 2RB6A 2GGRA 5J26A 4VUBA 1M2OA 4J9CA 5FWBA 4EMKC 3TEEA 2E1HA 2L3SA 4J6XA 3OYYA 2LX9A 5GANj 3HSBA 2RA2A 2RQUA 1I81A 4E7ZA 3VS4A 3CMEQ 3VS0A 4C8QD 4E7LA 3FIFA 2QQBA 4EPCA 4ME7A 3CMEA 1K8AR 2DEQA 2QQRA 5KH6A 3J7AF 3CXCA 4C92D 1AWWA 4FW1A 2QTXA 1FMKA 2V8JA 3MKDA 5I21A 3RR6A 1D1CA 3H0FA 5GANd 4QKUA 4KGZB 1SSFA 2KRSA 1Y07A 3I5SA 4PFOA 4EMHA 1E6HA 4E7SA 1SF9A 4PL6A 3FEOA 1QWFA 4M7DD 1YI2T 2FZKB 4XTWA 2BZ8A 3ZL7C 4IUVA 4DBRA 2X4JA 4RCCA 2DBKA 1P92A 1C1AA 9ATCB 3AT1B 2P4TA 3M0QA 2A37A 1YJNT 1PD0A 2FPFA 3S6WA 4AFSC 2DIQA 4M7DB 1FWZA 4LDUA 1BKBA 2A0FB 3TQ7P 4M7AG 3EFOB 4M77E 3OB9A 3RKWA 1G5VA 2QEXA 3CMAT 3HRUA 1N8RR 3OS0A 3GLXA 3HP9A 5CKEA 1JJ2A 3RERA 1S72A 2QI2A 2DA9A 4PJOC 3CCRT 2VKNA 2OX7A 1NPPA 4Z8AA 2MMPA 5GMKi 4M75B 2K3XA 4RTXA 3GPLA 2RI5A 1HK9A 3QKJA 1IGUA 2JS0A 4M4ZA 2JTMA 1WJQA 2F1LA 3V8JA 1G3YA 2QK0A 3G71T 1VQOQ 3OYLA 3H8ZA 3CC7A 2YDLA 1LVKA 2PUOB 3OBWA 2DYBA 2G6FX 4ZGJB 5A2QE 4R55A 4EMKA 1NZ9A 3OYIA 3L1AA 3UPUA 5FU6C 2AIRB 1M3BA 1PWTA 2DILA 2PUKB 3WVDB 3ZFJA 1C0MA 1PRMC 1WHKA 3GNGA 2PTKA 1X75C 2LQNA 2OAUA 1M90R 4ZNXA 4M77C 3BFMA 1MUZA 4QQGA 1ACMB 2E64A 2PVDB 2E6NA 4KUDK 1IREB 2MIOA 2V26A 4OMOA 5LJ5h 3SFMA 2M9UA 2EQIA 1VIFA 2ED0A 3NFCA 3NTHA 1H92A 5GAN8 4NL2A 1Q86C 3CMET 3EG9A 4LD6A 1SG5A 3T9NA 1YWPA 1WDXA 2NUPB 2WSFE 3VUBA 1AWOA 1RAIB 4B9XA 2AT1B 1N9RA 2QA4T 4RUGA 4Y91A 3CEYA 3QWXX 2RK2A 1D1BA 1ZA2B 1Z9QA 1LCKA 3UDCA 5LJ3e 2OTLA 4FM4B 2RH2A 1WQ7A 3HRTA 4CC3A 1OU8A 1YI2A 1TUDA 2E12A 2XIDA 1VQOA 4B6MA 4MZTA 2KROA 1RAHB 1WYXA 3SWNB 1OOTA 2BE9B 2V8IA 5LJ5d 2HAXA 2CSQA 3A5ZB 4F7UE 1KSWA 4M75E 4X9CA 2VUBA 1BI0A 4OGCA 2DL4A 4N4HA 4XU3A 3CXCS 1KD1U 3CCJQ 4C92B 2YRVA 2QEXT 1WFWA 2MPXC 5GANh 5D6XA 2YHTA 3LX7A 1RAEB 4C5IA 4J7FA 4LUDA 1S72T 3ASKA 2HL5C 3INZA 4E47A 2P0PA 5KYWA 1WXTA 2VASA 3P8HA 1TU0B 3CXCP 1QVFA 5C6SA 1T0HA 1UHFA 4JLIA 1M30A 1ZSZC 3RKYA 5GAMe 1T0JA 4RCBA 4LUEA 5IHNA 4PLLA 1AWJA 5DM7R 4C92G 2XICA 1VQ7T 3M53A 2DETA 2MWPA 4A4HA 2I2LA 2GQIA 5CKBA 4WTOB 1G8XA 1X01A 1W1FA 4AFZC 4X9DA 3QYHB 5FU7C 1W6XA 4BUGA 3SEMA 1K76A 3M58A 1PG5B 4JJCA 3VU3C 3HHTB 1XTDA 3V8KA 2KGTA 5FW9A 4KT0E 5GAMd 1AOJA 3MO8A 2PNIA 1YIJT 2KY9A 3ZBDA 3CCLQ 2GCXA 4BE0A 1GCQC 2OTJA 1R77A 3M54A 1GFCA 1KD1R 4BI4A 1RLPC 1PC0A 2YLBA 4ZGDB 4RTWA 1RI9A 1W2BA 2OTJQ 4E7JA 2KQWA 1I07A 2KRMA 2FO0A 4BACA 1W70A 3X25B 3QDFA 4M78C 3OBYA 1QVGS 3JRZA 4QQ6A 3QUIA 1WHHA 4C8QB 1CSKA 2G3RA 1CKBA 2DZCA 3C95A 3M59A 4IUPA 2CT3A 5I11A 3JB9I 4MZMA 3CC4Q 1TUGB 4OMPA 2HD0A 2C06A 1JXMA 2P0KA 3CD6T 3A8OB 1BCOA 4HT8A 2P84A 1E6GA 1LOJA 2VGMA 3CCVQ 4OF1A 3OSVA 1U8RA 2JVVA 2BE7D 2QTVA 1WHLA 2BUDA 2CZ7B 2HKNA 2Z0WA 4XTZA 3A98A 4DBQA 1UE9A 2AKLA 3EH1A 2C0OA 3FC3A 3CCUT 3FRNA 3OYCA 3PVLA 1VQ9A 2RO0A 4E6RA 1BK2A 3QYGB 1SHFA 1Y96B 1ZSGA 2A28A 1B3QA 2ZPBB 5GAN7 1ZSZA 2LRQA 1MMDA 1N5ZA 4JRQA 3OSSC 3VS1A 2CH4W 2DTHA 4OMLA 2EYXA 3TCJA 3PTAA 3JCMh 3M56A 1WJRA 5IHKA 4D8DA 2JMCA 1TSFA 2ZPGB 2CYZB 3CCVT 5EC7A 2LDMA 3SWNA 4IIMA 5KCHA 1SKUB 1BIBA 3EG1A 1VQ4T 3VUZA 2J6OA 3CC4T 3JV3A 2JJ9A 4JZ4A 3EGUA 4FT2A 1KC8U 2J6KA 2ESWA 2E6ZA 2Y4YA 1M2VB 4BD3A 1UUEA 2RJEA 3OYKA 2KNBB 4UC4A 5CCAA 3PMTA 1YHQQ 3LGFA 4BDZA 4M77G 4RTUA 2DTOA 3JCMf 1YN8A 3JCMb 4PJOF 2OTJT 4XTVA 1RACB 2YRDA 4M75A 1VQLT 4EMKB 3RIRA 1UECA 1VQNT 3MEUA 3MP1A 4JZ3A 4OGEA 2Y4XA 2DRKA 2DTIA 1TG0A 1GBQA 2YXYA 4M7DG 4IUQA 4JJBA 3EHQA 2KI7A 1HYOA 2ECZA 1UHCA 2CP5A 5GMKj 1RAAB 3C0CA 1KG1A 4J9DA 3E9GA 1VQ7Q 3EG3A 1M1FA 4BE1A 5GAMh 1SRMA 1ZX6A 2RM4A 3E1SA 1NM7A 5GAOm 2L3RA 3CPWA 4CC7A 2MF2A 2R58A 2IVWA 5D7UA 1X69A 2QGFB 4IIOA 1B07A 2A36A 3JCMP 3QWYA 5D6WA 4ELYC 1V1CA 1N8RU 1G3TA 1KHCA 5GANe 1RAGB 2O4XB 3UF4A 3CCUA 1VQ6Q 4GLMA 3JCMe 1MMNA 2QEXQ 4PJOG 1TUCA 2M0OA 4BDYA 1E7OA 4BB7A 3PIOA 2ED1A 2XD0A 2K5FA 2KK4A 2IIMA 4Z88A 2K57A 1MMGA 2DNUA 2ROTA 3TSWA 3M0SA 2RJCA 2OJ2A 5KYYA 4HCZA 1H3HA 2RJDA 4MDXA 4X34A 5GAN4 4HXJA 1NBEB 3L2QA 1GCQA 1JBMA 2VC8A 1IHWA 2CP3A 3C94A 4PK4A 3OYDA 2YUNA 1X6OA 1U5SA 1QW1A 1VA7A 4LN2A 4HCKA 1UGSB 2COYA 1JJ2S 3AHUA 2YWWA 2AK5A 3CCMA 5FROA 3TU4K 4CC4B 5KCOA 3JCMg 1K73C 2ATCB 2XU8A 2DJQA 5GMKe 2CT4A 3NTKA 1FYNA 1D09B 1SHGA 1Q95G 1M1KC 1OYXA 5A0GA 2OAWA 2D8JA 2W0ZA 1QVFP 2JM8A 1NJIR 5D6YA 2EWNA 3KBGA 2L0AA 5LL6S 1TH7A 3U23A 3TSZA 3HPWA 2F2XA 1NLOC 4OMNA 1VQ4Q 1UGPB 1YBYA 3KFVA 1OULA 1ZA1B 5KYWB 1ZHIA 5GAOp 1N8RC 4PJLA 3NTIA 5J3BA 4FW2A 2Y90A 1Q7YU 4M7DF 3JB9J 1GL5A 3VYGA 1VQOT 1OU9A 2E10A 1G3WA 4Y92A 2QGGA 4BE2A 1AHJB 1FMWA 1SEMA 4PFPA 2EYZA 1HJDA 2LMJA 2E41A 1QVGA 2FHDA 3CCRQ 3SWNC 4OMFB 3FJ5A 1QQJA 1PSEA 2QDLA 2RPNA 2L3QA 1RABB 4TVRA 3JB9D 4C0FA 4A63B 2I0NA 4PJOE 1VQKA 3CD6Q 2KSSA 1BIAA 1NEGA 2LVMA 5I22A 2QA4A 1K73R 3CC2T 2EKOA 4GY5A 2QG9B 1M8VA 2KRNA 3M55A 4L6V5 3OW2S 3X26B 4PJMA 2RHUA 2XI9A 4J83A 4M7DC 1M1GA 5ECAA 1QVFS 1KC8R 1GXIE 1YI2Q 2RI2A 2K79A 1IGQA 1PKSA 2NLUA 2HDAA 1M3AA 3OS5A 1EFNA 1NPRA 2LC4A 2HMAA 3VJPA 3CPWP 1VQMA 4N0AA 3TVTA 1M8MA 1U1SA 2GTOA 2KEAA 2D8HA 3OYEA 1ZUUA 2LX7A 3F70A 1VQ9Q 3EGDB 4HVVA 3VV0A 3CCLT 3IQLA 5FU7B 5DY9A 2XMFA 3JB9H 1YCYA 1Y57A 3OYGA 4LDXA 3H6ZA 5CIUA 1W4SA 4XAXB 1IXDA 4M78D 2AZSA 1OZ2A 4KGVB 1QKXA 2K2VA 4C8QG 2VXFA 4HVWA 4LNPA 2H8HA 1YJWA 3M5AA 1X2QA
chains in the Genus database with same CATH topology
