5GAOq

Head region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
72
structure length
72
Chain Sequence
PVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein-associated protein B
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 11
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
q PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gaoq00
4PNOA 4EMKB 4PJOC 5LJ3f 5GMKe 1HK9A 1HXDA 5GMKh 5GAN8 5GAN4 3FB9A 1KQ1A 4XU0A 5GAOl 5LJ5g 5LJ5f 1N9SA 4JUVA 4X9DA 4F7UA 5GANe 5GANh 4C8QC 4M75B 2VC8A 3SWNA 2JN0A 4M77C 3V7RA 3BW1A 4M75F 4WF2A 2DKGA 4J6YA 2DTOA 4XTWA 4EMHA 5GAMf 5GAN6 1BIAA 4J6XA 4M75E 2FYKA 4OP0A 4M7AA 3JB9D 1D3BA 4F7UG 3JCMg 5GANd 4A54A 5GAOq 5GMKj 4RCBA 3SB2A 1LNXA 1BIBA 4A53A 1M8VA 3HFNA 2DEQA 3L1AA 3JCMW 3JB9G 3RERA 4XTZA 2I2LA 3SWNC 4J6WA 5GANj 3JB9H 4NOYA 2CGHA 4NL3A 5GAOm 4C92C 4M7DB 4XU2A 1M5Q1 4NL2A 5LJ3g 1MGQA 3EFRA 2E64A 4EMKA 4M7AG 3JB9J 2E65A 4M7DF 4M78B 2DJZA 4N0AA 5I21A 2EJGA 1LOJA 4C92B 4PJOB 3RKWA 3QUIA 4M78F 4JRKA 2YLBA 4HA8A 3GIBA 4PJOF 2VXEA 2EAYA 4M78E 4MMKA 4XU1A 2YLCA 4DQ2A 5GMKl 4C8QB 3JCMb 1B34A 2QTXA 3L2ZA 4XTVA 3RKXA 4XU3A 4JRIA 4M77B 1Y96A 3V8LA 4C8QF 4RCCA 3JCMJ 4HT8A 2DZ9A 4M75D 3JB9I 2DVEA 1KQ2A 4M77F 1I4K1 4C8QE 1WQWA 1WQ7A 1I81A 1X01A 2ZGWA 4M77E 4C8QD 4QVCA 5GMKi 1WNLA 2DXUA 1I5LA 4M77D 2E10A 3QO3A 4JLIA 3RUXA 2RB6A 3SWNB 4M7AC 2RD1A 3QSUA 2E41A 5GANg 3RKYA 5GANf 3HSBA 4V2SA 4M7DE 5GAN2 5GAMe 1LJOA 1U1TA 2FB7A 4QVDA 3FIFA 4C92F 5GMKm 3JCMQ 4M75A 4M7DD 1WPYA 2K57A 3V7SA 4C92G 5LJ5d 2VXFA 4C92E 4PJOE 3JCMe 2EWNA 3JCMh 3EFSA 4M78D 4XTUA 4C8QA 4EMKC 4C92D 3JCMX 5GAOr 4PJOD 3JCMV 2DTIA 4M78G 4J5YA 2DTHA 4N0AC 4XQ3A 3BFMA 4M77A 5LJ5j 3V8KA 5GAMd 4Y91A 2DXTA 3QHSA 4M75G 4MMLA 5CAIA 1H641 5LJ3h 2DZCA 2HNIA 2RM4A 4M75C 5LJ3e 2EJ9A 3JCMP 3PGGA 4XTXA 5GAMj 4X9CA 4F7UB 3JCMd 3M4GA 5LJ5e 5LJ5h 4C8QG 1JBMA 4M7DA 4F7UF 2RA2A 4HT9A 1N9RA 2Y90A 4M77G 5GAOn 3RIRA 3JB9F 4M7AD 5GAOp 4M78A 4F7UE 1YCYA 1B34B 1I8FA 5LJ3d 2EJFA 4C92A 3INZA 4XTYA 5GAMh 4PJOA 5GAMg 5DY9A 1Y96B 1JRIA 4M7AB 1D3BB 3FJPA 4EMGA 3AHUA 3BY7A 5GAN3 1U1SA 3BDUA 3JCMf 3JCMc 5LJ3j 5GAN7 4M7AF 4M7DG 4M7DC 4M7AE 3V8JA 3VU3C 3RESA 1TH7A 2E1HA 4M78C 2YHTA 5GAN5 4PJOG 3V7CA 3HFOA
chains in the Genus database with same CATH superfamily
4EMKB 1HXDA 2O31A 2QAZA 4X9DA 5GANe 4QQDA 5KCOA 1CKAA 4RG2A 2L3PA 1M2VA 2K3YA 3SWNA 1FWZA 4KGXB 4WF2A 5GAN2 1R77A 4BD3A 3M54A 4QKUA 3REAB 1ZSGA 1K4US 3RERA 1WJSA 1QKWA 2FPDA 1WXBA 4M78B 1M1GA 4PJOB 2XIDA 3KBGA 2C0OA 3GIBA 2OTLQ 3A8MB 1NEBA 4DEYA 1VQPQ 4XTVA 2LCLA 1AEYA 3V8LA 4MDXA 2DZ9A 4M75D 3URGA 1I5OB 4HKEA 1KQ2A 2HQEA 1VQ9Q 2ZGWA 3O5ZA 2COZA 2EQMA 3OS1A 1WHKA 4FT4A 2KAFA 5FLXE 1YNZA 4KBMB 2NUPB 1GL5A 1YIJT 3RKYA 1VQ7Q 3EAEA 1YBYA 2L0AA 2QASA 2HD0A 2ZPBB 2KQWA 4N0AC 1R8OB 3CCLQ 2NYSA 4RTYA 2A28A 1EX4A 2QTVA 1OX9A 3NHNA 1Y71A 2JM8A 3CD6T 1K73C 1GCPA 1X6OA 4OGCA 4HT9A 3QZ5B 1M1FA 3RNJA 3HP9A 1QVGP 1UGRB 3EFOB 1UHCA 1O75A 5C6SA 1YHQT 3FJ5A 1H8KA 4HVVA 4QVCA 2CP3A 3GLXA 3C12A 5I2MA 4QQGA 4N4GA 5EC7A 1HJDA 4ZTJA 2D8HA 3P8HA 2PQWA 4GBQA 2GCXA 2R5AA 8AT1B 2EVRA 4N4HA 4KGVB 1UEBA 3L1AA 2OAUA 4J9IA 2H3EB 2GQIA 1QQJA 3QBYA 5FWBA 5KCHA 5KYUB 5GANj 2WSCE 1GFCA 3JB9J 1SG5A 1G5VA 5CCAA 4D8KA 2M02A 1YJNA 3MPUB 2QGGA 2DNUA 3QXEB 2V1QA 2M51A 2D1XA 3ZFJA 4XU3A 1Y96A 1AWWA 4RTUA 2FZKB 2DA9A 1G3YA 2EKHA 4C8QD 1QCNA 3QWYA 1VQNT 3THKA 4AG1C 1F1BB 4F14A 2L2PA 3JV3A 3MJXA 3SDZA 2RJFA 4ZN1A 5GANg 3CCJQ 5HK3A 3OSSC 1ACMB 4PLIA 2AK5A 1QP2A 1M1KU 2LVMA 3G7ZA 1GFDA 1WJRA 5A0GA 3QKJA 2LNVA 3KUFA 1IHVA 2E6ZA 3VYHB 5FU7C 4OB0B 3OYMA 1ZBXA 5FU7B 2SEMA 3J81E 1VQ4T 5L23A 2Y90A 2DEUA 5GAOp 4D6WA 2FZGB 5LJ3d 2BUDA 4EMGA 3PFSA 4JDSA 2JTMA 3TQ7P 2XI9A 2ZAEA 1M2OA 4E7JA 4DBHA 2E1HA 1AZEA 2V8JA 2K2MA 1GBRA 5ECAA 1KQ1A 2VGNA 1J3TA 3M5AA 4PLLA 2JN0A 2YRVA 4M77C 3OW2P 4KUDK 2QA4T 5GAMf 4ZN3A 4OP0A 4A54A 2MK5A 4RCBA 1Y07A 1TWBA 1UDLA 3HPWA 3CCMQ 3SHWA 1K8AU 3SWNC 4AFSC 3MO8A 4C92C 3EFRA 3E1SA 1W4SA 3VS0A 3IQLA 4C92B 3S3MA 2KDSA 1UB4A 3QUIA 2HEQA 1VQ8Q 4M78E 4XU1A 2DD5A 2BKDN 1AWJA 1C0MA 2RF0A 3TU4K 1VQKT 1MMAA 1PHTA 1S72A 2Z0WA 2RQRA 1M27C 1ZA2B 5IN1A 2YDLA 4DBRA 1IXDA 1PRMC 3CBOA 4JJCA 1MV0B 4M7DE 3EG3A 5DLOA 2K57A 3DLMA 1KC8U 1JJ2S 3GBQA 1KK7A 3QZ9B 1YWPA 1M1KC 1C6VX 2E3HA 1PNJA 1YJWQ 2AT1B 2EJ9A 3PGGA 1GCQA 2CDTA 1D09B 1PCXA 5KYXB 4LDVA 1DJ7B 1I8FA 5GAMh 1T0JA 1D3BB 1G2BA 3RMQA 3G71Q 4A63B 3OYFA 1YFNA 2A36A 3TCJA 1X6GA 1IB8A 2A08A 1VA7A 3VS5A 3U23A 3HFOA 2RI5A 3QYHB 2MYSA 3H8ZA 1YJ9A 1R0BG 3NGPA 3EGXB 1IREB 1RLPC 3H0HA 4M75B 5KE2A 3CCRT 2YT6A 2JVVA 3BW1A 4OB2B 4BACA 3AT1B 3FRNA 4A53A 1KIKA 1Q81R 1VQMA 4OB1B 3M56A 1K8AC 4A4EA 5A0LA 3I56A 3S3NA 3L2UA 2F69A 2RQWA 1QVGS 4BE2A 4EMKA 4M7AG 2KT1A 2E65A 2ROTA 4M78F 3CMEA 2OX7A 4PJOF 2EAYA 1SRLA 1PG5B 2QQRA 2MI6A 2XHCA 3FC3A 1OU9A 1K73R 3R6NA 4ZTFA 1YIJQ 1OYXA 1T3LA 2GFUA 2X9HA 2DXUA 2HQHA 1RACB 4JLIA 4R55A 2RD1A 5HKCA 3OW2A 1RAEB 2O4XB 4KULA 2RJCA 2AKLA 3CBMA 2FG0A 3V7SA 1KC8C 1G3SA 2CT3A 4OMPA 4RG8A 2C06A 4FU6A 2E3IA 2ESWA 3JCMe 3CD6Q 3NPFA 2MWPA 2V8IA 5FWCA 2CUBA 5GAMd 3V8KA 4Y91A 1RAFB 1VYTA 1K9AA 2KGTA 4M7DA 4QQ6A 2XU8A 2QDYB 4M7AB 3CPWS 4DOVA 1MMGA 4Y92A 3C95A 4IURA 2DERA 3TREA 2YHTA 2KE9A 4Q5WA 2OTLA 4FYXB 3OYNA 2ATCB 1VQPA 5GAOl 4XU0A 3MEAA 2DYBA 1I1JA 1WHMA 3I9QA 2CSIA 4C8QC 1VQLT 3OY9A 3RMSA 2VC8A 4ANJA 1NPPA 1VQ9A 2KEAA 4IUTA 1NM7A 4J9BA 2OTJT 1FYNA 4F7UG 5GAOq 3A1PA 2M16A 1VQ7A 1I07A 4JLGA 2K3XA 3EFOA 2EKOA 3M58A 3I55A 5GAOm 2R57A 4KUIA 1BB9A 3M57A 5IT9E 1K76A 2XD0A 3CCLA 1SHGA 2WACA 2RN8A 2HBPA 1T3SA 2YLBA 1VQ5A 2VXEA 4JS4A 3GF5A 2X4XA 1VQNQ 2CP2A 2E70A 2D9TA 4C0DC 3CCVA 5D6WA 3C94A 2DAQA 1ZHIA 2DVEA 1IRXA 2LQKA 1I4K1 1WQWA 1I81A 1X01A 2QQAA 4BY6B 2V1RA 3OW2S 1YWOA 4FM4B 5KYUA 3RUXA 2CZ7B 2RB6A 4V2SA 1QW1A 2PVGB 1K9MU 3L42A 4LNPA 1P92A 3CMAT 3WVDB 3VS3A 4PKCC 3JCMX 1TS9A 2RHZA 1PKSA 2VUBA 1VQ4Q 4CC4B 1VQ8T 1H641 2RM4A 2RNAA 4F7UB 2SRCA 1SEMA 1UTIA 4X1VA 2QI2A 2NUTB 1KFZA 2ZPFB 4M4ZA 4JRQA 1QMCA 3CCEQ 2DRMA 4MZPA 3ME9A 1WXUA 4IIMA 3UA7A 4E6RA 4GY5A 4PJOG 1NPRA 4IIOA 2W0ZA 4OMMA 3CCQT 2KROA 2QA4Q 3RDVA 4PJNA 4FL6A 5LJ5f 2OI3A 2EYZA 3RBBB 3OYAA 2LX7A 2J05A 4M75E 1LVKA 3JB9D 3JCMg 4L59A 4C5GA 3CCJA 2GGRA 5J3BA 2I2LA 4Z02A 4XU2A 1KG1A 3UDCA 2EBPA 4OMFB 3G71T 2RQVA 2LQWA 3C0CA 1M1KR 2K7AA 3UWNA 4PJMA 1AHJB 1HSQA 4HA8A 1VQKQ 5KYYB 1Y7XA 3C4SA 1VQOT 1SSFA 4MZMA 4A4GA 3L2QA 3JCMJ 2K5FA 3O8VA 1UGQB 3TSWA 2F2VA 3D7SB 1OU8A 3RR6A 4LD9K 5IXBA 2O9SA 3LX7A 2A0FB 4ORZA 3QSUA 2HDAA 4LDWA 3PIPA 4GLMA 3P8BB 3BE3A 1K9MC 4Z89A 2CKKA 2E5QA 2COWA 4F16A 2GTOA 4E7KA 2WSEE 1KHCA 1X69A 4QVZA 1TTHB 2QXFA 2JTEA 2VV5A 5LJ3e 2DZCA 2YUNA 5GJVB 1SKUB 1PWTA 3M4GA 5CVIA 5LJ5h 1Q7YU 3CEYA 3CCMA 4KGZB 5GAOn 2F1LA 3OQ5A 