5GAOq

Head region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
72
structure length
72
Chain Sequence
b'PVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein-associated protein B
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 11
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
q PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gaoq00
2HNIA 1MGQA 2RB6A 5LJ3f 1LOJA 4J6YA 4XTYA 4X9CA 1I81A 5GMKi 2DJZA 5LJ3d 4C92C 1BIAA 1N9SA 3V8JA 4M7AE 3QO3A 3RIRA 4DQ2A 5GMKl 5LJ5d 3AHUA 4M7DE 5GANd 4EMHA 5GAMh 3JCMW 3QSUA 2QTXA 4OP0A 4PJOB 5GANj 1HXDA 3SB2A 4M7AC 3VU3C 3JCMX 4M7AA 1B34A 2EJFA 3JB9G 1TH7A 3GIBA 4XU1A 4M7DC 4M78D 4EMKC 4M7DA 5GMKj 5GAOm 5GAOp 3JB9J 1WQ7A 1LNXA 2YLBA 3FB9A 3M4GA 5LJ3j 3JCMQ 3BFMA 3RKWA 5GAMf 2JN0A 4J6XA 4N0AA 5GAN4 4X9DA 3V7CA 4C92E 4C8QD 4QVCA 5GAMe 4M77D 4PJOD 2Y90A 5GAOr 2DTHA 2VXEA 1H641 1WNLA 3SWNC 3JCMJ 4C92G 4JRIA 4JUVA 2FYKA 4RCBA 2E65A 2RM4A 3RERA 1JRIA 2EAYA 4C92A 4HA8A 1I4K1 4XU0A 4M75D 4RCCA 4M7AF 4M78C 2DEQA 1M8VA 5GAMg 3INZA 4J5YA 4NL2A 4M7DF 1HK9A 4JLIA 3JB9F 4HT8A 4M7AG 4XTZA 2DXUA 2E41A 4M7DG 1Y96A 1WQWA 1YCYA 5GAOn 2VXFA 4QVDA 4C8QC 5LJ5h 4MMLA 3V8KA 3JCMb 3JCMP 3JB9H 4M77C 3JCMe 4EMKA 4MMKA 4NL3A 3L1AA 4C92B 4XU3A 1I8FA 3V8LA 4A53A 5GAMd 2DVEA 5GAN5 4PJOC 4M75C 2E64A 2EJGA 4C92F 4XU2A 3JCMg 4XTVA 4NOYA 4M78E 2DZCA 1Y96B 3JCMh 2FB7A 2I2LA 3HFNA 1B34B 2DKGA 4WF2A 4M7AB 1M5Q1 2YHTA 3SWNA 4A54A 4F7UE 3HSBA 5LJ5e 5GANh 4M7DB 1D3BA 3RESA 1WPYA 4EMKB 5I21A 1BIBA 4JRKA 2VC8A 4C8QE 4M78A 5GMKh 4M75F 5GAOq 5LJ3h 4M77E 5GAN7 3FJPA 4F7UA 4PJOE 3JCMf 5GAMj 5GAN8 3V7SA 5GAOl 1U1TA 2EWNA 5LJ5g 5GANf 3QUIA 4M7AD 2E10A 2CGHA 1N9RA 2YLCA 3QHSA 4M75E 3RKYA 3SWNB 4C8QA 4EMGA 4M77A 4M7DD 4PJOA 3JB9D 5DY9A 5GANe 1D3BB 4J6WA 3BW1A 1KQ1A 4M75G 4XTWA 4HT9A 