3HHTB 4OVAA 1XTDA 3V8KA 1V29B 2HQXA 3SD4A 4KT0E 1KHIA 3MO8A 4KUIA 2HNIA 5GAMd 5FU6B 3G6ET 1O9SA 1YIJT 1Y7XA 2KY9A 4IUUA 2B8AA 3ZBDA 2GCXA 4BE0A 1KC8C 1VQ6A 4PJOA 2OTJA 1WQWA 2EQMA 3M54A 3URGA 2MWOA 4MZPA 3PMIA 4BI4A 5C0MA 1NJIU 1LJOA 4M78B 2F69A 1WNLA 2QXFA 4M78E 3X24B 5HKCA 3C4SA 4JRKA 4A4GA 4QVDA 3I56A 3LWIA 2YLBA 2DZ9A 4ZGDB 3JCMV 1W2BA 3L2WA 4E7JA 2RD1A 2KQWA 2KVQG 3CCMA 4CRIA 5GMKl 3JCMX 3HKSA 4BACA 3MEVA 2L89A 4IURA 1XNIA 3CCQT 5IT9E 2A3LA 1Q82U 3X25B 2KMTA 4YTLA 4M78C 3OBYA 4C5GA 2RHYA 3QXEB 3A8LB 1QVGS 1YITT 1Q81U 3JRZA 4M7AB 4EMGA 5GMKh 2ZPHB 4QQ6A 4C5EA 3OYJA 3QUIA 2CZ1B 4C8QB 2X4YA 1Y71A 2G3RA 1YIJA 4DA4A 1VQ5A 1FX7A 2R5AA 3HRSA 2DZCA 4A54A 3C95A 3M59A 2D0QB 4A53A 3L2UA 4QVZA 1KQSA 4IUPA 3CCJT 1KQ1A 2JOYA 5GAOr 3JB9I 1JB0E 2EQUA 4MZMA 4XQ3A 1M4ZA 2M1HA 3X28B 3JCMQ 4N0AC 3L2VA 4M78G 4L59A 2HD0A 2RHIA 2C06A 3CCQA 2P0KA 4F7UF 5GAMf 3CD6T 2K5IA 3A8OB 2BKDN 4HT8A 1K9MC 4HT9A 5GANg 1YITA 5GAN6 3BY7A 3E9FA 1LOJA 2VGMA 3HFOA 4OF1A 3OSVA 1U8RA 5LJ3d 2D6FA 2JVVA 2QQSA 4HA8A 1B34A 1HXDA 2LQ8A 2WSCE 5KE3A 3G4SA 1YHQA 2ZPEB 3BW1A 5GAN5 4C92F 2F5KA 5IN1A 2BUDA 4FT4A 1MGQA 4ZN1A 2CZ7B 3R6OA 3WVEB 1VQLA 1BI3A 4XTZA 2FVUA 3L2ZA 3PGGA 3V7SA 4QQDA 3CC2A 3CCVA 3CCJA 2K4YA 4Q5WA 4XU0A 5LJ5f 3FC3A 1N9SA 3CCUT 3FRNA 3OYCA 4KULA 3LLRA 1VQ9A 2RO0A 1Q7YC 4F7UA 2IG0A 2QDYB 4FL6A 1VQ4A 3QYGB 1Y96B 5GAMg 1EIFA 3CC4A 2VGNA 3GF5A 2ZPBB 2JN0A 3CBPA 5GAN7 2LRQA 3JAME 3BDUA 3CCST 4XU2A 4JRQA 3OSSC 5FRMA 2DPPB 5I2SA 3OS1A 2DTHA 2ZGWA 5HK0A 2EJFA 3TCJA 2K3YA 4QVCA 5HK3A 3PTAA 4HKEA 3M56A 1WJRA 3JCMh 2VYTA 4M75F 3CMAA 5FRNA 1UGRB 4LDVA 5CKFA 5CK9A 2ZPGB 1I4K1 2CYZB 2R57A 1OI1A 2CZ6B 3LYIA 3CCVT 5GAOn 2ZCFB 2LDMA 3GNFB 3SWNA 1NE8A 5KCHA 4M75C 5GAOq 1BIBA 3A8HB 1VQ9T 2RK1A 4M75D 5LJ5e 2P0QA 4PNOA 1VQ4T 3VUZA 4M7DA 2CZ0B 3DB4A 3OY9A 2LTOA 4E7IA 2DXBA 4CI0C 1VQPT 3EAEA 3CC4T 4C0ZA 5IAYA 3PFSA 4A4KA 4FT2A 1KC8U 2EFIA 5DLOA 2PU9B 3BDLA 3CCSA 3JB9G 4PJOD 4O6JA 1VQNA 2EIFA 3DB3A 1QVPA 4L5GA 4C5HA 1YJ9A 1NJIC 3VKIA 5CAIA 2PVOB 3PNWC 2E6ZA 2Y4YA 4PLIA 1VUBA 1VQ8A 3LH0A 4BD3A 1K9MU 2DVEA 2RJEA 3OYKA 2R5MA 2M16A 5HY6A 3OYFA 1Q82C 4J6WA 2XHCA 1QP2A 3UT1A 4UC4A 4M77D 4IUTA 3META 1W2BS 3G71A 5CCAA 2AHJB 1YJWT 3PMTA 3LGFA 4A4FA 4BDZA 3DLLA 2PVGB 4BI3A 4LDYA 3CC7T 4M77G 2EQKA 2DIGA 2E70A 2HBPA 2DTOA 3JCMf 1K8AC 3JCMb 4M77F 4C8QA 4EDUA 4PJOF 1UB4A 3ZEHA 2OTJT 3OQ5A 3QPHA 4XTVA 4MMLA 2ZZDA 1U1TA 1IZ6A 3KUFA 3PT9A 1LNXA 3MP8A 3EFSA 4M75A 1VQLT 1N27A 4EMKB 3LWHA 4HCBA 3RIRA 2BIVA 4NL3A 1VQNT 3PIPA 3I56T 2ZPIB 2X4XA 3MEUA 3CBMA 4J6YA 3V8LA 4ZGEB 2WSEE 3MP1A 3O8VA 2RHXA 4OGEA 2Y4XA 5GAN2 1PSFA 2DTIA 3KXTA 4M7DE 5GMKm 5CKDA 2DAQA 2RB6A 3MHXA 5J26A 3OYBA 4VUBA 3QZ5B 4R56A 4M7DG 5CO7A 4EMKC 4IUQA 2A7YA 3TEEA 4ZN3A 2E1HA 4J6XA 3ME9A 1RL2A 3OYYA 2LX9A 5GANj 3HSBA 2RA2A 1I81A 4M7AD 1MHNA 5GMKj 1G3SA 3CPFA 1KG1A 4M7AC 4C8QD 4E7LA 3FIFA 5CVIA 2XK0A 4C92E 2QQBA 3E9GA 2MAMA 3QJ6A 4N4IA 4RKUE 4C8QC 4ME7A 4EPCA 1M1FA 3SDZA 4BE1A 3JSCA 3V7RA 3CMEA 2DEQA 2QQRA 5GAMh 5KH6A 5J39A 2LQKA 4E7KA 3J7AF 1D3BA 1UEBA 4ZTJA 2GQVA 2RM4A 3MCAB 3JCMd 3E1SA 5GAOm 4C92D 2L3RA 4F7UB 3CXCA 2QTXA 3MP6A 3QIIA 3CPWA 3JCMc 2V8JA 4OB2B 3CD6A 2MF2A 5I21A 4ZTFA 5GAMj 2R58A 5GANd 2IVWA 4J5YA 4V2SA 5LJ5g 1SSFA 1H641 3JCMP 2YLCA 5LJ3h 2F5TX 1R8OB 5D6WA 1XOVA 1Y07A 3M4GA 4BI8B 4C0DB 4ELYC 4EMHA 4JRPA 3M57A 3CPWS 1N8RU 4PL6A 3FEOA 1G3TA 1KHCA 3S3MA 4M7DD 1YI2T 1BI2A 5GANe 1B34B 2O4XB 3QHSA 5GAN3 1BYMA 4XTWA 4OB1B 3CCUA 2LNVA 1D3BB 4M7AF 4IUVA 1N6AA 2CGHA 3QJYA 2X4JA 3JCMe 4C0DC 2XDDA 2K5LA 4RCCA 4PJOG 3UWNA 1P92A 2M0OA 2P4TA 4BDYA 2O4XA 2LCCA 4BB7A 3S3OA 3OA6A 2QQAA 3PIOA 2XD0A 1YJNT 4C92C 2K5FA 2KK4A 4F7UG 2K57A 3S6WA 5M9OA 2DIQA 4JS5A 5FLXE 4NS5A 4M7DB 4M78F 1FWZA 2MI6A 2RJCA 4LDUA 1BKBA 3X20B 4M7AG 4M77E 2LT4A 3OB9A 3RKWA 1G5VA 4HCZA 3TREA 2QEXA 3CMAT 4A4EA 4LD9K 2RJDA 2RHZA 3HRUA 2RJFA 3DLMA 4MDXA 4MMKA 3CBOA 3GLXA 3OS0A 4X34A 2GFUA 4J8OA 5GAN4 3J81E 3HP9A 5CKEA 4XK8E 3OYNA 3L2QA 1S72A 1JJ2A 4RMOA 3RERA 2FL7A 2QI2A 2JNGA 2KDSA 1VQ8T 5GANf 2LT1A 1JBMA 4PJOC 2VC8A 3CCRT 2L8DA 3FJPA 4JLGA 2DK3A 4DOVA 1NPPA 5GMKi 2MMPA 3C94A 3OMCA 1K8AU 5LJ3f 4PJOB 4M75B 2K3XA 3OYDA 3OW2A 2GFAA 1X6OA 3EFRA 1YJNA 1QW1A 4P5NA 3GPLA 4DOWA 2XG8D 4NOYA 3L2RA 4ELZC 1UGSB 1JJ2S 2D9TA 2RI5A 1HK9A 3QKJA 3QO3A 1KD1C 3OYHA 3AHUA 4FIBA 5CQXA 3ER0A 4PKCC 4C92A 1DJ7B 2JTMA 1WJQA 2EJGA 2JZ2A 4M75G 5CQYA 5FROA 3OS2A 3TU4K 5KCOA 3JCMg 2ZPFB 4M78A 3V8JA 1G3YA 2DD5A 1K73C 2XU8A 4O5VA 2DO3A 3QDRB 2EAYA 5GMKe 3G71T 3NTKA 5LJ3j 2V8KA 3FLGA 3OYLA 3HL8A 4Y28E 4JS4A 3H8ZA 3OYAA 3CC7A 3JCMW 4JRIA 3CCRA 2PUOB 3OBWA 4N4GA 2X4WA 3RKXA 4QW2A 4ZGJB 3CCEA 5LJ5j 4XTXA 2FYKA 1M1KC 4FSXA 5A2QE 1OYXA 4RG2A 4EMKA 4D6WA 5A0GA 4R55A 1NZ9A 4JDSA 3V7CA 3OYIA 1JRIA 3L1AA 3UPUA 5FU6C 1H3ZA 2JTFA 5GAOl 1WGSA 3A8GB 3QG1A 1KQSS 3S3NA 2PUKB 3WVDB 3GP8A 3ZFJA 5D6YA 2QQ9A 2EWNA 3KBGA 3GOXA 3JCMJ 2GF7A 3GNGA 3M4YA 5DLQE 4BY6B 1X75C 2EYQA 3G6EA 5LL6S 1TH7A 4C8QF 1VQ6T 4C0GA 2DXTA 3HPWA 2OAUA 5CKHA 4M77C 3BFMA 1M90C 1RI0A 4QQGA 4MDWA 1UGPB 2CS7A 2E64A 1YBYA 2PVDB 2E6NA 4KUDK 3OYMA 3G7ZA 1IREB 3M9QA 2L5QA 4DQ2A 1ZHIA 5GAOp 1N8RC 2VV5A 3QZ9B 4BY6C 3NTIA 5J3BA 5LJ5h 2M9UA 4II1A 1VIFA 3SFMA 4WF2A 3NFCA 4B9WA 2Y90A 1Q7YU 4OB3B 4M7DF 3NTHA 4OP0A 4M77B 3JB9J 5GAN8 4NL2A 1Q86C 2RI3A 1M9SA 3VYGA 1QP3A 3CMET 1VQOT 2XDPA 4LD6A 3T9NA 2PQWA 1VIEA 2WACA 2E10A 1G3WA 1M5Q1 2WSFE 3RUXA 3VUBA 1VQKT 4BE2A 1O75A 1VQ5T 1WJSA 1AHJB 2FB7A 5A0LA 3C12A 4B9XA 1N9RA 2QA4T 4Y91A 3CEYA 3A8MB 2RK2A 1UGQB 2O01E 2X35A 3SB2A 4KBMB 2E41A 3UDCA 5LJ3e 3RMSA 3I55A 1QVGA 3QSUA 2OTLA 2FHDA 3SWNC 4OMFB 4FM4B 2RH2A 1WQ7A 3HRTA 1YI2A 2XDBA 1PSEA 2E12A 4RG8A 2XIDA 4XU1A 2JUFA 1VQOA 3WXMB 2HQEA 4OB0B 4J7IA 4TVRA 3JB9D 4C0FA 4PJOE 4MZTA 1VQKA 5EG2A 4JJNK 5LJ3g 3VYHB 1ZBXA 3G4ST 1KQ2A 1YHQT 3SWNB 2H3JA 2KSSA 2V8IA 5LJ5d 2HAXA 