1Q81C 2VGMA 1K8AR 3PIOA 4HXJA 5DY9A 3P8DA 5HK0A 2R58A 4M7DC 3CC2T 1NLPC 4M7AE 2X4WA 3VS6A 3CCRQ 3MCAB 2EQJA 2K3BA 5GAN5 3G4ST 2PVOB 4PNOA 5GMKe 4RTTA 2GBQA 4JUVA 3OYKA 3CC7T 5GANh 3EH2A 1Y0MA 1YP5A 5KYXA 3V7RA 4M75F 1K0XA 1FMWA 1BU1A 1NYGA 4C0GA 2X35A 1U06A 3OYHA 4FCYA 1D3BA 1UGVA 3HRSA 2DYIA 3OS2A 4EDUA 4YTLA 3BDLA 3NMZC 3QPHA 4KH1B 1D0XA 1W70A 1M4ZA 3M55A 2HKNA 4FIBA 1KC8R 2EYXA 3HRTA 3QJ6A 5I21A 2EJGA 3VV0A 3JAME 3EGXA 1ZSZC 4TVRA 1YJWA 5M9OA 2KT8A 3JCMb 1B34A 4C0FA 1C1AA 3JB9I 1H92A 3GP8A 1M3CA 3META 2JXBA 4HCKA 1M9SA 2E10A 4E7ZA 2HSEB 1Q86U 4B9XA 2FRYA 3TVTA 3M0SA 2DETA 1PD0A 2ECZA 4II1A 4A4KA 4QVDA 4ELYC 3OYEA 5LJ5d 3H9NA 4FYVB 3VS1A 4DA4A 2EQKA 5CKDA 4XK8E 2QGFB 3JRZA 1RAIB 3QHSA 1SHFA 3A8LB 2ABLA 1O9SA 2LCSA 1XQHA 1Q7YC 3MEUA 4M77G 3CCST 8ATCB 4F7UE 2KXDA 4XTYA 3G6ET 3H6ZA 1U3OA 5LJ3j 4M7AF 2XDDA 1TOVA 3VU3C 1AOJA 1VQLQ 4C92G 2LJ0A 2A7YA 3H0IA 2LC4A 3PT9A 3V7CA 4AT1B 2OTJQ 2HSPA 1YIJA 3EGDA 4FW2A 1OPKA 1OX8A 2DK3A 5HY6A 2ED0A 4DOWA 4M7AA 5GMKj 2AZSA 1QWEA 3EG9A 3I5RA 3JB9G 2DJQA 3M59A 1M30A 1X6BA 5LJ3g 3CCET 3CD6A 3GNGA 4FSSA 4HCZA 2L3RA 2KYBA 4IUQA 3M0TA 2L8DA 3QJYA 1MMNA 2Y4YA 1E6HA 4M77B 2DL3A 2A3LA 4RMOA 1ZLMA 1N6AA 1YHQA 4J8OA 6AT1B 2J6OA 3CMAQ 1M2VB 3SWNB 2JOYA 2ZPIB 1ARKA 2HMAA 1X2KA 1Q86C 3CMET 5GAMe 4ZGEB 4K11A 5KH6A 2RO0A 3QIIA 2JM9A 2KK4A 1VOMA 2NLUA 1YITT 4PJOE 2XDPA 5CKBA 5CKFA 2LDMA 3QYGB 4WTOB 5KYNA 2KBTA 2YUPA 4M75G 4NS5A 2DO3A 2AKKA 2QQ9A 2PZ1A 3FEOA 2OAWA 2JT4A 2HZYA 3L2RA 2F5TX 4F7UF 4B6MA 2X3WD 1K0SA 2DL7A 3NTHA 1MUZA 4KH0B 2RHIA 5CIUA 3CCQQ 5GJWB 1RI0A 3VJPA 1EFNA 1AZGB 3BDUA 3JCMc 5C0MA 1QVFP 3OYDA 1QLYA 3LW5E 3X28B 1TH7A 3CC4T 1HK9A 2DF6A 1WLPB 4R0KA 1VQNA 2P84A 3MP1A 4F7UA 2KMTA 2O88A 5GAN6 1BIAA 4LXCA 1OPLA 5IXFA 2BZYA 1KD1U 4XAXB 2VASA 5HCKA 1XOVA 1K9MR 2L3QA 3CXCP 4O6JA 1VQOQ 1Q82U 3G1JA 3LWHA 2P0QA 4HCCA 1VQ4A 3RKWA 2CREA 3OYCA 4FW1A 4BE0A 3OMGA 2YUQA 2YUOA 2CT4A 4RTXA 1A0NB 4J83A 1WHHA 4QT7A 2JJ9A 2KR3A 3LH0A 1PSEA 4N4IA 3X20B 4HVWA 4UC4A 1VQ5T 4Z88A 2RK2A 3ZL7C 4JJNK 1JO8A 2DIQA 2QA4A 4M7DD 3HTRA 4F17A 4EIKA 2E5KA 1N8RU 3BFMA 2RHXA 2M0YA 2EPDA 3PTAA 5J26A 2QYZA 5KE3A 1UGSB 3EG2A 1JQQA 1FX7A 4XTXA 5GAMj 4C8QG 2CP5A 2BZXA 2D0QB 2JNGA 3CC2Q 4M78A 2EJFA 4PJOA 4J9CA 1Y96B 5CKHA 3G4SQ 3MP6A 5GAN3 3JCMf 4IKFA 1G3WA 3CC7Q 1VQKA 4JRPA 1TU0B 2DFUA 4RTVA 1OULA 5GAN4 1G8XA 3ASKA 1NBEB 2KVQG 1VQ6T 2LT1A 1WGSA 2LMJA 3GPLA 2IG0A 2D6FA 1W6XA 1YI2T 2R5MA 3UA6A 1RUWA 3GOXA 2NUPA 5GAMg 4XTWA 5KYWB 1JXOA 4QW2A 1FMVA 2FYKA 4RTWA 1BKBA 1RL2A 2P4TA 1BIBA 1KD1C 2DLPA 2JMCA 3S6WA 1IO6A 2PUKB 2VB6A 3JB9H 3OBWA 2EGCA 4OF1A 1XTDA 2FO0A 5FU6C 1Q82C 4OMQA 3ZEHA 4N0AA 2DE0X 1RADB 1W1FA 1NG2A 5FU6B 2LJ1A 4LDYA 3ULRB 2EYYA 2K5IA 2DIGA 4DQ2A 4C8QB 4HCBA 2QEXT 1QVFA 3RKXA 3CCUT 2PTKA 3OBYA 3VKIA 1Q7YR 2E6NA 1WQ7A 4PJLA 3LYIA 4M77E 3E9GA 3S3OA 4ME7A 1WHJA 2HAXA 4LE9A 3OYLA 2BE7D 1U1TA 1OZ3A 4PFPA 4J9EA 4C92E 3JCMh 2JUFA 1JU5C 4OMOA 4BUGA 2RQTA 2DTIA 3X25B 4J5YA 2DTHA 2KSSA 4OMNA 3SEMA 3UT1A 1MNDA 3CXCA 3CCSQ 4C0DB 3OYBA 4BDZA 3G6EQ 1AWOA 3VS7A 3MHXA 1JEGA 1OV3A 3INZA 4BDYA 2JW4A 1JRIA 1H3HA 3DLLA 2F5KA 3AHUA 3L2WA 1RAHB 1AD5A 1BYMA 3PNWC 1BK2A 2K4YA 3EHRA 1U8RA 5GAN8 1VYVA 2HL3A 1IGUA 3ER0A 2KXCA 2KNBB 5AYFA 1OOTA 3R6OA 2NWMA 1FMKA 2RHUA 4J6XA 3LH5A 4LUDA 2LCCA 4E47A 4PJJA 4R56A 1CSKA 1N27A 2EIFA 1GCQC 1GRIA 2X51A 3SB2A 1Q86R 3HFNA 2AHJB 1WXTA 4J7FA 5IH2A 2AZVA 3A98A 1RI9A 4ESRA 1PM3A 4C5IA 3I56Q 1D1AA 4E7LA 1NJIU 4JRIA 3FDRA 4CI0C 5A0DA 3HL8A 1Y57A 4M77F 3CMEQ 3NFCA 5GMKi 2F2WA 2EQUA 1WHGA 9ATCB 1YITQ 1BI3A 2MOXA 2E41A 5GANf 2A37A 2J06A 2J6KA 1ZA1B 3FIFA 3MP8A 4C92F 2RK1A 3CXCS 4C5EA 5IHIA 2GNCA 1UG1A 4PL6A 2NUZA 2OTJA 2CYZB 2LRQA 1TUDA 3EHQA 7AT1B 2JZ2A 4XTUA 4EMKC 2MCNA 4M77A 2DXTA 4E2FB 2FEIA 3E9FA 1BCMA 1TUCA 1YJNT 2CH4W 3JB9F 2DPPB 1WI7A 2M1HA 4C92A 2BIVA 3DB4A 1GXIE 4BB7A 3VUBA 1WIEA 3A8HB 4WCIA 3CC4Q 2RQUA 1SSHA 1QVPA 1WHLA 4JJDA 2EGEA 4M78C 1VIFA 1NYFA 1MNEA 2OJ2A 4PJOC 5LJ3f 1JJ2P 4OB3B 5D7UA 3DKMA 1B07A 1UUEA 2C0IA 3TSZA 3CMAA 2LQ8A 3OYYA 2GF7A 5FROA 1VUBA 2YRCA 3EG1A 4BE1A 2YXYA 1PRLC 2CSQA 2ZZDA 3UF4A 1X43A 1VQ8A 4NOYA 5I2SA 4M7DB 1M5Q1 3H0FA 3NTIA 2E64A 1BCOA 2CZ6B 2KRSA 3LLRA 1D1BA 1W2BP 2O2OA 2BZ8A 1Z9QA 5CK9A 3I55Q 1NJIC 2QTXA 1UGPB 1BI0A 1RAAB 1XNIA 1M90U 3N5BB 4C8QE 1VQ5Q 1QCFA 3CCQA 2P4RA 3CCVQ 2XMFA 3A8GB 4J9DA 2AIRB 4HVUA 2DM1A 4J7IA 1LJOA 2GFAA 3JCMQ 4M75A 3QDRB 1ZSZB 2XK0A 2EWNA 5GAOr 1T0HA 1PC0A 4XQ3A 5LJ5j 1QP3A 4B9WA 2DILA 2JTFA 3PE0A 2LX9A 5FW9A 5LJ3h 5A2QE 4OGEA 2KRMA 3G71A 3M0QA 1JBMA 2RA2A 3KXTA 1V1CA 2L89A 2O01E 1KD1R 2FPFA 1UJ0A 2YSQA 3OYIA 1VQOA 5CR2A 1Q82R 5IAYA 3BY7A 4O5VA 1VQ6Q 3QDFA 3PVQA 2J6FA 1S72T 1YI2Q 3UATA 4M7AD 5GMKh 2CZ0B 3FLGA 2J7IA 2M9UA 5CO7A 4Y28E 3T9NA 5LJ5g 2RJEA 4LN2A 2DMOA 4J9FA 4E7HA 2VWFA 2DTOA 2EYQA 4RTZA 1LPLA 2O4XA 4FT2A 2PUOB 5GANd 1YCSB 2LZ6B 1M8VA 1S1NA 4J9HA 3OSVA 2DEQA 2D8JA 2G6FX 3OYGA 2ZCFB 4ELZC 2E12A 3CPWP 4CC3A 4C0ZA 1Q95G 1XJWB 2QEXQ 4AFQC 4AFZC 2V26A 3CCUQ 4RUGA 1PKTA 1N8RR 4MZTA 4CC2A 2EGAA 4MMKA 3I35A 3LGLA 3QG1A 5GMKl 5KYWA 4L6V5 4C8QF 1M90C 1SF9A 3CC2A 2QQBA 1JJ2A 1TG0A 3G4SA 4FYWB 1YJ9T 2EFIA 1BBZA 1ZUUA 1ZX6A 1I5LA 3M0UA 3REBB 4JS5A 1ABOA 4RKUE 3CC7A 3J7AF 3OMCA 4X34A 3HSBA 3A5ZB 3E19A 2DD4A 1WFWA 5GMKm 3WVEB 4ZGDB 4BI4A 4PFZA 2DX1A 1B7TA 4PK4A 4C8QA 2CP0A 3SFMA 2MF2A 1VQMT 1ZBJA 1D1CA 4IUPA 2PNIA 4MMLA 5IHNA 5CAIA 3I56T 2HNIA 2LP5A 5L8RE 1WJQA 1W2BA 1E6GA 2B8AA 2P0PA 2DRKA 4C5HA 3EGUA 5DM7R 1N9RA 1KQSP 1G3TA 1YCYA 2CH4A 4F04B 1TUGB 3ZBDA 3MEWA 2BTTA 2HKQB 3OB9A 2VYTA 2CUDA 2CP7A 3V8JA 4A4HA 4ZGJB 2YRDA 1NEGA 1M8MA 2H3JA 2XDBA 2RPNA 3FB9A 4DBQA 2MIOA 1MV3A 1SPKA 1H3ZA 4Z8AA 2L3SA 1AT1B 1QVGA 2DKGA 4EMHA 1CKBA 5CQXA 3F70A 4DEXA 1ZUKA 5D6YA 2G3RA 3CQTA 4JPBW 1UJYA 4D8DA 3JCMW 5I11A 1KSWA 4J6WA 4NL3A 2RJDA 4NL2A 1MGQA 5AT1B 1K1ZA 5IHKA 2C0TA 2DJZA 2MAMA 4ZNXA 1M3AA 2RI3A 4JRKA 3CCSA 5D6XA 3KFVA 3HKSA 2ENMA 1HYOA 2NUTA 4E7SA 3G6EA 4OMLA 5EG2A 1WYXA 3L2ZA 2D0NA 5CQYA 4GLKA 1M3BA 2MWOA 1NZ9A 2OTLT 1D0ZA 1VQPT 3JSCA 1VQ9T 3Q1JA 4LUEA 1IHWA 2VXFA 3CBPA 3EFSA 4M78D 1LCKA 3VYGA 1W2BS 2XG8D 4PJOD 3JCMV 1VQ7T 2QQSA 1RABB 3CPWA 2I0NA 2COYA 2XKOC 1YJNQ 1D0YA 3I55T 4M75C 3NTKA 2CP6A 2ED1A 3JCMP 3SD4A 4X9CA 2X4YA 3CCEA 2E4HA 2RMOA 3CCLT 1X27A 2QDLA 1RAGB 2LQNA 3H41A 1B34B 1V76A 1NLOC 3TEEA 4CRIA 1NE8A 3M0PA 1IZ6A 2FVUA 1KJWA 5KYYA 2CS7A 3CCVT 5GAN7 2JS2A 2EQIA 2MMPA 1G83A 2ZPGB 1UFFA 2V8KA 2K5LA 3J80E 4DBFA 1NJIR 2X3XD 4ATOA 3VRYA 1E7OA 2JS0A 1I0CA 2K9GA 2HL5C 2FL7A 1YITA 3GNFB 1BI1A 3I5SA 2ZPEB 3EH1A 3HRUA 5LL6S 1B3QA 3EG0A 4VUBA 2LJ3A 1KQSA 4IUVA 4M7DF 2EW3A 3HHTB 2KRNA 3QWXX 2L5QA 5I22A 1QKXA 1JXMA 2KY9A 1EZZB 2DXBA 1WA7A 2HBWA 4LDUA 2RHYA 4E7IA 2DXCA 4RCCA 1R0CB 2FRWA 