1X01A 4M78B 3V7RA 5GAN3 5GMKe 1LJOA 3PGGA 4M75A 4F7UB 5LJ3e 5LJ5f 3RKXA 3RUXA 4M78F 3JCMc 3BY7A 1KQ2A 2RD1A 2DTIA 4F7UF 5GANg 1JBMA 2ZGWA 3HFOA 2EJ9A 4C8QB 4M78G 5GMKm 3BDUA 4M77B 2DTOA 4C92D 5GAN2 1U1SA 4XTXA 4PNOA 4XQ3A 4F7UG 5LJ3g 4Y91A 3L2ZA 3EFRA 4C8QF 5CAIA 4M77F 4PJOF 1I5LA 3JCMV 4V2SA 3FIFA 4XTUA 3JB9I 4M75B 4C8QG 3JCMd 2K57A 4M77G 2DXTA 4N0AC 4PJOG 5LJ5j 3EFSA 2DZ9A 2E1HA 5GAN6 2RA2A
chains in the Genus database with same CATH superfamily
2JVVA 2HNIA 2LX7A 1MUZA 2DA9A 2E5QA 3QDFA 1C6VX 1Q81C 1OZ2A 5LJ5d 1GCQC 1C1AA 1M30A 3FDRA 4J9EA 2LQWA 3OMCA 2V1RA 1VQKA 2VYTA 2H8HA 4M78D 5FRMA 3QIIA 1OZ3A 1VQLT 1EX4A 2QYZA 4E7IA 1SHGA 1KHCA 1TOVA 1HSQA 2Y4YA 5IH2A 2O4XA 2CS7A 4TVRA 3LWHA 2OTLQ 1VQPT 4Z88A 2EAYA 4N4HA 2L2PA 3INZA 4FW1A 1HK9A 1Y0MA 1EZZB 2OTJT 1TG0A 3L2UA 3L42A 2E3HA 1WJSA 4KGZB 1RAFB 1YJWA 4MMKA 1NLPC 5DM7R 1M1KR 1I8FA 3G71Q 1OU8A 3CC4T 1HD3A 3G4SQ 2M0OA 2DZCA 1X2QA 2YUPA 3M5AA 4M7AB 4A54A 2DIGA 4PFZA 5CIUA 1N27A 4J9DA 5GAN7 4QKUA 3JCMf 3OS1A 1VYUA 4AT1B 3MHXA 2EWNA 5LJ5g 1ABQA 1BCOA 2FEIA 5HCKA 2CUDA 4C8QA 4M75E 2O9SA 1AWJA 4PKCC 3OYEA 5GJVB 1KD1R 2X4XA 2CZ7B 5CK9A 4M4ZA 2KDSA 2A0FB 5IXBA 1UTIA 3QZ5B 3RUXA 1BI1A 2VKNA 1AZEA 2EIFA 1QP2A 3WVDB 1KFZA 2EGAA 2FZGB 3OS5A 2JTMA 3EHRA 5CAIA 3EGXB 3FIFA 3OB9A 3CCVQ 1YI2A 2HMAA 4NS5A 3ZBDA 3NTKA 4N0AC 1M27C 2GF7A 1SEMA 1VOMA 2RA2A 3CQTA 2WACA 5KYYA 3CCMT 2PNIA 3H9NA 2GCXA 2ED0A 1NJIU 1G3SA 4M7DE 2VVKA 1PD0A 4EPCA 3L2VA 4ANJA 4PJOB 1PCXA 3VU3C 2L8DA 2CP7A 2AKKA 1WXUA 2EGCA 3A8MB 2KR3A 5GAMf 2E5KA 2HQXA 2K2MA 4JS5A 2Y90A 4HKEA 4B9WA 2EYQA 3CC7T 1TUCA 2CH4W 1JRIA 4KULA 2KRMA 4HVWA 1SPKA 5IXFA 1R0CB 3PVQA 4XTZA 5I11A 2XDBA 3QJYA 2OTLA 1KJWA 2DVJA 1ZBJA 2YRCA 1D1CA 2JTEA 3A8GB 4JPBW 4C92B 5FWCA 1HJDA 2OAUA 4C92F 2RQVA 2RQWA 1E6HA 2HZYA 4FM4B 3G71A 1BCMA 