5L8RE 3A5ZB 1BIAA 2LVMA 4F7UE 2QA4A 4E7HA 4ATOA 4M75E 3MEAA 2DXCA 4X9CA 3CC2T 2EKOA 4GY5A 2VUBA 3Q1JA 1M90U 4IKFA 3J80E 1M8VA 4XTUA 3M55A 1BI0A 3DKMA 4OGCA 4Z02A 2KAFA 4L6V5 4N4HA 3OW2S 3X26B 4XU3A 3CXCS 1KD1U 3I55T 4C92B 2OTLT 2YRVA 2QEXT 5GANh 2RHUA 1BI1A 2XI9A 3FDRA 2EJ9A 4J83A 2DJZA 5D6XA 4M7DC 1M1GA 2YHTA 3CCLA 3LX7A 2E65A 5A0DA 4C5IA 4J7FA 1S72T 4M7AA 3ASKA 1QVFS 1VQ7A 1GXIE 2VXEA 2RI2A 3INZA 4E47A 3HFNA 5CR2A 2DXUA 2P0PA 2NLUA 3LW5E 1Q81C 3OS5A 3QBYA 3P8BB 3P8HA 1Y96A 4JUVA 1NPRA 2LC4A 1M1KU 3GIBA 3VJPA 3L42A 1I8FA 3E19A 5C6SA 1VQMA 3OMGA 4N0AA 1QVFA 1U1SA 4JLIA 3CCMT 1ZQ1A 5GAMe 3RKYA 3OYEA 3F70A 4RCBA 1XQHA 4PLLA 2LCLA 4GLKA 3LGLA 1VQPA 3VV0A 1WPYA 3CCLT 5FU7B 3RMQA 5DM7R 4FU6A 3MEWA 5DY9A 5AYFA 4C92G 3JB9F 5I2MA 3JB9H 1YCYA 1K73U 2XICA 3FB9A 2DKGA 5KE2A 1VQ7T 3RESA 3M53A 1YJ9T 2MWPA 1OZ3A 4A4HA 2I2LA 3OYGA 2CKKA 1FXXA 4LDXA 5CKBA 3H6ZA 5CIUA 3CCET 1W4SA 4XAXB 1X01A 2EQJA 4M78D 4HCCA 1OZ2A 4XTYA 2E5QA 4M77A 4C8QE 4X9DA 3QYHB 2DD4A 5FU7C 1Q86U 3N5BB 2K2VA 3P8DA 4C8QG 2VXFA 4BUGA 4M7AE 4LDWA 3M58A 1I5LA 1VQMT 1YJWA 3M5AA 3VU3C 2XKOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E10 A;  1M5Q 1;  3RUX A;  4M75 D;  2CGH A;  3V8K A;  5LJ5 e;  4PNO A;  3JCM e;  5GAM d;  4M7D A;  2HNI A;  4RCC A;  4PJO G;  4PJO A;  2FB7 A;  1WQW A;  1N9R A;  4C92 C;  4Y91 A;  3JB9 G;  4PJO D;  4F7U G;  1LJO A;  2K57 A;  4M78 B;  1WNL A;  4M78 E;  4JRK A;  4QVD A;  5CAI A;  4M7D B;  2YLB A;  2DZ9 A;  3SB2 A;  4M78 F;  3JCM V;  4M7A G;  2RD1 A;  2E41 A;  4M77 E;  5LJ3 e;  3RKW A;  3QSU A;  5GMK l;  3JCM X;  2DVE A;  3SWN C;  1WQ7 A;  4J6W A;  4MMK A;  4M77 D;  5GAN 4;  4M78 C;  4XU1 A;  3RER A;  4M7A B;  5GMK h;  4EMG A;  5GAN f;  3JB9 D;  3QUI A;  4M77 G;  4PJO E;  1JBM A;  4PJO C;  4C8Q B;  2DTO A;  2VC8 A;  3JCM f;  5LJ3 g;  3FJP A;  3JCM b;  4M77 F;  4C8Q A;  1KQ2 A;  4PJO F;  5GMK i;  3SWN B;  5LJ3 f;  4XTV A;  4M75 B;  4MML A;  5LJ5 d;  4A54 A;  1U1T A;  2DZC A;  3EFR A;  1BIA A;  1LNX A;  4F7U E;  4M75 A;  3EFS A;  4A53 A;  4EMK B;  4M75 E;  4X9C A;  4NOY A;  3RIR A;  4NL3 A;  1M8V A;  1KQ1 A;  5GAO r;  3QO3 A;  1HK9 A;  4XTU A;  4J6Y A;  3V8L A;  3JB9 I;  3AHU A;  4XQ3 A;  5GAN 2;  3JCM Q;  4XU3 A;  4C92 A;  4M75 G;  2EJG A;  2DTI A;  4N0A C;  4C92 B;  4M78 G;  3JCM g;  5GMK m;  4M7D E;  4M78 A;  3V8J A;  5GAN h;  2RB6 A;  2EJ9 A;  2DJZ A;  4M7D G;  2EAY A;  2YHT A;  4F7U F;  4EMK C;  5GAM f;  5GMK e;  4M7D C;  2E65 A;  4HT8 A;  5LJ3 j;  4HT9 A;  5GAN g;  2E1H A;  5GAN 6;  3BY7 A;  4J6X A;  4M7A A;  1LOJ A;  3HFO A;  2VXE A;  5GAN j;  3JCM W;  3INZ A;  5LJ3 d;  3HSB A;  4JRI A;  2RA2 A;  4HA8 A;  1B34 A;  1HXD A;  3HFN A;  3RKX A;  2DXU A;  1I81 A;  3BW1 A;  4M7A D;  5GAN 5;  4C92 F;  5GMK j;  5LJ5 j;  4XTX A;  1MGQ A;  2FYK A;  4M7A C;  4XTZ A;  4C8Q D;  1Y96 A;  3FIF A;  4JUV A;  3L2Z A;  3PGG A;  3V7S A;  4C92 E;  4EMK A;  4M7A F;  3V7C A;  3GIB A;  4C8Q C;  1JRI A;  3L1A A;  4XU0 A;  5LJ5 f;  5GAO l;  1N9S A;  3V7R A;  1I8F A;  2DEQ A;  4N0A A;  5GAM h;  1U1S A;  4JLI A;  1D3B A;  5GAM e;  2RM4 A;  3RKY A;  3JCM d;  4F7U A;  2EWN A;  3JCM J;  5GAO m;  4C92 D;  4RCB A;  4F7U B;  1Y96 B;  2QTX A;  5GAM g;  1TH7 A;  3JCM c;  4C8Q F;  2DXT A;  1WPY A;  5I21 A;  5GAM j;  2JN0 A;  5GAN d;  4M77 C;  5DY9 A;  5GAN 7;  3BFM A;  4J5Y A;  4C92 G;  3JB9 F;  3JB9 H;  4V2S A;  3BDU A;  1YCY A;  4XU2 A;  3FB9 A;  2DKG A;  5LJ5 g;  2E64 A;  3RES A;  1H64 1;  3JCM P;  2I2L A;  2YLC A;  5LJ3 h;  4DQ2 A;  2DTH A;  2ZGW A;  3M4G A;  5GAO p;  2EJF A;  4QVC A;  1X01 A;  4M78 D;  4EMH A;  5LJ5 h;  3JCM h;  4WF2 A;  4XTY A;  4M75 F;  4M77 A;  2Y90 A;  4C8Q E;  4X9D A;  4M7D F;  4M7D D;  4PJO B;  4OP0 A;  1I4K 1;  4M77 B;  3JB9 J;  5GAN e;  4C8Q G;  1B34 B;  2VXF A;  3QHS A;  4NL2 A;  5GAN 8;  5GAN 3;  5GAO n;  3SWN A;  4XTW A;  1I5L A;  4M7A E;  4M75 C;  5GAO q;  3VU3 C;  1BIB A;  1D3B B; 
#chains in the Genus database with same CATH topology
 4OVA A;  1D1A A;  1V29 B;  3SD4 A;  1MND A;  1KHI A;  4KUI A;  2HNI A;  5FU6 B;  1O9S A;  4PJO A;  2FZC B;  5KYX A;  2EQM A;  1MNE A;  1NJI U;  4M78 B;  2F69 A;  3X24 B;  4JRK A;  3LWI A;  2KT8 A;  2RMO A;  3JCM V;  3L2W A;  2KVQ G;  3MEV A;  5FWC A;  1XNI A;  4C5G A;  2KMT A;  1YJW Q;  3QXE B;  3A8L B;  1Q81 U;  4M7A B;  2ZPH B;  2X4Y A;  1Y71 A;  6AT1 B;  1S72 Q;  1YIJ A;  2DF6 A;  1KK7 A;  4A54 A;  4QVZ A;  1SPK A;  1K1Z A;  2SEM A;  3CCJ T;  1KQ1 A;  2JOY A;  1JB0 E;  3CQT A;  4XQ3 A;  2M1H A;  4RTY A;  3I9Q A;  4M78 G;  4L59 A;  1Y0M A;  1D0Z A;  4F7U F;  1PKT A;  1K9M C;  4HT9 A;  5GAN g;  1YIT A;  3E9F A;  3BE3 A;  2K9G A;  5IH2 A;  4HA8 A;  1B34 A;  1HXD A;  2LQ8 A;  1YHQ A;  2ZPE B;  3BW1 A;  8ATC B;  4C92 F;  4ZN1 A;  1K0X A;  3WVE B;  2O9S A;  3V7S A;  2M0Y A;  4QQD A;  3CC2 A;  2DEU A;  1N9S A;  4KUL A;  1JXO A;  2QA4 Q;  5GAM g;  1EIF A;  3CC4 A;  2VGN A;  1TS9 A;  2JN0 A;  2NUT A;  3CBP A;  3MPU B;  3JAM E;  1Z9Z A;  1UFF A;  1T3S A;  1QWE A;  2X3W D;  4RTT A;  5I2S A;  2ZGW A;  5HK0 A;  2K3Y A;  3MJX A;  4HKE A;  3CMA A;  2NUZ A;  4LDV A;  2CUB A;  5CK9 A;  3SHW A;  2R57 A;  1OI1 A;  2C0I A;  1RAF B;  1VQ9 T;  3EG9 B;  2LJ0 A;  2LJ1 A;  2P0Q A;  5LJ5 e;  2CZ0 B;  3DB4 A;  3OY9 A;  1VQP T;  1ZSZ B;  3BDL A;  1QCO A;  4O6J A;  2CP6 A;  1VQN A;  2EIF A;  1QVP A;  1YJ9 A;  3VKI A;  2EGC A;  4PLI A;  1VQ8 A;  2DL8 A;  4R0K A;  5HY6 A;  4PJJ A;  2XHC A;  3G71 A;  2AHJ B;  2FPD A;  2GTJ A;  3CCQ Q;  