2LTOA 2CZ1B 3MKDA 3OS5A 5CKEA 4A4FA 1N5ZA 2DL4A 1RLQC 1WNLA 3LGFA 1OEBA 3CC4A 5FRNA 3EGDB 1KHIA 2IIMA 2QK0A 2RI2A 2W10A 4AFUC 4M7AC 1YHQQ 1OQKA 2PU9B 3PMIA 1HD3A 2LNHB 3EG9B 4AMCA 1U5SA 2KI7A 1TXQA 2K2VA 1GBQA 3CCJT 2O9VA 1WZOA 2LT4A 1YN8A 2DVJA 3M53A 1JB0E 1VIEA 2F2XA 3L2VA 3OS0A 1QCOA 3RIRA 2K6DA 3CCRA 1S72Q 1AVZC 2K79A 2BE9B 2GTJA 3VUZA 5FRMA 3FJPA 1PSFA 4FSXA 2RH2A 2Y4XA 1ABQA 1ZUYA 2ROLA 1ZSZA 4MDWA 1N8RC 5DLQE 4OVAA 2EYWA 3M9QA 2DL8A 1UE9A 1MMDA 4JZ4A 2XICA 1N9SA 1SRMA 2M0OA 1M90R 4LDXA 1BI2A 4J6YA 2FZCB 3OYJA 4PFOA 4BY6C 1V29B 1X2QA 1ZQ1A 2DBKA 2VVKA 3OA6A 1KQSS 1LNXA 4IUUA 1OI1A 4XTZA 3VS2A 4EPCA 3LWIA 2JMAA 2CGHA 1VYUA 1OZ2A 3WXMB 3VS4A 1LOJA 3CCMT 3PVLA 1MHNA 1Z9ZA 2IPOB 2YLCA 4J9GA 2HQXA 2KYMA 1YJ9Q 2VKNA 2FPEA 1UHFA 1AWXA 4HT8A 4KRTA 4AG2C 1FXXA 2PVDB 4M77D 4JJBA 3QO3A 4BI8B 1PD1A 1VQ6A 3X26B 1QVFS 1QWFA 1X75C 1Q81U 3PMTA 2WSFE 1YI2A 1VQMQ 2GQVA 3M0RA 2FB7A 5J39A 1WPYA 1WX6A 2IVWA 2MPXC 3E2UA 2QG9B 3X24B 3VRZA 1IGQA 2P0KA 4C92D 4LD6A 4BI3A 4M78G 2DL5A 3CPFA 4KT0E 2ZPHB 2FHDA 3JCMd 1K73U 5LJ5e 3UPUA 1UECA 3DB3A 1YJWT 1VQLA 1TSFA 2H8HA 2B86A 4JZ3A 3M4YA 1WDXA 2DBMA 2QEXA 3MEVA 1U1SA 4L5GA 4M7DG 4CC7A 3CCUA 3A8OB 2X4JA 4FYYB 1EIFA 3RESA 2HCKA 2YWWA 4P5NA
chains in the Genus database with same CATH topology
4EMKB 3OYNA 3CC4T 1VQPA 1HK9A 1HXDA 5GMKh 1VQNA 2CZ0B 3FLGA 5GAOl 4XU0A 2M9UA 3MEAA 5CO7A 4Y28E 3T9NA 5LJ5g 3MP1A 4X9DA 4F7UA 2RJEA 5GANe 4C8QC 2KMTA 4QQDA 1VQLT 3OY9A 5KCOA 3RMSA 2VC8A 4RG2A 1NPPA 4E7HA 1VQ9A 2K3YA 3SWNA 1FWZA 4WF2A 5GAN6 5GAN2 2DTOA 2EYQA 1BIAA 4IUTA 4BD3A 2O4XA 4FT2A 3M54A 2OTJT 2PUOB 4F7UG 5GANd 5GAOq 1M8VA 2M16A 3OSVA 1VQ7A 2DEQA 1KD1U 3RERA 4JLGA 2K3XA 4XAXB 3OYGA 1XOVA 1WJSA 2ZCFB 2EKOA 4ELZC 3M58A 2E12A 3I55A 5GAOm 2R57A 4C0ZA 4KUIA 4O6JA 1Q82U 3M57A 3LWHA 4M78B 5IT9E 2P0QA 4HCCA 2XD0A 1M1GA 3CCLA 1VQ4A 4PJOB 2WACA 3RKWA 2XIDA 2HBPA 4MZTA 3OYCA 3KBGA 2YLBA 1VQ5A 3GIBA 2VXEA 4MMKA 3LGLA 4JS4A 4BE0A 3OMGA 3QG1A 3GF5A 3A8MB 5GMKl 2X4XA 2E70A 4L6V5 4XTVA 2D9TA 4C0DC 2LCLA 3CCVA 5D6WA 3C94A 3V8LA 2DAQA 4C8QF 4MDXA 1M90C 2DZ9A 1ZHIA 4M75D 3URGA 3CC2A 4HKEA 2DVEA 1KQ2A 2LQKA 1I4K1 1WQWA 1I81A 1X01A 2HQEA 2QQAA 4BY6B 2QQBA 2ZGWA 4J83A 3OW2S 1JJ2A 3G4SA 1YJ9T 2EFIA 2EQMA 3OS1A 1I5LA 4FM4B 4FT4A 2KAFA 3LH0A 4JS5A 3RUXA 1PSEA 2CZ7B 5FLXE 4N4IA 4KBMB 2RB6A 4RKUE 3X20B 1YIJT 3CC7A 3J7AF 3OMCA 4UC4A 4X34A 1VQ5T 3RKYA 3HSBA 3A5ZB 4V2SA 3EAEA 3E19A 1YBYA 2RK2A 1QW1A 2DD4A 2PVGB 4JJNK 5GMKm 1K9MU 2DIQA 3L42A 3WVEB 4BI4A 4ZGDB 2QA4A 4M7DD 1P92A 2HD0A 3CMAT 2ZPBB 2KQWA 3WVDB 4C8QA 3SFMA 4PKCC 2MF2A 3JCMX 2RHZA 4N0AC 2VUBA 1R8OB 3BFMA 2RHXA 1VQMT 1N8RU 3PTAA 1VQ8T 4IUPA 5J26A 4MMLA 5CAIA 3I56T 1H641 2HNIA 2RM4A 5KE3A 5L8RE 1WJQA 1UGSB 4XTXA 1Y71A 1FX7A 4F7UB 5GAMj 1K73C 1W2BA 3CD6T 4C8QG 1X6OA 2B8AA 2P0PA 2D0QB 4OGCA 2QI2A 4C5HA 1N9RA 5DM7R 4HT9A 2JNGA 1G3TA 2ZPFB 3QZ5B 1YCYA 4M78A 1M1FA 2EJFA 3HP9A 4PJOA 4JRQA 1Y96B 5CKHA 3ZBDA 3MEWA 4MZPA 1UGRB 3MP6A 5GAN3 3JCMf 3ME9A 4IKFA 3OB9A 1G3WA 2VYTA 1O75A 3V8JA 5C6SA 1YHQT 1VQKA 4JRPA 4A4HA 4GY5A 4PJOG 4QVCA 1NPRA 3GLXA 4ZGJB 3C12A 3CCQT 5GAN4 2H3JA 2XDBA 3FB9A 3ASKA 4FL6A 2KVQG 5LJ5f 2LT1A 5I2MA 1VQ6T 4QQGA 1WGSA 4N4GA 3GPLA 2IG0A 2D6FA 1YI2T 2R5MA 4ZTJA 1H3ZA 3OYAA 3GOXA 1QVGA 5GAMg 2DKGA 3P8HA 4XTWA 4EMHA 2PQWA 5CQXA 3F70A 4QW2A 4M75E 2FYKA 2GCXA 2R5AA 4N4HA 1BKBA 3JB9D 3JCMg 1RL2A 2G3RA 2P4TA 4L59A 5D6YA 4C5GA 1BIBA 3CCJA 1KD1C 1UEBA 3L1AA 2OAUA 3JCMW 3S6WA 5J3BA 2I2LA 4Z02A 4J6WA 5KCHA 3QBYA 2PUKB 5GANj 3JB9H 4NL3A 2WSCE 3OBWA 2RJDA 4OF1A 4XU2A 4NL2A 3UDCA 1XTDA 1MGQA 1Q82C 5FU6C 1KG1A 4OMFB 3G71T 3ZEHA 3JB9J 2DJZA 4N0AA 5CCAA 1G5VA 3UWNA 2MAMA 5FU6B 1AHJB 2RI3A 4HA8A 4JRKA 4LDYA 5D6XA 3CCSA 1YJNA 1Y7XA 3HKSA 3C4SA 2K5IA 3QXEB 2DIGA 1VQOT 3G6EA 4DQ2A 1SSFA 4C8QB 4HCBA 3ZFJA 5EG2A 2QEXT 3L2ZA 1QVFA 5CQYA 4MZMA 3RKXA 4A4GA 4GLKA 4XU3A 3CCUT 3OBYA 1Y96A 1NZ9A 2MWOA 3VKIA 3L2QA 3JCMJ 2K5FA 3O8VA 2E6NA 1WQ7A 2OTLT 3LYIA 1UGQB 1G3YA 4M77E 4C8QD 3E9GA 1VQPT 1VQNT 3S3OA 4LD9K 3SDZA 3JSCA 4ME7A 2RJFA 3LX7A 4ZN1A 3QSUA 5GANg 2HAXA 4LDWA 5HK3A 3OSSC 3PIPA 3P8BB 3OYLA 1VQ9T 1K9MC 1U1TA 1OZ3A 4PLIA 1QP2A 3Q1JA 2CKKA 2VXFA 4C92E 2E5QA 3CBPA 3JCMh 4E7KA 3EFSA 2JUFA 2WSEE 4M78D 1M1KU 3VYGA 4BUGA 1KHCA 2LVMA 1W2BS 2XG8D 4PJOD 3JCMV 2DTIA 2QQSA 3G7ZA 2DTHA 2KSSA 4J5YA 4QVZA 3X25B 3UT1A 2QXFA 1WJRA 3CPWA 5A0GA 3QKJA 2LNVA 2XKOC 3KUFA 3CXCA 2E6ZA 2VV5A 3VYHB 4C0DB 5FU7C 5LJ3e 2DZCA 3I55T 4M75C 3NTKA 3OYBA 3JCMP 3SD4A 4BDZA 4X9CA 2X4YA 4OB0B 3CCEA 3M4GA 5CVIA 5LJ5h 3OYMA 1ZBXA 5FU7B 3J81E 3MHXA 3CCLT 1VQ4T 1Q7YU 3CEYA 3CCMA 2Y90A 5GAOn 3OQ5A 1Q81C 5GAOp 4D6WA 2VGMA 1B34B 5LJ3d 3TEEA 3PIOA 3INZA 4BDYA 4CRIA 1NE8A 5DY9A 1JRIA 1IZ6A 2FVUA 2BUDA 3P8DA 4EMGA 5HK0A 3DLLA 2F5KA 3AHUA 2CS7A 3CCVT 2R58A 3L2WA 5GAN7 3PFSA 4JDSA 2JTMA 4M7DC 3CC2T 2XI9A 2MMPA 4M7AE 2X4WA 4E7JA 2E1HA 1BYMA 3PNWC 3MCAB 2EQJA 2K4YA 2V8KA 2ZPGB 2K5LA 2PVOB 2V8JA 4PNOA 5GAN5 3G4ST 1U8RA 5GMKe 5GAN8 3J80E 1KQ1A 4JUVA 3OYKA 3ER0A 4ATOA 3CC7T 5GANh 2VGNA 5AYFA 3R6OA 3M5AA 4PLLA 2JN0A 2YRVA 4M77C 3V7RA 4M75F 2QA4T 4KUDK 5GAMf 2RHUA 4J6XA 4C0GA 2FL7A 2LCCA 2X35A 4E47A 3GNFB 4ZN3A 4R56A 3OYHA 4OP0A 1BI1A 1YITA 1D3BA 1N27A 2EIFA 4A54A 3HRSA 4RCBA 3SB2A 1Y07A 4EDUA 2ZPEB 3OS2A 3HFNA 3HPWA 3HRUA 5LL6S 4YTLA 3BDLA 2AHJB 3QPHA 4J7FA 4VUBA 1K8AU 3SWNC 3MO8A 4C92C 3EFRA 1M4ZA 3M55A 4FIBA 3E1SA 1KQSA 4IUVA 1W4SA 3HRTA 4M7DF 3HHTB 3QJ6A 5I21A 2EJGA 3VV0A 4C92B 3JAME 3S3MA 2KDSA 1UB4A 3QUIA 4TVRA 4C5IA 2L5QA 1YJWA 4M78E 2KY9A 4XU1A 5M9OA 2DXBA 4E7LA 3JCMb 4LDUA 2DD5A 1B34A 2BKDN 1NJIU 2RHYA 4E7IA 1VQ7T 4JRIA 3FDRA 2DXCA 4C0FA 4RCCA 4CI0C 5A0DA 3TU4K 3JB9I 3HL8A 1VQKT 2LTOA 4M77F 1S72A 2CZ1B 3OS5A 3NFCA 5CKEA 4A4FA 3GP8A 5GMKi 3META 1WNLA 3LGFA 3CC4A 5FRNA 5IN1A 1KHIA 1M9SA 2E10A 2EQUA 2RI2A 3CBOA 1BI3A 4M7AC 1Q86U 2E41A 4B9XA 5GANf 4M7DE 4II1A 4A4KA 4QVDA 3FIFA 3MP8A 2PU9B 4C92F 2RK1A 5DLOA 4ELYC 3CXCS 4C5EA 3PMIA 2K57A 3OYEA 5LJ5d 3DLMA 4PL6A 1KC8U 1JJ2S 4DA4A 2OTJA 2CYZB 2EQKA 2LRQA 2K2VA 3QZ9B 2JZ2A 4XTUA 4EMKC 5CKDA 1M1KC 3CCJT 4XK8E 3JRZA 4M77A 2DXTA 2LT4A 3QHSA 3A8LB 2EJ9A 3PGGA 1O9SA 3E9FA 3M53A 1JB0E 1VIEA 1XQHA 1Q7YC 3MEUA 4LDVA 1DJ7B 4M77G 3L2VA 3OS0A 1YJNT 3RIRA 3CCST 3JB9F 2DPPB 4F7UE 3CCRA 2M1HA 1I8FA 4C92A 5GAMh 2BIVA 4XTYA 3DB4A 1GXIE 4BB7A 3G6ET 3H6ZA 1D3BB 3VUBA 3FJPA 3VUZA 5FRMA 3A8HB 1PSFA 4FSXA 2RH2A 2Y4XA 3RMQA 5LJ3j 4M7AF 1QVPA 2XDDA 3OYFA 3TCJA 4MDWA 3VU3C 1N8RC 4M78C 5DLQE 1VIFA 4C92G 2A7YA 3HFOA 2LC4A 2RI5A 3PT9A 4OVAA 3V7CA 5LJ3f 4PJOC 3QYHB 3H8ZA 3M9QA 1YJ9A 4OB3B 2XICA 1N9SA 3DKMA 1IREB 1YIJA 2M0OA 4M75B 5KE2A 3CCRT 4LDXA 2JVVA 2DK3A 1BI2A 5HY6A 3BW1A 4OB2B 4J6YA 4BACA 3OYJA 4BY6C 1V29B 3FRNA 3CMAA 4DOWA 