4AFUC 3EH1A 4KUDK 3G4SA 4ELYC 1Q95G 3RMSA 3R6NA 2D9TA 4KUIA 3ME9A 3SDZA 4OMFB 3QHSA 1N9RA 3RKYA 5KYUB 1MNEA 2XIDA 4BY6B 4ZN1A 4F7UB 2E3IA 2B86A 1AD5A 1KQ2A 2RD1A 2DTIA 4F7UF 2EQIA 2EFIA 2JXBA 2MAMA 4M77B 4HCKA 2R5MA 5FU7C 4M77F 3CCJQ 2CP2A 1RAAB 3JCMd 5LL6S 1JXOA 1O75A 1RACB 2XG8D 2QQRA 3GF5A 3A8OB 3VYGA 1I81A 2YRDA 1QP3A 4D8KA 4ZTFA 1YJNQ 4PJMA 1M90U 2BE9B 4FSXA 2DYBA 3QG1A 3P8DA 1FMKA 4PFPA 4CRIA 4M7AA 1Z9ZA 2EJFA 1NEBA 1FYNA 1PRLC 4EMKC 5HKCA 5GMKj 3JCMQ 4RTZA 2F1LA 2LX9A 2J05A 3CCQT 3MO8A 2WSCE 5CKFA 1SSFA 1KIKA 2COWA 4D8DA 1NPRA 2V26A 4RCBA 1I0CA 1N8RC 1M3CA 2DBMA 3GP8A 2DPPB 1M8VA 4DEYA 3H0FA 2SRCA 5CKBA 1JJ2P 4J9CA 4LDYA 4E2FB 3JCMP 1VQ8T 2MWOA 1K8AC 5GAMd 1S72Q 4BDYA 2IVWA 1VQ9Q 1OYXA 3JCMg 1UGVA 3MEUA 1WHKA 5D7UA 4FYWB 2QDYB 3RESA 3G6EA 1BIBA 4JZ3A 3M0QA 2VC8A 3OYNA 2HCKA 1AT1B 1QWEA 1Q7YU 5GAMj 2QQ9A 3A98A 2ATCB 2GFAA 1XTDA 4BE2A 2X35A 1NBEB 4PJOA 1QW1A 4PFOA 1D3BB 1KQ1A 1IXDA 3EHQA 1LJOA 3EAEA 2K79A 3I55Q 1UE9A 2W0ZA 2SEMA 5FROA 3H41A 5KE3A 1K4US 2BE7D 3HFOA 5GAN2 2M0YA 1UFFA 4R0KA 2QDLA 2JM9A 1FMVA 3MP8A 4C8QG 1M1FA 2FO0A 1AOJA 4QW2A 3VS2A 1YWOA 2E1HA 4J9GA 3ASKA 5LJ3f 2QEXT 2ROTA 3CCJA 2PZ1A 1KQSA 2PTKA 4EIKA 2A3LA 3V8JA 2K7AA 3AHUA 4CI0C 1JJ2S 1VQ4Q 1MMNA 2GTJA 4O5VA 2LC4A 1QWFA 1I1JA 1TH7A 1YJNA 2DIQA 1WXBA 2HL3A 3WVEB 1OPKA 2AT1B 1Q82U 1TWBA 1ZHIA 1JJ2A 2QASA 1H8KA 1WHMA 5I2MA 4Q5WA 1K9AA 2P0QA 4AG1C 3OYIA 1H641 2LMJA 2JOYA 3RERA 2LRQA 3OMGA 4BI8B 1UGQB 2R58A 1M90R 2M51A 5FW9A 4AFQC 2OJ2A 3JB9H 5KE2A 4QT7A 2GQVA 4KH1B 3DKMA 3X20B 4M75C 3EG1A 5D6YA 2CZ0B 4K11A 4N4GA 3HSBA 2DLPA 4BDZA 1FWZA 3D7SB 3E19A 1D1BA 1S72A 1VQ9A 1UUEA 1Z9QA 4JZ4A 4M78A 4EDUA 2LDMA 2YWWA 3PNWC 3CCUQ 4IUPA 2LCCA 5DY9A 1QCOA 1BI0A 1Q86C 3G1JA 3VRZA 4FIBA 4A4GA 3DLMA 3QWYA 5GMKm 1U1SA 4PNOA 1TU0B 3CCLT 3JCMV 