1JEG A;  2PVG B;  3CC7 T;  2DIG A;  2HBP A;  3EGX A;  3G71 Q;  1UJY A;  1UB4 A;  2ZZD A;  3KUF A;  1Q7Y R;  2M02 A;  3CBM A;  1ABO A;  1QMC A;  4EIK A;  5GAN 2;  1YP5 A;  1JO8 A;  1WZO A;  3MHX A;  3OYB A;  3QZ5 B;  5CO7 A;  2A7Y A;  1RUW A;  4ZN3 A;  1VQ5 Q;  3ME9 A;  1RL2 A;  1VQK Q;  1LPL A;  1MHN A;  3RBB B;  2O88 A;  4DEY A;  1QCN A;  3CMA Q;  5CVI A;  4AFU C;  3QJ6 A;  4RKU E;  4N4I A;  4C8Q C;  4KGX B;  3JSC A;  1D0X A;  3D7S B;  3V7R A;  5J39 A;  2LQK A;  4E7K A;  1D3B A;  4ZTJ A;  2GQV A;  3H0I A;  3EHR A;  3JCM d;  4AG1 C;  3PE0 A;  2QAS A;  1YJN Q;  2DX1 A;  3CCM Q;  2CRE A;  4ZTF A;  2EGE A;  3EFO A;  4RTV A;  1J3T A;  1WI7 A;  2YLC A;  5LJ3 h;  2F5T X;  1R8O B;  4BI8 B;  2EGA A;  2KE9 A;  3M57 A;  2L2P A;  3CPW S;  1BI2 A;  5GAN 3;  4FYY B;  3RNJ A;  3VS6 A;  4LXC A;  1N6A A;  1KFZ A;  2CGH A;  3QJY A;  4C0D C;  2JMA A;  3UWN A;  2OTL Q;  5AT1 B;  2C0T A;  1X27 A;  2O4X A;  3VS5 A;  2KYB A;  5HCK A;  4F04 B;  3OA6 A;  2NWM A;  2QQA A;  4F7U G;  4M78 F;  2MI6 A;  1IHV A;  1YFN A;  2LT4 A;  3H0H A;  2X9H A;  2RHZ A;  1G83 A;  4MMK A;  1BU1 A;  2GFU A;  2YT6 A;  3OYN A;  4F14 A;  2JNG A;  2RQR A;  1M2V A;  2KDS A;  5GAN f;  3FJP A;  4JLG A;  2DK3 A;  1K8A U;  3OMC A;  3OW2 A;  2GFA A;  2XG8 D;  3VS2 A;  1KD1 C;  2CH4 A;  3OYH A;  1X2K A;  2FRY A;  5CQX A;  4C92 A;  1VQ8 T;  1DJ7 B;  2EJG A;  3EG0 A;  3OS2 A;  1ABQ A;  4M78 A;  4DBH A;  2DD5 A;  1EZZ B;  4O5V A;  2CDT A;  1EX4 A;  5LJ3 j;  2LJ3 A;  3HL8 A;  4JS4 A;  3OYA A;  5KYU A;  3RDV A;  3JCM W;  2FRW A;  1K9M R;  3RKX A;  4QW2 A;  3CCE A;  3UAT A;  2FYK A;  4FSX A;  3REB B;  1JRI A;  1H3Z A;  3I35 A;  2B86 A;  3A8G B;  2AKK A;  1K9A A;  2JW4 A;  3GOX A;  2GF7 A;  3M4Y A;  1ARK A;  4C8Q F;  1VQ6 T;  4C0G A;  2RF0 A;  2DXT A;  1SSH A;  5CKH A;  3NGP A;  1OEB A;  1RI0 A;  1WA7 A;  1M90 C;  2CS7 A;  2O9V A;  2LZ6 B;  1JQQ A;  2DM1 A;  1M1K R;  3M9Q A;  2L5Q A;  2DRM A;  4DBF A;  3QZ9 B;  4BY6 C;  4J9I A;  4WF2 A;  4B9W A;  1PM3 A;  2BZY A;  4OB3 B;  4OP0 A;  2K6D A;  2QAZ A;  2RI3 A;  2XDP A;  2PQW A;  1W2B P;  1VIE A;  2WAC A;  4DEX A;  2YUP A;  1ZLM A;  1VQK T;  1R0B G;  1O75 A;  1VQ5 T;  1WJS A;  2FB7 A;  5KYY B;  2ZAE A;  2YRC A;  2EYY A;  4FYW B;  2DLP A;  2X35 A;  4KBM B;  3RMS A;  3I55 A;  3QSU A;  1A0N B;  2XDB A;  4RG8 A;  4XU1 A;  2JUF A;  1RAD B;  4J7I A;  1X6G A;  2RQT A;  5LJ3 g;  4KH0 B;  1ZBX A;  3G4S T;  2HQH A;  1VYT A;  1VQL Q;  4ATO A;  3MEA A;  1M90 U;  3Q1J A;  1HD3 A;  3EGD A;  2HL3 A;  3DKM A;  2SRC A;  4Z02 A;  1F1B B;  2KAF A;  2FZG B;  1R0C B;  3FDR A;  2EJ9 A;  3CCL A;  5A0D A;  4M7A A;  2MCN A;  1YNZ A;  1NG2 A;  5CR2 A;  2DXU A;  1WX6 A;  4JUV A;  2J05 A;  3L42 A;  1I8F A;  3E19 A;  3OMG A;  1B7T A;  2EPD A;  1ZQ1 A;  4JPB W;  2DFU A;  1XQH A;  4GLK A;  3UA7 A;  1ZUK A;  1WPY A;  3EH2 A;  1Q82 R;  3G6E Q;  3MEW A;  3JB9 F;  1BBZ A;  3FB9 A;  2DKG A;  5KE2 A;  2YUO A;  2CKK A;  1FXX A;  1ZBJ A;  1AEY A;  3CCE T;  1PCX A;  3THK A;  2EQJ A;  1MV3 A;  3PVQ A;  4M77 A;  2DD4 A;  3N5B B;  1MMA A;  3P8D A;  4M7A E;  2CP2 A;  1VQM T;  1YJ9 Q;  2XKO C;  2V1Q A;  1I0C A;  4IUU A;  3CCU Q;  1VQ6 A;  1KJW A;  3URG A;  2MWO A;  4MZP A;  3PMI A;  5C0M A;  1VQL A;  5HKC A;  1WNL A;  2QXF A;  4K11 A;  2ROL A;  4M78 E;  3C4S A;  2CUD A;  2O2O A;  3JCM X;  1WHJ A;  2CSI A;  3HKS A;  2L89 A;  4IUR A;  4HVU A;  4YTL A;  2RHY A;  1YIT T;  1WIE A;  2HBW A;  2J6F A;  2FPE A;  4DA4 A;  1VQ5 A;  2DL3 A;  2R5A A;  3HRS A;  2F2W A;  2D0Q B;  2KXD A;  3L2U A;  4AMC A;  1Q86 R;  1YCS B;  5GAO r;  3M0U A;  5IHI A;  1M4Z A;  2NYS A;  2KR3 A;  4N0A C;  1TTH B;  2RHI A;  4RTZ A;  1BB9 A;  3CCQ A;  4F16 A;  5GAM f;  4J9G A;  2HSE B;  5GAN 6;  3BY7 A;  1X6B A;  5LJ3 d;  2D6F A;  1D0Y A;  2QQS A;  2WSC E;  1AWX A;  5KE3 A;  3G4S A;  2QYZ A;  4FT4 A;  1MGQ A;  3R6O A;  1BI3 A;  3PGG A;  2E3I A;  3CCJ A;  3CCS Q;  4Q5W A;  5LJ5 f;  2AZV A;  1Q7Y C;  1VYU A;  2IG0 A;  4FL6 A;  2KXC A;  2HEQ A;  1I1J A;  1H8K A;  3GF5 A;  2MYS A;  3BDU A;  3CCS T;  4XU2 A;  1YWO A;  5FRM A;  2DPP B;  1KIK A;  3OS1 A;  2EJF A;  4QVC A;  5HK3 A;  4M75 F;  5FRN A;  1UGR B;  4PJO B;  1I4K 1;  3LYI A;  3NMZ C;  5GAO n;  2ZCF B;  2GNC A;  1WHG A;  1NE8 A;  4GBQ A;  4M75 C;  4FYX B;  4M75 D;  2FEI A;  4PNO A;  2NUP A;  2A08 A;  2LTO A;  3VS3 A;  2DXB A;  4CI0 C;  3EAE A;  2VVK A;  3PFS A;  3H41 A;  4A4K A;  1M27 C;  2PU9 B;  3JB9 G;  4L5G A;  1NJI C;  5CAI A;  1VUB A;  2JT4 A;  3LH0 A;  2X3X D;  1TWB A;  2R5M A;  3OYF A;  3CC2 Q;  1Q82 C;  4J6W A;  1QP2 A;  1TOV A;  2DVJ A;  4M77 D;  3UT1 A;  4IUT A;  4A4F A;  3DLL A;  3O5Z A;  2EQK A;  2E70 A;  4M77 F;  2EBP A;  4EDU A;  3QPH A;  4MML A;  1U1T A;  1IZ6 A;  1AZE A;  4LE9 A;  3LWH A;  4E2F B;  2ZPI B;  2PZ1 A;  3V8L A;  1KQS P;  1QLY A;  2MOX A;  3O8V A;  2CP0 A;  1PSF A;  3G1J A;  3KXT A;  2LNH B;  4M7D E;  2DAQ A;  2E3H A;  4R56 A;  4Z89 A;  4ANJ A;  1OX8 A;  2DL7 A;  1NLP C;  2X51 A;  4M7A D;  2H3E B;  1G3S A;  3CPF A;  4M7A C;  1G2B A;  2EW3 A;  3VRY A;  2XK0 A;  4C92 E;  2MAM A;  3SDZ A;  2NUT B;  1UDL A;  1UEB A;  2D0N A;  3MCA B;  4F7U B;  3MP6 A;  3QII A;  3JCM c;  4OB2 B;  3CD6 A;  4PJN A;  5GAM j;  1PD1 A;  4J5Y A;  4V2S A;  5LJ5 g;  1H64 1;  2J06 A;  5KYN A;  2YSQ A;  1XOV A;  3M4G A;  4C0D B;  4JRP A;  1UJ0 A;  3S3M A;  1B34 B;  3QHS A;  1BYM A;  4OB1 B;  2LNV A;  1D3B B;  4M7A F;  2GBQ A;  4FSS A;  3REA B;  2XDD A;  2K5L A;  1M3C A;  2LCC