4M7AA 2LQ8A 1ZQ1A 3OYYA 5GMKj 3OA6A 2GF7A 1LNXA 4A53A 4IUUA 1VUBA 5FROA 4BE1A 3JB9G 1KQSS 1VQMA 1OI1A 3M59A 4OB1B 3M56A 4XTZA 2ZZDA 1K8AC 4A4EA 4EPCA 3LWIA 1VQ8A 4NOYA 5A0LA 2CGHA 5I2SA 3I56A 3L2UA 3S3NA 2F69A 4M7DB 5LJ3g 1M5Q1 1QVGS 3CCET 1OZ2A 3CD6A 3GNGA 2E64A 3NTIA 2CZ6B 3LLRA 4HCZA 4EMKA 2E65A 2L3RA 3WXMB 4BE2A 4M7AG 4IUQA 1LOJA 3CCMT 4M78F 3QJYA 2L8DA 3CMEA 1MHNA 5CK9A 4PJOF 2EAYA 2QQRA 2MI6A 2XHCA 2C06A 2YLCA 2HQXA 1NJIC 2Y4YA 2QTXA 3FC3A 1UGPB 1BI0A 4M77B 4HT8A 1XNIA 4ZTFA 1M90U 3N5BB 2A3LA 4RMOA 1OYXA 4C8QE 1N6AA 1YHQA 2GFUA 4J8OA 3CCQA 2DXUA 1FXXA 2PVDB 4M77D 3QO3A 4BI8B 4JLIA 1VQ6A 3SWNB 2JOYA 2ZPIB 3A8GB 3X26B 2RD1A 4R55A 1Q86C 5HKCA 3CMET 3OW2A 1QVFS 1X75C 1Q81U 3PMTA 2WSFE 2O4XB 5GAMe 1YI2A 4KULA 2GQVA 1LJOA 2FB7A 2GFAA 4J7IA 4ZGEB 2RJCA 5J39A 3JCMQ 4M75A 5KH6A 2RO0A 3CBMA 1WPYA 2IVWA 2KK4A 2NLUA 3QIIA 1G3SA 3V7SA 3X24B 4RG8A 1YITT 3QDRB 4FU6A 1KC8C 2P0KA 2XK0A 2EWNA 2XDPA 3JCMe 4PJOE 2MWPA 5CKBA 4C92D 2V8IA 4LD6A 5CKFA 4BI3A 5GAOr 4M78G 4XQ3A 5LJ5j 2LDMA 1QP3A 3CPFA 4B9WA 3QYGB 2JTFA 3V8KA 5GAMd 2LX9A 4Y91A 4KT0E 4M75G 2ZPHB 5LJ3h 4NS5A 2DO3A 5A2QE 2FHDA 2QQ9A 4OGEA 3JCMd 1K73U 3FEOA 5LJ5e 3G71A 1JBMA 3L2RA 4M7DA 2F5TX 3UPUA 4F7UF 2RA2A 4QQ6A 3KXTA 2L89A 2O01E 3DB3A 2XU8A 1YJWT 1VQLA 2QDYB 3NTHA 4M7AB 3OYIA 4DOVA 3M4YA 2RHIA 5CIUA 3CPWS 1VQOA 1RI0A 5CR2A 3VJPA 3BY7A 5IAYA 3MEVA 2QEXA 1U1SA 3BDUA 3C95A 4L5GA 3JCMc 4O5VA 5C0MA 4IURA 3A8OB 2X4JA 3CCUA 4M7DG 3OYDA 3LW5E 3X28B 1EIFA 3RESA 1TH7A 1S72T 3TREA 2YHTA 4Q5WA 4M7AD 2OTLA 4P5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PNO A;  4EMK B;  4PJO C;  5LJ3 f;  5GMK e;  1HK9 A;  1HXD A;  5GMK h;  5GAN 8;  5GAN 4;  3FB9 A;  1KQ1 A;  4XU0 A;  5GAO l;  5LJ5 g;  5LJ5 f;  1N9S A;  4JUV A;  4X9D A;  4F7U A;  5GAN e;  5GAN h;  4C8Q C;  4M75 B;  2VC8 A;  3SWN A;  2JN0 A;  4M77 C;  3V7R A;  3BW1 A;  4M75 F;  4WF2 A;  2DKG A;  4J6Y A;  2DTO A;  4XTW A;  4EMH A;  5GAM f;  5GAN 6;  1BIA A;  4J6X A;  4M75 E;  2FYK A;  4OP0 A;  4M7A A;  3JB9 D;  1D3B A;  4F7U G;  3JCM g;  5GAN d;  4A54 A;  5GAO q;  5GMK j;  4RCB A;  3SB2 A;  1LNX A;  1BIB A;  4A53 A;  1M8V A;  3HFN A;  2DEQ A;  3L1A A;  3JCM W;  3JB9 G;  3RER A;  4XTZ A;  2I2L A;  3SWN C;  4J6W A;  5GAN j;  3JB9 H;  4NOY A;  2CGH A;  4NL3 A;  5GAO m;  4C92 C;  4M7D B;  4XU2 A;  1M5Q 1;  4NL2 A;  5LJ3 g;  1MGQ A;  3EFR A;  2E64 A;  4EMK A;  4M7A G;  3JB9 J;  2E65 A;  4M7D F;  4M78 B;  2DJZ A;  4N0A A;  5I21 A;  2EJG A;  1LOJ A;  4C92 B;  4PJO B;  3RKW A;  3QUI A;  4M78 F;  4JRK A;  2YLB A;  4HA8 A;  3GIB A;  4PJO F;  2VXE A;  2EAY A;  4M78 E;  4MMK A;  4XU1 A;  2YLC A;  4DQ2 A;  5GMK l;  4C8Q B;  3JCM b;  1B34 A;  2QTX A;  3L2Z A;  4XTV A;  3RKX A;  4XU3 A;  4JRI A;  4M77 B;  1Y96 A;  3V8L A;  4C8Q F;  4RCC A;  3JCM J;  4HT8 A;  2DZ9 A;  4M75 D;  3JB9 I;  2DVE A;  1KQ2 A;  4M77 F;  1I4K 1;  4C8Q E;  1WQW A;  1WQ7 A;  1I81 A;  1X01 A;  2ZGW A;  4M77 E;  4C8Q D;  4QVC A;  5GMK i;  1WNL A;  2DXU A;  1I5L A;  4M77 D;  2E10 A;  3QO3 A;  4JLI A;  3RUX A;  2RB6 A;  3SWN B;  4M7A C;  2RD1 A;  3QSU A;  2E41 A;  5GAN g;  3RKY A;  5GAN f;  3HSB A;  4V2S A;  4M7D E;  5GAN 2;  5GAM e;  1LJO A;  1U1T A;  2FB7 A;  4QVD A;  3FIF A;  4C92 F;  5GMK m;  3JCM Q;  4M75 A;  4M7D D;  1WPY A;  2K57 A;  3V7S A;  4C92 G;  5LJ5 d;  2VXF A;  4C92 E;  4PJO E;  3JCM e;  2EWN A;  3JCM h;  3EFS A;  4M78 D;  4XTU A;  4C8Q A;  4EMK C;  4C92 D;  3JCM X;  5GAO r;  4PJO D;  3JCM V;  2DTI A;  4M78 G;  4J5Y A;  2DTH A;  4N0A C;  4XQ3 A;  3BFM A;  4M77 A;  5LJ5 j;  3V8K A;  5GAM d;  4Y91 A;  2DXT A;  3QHS A;  4M75 G;  4MML A;  5CAI A;  1H64 1;  5LJ3 h;  2DZC A;  2HNI A;  2RM4 A;  4M75 C;  5LJ3 e;  2EJ9 A;  3JCM P;  3PGG A;  4XTX A;  5GAM j;  4X9C A;  4F7U B;  3JCM d;  3M4G A;  5LJ5 e;  5LJ5 h;  4C8Q G;  1JBM A;  4M7D A;  4F7U F;  2RA2 A;  4HT9 A;  1N9R A;  2Y90 A;  4M77 G;  5GAO n;  3RIR A;  3JB9 F;  4M7A D;  5GAO p;  4M78 A;  4F7U E;  1YCY A;  1B34 B;  1I8F A;  5LJ3 d;  2EJF A;  4C92 A;  3INZ A;  4XTY A;  5GAM h;  4PJO A;  5GAM g;  5DY9 A;  1Y96 B;  1JRI A;  4M7A B;  1D3B B;  3FJP A;  4EMG A;  3AHU A;  3BY7 A;  5GAN 3;  1U1S A;  3BDU A;  3JCM f;  3JCM c;  5LJ3 j;  5GAN 7;  4M7A F;  4M7D G;  4M7D C;  4M7A E;  3V8J A;  3VU3 C;  3RES A;  1TH7 A;  2E1H A;  4M78 C;  2YHT A;  5GAN 5;  4PJO G;  3V7C A;  3HFO A; 
#chains in the Genus database with same CATH topology
 4EMK B;  1HXD A;  2O31 A;  2QAZ A;  4X9D A;  5GAN e;  4QQD A;  5KCO A;  1CKA A;  4RG2 A;  2L3P A;  1M2V A;  2K3Y A;  3SWN A;  1FWZ A;  4KGX B;  4WF2 A;  5GAN 2;  1R77 A;  4BD3 A;  3M54 A;  4QKU A;  3REA B;  1ZSG A;  1K4U S;  3RER A;  1WJS A;  1QKW A;  2FPD A;  1WXB A;  4M78 B;  1M1G A;  4PJO B;  2XID A;  3KBG A;  2C0O A;  3GIB A;  2OTL Q;  3A8M B;  1NEB A;  4DEY A;  1VQP Q;  4XTV A;  2LCL A;  1AEY A;  3V8L A;  4MDX A;  2DZ9 A;  4M75 D;  3URG A;  1I5O B;  4HKE A;  1KQ2 A;  2HQE A;  1VQ9 Q;  2ZGW A;  3O5Z A;  2COZ A;  2EQM A;  3OS1 A;  1WHK A;  4FT4 A;  2KAF A;  5FLX E;  1YNZ A;  4KBM B;  2NUP B;  1GL5 A;  1YIJ T;  3RKY A;  1VQ7 Q;  3EAE A;  1YBY A;  2L0A A;  2QAS A;  2HD0 A;  2ZPB B;  2KQW A;  4N0A C;  1R8O B;  3CCL Q;  2NYS A;  4RTY A;  2A28 A;  1EX4 A;  2QTV A;  1OX9 A;  3NHN A;  1Y71 A;  2JM8 A;  3CD6 T;  1K73 C;  1GCP A;  1X6O A;  4OGC A;  4HT9 A;  3QZ5 B;  1M1F A;  3RNJ A;  3HP9 A;  1QVG P;  1UGR B;  3EFO B;  1UHC A;  1O75 A;  5C6S A;  1YHQ T;  3FJ5 A;  1H8K A;  4HVV A;  4QVC A;  2CP3 A;  3GLX A;  3C12 A;  5I2M A;  4QQG A;  4N4G A;  5EC7 A;  1HJD A;  4ZTJ A;  2D8H A;  3P8H A;  2PQW A;  4GBQ A;  2GCX A;  2R5A A;  8AT1 B;  2EVR A;  4N4H A;  4KGV B;  1UEB A;  3L1A A;  2OAU A;  4J9I A;  2H3E B;  2GQI A;  1QQJ A;  3QBY A;  5FWB A;  5KCH A;  5KYU B;  5GAN j;  2WSC E;  1GFC A;  3JB9 J;  1SG5 A;  1G5V A;  5CCA A;  4D8K A;  2M02 A;  1YJN A;  3MPU B;  2QGG A;  2DNU A;  3QXE B;  2V1Q A;  2M51 A;  2D1X A;  3ZFJ A;  4XU3 A;  1Y96 A;  1AWW A;  4RTU A;  2FZK B;  2DA9 A;  1G3Y A;  2EKH A;  4C8Q D;  1QCN A;  3QWY A;  1VQN T;  3THK A;  4AG1 C;  1F1B B;  4F14 A;  2L2P A;  3JV3 A;  3MJX A;  3SDZ A;  2RJF A;  4ZN1 A;  5GAN g;  3CCJ Q;  5HK3 A;  3OSS C;  1ACM B;  4PLI A;  2AK5 A;  1QP2 A;  1M1K U;  2LVM A;  3G7Z A;  1GFD A;  1WJR A;  5A0G A;  3QKJ A;  2LNV A;  3KUF A;  1IHV A;  2E6Z A;  3VYH B;  5FU7 C;  4OB0 B;  3OYM A;  1ZBX A;  5FU7 B;  2SEM A;  3J81 E;  1VQ4 T;  5L23 A;  2Y90 A;  2DEU A;  5GAO p;  4D6W A;  2FZG B;  5LJ3 d;  2BUD A;  4EMG A;  3PFS A;  4JDS A;  2JTM A;  3TQ7 P;  2XI9 A;  2ZAE A;  1M2O A;  4E7J A;  4DBH A;  2E1H A;  1AZE A;  2V8J A;  2K2M A;  1GBR A;  5ECA A;  1KQ1 A;  2VGN A;  1J3T A;  3M5A A;  4PLL A;  2JN0 