2JUFA 2DFUA 4A4EA 5KYNA 1PKTA 4JJBA 2CSIA 3EG9B 2DXBA 2O9VA 1YITQ 3CCSQ 4BUGA 1M1KC 4JRQA 1OEBA 1BIAA 3EG3A 1GCQA 1VA7A 1KC8U 3EGDA 4RTUA 2Y4XA 3MEAA 4IURA 1VQ4A 4E7KA 3TVTA 1U06A 1LVKA 1KSWA 1DJ7B 1S1NA 1YIJT 1XQHA 3M0SA 4HVUA 1KD1C 2COZA 1VQKT 4J9HA 4DBFA 5FU7B 3CCRT 2LTOA 3JB9F 4M7AG 4J7FA 4RMOA 2VXFA 5LJ5h 2QQSA 1QVGP 2RJCA 2EYXA 1Q82R 1VQ6Q 2E64A 2LZ6B 1K9MU 2RO0A 1Y96B 2VGMA 1UJYA 5LJ5e 3FRNA 4ME7A 4DEXA 1YJWT 4EMKB 2VB6A 4C8QE 1JB0E 2AHJB 4FCYA 4LD9K 2CZ1B 1VQ7Q 5GANf 2E10A 1MMDA 3CC2T 3MKDA 1WHJA 4JLGA 3ULRB 2H3EB 1UGSB 1SF9A 1SG5A 2PVOB 2X4JA 1MMAA 2KYBA 4AFSC 4C92D 3TQ7P 1PNJA 5FU6C 5LJ3g 1TUGB 3CCEQ 2J6OA 4PJOG 1YP5A 4RKUE 5A0DA 3NTIA 2CP6A 4BACA 4JRPA 1N9SA 1WJQA 5J3BA 1YI2T 1YN8A 4DQ2A 4DBRA 2ZPFB 2KRSA 3CCSA 3JCMW 2HSEB 2A28A 3JCMX 1QVGS 1VQNT 2H3JA 3LWIA 3RKWA 3VS0A 2ZPGB 3A5ZB 3V7CA 1UGPB 1D09B 4M77D 1ACMB 3JCMJ 4C92G 2FYKA 1Y71A 1QVGA 2C06A 1YJ9Q 2DL7A 2DYIA 4DOVA 1X6BA 4J5YA 5A0LA 5IT9E 4E7SA 3TU4K 3LGFA 3KXTA 4ZNXA 3I5RA 3JCMb 2CREA 1N5ZA 3V8LA 3OS0A 1IGUA 3QWXX 1ZUKA 2QA4Q 4OMMA 2YHTA 3PE0A 3PTAA 1VQ6A 1WPYA 2PU9B 2X4WA 2KK4A 4ZGJB 1YFNA 1SHFA 2LCLA 1HYOA 3FJPA 5GAOl 2MPXC 1ZA1B 1RAGB 1VQLQ 4A4KA 2K5FA 1W2BP 3LGLA 5I2SA 5IN1A 3G4ST 1VQ7A 2JNGA 5GAN3 1K9MR 3U23A 3UPUA 3REAB 3C95A 1JBMA 1GFDA 2QGGA 3L2QA 4M78G 4XTXA 2RK2A 3E2UA 3EFRA 4LDVA 1SRMA 1I5LA 4M75B 2FVUA 2ZPHB 4II1A 2M9UA 1K73R 1Q81U 2L3RA 5GANd 4M75F 5KYWB 5GAN6 2X51A 3CCEA 3JAME 1W70A 3CC4Q 4IIOA 2F2VA 2QTVA 1E6GA 4E7JA 1IB8A 4M7AE 2RHZA 5IHKA 2YXYA 3KFVA 3UF4A 4HVVA 1M2OA 5GANj 4P5NA 2FPDA 4BI4A 3OYJA 3CCVT 2DAQA 2X3WD 1D0XA 2JW4A 1Y7XA 3M4GA 3VRYA 2K5LA 2QG9B 5GAOr 3GOXA 1WDXA 2V8KA 3CXCP 4M7DF 2YDLA 3LYIA 3RR6A 4MDWA 3CPWA 4WTOB 3VUBA 3UT1A 1W2BS 1YJ9A 1Y07A 2KBTA 3JCMe 2DL3A 2NUTB 1D1AA 2GNCA 3UDCA 1VQ5Q 2PVDB 