A;  3S3O A;  1OPL A;  3NHN A;  4C92 C;  1VYV A;  5M9O A;  2DE0 X;  2RNA A;  2DMO A;  4JS5 A;  5FLX E;  1UTI A;  4NS5 A;  2F2V A;  3X20 B;  3G4S Q;  3TRE A;  4A4E A;  4LD9 K;  2RJF A;  3H9N A;  3DLM A;  3CBO A;  2COW A;  2ENM A;  4J8O A;  3J81 E;  4XK8 E;  2KBT A;  1AZG B;  4RMO A;  2FL7 A;  2MK5 A;  1AD5 A;  2LT1 A;  2L8D A;  4DOV A;  5LJ3 f;  3EFR A;  1YJN A;  4FCY A;  4P5N A;  4DOW A;  4NOY A;  3L2R A;  4ELZ C;  1PHT A;  2D9T A;  3QO3 A;  2FG0 A;  4FIB A;  5GJW B;  3ER0 A;  2BTT A;  2JZ2 A;  4M75 G;  4PKC C;  5CQY A;  2ZPF B;  2DO3 A;  3M0T A;  2HSP A;  2EAY A;  3QDR B;  2V8K A;  3FLG A;  2COZ A;  4Y28 E;  4JRI A;  3CCR A;  1WXU A;  4N4G A;  2P4R A;  2X4W A;  5LJ5 j;  4XTX A;  4RG2 A;  4D6W A;  4JDS A;  3V7C A;  5L23 A;  1HSQ A;  2JTF A;  5GAO l;  1WGS A;  3QG1 A;  1KQS S;  3S3N A;  3GP8 A;  2QQ9 A;  3JCM J;  4J9F A;  5DLQ E;  4BY6 B;  2EYQ A;  4CC2 A;  3G6E A;  2DBM A;  1NEB A;  2RQW A;  4MDW A;  3OYM A;  3G7Z A;  4D8K A;  4DQ2 A;  2VV5 A;  1WHM A;  4II1 A;  3HTR A;  4M77 B;  1M9S A;  1QP3 A;  1OV3 A;  1M5Q 1;  3RUX A;  2JS2 A;  1WXB A;  2K7A A;  5A0L A;  3C12 A;  1UGV A;  1QCF A;  3A8M B;  1UGQ B;  2O01 E;  4ESR A;  3SB2 A;  4KH1 B;  1VQN Q;  1BCM A;  2K2M A;  3R6N A;  2DL5 A;  3WXM B;  4OMM A;  2HQE A;  4OB0 B;  3I5R A;  2JTE A;  5EG2 A;  4JJN K;  3VYH B;  1KQ2 A;  2KT1 A;  1YHQ T;  2H3J A;  3I56 Q;  5L8R E;  1IRX A;  4E7H A;  2LCS A;  2DXC A;  4IKF A;  3J80 E;  4XTU A;  5IXF A;  3I55 T;  2OTL T;  2RN8 A;  3NPF A;  1BI1 A;  2DJZ A;  3UA6 A;  2VWF A;  3M0P A;  2DER A;  2E65 A;  4KRT A;  1NYG A;  1VQ7 A;  2VXE A;  1V76 A;  1YIT Q;  2ABL A;  2E4H A;  3HFN A;  2O31 A;  3LW5 E;  1Q81 C;  4QT7 A;  3QBY A;  2KYM A;  3P8B B;  1Y96 A;  1ZUY A;  3A1P A;  1M1K U;  3GIB A;  3CCM T;  1X43 A;  1MV0 B;  2LCL A;  3LGL A;  5GJV B;  1VQP A;  3RMQ A;  4FU6 A;  5AYF A;  5I2M A;  1GCP A;  3EG2 A;  2D1X A;  1K73 U;  3RES A;  3GBQ A;  1YJ9 T;  1OZ3 A;  1VQM Q;  2M51 A;  4HCC A;  1FMV A;  4XTY A;  2E5Q A;  4C8Q E;  1Q86 U;  3LH5 A;  1UG1 A;  2DYI A;  3CCE Q;  5KYX B;  4LDW A;  1I5L A;  2HCK A;  2HQX A;  3G6E T;  1Y7X A;  2B8A A;  4X1V A;  1KC8 C;  2W10 A;  1WQW A;  1LJO A;  2L3P A;  4A4G A;  4QVD A;  4AFQ C;  3I56 A;  2DZ9 A;  2RD1 A;  3ULR B;  1NYF A;  4CRI A;  1PNJ A;  5GMK l;  2HKQ B;  1OPK A;  3CC7 Q;  2BZX A;  1XJW B;  5IT9 E;  3CCQ T;  1GBR A;  2A3L A;  7AT1 B;  1Q82 U;  1U3O A;  4AG2 C;  5GMK h;  3OYJ A;  4EMG A;  4C5E A;  5KYU B;  2CZ1 B;  1RLQ C;  1QKW A;  1FX7 A;  1JJ2 P;  1CKA A;  1QVG P;  4A53 A;  1Q81 R;  1OQK A;  1IO6 A;  1KQS A;  2OI3 A;  3E2U A;  2EQU A;  3JCM Q;  3X28 B;  1VQP Q;  2LP5 A;  3L2V A;  2LQW A;  1IB8 A;  2V1R A;  2EYW A;  8AT1 B;  2K5I A;  2BKD N;  1TXQ A;  2EVR A;  4WCI A;  2JM9 A;  3M0R A;  2E5K A;  1YIJ Q;  3HFO A;  2CP7 A;  2VB6 A;  1JU5 C;  3VS7 A;  5GAN 5;  2F5K A;  5IN1 A;  1OX9 A;  1C6V X;  1WLP B;  2FVU A;  3L2Z A;  3CCV A;  2K4Y A;  1AVZ C;  4XU0 A;  4AT1 B;  3LLR A;  4F7U A;  2YUQ A;  4J9H A;  1VQ4 A;  2QDY B;  1GFD A;  5IXB A;  4PFZ A;  1AT1 B;  4JJD A;  2IPO B;  3VRZ A;  4OMQ A;  1VOM A;  1PRL C;  4FYV B;  2VYT A;  2JXB A;  5CKF A;  4J9E A;  2CZ6 B;  3GNF B;  5GAO q;  2HZY A;  3A8H B;  2RK1 A;  1S1N A;  4F17 A;  4M7D A;  2RQV A;  4E7I A;  1SRL A;  4C0Z A;  5IAY A;  2J7I A;  2K3B A;  1U06 A;  2EFI A;  5DLO A;  3CCS A;  4PJO D;  3DB3 A;  4C5H A;  2EKH A;  2PVO B;  3PNW C;  3OW2 P;  1K9M U;  2DVE A;  2M16 A;  4ORZ A;  3MET A;  1W2B S;  1K4U S;  1YJW T;  1K0S A;  1T3L A;  4BI3 A;  4LDY A;  3I55 Q;  1I5O B;  1K8A C;  4C8Q A;  3ZEH A;  3OQ5 A;  1GRI A;  3PT9 A;  1LNX A;  3MP8 A;  3EFS A;  1N27 A;  4HCB A;  4J9B A;  4NL3 A;  2BIV A;  3PIP A;  3I56 T;  1VQ8 Q;  2X4X A;  4ZGE B;  4J6Y A;  2WSE E;  2RHX A;  3EGX B;  5GMK m;  5CKD A;  2RB6 A;  2GGR A;  5J26 A;  4VUB A;  1M2O A;  4J9C A;  5FWB A;  4EMK C;  3TEE A;  2E1H A;  2L3S A;  4J6X A;  3OYY A;  2LX9 A;  5GAN j;  3HSB A;  2RA2 A;  2RQU A;  1I81 A;  4E7Z A;  3VS4 A;  3CME Q;  3VS0 A;  4C8Q D;  4E7L A;  3FIF A;  2QQB A;  4EPC A;  4ME7 A;  3CME A;  1K8A R;  2DEQ A;  2QQR A;  5KH6 A;  3J7A F;  3CXC A;  4C92 D;  1AWW A;  4FW1 A;  2QTX A;  1FMK A;  2V8J A;  3MKD A;  5I21 A;  3RR6 A;  1D1C A;  3H0F A;  5GAN d;  4QKU A;  4KGZ B;  1SSF A;  2KRS A;  1Y07 A;  3I5S A;  4PFO A;  4EMH A;  1E6H A;  4E7S A;  1SF9 A;  4PL6 A;  3FEO A;  1QWF A;  4M7D D;  1YI2 T;  2FZK B;  4XTW A;  2BZ8 A;  3ZL7 C;  4IUV A;  4DBR A;  2X4J A;  4RCC A;  2DBK A;  1P92 A;  1C1A A;  9ATC B;  3AT1 B;  2P4T A;  3M0Q A;  2A37 A;  1YJN T;  1PD0 A;  2FPF A;  3S6W A;  4AFS C;  2DIQ A;  4M7D B;  1FWZ A;  4LDU A;  1BKB A;  2A0F B;  3TQ7 P;  4M7A G;  3EFO B;  4M77 E;  3OB9 A;  3RKW A;  1G5V A;  2QEX A;  3CMA T;  3HRU A;  1N8R R;  3OS0 A;  3GLX A;  3HP9 A;  5CKE A;  1JJ2 A;  3RER A;  1S72 A;  2QI2 A;  2DA9 A;  4PJO C;  3CCR T;  2VKN A;  2OX7 A;  1NPP A;  4Z8A A;  2MMP A;  5GMK i;  4M75 B;  2K3X A;  4RTX A;  3GPL A;  2RI5 A;  1HK9 A;  3QKJ A;  1IGU A;  2JS0 A;  4M4Z A;  2JTM A;  1WJQ A;  2F1L A;  3V8J A;  1G3Y A;  2QK0 A;  3G71 T;  1VQO Q;  3OYL A;  3H8Z A;  3CC7 A;  2YDL A;  1LVK A;  2PUO B;  3OBW A;  2DYB A;  2G6F X;  4ZGJ B;  5A2Q E;  4R55 A;  4EMK A;  1NZ9 A;  3OYI A;  3L1A A;  3UPU A;  5FU6 C;  2AIR B;  1M3B A;  1PWT A;  2DIL A;  2PUK B;  3WVD B;  3ZFJ A;  1C0M A;  1PRM C;  1WHK A;  3GNG A;  2PTK A;  1X75 C;  2LQN A;  2OAU A;  1M90 R;  4ZNX A;  4M77 C;  3BFM A;  1MUZ A;  4QQG A;  1ACM B;  2E64 A;  2PVD B;  