A;  2YRV A;  4M77 C;  3OW2 P;  4KUD K;  2QA4 T;  5GAM f;  4ZN3 A;  4OP0 A;  4A54 A;  2MK5 A;  4RCB A;  1Y07 A;  1TWB A;  1UDL A;  3HPW A;  3CCM Q;  3SHW A;  1K8A U;  3SWN C;  4AFS C;  3MO8 A;  4C92 C;  3EFR A;  3E1S A;  1W4S A;  3VS0 A;  3IQL A;  4C92 B;  3S3M A;  2KDS A;  1UB4 A;  3QUI A;  2HEQ A;  1VQ8 Q;  4M78 E;  4XU1 A;  2DD5 A;  2BKD N;  1AWJ A;  1C0M A;  2RF0 A;  3TU4 K;  1VQK T;  1MMA A;  1PHT A;  1S72 A;  2Z0W A;  2RQR A;  1M27 C;  1ZA2 B;  5IN1 A;  2YDL A;  4DBR A;  1IXD A;  1PRM C;  3CBO A;  4JJC A;  1MV0 B;  4M7D E;  3EG3 A;  5DLO A;  2K57 A;  3DLM A;  1KC8 U;  1JJ2 S;  3GBQ A;  1KK7 A;  3QZ9 B;  1YWP A;  1M1K C;  1C6V X;  2E3H A;  1PNJ A;  1YJW Q;  2AT1 B;  2EJ9 A;  3PGG A;  1GCQ A;  2CDT A;  1D09 B;  1PCX A;  5KYX B;  4LDV A;  1DJ7 B;  1I8F A;  5GAM h;  1T0J A;  1D3B B;  1G2B A;  3RMQ A;  3G71 Q;  4A63 B;  3OYF A;  1YFN A;  2A36 A;  3TCJ A;  1X6G A;  1IB8 A;  2A08 A;  1VA7 A;  3VS5 A;  3U23 A;  3HFO A;  2RI5 A;  3QYH B;  2MYS A;  3H8Z A;  1YJ9 A;  1R0B G;  3NGP A;  3EGX B;  1IRE B;  1RLP C;  3H0H A;  4M75 B;  5KE2 A;  3CCR T;  2YT6 A;  2JVV A;  3BW1 A;  4OB2 B;  4BAC A;  3AT1 B;  3FRN A;  4A53 A;  1KIK A;  1Q81 R;  1VQM A;  4OB1 B;  3M56 A;  1K8A C;  4A4E A;  5A0L A;  3I56 A;  3S3N A;  3L2U A;  2F69 A;  2RQW A;  1QVG S;  4BE2 A;  4EMK A;  4M7A G;  2KT1 A;  2E65 A;  2ROT A;  4M78 F;  3CME A;  2OX7 A;  4PJO F;  2EAY A;  1SRL A;  1PG5 B;  2QQR A;  2MI6 A;  2XHC A;  3FC3 A;  1OU9 A;  1K73 R;  3R6N A;  4ZTF A;  1YIJ Q;  1OYX A;  1T3L A;  2GFU A;  2X9H A;  2DXU A;  2HQH A;  1RAC B;  4JLI A;  4R55 A;  2RD1 A;  5HKC A;  3OW2 A;  1RAE B;  2O4X B;  4KUL A;  2RJC A;  2AKL A;  3CBM A;  2FG0 A;  3V7S A;  1KC8 C;  1G3S A;  2CT3 A;  4OMP A;  4RG8 A;  2C06 A;  4FU6 A;  2E3I A;  2ESW A;  3JCM e;  3CD6 Q;  3NPF A;  2MWP A;  2V8I A;  5FWC A;  2CUB A;  5GAM d;  3V8K A;  4Y91 A;  1RAF B;  1VYT A;  1K9A A;  2KGT A;  4M7D A;  4QQ6 A;  2XU8 A;  2QDY B;  4M7A B;  3CPW S;  4DOV A;  1MMG A;  4Y92 A;  3C95 A;  4IUR A;  2DER A;  3TRE A;  2YHT A;  2KE9 A;  4Q5W A;  2OTL A;  4FYX B;  3OYN A;  2ATC B;  1VQP A;  5GAO l;  4XU0 A;  3MEA A;  2DYB A;  1I1J A;  1WHM A;  3I9Q A;  2CSI A;  4C8Q C;  1VQL T;  3OY9 A;  3RMS A;  2VC8 A;  4ANJ A;  1NPP A;  1VQ9 A;  2KEA A;  4IUT A;  1NM7 A;  4J9B A;  2OTJ T;  1FYN A;  4F7U G;  5GAO q;  3A1P A;  2M16 A;  1VQ7 A;  1I07 A;  4JLG A;  2K3X A;  3EFO A;  2EKO A;  3M58 A;  3I55 A;  5GAO m;  2R57 A;  4KUI A;  1BB9 A;  3M57 A;  5IT9 E;  1K76 A;  2XD0 A;  3CCL A;  1SHG A;  2WAC A;  2RN8 A;  2HBP A;  1T3S A;  2YLB A;  1VQ5 A;  2VXE A;  4JS4 A;  3GF5 A;  2X4X A;  1VQN Q;  2CP2 A;  2E70 A;  2D9T A;  4C0D C;  3CCV A;  5D6W A;  3C94 A;  2DAQ A;  1ZHI A;  2DVE A;  1IRX A;  2LQK A;  1I4K 1;  1WQW A;  1I81 A;  1X01 A;  2QQA A;  4BY6 B;  2V1R A;  3OW2 S;  1YWO A;  4FM4 B;  5KYU A;  3RUX A;  2CZ7 B;  2RB6 A;  4V2S A;  1QW1 A;  2PVG B;  1K9M U;  3L42 A;  4LNP A;  1P92 A;  3CMA T;  3WVD B;  3VS3 A;  4PKC C;  3JCM X;  1TS9 A;  2RHZ A;  1PKS A;  2VUB A;  1VQ4 Q;  4CC4 B;  1VQ8 T;  1H64 1;  2RM4 A;  2RNA A;  4F7U B;  2SRC A;  1SEM A;  1UTI A;  4X1V A;  2QI2 A;  2NUT B;  1KFZ A;  2ZPF B;  4M4Z A;  4JRQ A;  1QMC A;  3CCE Q;  2DRM A;  4MZP A;  3ME9 A;  1WXU A;  4IIM A;  3UA7 A;  4E6R A;  4GY5 A;  4PJO G;  1NPR A;  4IIO A;  2W0Z A;  4OMM A;  3CCQ T;  2KRO A;  2QA4 Q;  3RDV A;  4PJN A;  4FL6 A;  5LJ5 f;  2OI3 A;  2EYZ A;  3RBB B;  3OYA A;  2LX7 A;  2J05 A;  4M75 E;  1LVK A;  3JB9 D;  3JCM g;  4L59 A;  4C5G A;  3CCJ A;  2GGR A;  5J3B A;  2I2L A;  4Z02 A;  4XU2 A;  1KG1 A;  3UDC A;  2EBP A;  4OMF B;  3G71 T;  2RQV A;  2LQW A;  3C0C A;  1M1K R;  2K7A A;  3UWN A;  4PJM A;  1AHJ B;  1HSQ A;  4HA8 A;  1VQK Q;  5KYY B;  1Y7X A;  3C4S A;  1VQO T;  1SSF A;  4MZM A;  4A4G A;  3L2Q A;  3JCM J;  2K5F A;  3O8V A;  1UGQ B;  3TSW A;  2F2V A;  3D7S B;  1OU8 A;  3RR6 A;  4LD9 K;  5IXB A;  2O9S A;  3LX7 A;  2A0F B;  4ORZ A;  3QSU A;  2HDA A;  4LDW A;  3PIP A;  4GLM A;  3P8B B;  3BE3 A;  1K9M C;  4Z89 A;  2CKK A;  2E5Q A;  2COW A;  4F16 A;  2GTO A;  4E7K A;  2WSE E;  1KHC A;  1X69 A;  4QVZ A;  1TTH B;  2QXF A;  2JTE A;  2VV5 A;  5LJ3 e;  2DZC A;  2YUN A;  5GJV B;  1SKU B;  1PWT A;  3M4G A;  5CVI A;  5LJ5 h;  1Q7Y U;  3CEY A;  3CCM A;  4KGZ B;  5GAO n;  2F1L A;  3OQ5 A;  1Q81 C;  2VGM A;  1K8A R;  3PIO A;  4HXJ A;  5DY9 A;  3P8D A;  5HK0 A;  2R58 A;  4M7D C;  3CC2 T;  1NLP C;  4M7A E;  2X4W A;  3VS6 A;  3CCR Q;  3MCA B;  2EQJ A;  2K3B A;  5GAN 5;  3G4S T;  2PVO B;  4PNO A;  5GMK e;  4RTT A;  2GBQ A;  4JUV A;  3OYK A;  3CC7 T;  5GAN h;  3EH2 A;  1Y0M A;  1YP5 A;  5KYX A;  3V7R A;  4M75 F;  1K0X A;  1FMW A;  1BU1 A;  1NYG A;  4C0G A;  2X35 A;  1U06 A;  3OYH A;  4FCY A;  1D3B A;  1UGV A;  3HRS A;  2DYI A;  3OS2 A;  4EDU A;  4YTL A;  3BDL A;  3NMZ C;  3QPH A;  4KH1 B;  1D0X A;  1W70 A;  1M4Z A;  3M55 A;  2HKN A;  4FIB A;  1KC8 R;  2EYX A;  3HRT A;  3QJ6 A;  5I21 A;  2EJG A;  3VV0 A;  3JAM E;  3EGX A;  1ZSZ C;  4TVR A;  1YJW A;  5M9O A;  2KT8 A;  3JCM b;  1B34 A;  4C0F A;  1C1A A;  3JB9 I;  1H92 A;  3GP8 A;  1M3C A;  3MET A;  2JXB A;  4HCK A;  1M9S A;  2E10 A;  4E7Z A;  2HSE B;  1Q86 U;  4B9X A;  2FRY A;  3TVT A;  3M0S A;  2DET A;  1PD0 A;  2ECZ A;  4II1 A;  4A4K A;  4QVD A;  4ELY C;  3OYE A;  5LJ5 d;  3H9N A;  4FYV B;  3VS1 A;  4DA4 A;  2EQK A;  5CKD A;  4XK8 E;  2QGF B;  3JRZ A;  1RAI B;  3QHS A;  1SHF A;  3A8L B;  2ABL A;  1O9S A;  2LCS A;  1XQH A;  1Q7Y C;  3MEU A;  4M77 G;  3CCS T;  8ATC B;  4F7U E;  2KXD A;  4XTY A;  3G6E T;  3H6Z A;  1U3O A;  5LJ3 j;  4M7A F;  2XDD A;  1TOV A;  3VU3 C;  1AOJ A;  1VQL Q;  4C92 G;  2LJ0 A;  2A7Y A;  3H0I A;  2LC4 A;  3PT9 A;  3V7C A;  4AT1 B;  2OTJ Q;  2HSP A;  1YIJ A;  3EGD A;  4FW2 A;  1OPK A;  1OX8 A;  2DK3 A;  5HY6 A;  2ED0 A;  4DOW A;  4M7A A;  5GMK j;  2AZS A;  1QWE A;  3EG9 A;  3I5R A;  3JB9 G;  2DJQ A;  3M59 A;  1M30 A;  1X6B A;  5LJ3 g;  3CCE T;  3CD6 A;  3GNG A;  4FSS A;  4HCZ A;  2L3R A;  2KYB A;  4IUQ A;  3M0T A;  2L8D A;  3QJY A;  1MMN A;  2Y4Y A;  1E6H A;  4M77 B;  2DL3 A;  2A3L A;  4RMO A;  1ZLM A;  1N6A A;  1YHQ A;  4J8O A;  6AT1 B;  2J6O A;  3CMA Q;  1M2V B;  3SWN B;  2JOY A;  2ZPI B;  1ARK A;  2HMA A;  1X2K A;  1Q86 C;  3CME T;  5GAM e;  4ZGE B;  4K11 A;  5KH6 A;  2RO0 A;  3QII A;  2JM9 A;  2KK4 A;  1VOM A;  2NLU A;  1YIT T;  4PJO E;  2XDP A;  5CKB A;  5CKF A;  2LDM A;  3QYG B;  4WTO B;  5KYN A;  2KBT A;  2YUP A;  4M75 G;  4NS5 A;  2DO3 A;  2AKK A;  2QQ9 A;  2PZ1 A;  3FEO A;  2OAW A;  2JT4 A;  2HZY A;  3L2R A;  2F5T X;  4F7U F;  4B6M A;  2X3W D;  1K0S A;  2DL7 A;  3NTH A;  1MUZ A;  4KH0 B;  2RHI A;  5CIU A;  