2LQKA 4MZMA 1H92A 2MOXA 1X6GA 4L5GA 3SWNA 2FPEA 2K4YA 1W2BA 2BKDN 1VYVA 2J6KA 2QAZA 4O6JA 4PJOE 1K1ZA 3META 2QA4A 2AK5A 3V7SA 1YHQQ 1WXTA 4OB3B 3UATA 2AZSA 3MEVA 1LPLA 3RDVA 1R0BG 2VV5A 2ZPIB 2XDPA 1OQKA 3G6EQ 1BYMA 1VQLA 3RKXA 2EVRA 3MP1A 3BY7A 2RMOA 1PSFA 4HCZA 1VQOQ 1UG1A 2RN8A 4E7HA 1A0NB 1WZOA 4RTXA 4LUDA 1M90C 3A1PA 1GFCA 3QYHB 3I5SA 1H3HA 2K57A 4OB0B 2DMOA 2DXTA 3I56T 3EFSA 2OTJA 1MGQA 3CXCS 2FRYA 1GL5A 1QCNA 1M2VB 2ZPBB 3DB3A 4KH0B 2GQIA 1TXQA 4PJNA 2BZXA 1WHLA 3CC4A 2QTXA 4HXJA 1QQJA 1NG2A 2FHDA 2KT8A 3HL8A 1ZSGA 2C0TA 3M59A 3QXEB 3MEWA 3CXCA 1Q81R 2KVQG 3QKJA 1V1CA 3OYCA 1QKWA 1UHFA 3FJ5A 3OYAA 1OULA 1I5OB 1XNIA 1RL2A 2DXUA 1OU9A 2AIRB 4DOWA 1KQSP 3C94A 1ZUUA 2P4TA 4MMLA 4C8QC 4OMQA 4XK8E 4XU2A 4LE9A 2LJ3A 4M78E 2LNHB 4RTYA 4ORZA 4RTTA 5KYWA 1NJIR 8ATCB 5ECAA 2HL5C 3OY9A 1VQ5A 1OX9A 3CCMA 4C5IA 4KBMB 2CP0A 4ZGEB 4CC2A 2DBKA 2HDAA 1X2KA 2CGHA 4EMGA 1I07A 2E70A 3JB9D 1YHQA 4RTWA 1S72T 3EGXA 3TEEA 2CUBA 5D6WA 4Y28E 1IZ6A 2X3XD 2HBPA 1RI0A 2RHYA 4XAXB 2EJ9A 2CT4A 1W4SA 1EFNA 2NYSA 3OA6A 1VQOA 1UECA 1H3ZA 2QK0A 2ROLA 2YRVA 2O88A 1BI3A 3CMEQ 4FYXB 3CMAQ 2HAXA 2XMFA 3OQ5A 2DJZA 3FLGA 4VUBA 1Q82C 1OX8A 3I55T 2L89A 2QGFB 3J80E 1X6OA 1U3OA 3C0CA 4OP0A 2G3RA 1KQSS 3M0RA 5CKEA 4X34A 3JB9G 3HRUA 3HTRA 2RQUA 3LH5A 5AT1B 2NWMA 2JN0A 4J6XA 4UC4A 1N8RU 3M0PA 1JU5C 3PFSA 4QVCA 4AFZC 4A63B 1R77A 2A7YA 3EFOB 4C92A 1I4K1 2DXCA 1VQ4T 5GAMg 3VYHB 4NL2A 1K8AU 2AKLA 3TSWA 3X26B 4LXCA 1Y57A 2OAWA 4PJLA 3TREA 1AZGB 2EKOA 3RMQA 3GNGA 5I22A 4L6V5 3M58A 2EBPA 2DEUA 2PUKB 1K76A 5KYUA 4FT2A 1J3TA 1RLPC 2BTTA 4QQDA 5GAOq 5LJ3h 3X25B 4F7UA 4GY5A 3X24B 5GAN8 1X75C 2EW3A 2DL5A 2BIVA 3HP9A 1WGSA 3NMZC 3VS5A 3L2RA 4M77A 1M8MA 1TUDA 2K6DA 3EG2A 2FZCB 1M9SA 4QQGA 2I0NA 2L5QA 1G3YA 2WSEE 5LJ3e 1B07A 2EPDA 2RQTA 1WIEA 2KROA 1G2BA 