2E6N A;  4KUD K;  1IRE B;  2MIO A;  2V26 A;  4OMO A;  5LJ5 h;  3SFM A;  2M9U A;  2EQI A;  1VIF A;  2ED0 A;  3NFC A;  3NTH A;  1H92 A;  5GAN 8;  4NL2 A;  1Q86 C;  3CME T;  3EG9 A;  4LD6 A;  1SG5 A;  3T9N A;  1YWP A;  1WDX A;  2NUP B;  2WSF E;  3VUB A;  1AWO A;  1RAI B;  4B9X A;  2AT1 B;  1N9R A;  2QA4 T;  4RUG A;  4Y91 A;  3CEY A;  3QWX X;  2RK2 A;  1D1B A;  1ZA2 B;  1Z9Q A;  1LCK A;  3UDC A;  5LJ3 e;  2OTL A;  4FM4 B;  2RH2 A;  1WQ7 A;  3HRT A;  4CC3 A;  1OU8 A;  1YI2 A;  1TUD A;  2E12 A;  2XID A;  1VQO A;  4B6M A;  4MZT A;  2KRO A;  1RAH B;  1WYX A;  3SWN B;  1OOT A;  2BE9 B;  2V8I A;  5LJ5 d;  2HAX A;  2CSQ A;  3A5Z B;  4F7U E;  1KSW A;  4M75 E;  4X9C A;  2VUB A;  1BI0 A;  4OGC A;  2DL4 A;  4N4H A;  4XU3 A;  3CXC S;  1KD1 U;  3CCJ Q;  4C92 B;  2YRV A;  2QEX T;  1WFW A;  2MPX C;  5GAN h;  5D6X A;  2YHT A;  3LX7 A;  1RAE B;  4C5I A;  4J7F A;  4LUD A;  1S72 T;  3ASK A;  2HL5 C;  3INZ A;  4E47 A;  2P0P A;  5KYW A;  1WXT A;  2VAS A;  3P8H A;  1TU0 B;  3CXC P;  1QVF A;  5C6S A;  1T0H A;  1UHF A;  4JLI A;  1M30 A;  1ZSZ C;  3RKY A;  5GAM e;  1T0J A;  4RCB A;  4LUE A;  5IHN A;  4PLL A;  1AWJ A;  5DM7 R;  4C92 G;  2XIC A;  1VQ7 T;  3M53 A;  2DET A;  2MWP A;  4A4H A;  2I2L A;  2GQI A;  5CKB A;  4WTO B;  1G8X A;  1X01 A;  1W1F A;  4AFZ C;  4X9D A;  3QYH B;  5FU7 C;  1W6X A;  4BUG A;  3SEM A;  1K76 A;  3M58 A;  1PG5 B;  4JJC A;  3VU3 C;  3HHT B;  1XTD A;  3V8K A;  2KGT A;  5FW9 A;  4KT0 E;  5GAM d;  1AOJ A;  3MO8 A;  2PNI A;  1YIJ T;  2KY9 A;  3ZBD A;  3CCL Q;  2GCX A;  4BE0 A;  1GCQ C;  2OTJ A;  1R77 A;  3M54 A;  1GFC A;  1KD1 R;  4BI4 A;  1RLP C;  1PC0 A;  2YLB A;  4ZGD B;  4RTW A;  1RI9 A;  1W2B A;  2OTJ Q;  4E7J A;  2KQW A;  1I07 A;  2KRM A;  2FO0 A;  4BAC A;  1W70 A;  3X25 B;  3QDF A;  4M78 C;  3OBY A;  1QVG S;  3JRZ A;  4QQ6 A;  3QUI A;  1WHH A;  4C8Q B;  1CSK A;  2G3R A;  1CKB A;  2DZC A;  3C95 A;  3M59 A;  4IUP A;  2CT3 A;  5I11 A;  3JB9 I;  4MZM A;  3CC4 Q;  1TUG B;  4OMP A;  2HD0 A;  2C06 A;  1JXM A;  2P0K A;  3CD6 T;  3A8O B;  1BCO A;  4HT8 A;  2P84 A;  1E6G A;  1LOJ A;  2VGM A;  3CCV Q;  4OF1 A;  3OSV A;  1U8R A;  2JVV A;  2BE7 D;  2QTV A;  1WHL A;  2BUD A;  2CZ7 B;  2HKN A;  2Z0W A;  4XTZ A;  3A98 A;  4DBQ A;  1UE9 A;  2AKL A;  3EH1 A;  2C0O A;  3FC3 A;  3CCU T;  3FRN A;  3OYC A;  3PVL A;  1VQ9 A;  2RO0 A;  4E6R A;  1BK2 A;  3QYG B;  1SHF A;  1Y96 B;  1ZSG A;  2A28 A;  1B3Q A;  2ZPB B;  5GAN 7;  1ZSZ A;  2LRQ A;  1MMD A;  1N5Z A;  4JRQ A;  3OSS C;  3VS1 A;  2CH4 W;  2DTH A;  4OML A;  2EYX A;  3TCJ A;  3PTA A;  3JCM h;  3M56 A;  1WJR A;  5IHK A;  4D8D A;  2JMC A;  1TSF A;  2ZPG B;  2CYZ B;  3CCV T;  5EC7 A;  2LDM A;  3SWN A;  4IIM A;  5KCH A;  1SKU B;  1BIB A;  3EG1 A;  1VQ4 T;  3VUZ A;  2J6O A;  3CC4 T;  3JV3 A;  2JJ9 A;  4JZ4 A;  3EGU A;  4FT2 A;  1KC8 U;  2J6K A;  2ESW A;  2E6Z A;  2Y4Y A;  1M2V B;  4BD3 A;  1UUE A;  2RJE A;  3OYK A;  2KNB B;  4UC4 A;  5CCA A;  3PMT A;  1YHQ Q;  3LGF A;  4BDZ A;  4M77 G;  4RTU A;  2DTO A;  3JCM f;  1YN8 A;  3JCM b;  4PJO F;  2OTJ T;  4XTV A;  1RAC B;  2YRD A;  4M75 A;  1VQL T;  4EMK B;  3RIR A;  1UEC A;  1VQN T;  3MEU A;  3MP1 A;  4JZ3 A;  4OGE A;  2Y4X A;  2DRK A;  2DTI A;  1TG0 A;  1GBQ A;  2YXY A;  4M7D G;  4IUQ A;  4JJB A;  3EHQ A;  2KI7 A;  1HYO A;  2ECZ A;  1UHC A;  2CP5 A;  5GMK j;  1RAA B;  3C0C A;  1KG1 A;  4J9D A;  3E9G A;  1VQ7 Q;  3EG3 A;  1M1F A;  4BE1 A;  5GAM h;  1SRM A;  1ZX6 A;  2RM4 A;  3E1S A;  1NM7 A;  5GAO m;  2L3R A;  3CPW A;  4CC7 A;  2MF2 A;  2R58 A;  2IVW A;  5D7U A;  1X69 A;  2QGF B;  4IIO A;  1B07 A;  2A36 A;  3JCM P;  3QWY A;  5D6W A;  4ELY C;  1V1C A;  1N8R U;  1G3T A;  1KHC A;  5GAN e;  1RAG B;  2O4X B;  3UF4 A;  3CCU A;  1VQ6 Q;  4GLM A;  3JCM e;  1MMN A;  2QEX Q;  4PJO G;  1TUC A;  2M0O A;  4BDY A;  1E7O A;  4BB7 A;  3PIO A;  2ED1 A;  2XD0 A;  2K5F A;  2KK4 A;  2IIM A;  4Z88 A;  2K57 A;  1MMG A;  2DNU A;  2ROT A;  3TSW A;  3M0S A;  2RJC A;  2OJ2 A;  5KYY A;  4HCZ A;  1H3H A;  2RJD A;  4MDX A;  4X34 A;  5GAN 4;  4HXJ A;  1NBE B;  3L2Q A;  1GCQ A;  1JBM A;  2VC8 A;  1IHW A;  2CP3 A;  3C94 A;  4PK4 A;  3OYD A;  2YUN A;  1X6O A;  1U5S A;  1QW1 A;  1VA7 A;  4LN2 A;  4HCK A;  1UGS B;  2COY A;  1JJ2 S;  3AHU A;  2YWW A;  2AK5 A;  3CCM A;  5FRO A;  3TU4 K;  4CC4 B;  5KCO A;  3JCM g;  1K73 C;  2ATC B;  2XU8 A;  2DJQ A;  5GMK e;  2CT4 A;  3NTK A;  1FYN A;  1D09 B;  1SHG A;  1Q95 G;  1M1K C;  1OYX A;  5A0G A;  2OAW A;  2D8J A;  2W0Z A;  1QVF P;  2JM8 A;  1NJI R;  5D6Y A;  2EWN A;  3KBG A;  2L0A A;  5LL6 S;  1TH7 A;  3U23 A;  3TSZ A;  3HPW A;  2F2X A;  1NLO C;  4OMN A;  1VQ4 Q;  1UGP B;  1YBY A;  3KFV A;  1OUL A;  1ZA1 B;  5KYW B;  1ZHI A;  5GAO p;  1N8R C;  4PJL A;  3NTI A;  5J3B A;  4FW2 A;  2Y90 A;  1Q7Y U;  4M7D F;  3JB9 J;  1GL5 A;  3VYG A;  1VQO T;  1OU9 A;  2E10 A;  1G3W A;  4Y92 A;  2QGG A;  4BE2 A;  1AHJ B;  1FMW A;  1SEM A;  4PFP A;  2EYZ A;  1HJD A;  2LMJ A;  2E41 A;  1QVG A;  2FHD A;  3CCR Q;  3SWN C;  4OMF B;  3FJ5 A;  1QQJ A;  1PSE A;  2QDL A;  2RPN A;  2L3Q A;  1RAB B;  4TVR A;  3JB9 D;  4C0F A;  4A63 B;  2I0N A;  4PJO E;  1VQK A;  3CD6 Q;  2KSS A;  1BIA A;  1NEG A;  2LVM A;  5I22 A;  2QA4 A;  1K73 R;  3CC2 T;  2EKO A;  4GY5 A;  2QG9 B;  1M8V A;  2KRN A;  3M55 A;  4L6V 5;  3OW2 S;  3X26 B;  4PJM A;  2RHU A;  2XI9 A;  4J83 A;  4M7D C;  1M1G A;  5ECA A;  1QVF S;  1KC8 R;  1GXI E;  1YI2 Q;  2RI2 A;  2K79 A;  1IGQ A;  1PKS A;  2NLU A;  2HDA A;  1M3A A;  3OS5 A;  1EFN A;  1NPR A;  2LC4 A;  2HMA A;  3VJP A;  3CPW P;  1VQM A;  4N0A A;  3TVT A;  1M8M A;  1U1S A;  2GTO A;  2KEA A;  2D8H A;  3OYE A;  1ZUU A;  2LX7 A;  3F70 A;  1VQ9 Q;  3EGD B;  4HVV A;  3VV0 A;  3CCL T;  3IQL A;  5FU7 B;  5DY9 A;  2XMF A;  3JB9 H;  1YCY A;  1Y57 A;  3OYG A;  4LDX A;  3H6Z A;  5CIU A;  1W4S A;  4XAX B;  1IXD A;  4M78 D;  2AZS A;  1OZ2 A;  4KGV B;  1QKX A;  2K2V A;  4C8Q G;  2VXF A;  4HVW A;  4LNP A;  2H8H A;  1YJW A;  3M5A A;  1X2Q A; 