3CCQ Q;  5GJW B;  1RI0 A;  3VJP A;  1EFN A;  1AZG B;  3BDU A;  3JCM c;  5C0M A;  1QVF P;  3OYD A;  1QLY A;  3LW5 E;  3X28 B;  1TH7 A;  3CC4 T;  1HK9 A;  2DF6 A;  1WLP B;  4R0K A;  1VQN A;  2P84 A;  3MP1 A;  4F7U A;  2KMT A;  2O88 A;  5GAN 6;  1BIA A;  4LXC A;  1OPL A;  5IXF A;  2BZY A;  1KD1 U;  4XAX B;  2VAS A;  5HCK A;  1XOV A;  1K9M R;  2L3Q A;  3CXC P;  4O6J A;  1VQO Q;  1Q82 U;  3G1J A;  3LWH A;  2P0Q A;  4HCC A;  1VQ4 A;  3RKW A;  2CRE A;  3OYC A;  4FW1 A;  4BE0 A;  3OMG A;  2YUQ A;  2YUO A;  2CT4 A;  4RTX A;  1A0N B;  4J83 A;  1WHH A;  4QT7 A;  2JJ9 A;  2KR3 A;  3LH0 A;  1PSE A;  4N4I A;  3X20 B;  4HVW A;  4UC4 A;  1VQ5 T;  4Z88 A;  2RK2 A;  3ZL7 C;  4JJN K;  1JO8 A;  2DIQ A;  2QA4 A;  4M7D D;  3HTR A;  4F17 A;  4EIK A;  2E5K A;  1N8R U;  3BFM A;  2RHX A;  2M0Y A;  2EPD A;  3PTA A;  5J26 A;  2QYZ A;  5KE3 A;  1UGS B;  3EG2 A;  1JQQ A;  1FX7 A;  4XTX A;  5GAM j;  4C8Q G;  2CP5 A;  2BZX A;  2D0Q B;  2JNG A;  3CC2 Q;  4M78 A;  2EJF A;  4PJO A;  4J9C A;  1Y96 B;  5CKH A;  3G4S Q;  3MP6 A;  5GAN 3;  3JCM f;  4IKF A;  1G3W A;  3CC7 Q;  1VQK A;  4JRP A;  1TU0 B;  2DFU A;  4RTV A;  1OUL A;  5GAN 4;  1G8X A;  3ASK A;  1NBE B;  2KVQ G;  1VQ6 T;  2LT1 A;  1WGS A;  2LMJ A;  3GPL A;  2IG0 A;  2D6F A;  1W6X A;  1YI2 T;  2R5M A;  3UA6 A;  1RUW A;  3GOX A;  2NUP A;  5GAM g;  4XTW A;  5KYW B;  1JXO A;  4QW2 A;  1FMV A;  2FYK A;  4RTW A;  1BKB A;  1RL2 A;  2P4T A;  1BIB A;  1KD1 C;  2DLP A;  2JMC A;  3S6W A;  1IO6 A;  2PUK B;  2VB6 A;  3JB9 H;  3OBW A;  2EGC A;  4OF1 A;  1XTD A;  2FO0 A;  5FU6 C;  1Q82 C;  4OMQ A;  3ZEH A;  4N0A A;  2DE0 X;  1RAD B;  1W1F A;  1NG2 A;  5FU6 B;  2LJ1 A;  4LDY A;  3ULR B;  2EYY A;  2K5I A;  2DIG A;  4DQ2 A;  4C8Q B;  4HCB A;  2QEX T;  1QVF A;  3RKX A;  3CCU T;  2PTK A;  3OBY A;  3VKI A;  1Q7Y R;  2E6N A;  1WQ7 A;  4PJL A;  3LYI A;  4M77 E;  3E9G A;  3S3O A;  4ME7 A;  1WHJ A;  2HAX A;  4LE9 A;  3OYL A;  2BE7 D;  1U1T A;  1OZ3 A;  4PFP A;  4J9E A;  4C92 E;  3JCM h;  2JUF A;  1JU5 C;  4OMO A;  4BUG A;  2RQT A;  2DTI A;  3X25 B;  4J5Y A;  2DTH A;  2KSS A;  4OMN A;  3SEM A;  3UT1 A;  1MND A;  3CXC A;  3CCS Q;  4C0D B;  3OYB A;  4BDZ A;  3G6E Q;  1AWO A;  3VS7 A;  3MHX A;  1JEG A;  1OV3 A;  3INZ A;  4BDY A;  2JW4 A;  1JRI A;  1H3H A;  3DLL A;  2F5K A;  3AHU A;  3L2W A;  1RAH B;  1AD5 A;  1BYM A;  3PNW C;  1BK2 A;  2K4Y A;  3EHR A;  1U8R A;  5GAN 8;  1VYV A;  2HL3 A;  1IGU A;  3ER0 A;  2KXC A;  2KNB B;  5AYF A;  1OOT A;  3R6O A;  2NWM A;  1FMK A;  2RHU A;  4J6X A;  3LH5 A;  4LUD A;  2LCC A;  4E47 A;  4PJJ A;  4R56 A;  1CSK A;  1N27 A;  2EIF A;  1GCQ C;  1GRI A;  2X51 A;  3SB2 A;  1Q86 R;  3HFN A;  2AHJ B;  1WXT A;  4J7F A;  5IH2 A;  2AZV A;  3A98 A;  1RI9 A;  4ESR A;  1PM3 A;  4C5I A;  3I56 Q;  1D1A A;  4E7L A;  1NJI U;  4JRI A;  3FDR A;  4CI0 C;  5A0D A;  3HL8 A;  1Y57 A;  4M77 F;  3CME Q;  3NFC A;  5GMK i;  2F2W A;  2EQU A;  1WHG A;  9ATC B;  1YIT Q;  1BI3 A;  2MOX A;  2E41 A;  5GAN f;  2A37 A;  2J06 A;  2J6K A;  1ZA1 B;  3FIF A;  3MP8 A;  4C92 F;  2RK1 A;  3CXC S;  4C5E A;  5IHI A;  2GNC A;  1UG1 A;  4PL6 A;  2NUZ A;  2OTJ A;  2CYZ B;  2LRQ A;  1TUD A;  3EHQ A;  7AT1 B;  2JZ2 A;  4XTU A;  4EMK C;  2MCN A;  4M77 A;  2DXT A;  4E2F B;  2FEI A;  3E9F A;  1BCM A;  1TUC A;  1YJN T;  2CH4 W;  3JB9 F;  2DPP B;  1WI7 A;  2M1H A;  4C92 A;  2BIV A;  3DB4 A;  1GXI E;  4BB7 A;  3VUB A;  1WIE A;  3A8H B;  4WCI A;  3CC4 Q;  2RQU A;  1SSH A;  1QVP A;  1WHL A;  4JJD A;  2EGE A;  4M78 C;  1VIF A;  1NYF A;  1MNE A;  2OJ2 A;  4PJO C;  5LJ3 f;  1JJ2 P;  4OB3 B;  5D7U A;  3DKM A;  1B07 A;  1UUE A;  2C0I A;  3TSZ A;  3CMA A;  2LQ8 A;  3OYY A;  2GF7 A;  5FRO A;  1VUB A;  2YRC A;  3EG1 A;  4BE1 A;  2YXY A;  1PRL C;  2CSQ A;  2ZZD A;  3UF4 A;  1X43 A;  1VQ8 A;  4NOY A;  5I2S A;  4M7D B;  1M5Q 1;  3H0F A;  3NTI A;  2E64 A;  1BCO A;  2CZ6 B;  2KRS A;  3LLR A;  1D1B A;  1W2B P;  2O2O A;  2BZ8 A;  1Z9Q A;  5CK9 A;  3I55 Q;  1NJI C;  2QTX A;  1UGP B;  1BI0 A;  1RAA B;  1XNI A;  1M90 U;  3N5B B;  4C8Q E;  1VQ5 Q;  1QCF A;  3CCQ A;  2P4R A;  3CCV Q;  2XMF A;  3A8G B;  4J9D A;  2AIR B;  4HVU A;  2DM1 A;  4J7I A;  1LJO A;  2GFA A;  3JCM Q;  4M75 A;  3QDR B;  1ZSZ B;  2XK0 A;  2EWN A;  5GAO r;  1T0H A;  1PC0 A;  4XQ3 A;  5LJ5 j;  1QP3 A;  4B9W A;  2DIL A;  2JTF A;  3PE0 A;  2LX9 A;  5FW9 A;  5LJ3 h;  5A2Q E;  4OGE A;  2KRM A;  3G71 A;  3M0Q A;  1JBM A;  2RA2 A;  3KXT A;  1V1C A;  2L89 A;  2O01 E;  1KD1 R;  2FPF A;  1UJ0 A;  2YSQ A;  3OYI A;  1VQO A;  5CR2 A;  1Q82 R;  5IAY A;  3BY7 A;  4O5V A;  1VQ6 Q;  3QDF A;  3PVQ A;  2J6F A;  1S72 T;  1YI2 Q;  3UAT A;  4M7A D;  5GMK h;  2CZ0 B;  3FLG A;  2J7I A;  2M9U A;  5CO7 A;  4Y28 E;  3T9N A;  5LJ5 g;  2RJE A;  4LN2 A;  2DMO A;  4J9F A;  4E7H A;  2VWF A;  2DTO A;  2EYQ A;  4RTZ A;  1LPL A;  2O4X A;  4FT2 A;  2PUO B;  5GAN d;  1YCS B;  2LZ6 B;  1M8V A;  1S1N A;  4J9H A;  3OSV A;  2DEQ A;  2D8J A;  2G6F X;  3OYG A;  2ZCF B;  4ELZ C;  2E12 A;  3CPW P;  4CC3 A;  4C0Z A;  1Q95 G;  1XJW B;  2QEX Q;  4AFQ C;  4AFZ C;  2V26 A;  3CCU Q;  4RUG A;  1PKT A;  1N8R R;  4MZT A;  4CC2 A;  2EGA A;  4MMK A;  3I35 A;  3LGL A;  3QG1 A;  5GMK l;  5KYW A;  4L6V 5;  4C8Q F;  1M90 C;  1SF9 A;  3CC2 A;  2QQB A;  1JJ2 A;  1TG0 A;  3G4S A;  4FYW B;  1YJ9 T;  2EFI A;  1BBZ A;  1ZUU A;  1ZX6 A;  1I5L A;  3M0U A;  3REB B;  4JS5 A;  1ABO A;  4RKU E;  3CC7 A;  3J7A F;  3OMC A;  4X34 A;  3HSB A;  3A5Z B;  3E19 A;  2DD4 A;  1WFW A;  5GMK m;  3WVE B;  4ZGD B;  4BI4 A;  4PFZ A;  2DX1 A;  1B7T A;  4PK4 A;  4C8Q A;  2CP0 A;  3SFM A;  2MF2 A;  1VQM T;  1ZBJ A;  1D1C A;  4IUP A;  2PNI A;  4MML A;  5IHN A;  5CAI A;  3I56 T;  2HNI A;  2LP5 A;  5L8R E;  1WJQ A;  1W2B A;  1E6G A;  2B8A A;  2P0P A;  2DRK A;  4C5H A;  3EGU A;  5DM7 R;  1N9R A;  1KQS P;  1G3T A;  1YCY A;  2CH4 A;  4F04 B;  1TUG B;  3ZBD A;  3MEW A;  2BTT A;  2HKQ B;  3OB9 A;  2VYT A;  2CUD A;  2CP7 A;  3V8J A;  4A4H A;  4ZGJ B;  2YRD A;  1NEG A;  1M8M A;  2H3J A;  2XDB A;  2RPN A;  3FB9 A;  4DBQ A;  2MIO A;  1MV3 A;  1SPK A;  1H3Z A;  4Z8A A;  2L3S A;  1AT1 B;  1QVG A;  2DKG A;  4EMH A;  1CKB A;  5CQX A;  3F70 A;  4DEX A;  1ZUK A;  5D6Y A;  2G3R A;  3CQT A;  4JPB W;  1UJY A;  4D8D A;  3JCM W;  5I11 A;  1KSW A;  4J6W A;  4NL3 A;  2RJD A;  4NL2 A;  1MGQ A;  5AT1 B;  1K1Z A;  5IHK A;  2C0T A;  2DJZ A;  2MAM A;  4ZNX A;  1M3A A;  2RI3 A;  4JRK A;  3CCS A;  5D6X A;  3KFV A;  3HKS A;  2ENM A;  1HYO A;  2NUT A;  4E7S A;  3G6E A;  4OML A;  5EG2 A;  1WYX A;  3L2Z A;  2D0N A;  5CQY A;  4GLK A;  1M3B A;  2MWO A;  1NZ9 A;  2OTL T;  1D0Z A;  1VQP T;  3JSC A;  1VQ9 T;  3Q1J A;  4LUE A;  1IHW A;  2VXF