4LUEA 3JCMc 1WLPB 5HY6A 2KT1A 2DTOA 1V29B 4XQ3A 4J9FA 2MCNA 2GGRA 2KGTA 1VQMQ 4LD6A 3H0IA 4GLMA 1FMWA 3GLXA 3CCUT 3CD6Q 4XTYA 4X9CA 1VQ8A 3VS4A 3KUFA 3QPHA 4IIMA 1PD1A 4E47A 1MV3A 2LJ0A 4R55A 1PG5B 1UDLA 1VIEA 3OYMA 2C0OA 2BZ8A 3CMEA 3CMAA 2X9HA 4AMCA 1IRXA 1AWWA 2OI3A 4M7DC 1GRIA 4FT4A 4XU1A 4IKFA 2D8JA 5HK0A 2HQHA 5GAOm 1Q7YR 4LDUA 2YLBA 1W6XA 5L8RE 1QKXA 3I35A 3IQLA 5CVIA 1RI9A 1YITT 4X9DA 1PWTA 2HKQB 1GCPA 4XU0A 4M75D 5IHNA 3A8LB 4C5HA 4PJJA 4BD3A 3CCLQ 2E41A 4F17A 2O4XB 2XK0A 1OI1A 3SEMA 2KY9A 3L2WA 1K73C 2DVEA 2EJGA 2G6FX 4L59A 1MV0B 2DJQA 2MYSA 4XTVA 2L3SA 2I2LA 4JDSA 1B34B 2D1XA 4OMPA 2QEXA 1D3BA 5I21A 3PMTA 2NUZA 2KAFA 2MI6A 6AT1B 3AT1B 2KI7A 2DETA 4M7DD 1Q86U 1BB9A 1AWOA 3NPFA 4M75G 4R56A 4PLIA 2GBQA 2R5AA 4OGCA 2ECZA 3CPFA 4ZGDB 2YUNA 4GBQA 4C8QB 3NFCA 1ZSZC 3L2ZA 4C8QF 1VQ7T 1XOVA 1M1KU 3MJXA 4ELZC 2RJEA 3PMIA 2YUQA 3SHWA 3VS7A 2DZ9A 3DLLA 2RB6A 1ZUYA 1LOJA 4OF1A 1VQMA 4BE0A 2VWFA 4IUVA 2XKOC 4CC4B 4AG2C 2O2OA 2P4RA 3P8HA 3CD6A 2MIOA 1QVPA 1UEBA 3QSUA 1D0ZA 1CKAA 3SB2A 4OMOA 1WX6A 2VASA 2CT3A 4OB1B 5KYYB 3GIBA 4JJNK 5GAOp 1U8RA 3BFMA 2RPNA 1KD1U 4J83A 2RNAA 4N0AA 2KYMA 3NHNA 2AZVA 1GBRA 1N6AA 4LDWA 4ZTJA 8AT1B 2RM4A 4RG2A 2A36A 3A8HB 4M78C 2CKKA 2PVGB 3GNFB 4JLIA 2DL4A 3JRZA 3M55A 2DK3A 4A4FA 4CC3A 5GAOn 1VUBA 4PLLA 1WHGA 3OBYA 2M16A 2HEQA 1AVZC 3NTHA 2ED1A 3CCLA 1UJ0A 2FZKB 5GAN5 1FX7A 1PHTA 2DO3A 3TCJA 3HFNA 2DRKA 3T9NA 1RADB 1MMGA 2QXFA 1KC8R 2MK5A 1MHNA 2LCSA 3I9QA 1VQNQ 2J6FA 1NM7A 4HT8A 3ZFJA 1P92A 2EQMA 5CKHA 2E6NA 3CPWP 2VGNA 2LVMA 2QA4T 2OTLT 1X27A 5GJWB 3EG9A 2ZGWA 2V8JA 1RAEB 2FL7A 3N5BB 1YIJA 1G3WA 4RG8A 4F7UG 2JMCA 3UA6A 2XU8A 2RHIA 4V2SA 2M02A 3OYLA 3REBB 1T3SA 3CCRA 4M77G 1SSHA 1B3QA 1U5SA 5LJ5j 3ZEHA 3G71T 1Q86R 3E9GA 1M1GA 1RLQC 3LW5E 2CP3A 1JO8A 2J06A 3CEYA 1VQPQ 