#chains in the Genus database with same CATH homology
 3HHT B;  4OVA A;  1XTD A;  3V8K A;  1V29 B;  2HQX A;  3SD4 A;  4KT0 E;  1KHI A;  3MO8 A;  4KUI A;  2HNI A;  5GAM d;  5FU6 B;  3G6E T;  1O9S A;  1YIJ T;  1Y7X A;  2KY9 A;  4IUU A;  2B8A A;  3ZBD A;  2GCX A;  4BE0 A;  1KC8 C;  1VQ6 A;  4PJO A;  2OTJ A;  1WQW A;  2EQM A;  3M54 A;  3URG A;  2MWO A;  4MZP A;  3PMI A;  4BI4 A;  5C0M A;  1NJI U;  1LJO A;  4M78 B;  2F69 A;  1WNL A;  2QXF A;  4M78 E;  3X24 B;  5HKC A;  3C4S A;  4JRK A;  4A4G A;  4QVD A;  3I56 A;  3LWI A;  2YLB A;  2DZ9 A;  4ZGD B;  3JCM V;  1W2B A;  3L2W A;  4E7J A;  2RD1 A;  2KQW A;  2KVQ G;  3CCM A;  4CRI A;  5GMK l;  3JCM X;  3HKS A;  4BAC A;  3MEV A;  2L89 A;  4IUR A;  1XNI A;  3CCQ T;  5IT9 E;  2A3L A;  1Q82 U;  3X25 B;  2KMT A;  4YTL A;  4M78 C;  3OBY A;  4C5G A;  2RHY A;  3QXE B;  3A8L B;  1QVG S;  1YIT T;  1Q81 U;  3JRZ A;  4M7A B;  4EMG A;  5GMK h;  2ZPH B;  4QQ6 A;  4C5E A;  3OYJ A;  3QUI A;  2CZ1 B;  4C8Q B;  2X4Y A;  1Y71 A;  2G3R A;  1YIJ A;  4DA4 A;  1VQ5 A;  1FX7 A;  2R5A A;  3HRS A;  2DZC A;  4A54 A;  3C95 A;  3M59 A;  2D0Q B;  4A53 A;  3L2U A;  4QVZ A;  1KQS A;  4IUP A;  3CCJ T;  1KQ1 A;  2JOY A;  5GAO r;  3JB9 I;  1JB0 E;  2EQU A;  4MZM A;  4XQ3 A;  1M4Z A;  2M1H A;  3X28 B;  3JCM Q;  4N0A C;  3L2V A;  4M78 G;  4L59 A;  2HD0 A;  2RHI A;  2C06 A;  3CCQ A;  2P0K A;  4F7U F;  5GAM f;  3CD6 T;  2K5I A;  3A8O B;  2BKD N;  4HT8 A;  1K9M C;  4HT9 A;  5GAN g;  1YIT A;  5GAN 6;  3BY7 A;  3E9F A;  1LOJ A;  2VGM A;  3HFO A;  4OF1 A;  3OSV A;  1U8R A;  5LJ3 d;  2D6F A;  2JVV A;  2QQS A;  4HA8 A;  1B34 A;  1HXD A;  2LQ8 A;  2WSC E;  5KE3 A;  3G4S A;  1YHQ A;  2ZPE B;  3BW1 A;  5GAN 5;  4C92 F;  2F5K A;  5IN1 A;  2BUD A;  4FT4 A;  1MGQ A;  4ZN1 A;  2CZ7 B;  3R6O A;  3WVE B;  1VQL A;  1BI3 A;  4XTZ A;  2FVU A;  3L2Z A;  3PGG A;  3V7S A;  4QQD A;  3CC2 A;  3CCV A;  3CCJ A;  2K4Y A;  4Q5W A;  4XU0 A;  5LJ5 f;  3FC3 A;  1N9S A;  3CCU T;  3FRN A;  3OYC A;  4KUL A;  3LLR A;  1VQ9 A;  2RO0 A;  1Q7Y C;  4F7U A;  2IG0 A;  2QDY B;  4FL6 A;  1VQ4 A;  3QYG B;  1Y96 B;  5GAM g;  1EIF A;  3CC4 A;  2VGN A;  3GF5 A;  2ZPB B;  2JN0 A;  3CBP A;  5GAN 7;  2LRQ A;  3JAM E;  3BDU A;  3CCS T;  4XU2 A;  4JRQ A;  3OSS C;  5FRM A;  2DPP B;  5I2S A;  3OS1 A;  2DTH A;  2ZGW A;  5HK0 A;  2EJF A;  3TCJ A;  2K3Y A;  4QVC A;  5HK3 A;  3PTA A;  4HKE A;  3M56 A;  1WJR A;  3JCM h;  2VYT A;  4M75 F;  3CMA A;  5FRN A;  1UGR B;  4LDV A;  5CKF A;  5CK9 A;  2ZPG B;  1I4K 1;  2CYZ B;  2R57 A;  1OI1 A;  2CZ6 B;  3LYI A;  3CCV T;  5GAO n;  2ZCF B;  2LDM A;  3GNF B;  3SWN A;  1NE8 A;  5KCH A;  4M75 C;  5GAO q;  1BIB A;  3A8H B;  1VQ9 T;  2RK1 A;  4M75 D;  5LJ5 e;  2P0Q A;  4PNO A;  1VQ4 T;  3VUZ A;  4M7D A;  2CZ0 B;  3DB4 A;  3OY9 A;  2LTO A;  4E7I A;  2DXB A;  4CI0 C;  1VQP T;  3EAE A;  3CC4 T;  4C0Z A;  5IAY A;  3PFS A;  4A4K A;  4FT2 A;  1KC8 U;  2EFI A;  5DLO A;  2PU9 B;  3BDL A;  3CCS A;  3JB9 G;  4PJO D;  4O6J A;  1VQN A;  2EIF A;  3DB3 A;  1QVP A;  4L5G A;  4C5H A;  1YJ9 A;  1NJI C;  3VKI A;  5CAI A;  2PVO B;  3PNW C;  2E6Z A;  2Y4Y A;  4PLI A;  1VUB A;  1VQ8 A;  3LH0 A;  4BD3 A;  1K9M U;  2DVE A;  2RJE A;  3OYK A;  2R5M A;  2M16 A;  5HY6 A;  3OYF A;  1Q82 C;  4J6W A;  2XHC A;  1QP2 A;  3UT1 A;  4UC4 A;  4M77 D;  4IUT A;  3MET A;  1W2B S;  3G71 A;  5CCA A;  2AHJ B;  1YJW T;  3PMT A;  3LGF A;  4A4F A;  4BDZ A;  3DLL A;  2PVG B;  4BI3 A;  4LDY A;  3CC7 T;  4M77 G;  2EQK A;  2DIG A;  2E70 A;  2HBP A;  2DTO A;  3JCM f;  1K8A C;  3JCM b;  4M77 F;  4C8Q A;  4EDU A;  4PJO F;  1UB4 A;  3ZEH A;  2OTJ T;  3OQ5 A;  3QPH A;  4XTV A;  4MML A;  2ZZD A;  1U1T A;  1IZ6 A;  3KUF A;  3PT9 A;  1LNX A;  3MP8 A;  3EFS A;  4M75 A;  1VQL T;  1N27 A;  4EMK B;  3LWH A;  4HCB A;  3RIR A;  2BIV A;  4NL3 A;  1VQN T;  3PIP A;  3I56 T;  2ZPI B;  2X4X A;  3MEU A;  3CBM A;  4J6Y A;  3V8L A;  4ZGE B;  2WSE E;  3MP1 A;  3O8V A;  2RHX A;  4OGE A;  2Y4X A;  5GAN 2;  1PSF A;  2DTI A;  3KXT A;  4M7D E;  5GMK m;  5CKD A;  2DAQ A;  2RB6 A;  3MHX A;  5J26 A;  3OYB A;  4VUB A;  3QZ5 B;  4R56 A;  4M7D G;  5CO7 A;  4EMK C;  4IUQ A;  2A7Y A;  3TEE A;  4ZN3 A;  2E1H A;  4J6X A;  3ME9 A;  1RL2 A;  3OYY A;  2LX9 A;  5GAN j;  3HSB A;  2RA2 A;  1I81 A;  4M7A D;  1MHN A;  5GMK j;  1G3S A;  3CPF A;  1KG1 A;  4M7A C;  4C8Q D;  4E7L A;  3FIF A;  5CVI A;  2XK0 A;  4C92 E;  2QQB A;  3E9G A;  2MAM A;  3QJ6 A;  4N4I A;  4RKU E;  4C8Q C;  4ME7 A;  4EPC A;  1M1F A;  3SDZ A;  4BE1 A;  3JSC A;  3V7R A;  3CME A;  2DEQ A;  2QQR A;  5GAM h;  5KH6 A;  5J39 A;  2LQK A;  4E7K A;  3J7A F;  1D3B A;  1UEB A;  4ZTJ A;  2GQV A;  2RM4 A;  3MCA B;  3JCM d;  3E1S A;  5GAO m;  4C92 D;  2L3R A;  4F7U B;  3CXC A;  2QTX A;  3MP6 A;  3QII A;  3CPW A;  3JCM c;  2V8J A;  4OB2 B;  3CD6 A;  2MF2 A;  5I21 A;  4ZTF A;  5GAM j;  2R58 A;  5GAN d;  2IVW A;  4J5Y A;  4V2S A;  5LJ5 g;  1SSF A;  1H64 1;  3JCM P;  2YLC A;  5LJ3 h;  2F5T X;  1R8O B;  5D6W A;  1XOV A;  1Y07 A;  3M4G