A;  3CBP A;  3EFS A;  4M78 D;  1LCK A;  3VYG A;  1W2B S;  2XG8 D;  4PJO D;  3JCM V;  1VQ7 T;  2QQS A;  1RAB B;  3CPW A;  2I0N A;  2COY A;  2XKO C;  1YJN Q;  1D0Y A;  3I55 T;  4M75 C;  3NTK A;  2CP6 A;  2ED1 A;  3JCM P;  3SD4 A;  4X9C A;  2X4Y A;  3CCE A;  2E4H A;  2RMO A;  3CCL T;  1X27 A;  2QDL A;  1RAG B;  2LQN A;  3H41 A;  1B34 B;  1V76 A;  1NLO C;  3TEE A;  4CRI A;  1NE8 A;  3M0P A;  1IZ6 A;  2FVU A;  1KJW A;  5KYY A;  2CS7 A;  3CCV T;  5GAN 7;  2JS2 A;  2EQI A;  2MMP A;  1G83 A;  2ZPG B;  1UFF A;  2V8K A;  2K5L A;  3J80 E;  4DBF A;  1NJI R;  2X3X D;  4ATO A;  3VRY A;  1E7O A;  2JS0 A;  1I0C A;  2K9G A;  2HL5 C;  2FL7 A;  1YIT A;  3GNF B;  1BI1 A;  3I5S A;  2ZPE B;  3EH1 A;  3HRU A;  5LL6 S;  1B3Q A;  3EG0 A;  4VUB A;  2LJ3 A;  1KQS A;  4IUV A;  4M7D F;  2EW3 A;  3HHT B;  2KRN A;  3QWX X;  2L5Q A;  5I22 A;  1QKX A;  1JXM A;  2KY9 A;  1EZZ B;  2DXB A;  1WA7 A;  2HBW A;  4LDU A;  2RHY A;  4E7I A;  2DXC A;  4RCC A;  1R0C B;  2FRW A;  2LTO A;  2CZ1 B;  3MKD A;  3OS5 A;  5CKE A;  4A4F A;  1N5Z A;  2DL4 A;  1RLQ C;  1WNL A;  3LGF A;  1OEB A;  3CC4 A;  5FRN A;  3EGD B;  1KHI A;  2IIM A;  2QK0 A;  2RI2 A;  2W10 A;  4AFU C;  4M7A C;  1YHQ Q;  1OQK A;  2PU9 B;  3PMI A;  1HD3 A;  2LNH B;  3EG9 B;  4AMC A;  1U5S A;  2KI7 A;  1TXQ A;  2K2V A;  1GBQ A;  3CCJ T;  2O9V A;  1WZO A;  2LT4 A;  1YN8 A;  2DVJ A;  3M53 A;  1JB0 E;  1VIE A;  2F2X A;  3L2V A;  3OS0 A;  1QCO A;  3RIR A;  2K6D A;  3CCR A;  1S72 Q;  1AVZ C;  2K79 A;  2BE9 B;  2GTJ A;  3VUZ A;  5FRM A;  3FJP A;  1PSF A;  4FSX A;  2RH2 A;  2Y4X A;  1ABQ A;  1ZUY A;  2ROL A;  1ZSZ A;  4MDW A;  1N8R C;  5DLQ E;  4OVA A;  2EYW A;  3M9Q A;  2DL8 A;  1UE9 A;  1MMD A;  4JZ4 A;  2XIC A;  1N9S A;  1SRM A;  2M0O A;  1M90 R;  4LDX A;  1BI2 A;  4J6Y A;  2FZC B;  3OYJ A;  4PFO A;  4BY6 C;  1V29 B;  1X2Q A;  1ZQ1 A;  2DBK A;  2VVK A;  3OA6 A;  1KQS S;  1LNX A;  4IUU A;  1OI1 A;  4XTZ A;  3VS2 A;  4EPC A;  3LWI A;  2JMA A;  2CGH A;  1VYU A;  1OZ2 A;  3WXM B;  3VS4 A;  1LOJ A;  3CCM T;  3PVL A;  1MHN A;  1Z9Z A;  2IPO B;  2YLC A;  4J9G A;  2HQX A;  2KYM A;  1YJ9 Q;  2VKN A;  2FPE A;  1UHF A;  1AWX A;  4HT8 A;  4KRT A;  4AG2 C;  1FXX A;  2PVD B;  4M77 D;  4JJB A;  3QO3 A;  4BI8 B;  1PD1 A;  1VQ6 A;  3X26 B;  1QVF S;  1QWF A;  1X75 C;  1Q81 U;  3PMT A;  2WSF E;  1YI2 A;  1VQM Q;  2GQV A;  3M0R A;  2FB7 A;  5J39 A;  1WPY A;  1WX6 A;  2IVW A;  2MPX C;  3E2U A;  2QG9 B;  3X24 B;  3VRZ A;  1IGQ A;  2P0K A;  4C92 D;  4LD6 A;  4BI3 A;  4M78 G;  2DL5 A;  3CPF A;  4KT0 E;  2ZPH B;  2FHD A;  3JCM d;  1K73 U;  5LJ5 e;  3UPU A;  1UEC A;  3DB3 A;  1YJW T;  1VQL A;  1TSF A;  2H8H A;  2B86 A;  4JZ3 A;  3M4Y A;  1WDX A;  2DBM A;  2QEX A;  3MEV A;  1U1S A;  4L5G A;  4M7D G;  4CC7 A;  3CCU A;  3A8O B;  2X4J A;  4FYY B;  1EIF A;  3RES A;  2HCK A;  2YWW A;  4P5N A; 
#chains in the Genus database with same CATH homology
 4EMK B;  3OYN A;  3CC4 T;  1VQP A;  1HK9 A;  1HXD A;  5GMK h;  1VQN A;  2CZ0 B;  3FLG A;  5GAO l;  4XU0 A;  2M9U A;  3MEA A;  5CO7 A;  4Y28 E;  3T9N A;  5LJ5 g;  3MP1 A;  4X9D A;  4F7U A;  2RJE A;  5GAN e;  4C8Q C;  2KMT A;  4QQD A;  1VQL T;  3OY9 A;  5KCO A;  3RMS A;  2VC8 A;  4RG2 A;  1NPP A;  4E7H A;  1VQ9 A;  2K3Y A;  3SWN A;  1FWZ A;  4WF2 A;  5GAN 6;  5GAN 2;  2DTO A;  2EYQ A;  1BIA A;  4IUT A;  4BD3 A;  2O4X A;  4FT2 A;  3M54 A;  2OTJ T;  2PUO B;  4F7U G;  5GAN d;  5GAO q;  1M8V A;  2M16 A;  3OSV A;  1VQ7 A;  2DEQ A;  1KD1 U;  3RER A;  4JLG A;  2K3X A;  4XAX B;  3OYG A;  1XOV A;  1WJS A;  2ZCF B;  2EKO A;  4ELZ C;  3M58 A;  2E12 A;  3I55 A;  5GAO m;  2R57 A;  4C0Z A;  4KUI A;  4O6J A;  1Q82 U;  3M57 A;  3LWH A;  4M78 B;  5IT9 E;  2P0Q A;  4HCC A;  2XD0 A;  1M1G A;  3CCL A;  1VQ4 A;  4PJO B;  2WAC A;  3RKW A;  2XID A;  2HBP A;  4MZT A;  3OYC A;  3KBG A;  2YLB A;  1VQ5 A;  3GIB A;  2VXE A;  4MMK A;  3LGL A;  4JS4 A;  4BE0 A;  3OMG A;  3QG1 A;  3GF5 A;  3A8M B;  5GMK l;  2X4X A;  2E70 A;  4L6V 5;  4XTV A;  2D9T A;  4C0D C;  2LCL A;  3CCV A;  5D6W A;  3C94 A;  3V8L A;  2DAQ A;  4C8Q F;  4MDX A;  1M90 C;  2DZ9 A;  1ZHI A;  4M75 D;  3URG A;  3CC2 A;  4HKE A;  2DVE A;  1KQ2 A;  2LQK A;  1I4K 1;  1WQW A;  1I81 A;  1X01 A;  2HQE A;  2QQA A;  4BY6 B;  2QQB A;  2ZGW A;  4J83 A;  3OW2 S;  1JJ2 A;  3G4S A;  1YJ9 T;  2EFI A;  2EQM A;  3OS1 A;  1I5L A;  4FM4 B;  4FT4 A;  2KAF A;  3LH0 A;  4JS5 A;  3RUX A;  1PSE A;  2CZ7 B;  5FLX E;  4N4I A;  4KBM B;  2RB6 A;  4RKU E;  3X20 B;  1YIJ T;  3CC7 A;  3J7A F;  3OMC A;  4UC4 A;  4X34 A;  1VQ5 T;  3RKY A;  3HSB A;  3A5Z B;  4V2S A;  3EAE A;  3E19 A;  1YBY A;  2RK2 A;  1QW1 A;  2DD4 A;  2PVG B;  4JJN K;  5GMK m;  1K9M U;  2DIQ A;  3L42 A;  3WVE B;  4BI4 A;  4ZGD B;  2QA4 A;  4M7D D;  1P92 A;  2HD0 A;  3CMA T;  2ZPB B;  2KQW A;  3WVD B;  4C8Q A;  3SFM A;  4PKC C;  2MF2 A;  3JCM X;  2RHZ A;  4N0A C;  2VUB A;  1R8O B;  3BFM A;  2RHX A;  1VQM T;  1N8R U;  3PTA A;  1VQ8 T;  4IUP A;  5J26 A;  4MML A;  5CAI A;  3I56 T;  1H64 1;  2HNI A;  2RM4 A;  5KE3 A;  5L8R E;  1WJQ A;  1UGS B;  4XTX A;  1Y71 A;  1FX7 A;  4F7U B;  5GAM j;  1K73 C;  1W2B A;  3CD6 T;  4C8Q G;  1X6O A;  2B8A A;  2P0P A;  2D0Q B;  4OGC A;  2QI2 A;  4C5H A;  1N9R A;  5DM7 R;  4HT9 A;  2JNG A;  1G3T A;  2ZPF B;  3QZ5 B;  1YCY A;  4M78 A;  1M1F A;  2EJF A;  3HP9 A;  4PJO A;  4JRQ A;  1Y96 B;  5CKH A;  3ZBD A;  3MEW A;  4MZP A;  1UGR B;  3MP6 A;  5GAN 3;  3JCM f;  3ME9 A;  4IKF A;  3OB9 A;  1G3W A;  2VYT A;  1O75 A;  3V8J A;  5C6S A;  1YHQ T;  1VQK A;  4JRP A;  4A4H A;  4GY5 A;  4PJO G;  4QVC A;  1NPR A;  3GLX A;  4ZGJ B;  3C12 A;  3CCQ T;  5GAN 4;  2H3J A;  2XDB A;  3FB9 A;  3ASK A;  4FL6 A;  2KVQ G;  5LJ5 f;  2LT1 A;  5I2M A;  1VQ6 T;  4QQG A;  1WGS A;  4N4G A;  3GPL A;  2IG0 A;  2D6F A;  1YI2 T;  2R5M A;  4ZTJ A;  1H3Z A;  3OYA A;  3GOX A;  1QVG A;  5GAM g;  2DKG A;  3P8H A;  4XTW A;  4EMH A;  2PQW A;  5CQX A;  3F70 A;  4QW2 A;  4M75 E;  2FYK A;  2GCX A;  2R5A A;  4N4H A;  1BKB A;  3JB9 D;  3JCM g;  1RL2 A;  2G3R A;  2P4T A;  4L59 A;  5D6Y A;  4C5G A;  1BIB A;  3CCJ A;  1KD1 C;  1UEB A;  3L1A A;  2OAU A;  3JCM W;  3S6W A;  5J3B A;  2I2L A;  4Z02 A;  4J6W A;  5KCH A;  3QBY A;  2PUK B;  5GAN j;  3JB9 H;  4NL3 A;  2WSC E;  3OBW A;  2RJD A;  4OF1 A;  4XU2 A;  4NL2 A;  3UDC A;  1XTD A;  1MGQ A;  1Q82 C;  5FU6 C;  1KG1 A;  4OMF B;  3G71 T;  3ZEH A;  3JB9 J;  2DJZ A;  4N0A A;  5CCA A;  1G5V A;  3UWN A;  2MAM A;  5FU6 B;  1AHJ B;  2RI3 A;  4HA8 A;  4JRK A;  4LDY A;  5D6X A;  3CCS A;  1YJN A;  1Y7X A;  3HKS A;  3C4S A;  2K5I A;  3QXE B;  2DIG A;  1VQO T;  3G6E A;  4DQ2 A;  1SSF A;  4C8Q B;  4HCB A;  3ZFJ A;  5EG2 A;  2QEX T;  3L2Z A;  1QVF A;  5CQY A;  4MZM A;  3RKX A;  4A4G A;  4GLK A;  4XU3 A;  3CCU T;  3OBY A;  1Y96 A;  1NZ9 A;  2MWO A;  3VKI A;  3L2Q A;  3JCM J;  2K5F A;  3O8V A;  2E6N A;  1WQ7 A;  2OTL T;  3LYI A;  1UGQ B;  1G3Y A;  4M77 E;  4C8Q D;  3E9G A;  1VQP T;  1VQN T;  3S3O A;  4LD9 K;  3SDZ A;  3JSC A;  4ME7 A;  2RJF A;  3LX7 A;  4ZN1 A;  3QSU A;  5GAN g;  2HAX A;  4LDW A;  5HK3 A;  3OSS C;  3PIP A;  3P8B B;  3OYL A;  1VQ9 T;  1K9M C;  1U1T A;  1OZ3 A;  4PLI A;  1QP2 A;  3Q1J A;  2CKK A;  2VXF A;  4C92 E;  2E5Q A;  3CBP A;  3JCM h;  4E7K A;  3EFS A;  2JUF A;  2WSE E;  4M78 D;  1M1K U;  3VYG A;  4BUG A;  1KHC A;  2LVM A;  1W2B S;  2XG8 D;  4PJO D;  3JCM V;  2DTI A;  2QQS A;  3G7Z A;  2DTH A;  2KSS A;  4J5Y A;  4QVZ A;  3X25 B;  3UT1 A;  2QXF A;  1WJR A;  3CPW A;  5A0G A;  3QKJ A;  2LNV A;  2XKO C;  3KUF A;  3CXC A;  2E6Z A;  2VV5 A;  3VYH B;  4C0D B;  5FU7 C;  5LJ3 e;  2DZC A;  3I55 T;  4M75 C;  3NTK A;  3OYB A;  3JCM P;  3SD4 A;  4BDZ A;  4X9C A;  2X4Y A;  4OB0 B;  3CCE A;  3M4G A;  5CVI A;  5LJ5 h;  3OYM A;  1ZBX A;  5FU7 B;  3J81 E;  3MHX A;  3CCL T;  1VQ4 T;  1Q7Y U;  3CEY A;  3CCM A;  2Y90 A;  5GAO n;  3OQ5 A;  1Q81 C;  5GAO p;  4D6W A;  2VGM A;  1B34 B;  5LJ3 d;  3TEE A;  3PIO A;  3INZ A;  4BDY A;  4CRI A;  1NE8 A;  5DY9 A;  1JRI A;  1IZ6 A;  2FVU A;  2BUD A;  3P8D A;  4EMG A;  5HK0 A;  3DLL A;  2F5K A;  3AHU A;  2CS7 A;  3CCV T;  2R58 A;  3L2W A;  5GAN 7;  3PFS A;  4JDS A;  2JTM A;  4M7D C;  3CC2 T;  2XI9 A;  2MMP A;  4M7A E;  2X4W A;  4E7J A;  2E1H A;  1BYM A;  3PNW C;  3MCA B;  2EQJ A;  2K4Y A;  2V8K A;  2ZPG B;  2K5L A;  2PVO B;  2V8J A;  4PNO A;  5GAN 5;  3G4S T;  1U8R A;  5GMK e;  5GAN 8;  3J80 E;  1KQ1 A;  4JUV A;  3OYK A;  3ER0 A;  4ATO A;  3CC7 T;  5GAN h;  2VGN A;  5AYF A;  3R6O A;  3M5A A;  4PLL A;  2JN0 A;  2YRV A;  4M77 C;  3V7R A;  4M75 F;  2QA4 T;  4KUD K;  5GAM f;  2RHU A;  4J6X A;  4C0G A;  2FL7 A;  2LCC A;  2X35 A;  4E47 A;  3GNF B;  4ZN3 A;  4R56 A;  3OYH A;  4OP0 A;  1BI1 A;  1YIT A;  1D3B A;  1N27 A;  2EIF A;  4A54 A;  3HRS A;  4RCB A;  3SB2 A;  1Y07 A;  4EDU A;  2ZPE B;  3OS2 A;  3HFN A;  3HPW A;  3HRU A;  5LL6 S;  4YTL A;  3BDL A;  2AHJ B;  3QPH A;  4J7F A;  4VUB A;  1K8A U;  3SWN C;  3MO8 A;  4C92 C;  3EFR A;  1M4Z A;  3M55 A;  4FIB A;  3E1S A;  1KQS A;  4IUV A;  1W4S A;  3HRT A;  4M7D F;  3HHT B;  3QJ6 A;  5I21 A;  2EJG A;  3VV0 A;  4C92 B;  3JAM E;  3S3M A;  2KDS A;  1UB4 A;  3QUI A;  4TVR A;  4C5I A;  2L5Q A;  1YJW A;  4M78 E;  2KY9 A;  4XU1 A;  5M9O A;  2DXB A;  4E7L A;  3JCM b;  4LDU A;  2DD5 A;  1B34 A;  2BKD N;  1NJI U;  2RHY A;  4E7I A;  1VQ7 T;  4JRI A;  3FDR A;  2DXC A;  4C0F A;  4RCC A;  4CI0 C;  5A0D A;  3TU4 K;  3JB9 I;  3HL8 A;  1VQK T;  2LTO A;  4M77 F;  1S72 A;  2CZ1 B;  3OS5 A;  3NFC A;  5CKE A;  4A4F A;  3GP8 A;  5GMK i;  3MET A;  1WNL A;  3LGF A;  3CC4 A;  5FRN A;  5IN1 A;  1KHI A;  1M9S A;  2E10 A;  2EQU A;  2RI2 A;  3CBO A;  1BI3 A;  4M7A C;  1Q86 U;  2E41 A;  4B9X A;  5GAN f;  4M7D E;  4II1 A;  4A4K A;  4QVD A;  3FIF A;  3MP8 A;  2PU9 B;  4C92 F;  2RK1 A;  5DLO A;  4ELY C;  3CXC S;  4C5E A;  3PMI A;  2K57 A;  3OYE A;  5LJ5 d;  3DLM A;  4PL6 A;  1KC8 U;  1JJ2 S;  4DA4 A;  2OTJ A;  2CYZ B;  2EQK A;  2LRQ A;  2K2V A;  3QZ9 B;  2JZ2 A;  4XTU A;  4EMK C;  5CKD A;  1M1K C;  3CCJ T;  4XK8 E;  3JRZ A;  4M77 A;  2DXT A;  2LT4 A;  3QHS A;  3A8L B;  2EJ9 A;  3PGG A;  1O9S A;  3E9F A;  3M53 A;  1JB0 E;  1VIE A;  1XQH A;  1Q7Y C;  3MEU A;  4LDV A;  1DJ7 B;  4M77 G;  3L2V A;  3OS0 A;  1YJN T;  3RIR A;  3CCS T;  3JB9 F;  2DPP B;  4F7U E;  3CCR A;  2M1H A;  1I8F A;  4C92 A;  5GAM h;  2BIV A;  4XTY A;  3DB4 A;  1GXI E;  4BB7 A;  3G6E T;  3H6Z A;  1D3B B;  3VUB A;  3FJP A;  3VUZ A;  5FRM A;  3A8H B;  1PSF A;  4FSX A;  2RH2 A;  2Y4X A;  3RMQ A;  5LJ3 j;  4M7A F;  1QVP A;  2XDD A;  3OYF A;  3TCJ A;  4MDW A;  3VU3 C;  1N8R C;  4M78 C;  5DLQ E;  1VIF A;  4C92 G;  2A7Y A;  3HFO A;  2LC4 A;  2RI5 A;  3PT9 A;  4OVA A;  3V7C A;  5LJ3 f;  4PJO C;  3QYH B;  3H8Z A;  3M9Q A;  1YJ9 A;  4OB3 B;  2XIC A;  1N9S A;  3DKM A;  1IRE B;  1YIJ A;  2M0O A;  4M75 B;  5KE2 A;  3CCR T;  4LDX A;  2JVV A;  2DK3 A;  1BI2 A;  5HY6 A;  3BW1 A;  4OB2 B;  4J6Y A;  4BAC A;  3OYJ A;  4BY6 C;  1V29 B;  3FRN A;  3CMA A;  4DOW A;  4M7A A;  2LQ8 A;  1ZQ1 A;  3OYY A;  5GMK j;  3OA6 A;  2GF7 A;  1LNX A;  4A53 A;  4IUU A;  1VUB A;  5FRO A;  4BE1 A;  3JB9 G;  1KQS S;  1VQM A;  1OI1 A;  3M59 A;  4OB1 B;  3M56 A;  4XTZ A;  2ZZD A;  1K8A C;  4A4E A;  4EPC A;  3LWI A;  1VQ8 A;  4NOY A;  5A0L A;  2CGH A;  5I2S A;  3I56 A;  3L2U A;  3S3N A;  2F69 A;  4M7D B;  5LJ3 g;  1M5Q 1;  1QVG S;  3CCE T;  1OZ2 A;  3CD6 A;  3GNG A;  2E64 A;  3NTI A;  2CZ6 B;  3LLR A;  4HCZ A;  4EMK A;  2E65 A;  2L3R A;  3WXM B;  4BE2 A;  4M7A G;  4IUQ A;  1LOJ A;  3CCM T;  4M78 F;  3QJY A;  2L8D A;  3CME A;  1MHN A;  5CK9 A;  4PJO F;  2EAY A;  2QQR A;  2MI6 A;  2XHC A;  2C06 A;  2YLC A;  2HQX A;  1NJI C;  2Y4Y A;  2QTX A;  3FC3 A;  1UGP B;  1BI0 A;  4M77 B;  4HT8 A;  1XNI A;  4ZTF A;  1M90 U;  3N5B B;  2A3L A;  4RMO A;  1OYX A;  4C8Q E;  1N6A A;  1YHQ A;  2GFU A;  4J8O A;  3CCQ A;  2DXU A;  1FXX A;  2PVD B;  4M77 D;  3QO3 A;  4BI8 B;  4JLI A;  1VQ6 A;  3SWN B;  2JOY A;  2ZPI B;  3A8G B;  3X26 B;  2RD1 A;  4R55 A;  1Q86 C;  5HKC A;  3CME T;  3OW2 A;  1QVF S;  1X75 C;  1Q81 U;  3PMT A;  2WSF E;  2O4X B;  5GAM e;  1YI2 A;  4KUL A;  2GQV A;  1LJO A;  2FB7 A;  2GFA A;  4J7I A;  4ZGE B;  2RJC A;  5J39 A;  3JCM Q;  4M75 A;  5KH6 A;  2RO0 A;  3CBM A;  1WPY A;  2IVW A;  2KK4 A;  2NLU A;  3QII A;  1G3S A;  3V7S A;  3X24 B;  4RG8 A;  1YIT T;  3QDR B;  4FU6 A;  1KC8 C;  2P0K A;  2XK0 A;  2EWN A;  2XDP A;  3JCM e;  4PJO E;  2MWP A;  5CKB A;  4C92 D;  2V8I A;  4LD6 A;  5CKF A;  4BI3 A;  5GAO r;  4M78 G;  4XQ3 A;  5LJ5 j;  2LDM A;  1QP3 A;  3CPF A;  4B9W A;  3QYG B;  2JTF A;  3V8K A;  5GAM d;  2LX9 A;  4Y91 A;  4KT0 E;  4M75 G;  2ZPH B;  5LJ3 h;  4NS5 A;  2DO3 A;  5A2Q E;  2FHD A;  2QQ9 A;  4OGE A;  3JCM d;  1K73 U;  3FEO A;  5LJ5 e;  3G71 A;  1JBM A;  3L2R A;  4M7D A;  2F5T X;  3UPU A;  4F7U F;  2RA2 A;  4QQ6 A;  3KXT A;  2L89 A;  2O01 E;  3DB3 A;  2XU8 A;  1YJW T;  1VQL A;  2QDY B;  3NTH A;  4M7A B;  3OYI A;  4DOV A;  3M4Y A;  2RHI A;  5CIU A;  3CPW S;  1VQO A;  1RI0 A;  5CR2 A;  3VJP A;  3BY7 A;  5IAY A;  3MEV A;  2QEX A;  1U1S A;  3BDU A;  3C95 A;  4L5G A;  3JCM c;  4O5V A;  5C0M A;  4IUR A;  3A8O B;  2X4J A;  3CCU A;  4M7D G;  3OYD A;  3LW5 E;  3X28 B;  1EIF A;  3RES A;  1TH7 A;  1S72 T;  3TRE A;  2YHT A;  4Q5W A;  4M7A D;  2OTL A;  4P5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...