A;  4BI8 B;  4C0D B;  4ELY C;  4EMH A;  4JRP A;  3M57 A;  3CPW S;  1N8R U;  4PL6 A;  3FEO A;  1G3T A;  1KHC A;  3S3M A;  4M7D D;  1YI2 T;  1BI2 A;  5GAN e;  1B34 B;  2O4X B;  3QHS A;  5GAN 3;  1BYM A;  4XTW A;  4OB1 B;  3CCU A;  2LNV A;  1D3B B;  4M7A F;  4IUV A;  1N6A A;  2CGH A;  3QJY A;  2X4J A;  3JCM e;  4C0D C;  2XDD A;  2K5L A;  4RCC A;  4PJO G;  3UWN A;  1P92 A;  2M0O A;  2P4T A;  4BDY A;  2O4X A;  2LCC A;  4BB7 A;  3S3O A;  3OA6 A;  2QQA A;  3PIO A;  2XD0 A;  1YJN T;  4C92 C;  2K5F A;  2KK4 A;  4F7U G;  2K57 A;  3S6W A;  5M9O A;  2DIQ A;  4JS5 A;  5FLX E;  4NS5 A;  4M7D B;  4M78 F;  1FWZ A;  2MI6 A;  2RJC A;  4LDU A;  1BKB A;  3X20 B;  4M7A G;  4M77 E;  2LT4 A;  3OB9 A;  3RKW A;  1G5V A;  4HCZ A;  3TRE A;  2QEX A;  3CMA T;  4A4E A;  4LD9 K;  2RJD A;  2RHZ A;  3HRU A;  2RJF A;  3DLM A;  4MDX A;  4MMK A;  3CBO A;  3GLX A;  3OS0 A;  4X34 A;  2GFU A;  4J8O A;  5GAN 4;  3J81 E;  3HP9 A;  5CKE A;  4XK8 E;  3OYN A;  3L2Q A;  1S72 A;  1JJ2 A;  4RMO A;  3RER A;  2FL7 A;  2QI2 A;  2JNG A;  2KDS A;  1VQ8 T;  5GAN f;  2LT1 A;  1JBM A;  4PJO C;  2VC8 A;  3CCR T;  2L8D A;  3FJP A;  4JLG A;  2DK3 A;  4DOV A;  1NPP A;  5GMK i;  2MMP A;  3C94 A;  3OMC A;  1K8A U;  5LJ3 f;  4PJO B;  4M75 B;  2K3X A;  3OYD A;  3OW2 A;  2GFA A;  1X6O A;  3EFR A;  1YJN A;  1QW1 A;  4P5N A;  3GPL A;  4DOW A;  2XG8 D;  4NOY A;  3L2R A;  4ELZ C;  1UGS B;  1JJ2 S;  2D9T A;  2RI5 A;  1HK9 A;  3QKJ A;  3QO3 A;  1KD1 C;  3OYH A;  3AHU A;  4FIB A;  5CQX A;  3ER0 A;  4PKC C;  4C92 A;  1DJ7 B;  2JTM A;  1WJQ A;  2EJG A;  2JZ2 A;  4M75 G;  5CQY A;  5FRO A;  3OS2 A;  3TU4 K;  5KCO A;  3JCM g;  2ZPF B;  4M78 A;  3V8J A;  1G3Y A;  2DD5 A;  1K73 C;  2XU8 A;  4O5V A;  2DO3 A;  3QDR B;  2EAY A;  5GMK e;  3G71 T;  3NTK A;  5LJ3 j;  2V8K A;  3FLG A;  3OYL A;  3HL8 A;  4Y28 E;  4JS4 A;  3H8Z A;  3OYA A;  3CC7 A;  3JCM W;  4JRI A;  3CCR A;  2PUO B;  3OBW A;  4N4G A;  2X4W A;  3RKX A;  4QW2 A;  4ZGJ B;  3CCE A;  5LJ5 j;  4XTX A;  2FYK A;  1M1K C;  4FSX A;  5A2Q E;  1OYX A;  4RG2 A;  4EMK A;  4D6W A;  5A0G A;  4R55 A;  1NZ9 A;  4JDS A;  3V7C A;  3OYI A;  1JRI A;  3L1A A;  3UPU A;  5FU6 C;  1H3Z A;  2JTF A;  5GAO l;  1WGS A;  3A8G B;  3QG1 A;  1KQS S;  3S3N A;  2PUK B;  3WVD B;  3GP8 A;  3ZFJ A;  5D6Y A;  2QQ9 A;  2EWN A;  3KBG A;  3GOX A;  3JCM J;  2GF7 A;  3GNG A;  3M4Y A;  5DLQ E;  4BY6 B;  1X75 C;  2EYQ A;  3G6E A;  5LL6 S;  1TH7 A;  4C8Q F;  1VQ6 T;  4C0G A;  2DXT A;  3HPW A;  2OAU A;  5CKH A;  4M77 C;  3BFM A;  1M90 C;  1RI0 A;  4QQG A;  4MDW A;  1UGP B;  2CS7 A;  2E64 A;  1YBY A;  2PVD B;  2E6N A;  4KUD K;  3OYM A;  3G7Z A;  1IRE B;  3M9Q A;  2L5Q A;  4DQ2 A;  1ZHI A;  5GAO p;  1N8R C;  2VV5 A;  3QZ9 B;  4BY6 C;  3NTI A;  5J3B A;  5LJ5 h;  2M9U A;  4II1 A;  1VIF A;  3SFM A;  4WF2 A;  3NFC A;  4B9W A;  2Y90 A;  1Q7Y U;  4OB3 B;  4M7D F;  3NTH A;  4OP0 A;  4M77 B;  3JB9 J;  5GAN 8;  4NL2 A;  1Q86 C;  2RI3 A;  1M9S A;  3VYG A;  1QP3 A;  3CME T;  1VQO T;  2XDP A;  4LD6 A;  3T9N A;  2PQW A;  1VIE A;  2WAC A;  2E10 A;  1G3W A;  1M5Q 1;  2WSF E;  3RUX A;  3VUB A;  1VQK T;  4BE2 A;  1O75 A;  1VQ5 T;  1WJS A;  1AHJ B;  2FB7 A;  5A0L A;  3C12 A;  4B9X A;  1N9R A;  2QA4 T;  4Y91 A;  3CEY A;  3A8M B;  2RK2 A;  1UGQ B;  2O01 E;  2X35 A;  3SB2 A;  4KBM B;  2E41 A;  3UDC A;  5LJ3 e;  3RMS A;  3I55 A;  1QVG A;  3QSU A;  2OTL A;  2FHD A;  3SWN C;  4OMF B;  4FM4 B;  2RH2 A;  1WQ7 A;  3HRT A;  1YI2 A;  2XDB A;  1PSE A;  2E12 A;  4RG8 A;  2XID A;  4XU1 A;  2JUF A;  1VQO A;  3WXM B;  2HQE A;  4OB0 B;  4J7I A;  4TVR A;  3JB9 D;  4C0F A;  4PJO E;  4MZT A;  1VQK A;  5EG2 A;  4JJN K;  5LJ3 g;  3VYH B;  1ZBX A;  3G4S T;  1KQ2 A;  1YHQ T;  3SWN B;  2H3J A;  2KSS A;  2V8I A;  5LJ5 d;  2HAX A;  5L8R E;  3A5Z B;  1BIA A;  2LVM A;  4F7U E;  2QA4 A;  4E7H A;  4ATO A;  4M75 E;  3MEA A;  2DXC A;  4X9C A;  3CC2 T;  2EKO A;  4GY5 A;  2VUB A;  3Q1J A;  1M90 U;  4IKF A;  3J80 E;  1M8V A;  4XTU A;  3M55 A;  1BI0 A;  3DKM A;  4OGC A;  4Z02 A;  2KAF A;  4L6V 5;  4N4H A;  3OW2 S;  3X26 B;  4XU3 A;  3CXC S;  1KD1 U;  3I55 T;  4C92 B;  2OTL T;  2YRV A;  2QEX T;  5GAN h;  2RHU A;  1BI1 A;  2XI9 A;  3FDR A;  2EJ9 A;  4J83 A;  2DJZ A;  5D6X A;  4M7D C;  1M1G A;  2YHT A;  3CCL A;  3LX7 A;  2E65 A;  5A0D A;  4C5I A;  4J7F A;  1S72 T;  4M7A A;  3ASK A;  1QVF S;  1VQ7 A;  1GXI E;  2VXE A;  2RI2 A;  3INZ A;  4E47 A;  3HFN A;  5CR2 A;  2DXU A;  2P0P A;  2NLU A;  3LW5 E;  1Q81 C;  3OS5 A;  3QBY A;  3P8B B;  3P8H A;  1Y96 A;  4JUV A;  1NPR A;  2LC4 A;  1M1K U;  3GIB A;  3VJP A;  3L42 A;  1I8F A;  3E19 A;  5C6S A;  1VQM A;  3OMG A;  4N0A A;  1QVF A;  1U1S A;  4JLI A;  3CCM T;  1ZQ1 A;  5GAM e;  3RKY A;  3OYE A;  3F70 A;  4RCB A;  1XQH A;  4PLL A;  2LCL A;  4GLK A;  3LGL A;  1VQP A;  3VV0 A;  1WPY A;  3CCL T;  5FU7 B;  3RMQ A;  5DM7 R;  4FU6 A;  3MEW A;  5DY9 A;  5AYF A;  4C92 G;  3JB9 F;  5I2M A;  3JB9 H;  1YCY A;  1K73 U;  2XIC A;  3FB9 A;  2DKG A;  5KE2 A;  1VQ7 T;  3RES A;  3M53 A;  1YJ9 T;  2MWP A;  1OZ3 A;  4A4H A;  2I2L A;  3OYG A;  2CKK A;  1FXX A;  4LDX A;  5CKB A;  3H6Z A;  5CIU A;  3CCE T;  1W4S A;  4XAX B;  1X01 A;  2EQJ A;  4M78 D;  4HCC A;  1OZ2 A;  4XTY A;  2E5Q A;  4M77 A;  4C8Q E;  4X9D A;  3QYH B;  2DD4 A;  5FU7 C;  1Q86 U;  3N5B B;  2K2V A;  3P8D A;  4C8Q G;  2VXF A;  4BUG A;  4M7A E;  4LDW A;  3M58 A;  1I5L A;  1VQM T;  1YJW A;  3M5A A;  3VU3 C;  2XKO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...