5GMKl 3QYGB 3M56A 3QJ6A 2JJ9A 3NGPA 1NJIC 2HSPA 4LN2A 3OSVA 4C0ZA 2OTJQ 1B34A 2KEAA 1LNXA 2A08A 2MWPA 3OYHA 3H0HA 1W1FA 1WA7A 2RH2A 4B6MA 5GAN4 1IGQA 2RI5A 3UA7A 3OSSC 2D0NA 3JV3A 3CC2A 1IO6A 5C0MA 2E65A 4C0FA 4HA8A 2RJFA 4M7AF 1ZX6A 4YTLA 3LH0A 1Y96A 1WQWA 5C6SA 4KT0E 1B7TA 2DERA 4E6RA 2EQUA 5FWBA 4EMKA 3OYBA 2D8HA 3O8VA 1BU1A 2DM1A 4CC7A 4E7ZA 2P84A 2RQRA 2NUPB 3CPWS 5L23A 3VJPA 4MDXA 3JCMh 3OYKA 4M7DB 2V1QA 1RAIB 4JRKA 2EYWA 5GMKh 1UB4A 5KCOA 2QQBA 2K5IA 1U1TA 4FYVB 2DILA 1SRLA 2YLCA 3LX7A 1IHWA 1QMCA 1VQ5T 1OV3A 2L3QA 2K3XA 1X01A 1VQNA 3CCMQ 2EKHA 5GMKe 2EGEA 3KBGA 1QLYA 3M54A 5GANg 2KQWA 2F69A 1YWPA 1AEYA 1LCKA 2X4YA 4DBQA 2WSFE 1YHQT 2MF2A 4PJOF 3HRSA 4BB7A 3M4YA 1F1BB 3OS2A 4DA4A 2PUOB 5CQXA 3E1SA 3G6ET 1NYGA 2JS2A 3CC7Q 2JTFA 1VQOT 2W10A 5KYXB 5GAMh 2JZ2A 2KNBB 1PM3A 2GFUA 1VQPA 2XD0A 2JM8A 1WQ7A 3FEOA 3URGA 4C92E 3M53A 5GAMe 2ZCFB 3OYGA 1X69A 1ZSZB 5M9OA 3EGUA 3VS1A 2HQEA 2DE0X 5J39A 4FW2A 1PSEA 4DBHA 4C0DC 4QVDA 3VS6A 2VUBA 3CCJT 3EG0A 3S3NA 1IREB 2F2WA 3I56Q 4NL3A 4GLKA 4XU3A 5A0GA 1G3TA 3P8BB 2CZ6B 1BKBA 4F7UE 3GPLA 1YJNT 5FU6B 1D0YA 3PVLA 4KRTA 4ZN3A 1R8OB 4M77E 2KE9A 3PT9A 1RABB 3M0TA 1NYFA 5IHIA 1RAHB 1Q7YC 2YT6A 4J6WA 2RHUA 3BW1A 3CCVA 4XTWA 2BZYA 3QDRB 4M78B 4M75A 2XICA 1O9SA 4M78F 2KMTA 2KRNA 1JEGA 5CO7A 2DD5A 1YCSB 2LNVA 1RUWA 3WXMB 2O01E 2K3BA 2CSQA 4F16A 2F2XA 2K2VA 2COYA 3CCQQ 1G5VA 2LP5A 1VQ9T 3OYYA 1YNZA 2RI3A 2IIMA 2YUOA 2E6ZA 2O31A 2NUPA 9ATCB 4MZPA 1BK2A 2CDTA 2CYZB 3CC7A 4JS4A 2RJDA 3RNJA 3CBPA 4M7DA 3O5ZA 3JB9J 4KGVB 1VQ8Q 1ZA2B 5EG2A 3LLRA 5CKDA 3CMET 3CMAT 4C8QD 3EGDB 1OOTA 2L0AA 4MZTA 2ZAEA 2QQAA 2VXEA 1WNLA 3HRTA 3SWNC 4JUVA 2A37A 2NUTA 3TSZA 2XHCA 1ABOA 3J81E 2DRMA 3G7ZA 2DF6A 1YCYA 2DX1A 4KGXB 1K0SA 3S3MA 3VKIA 2M1HA 2KXDA 2D0QB 1TSFA 4C0GA 3C4SA 1E7OA 2LT4A 3I56A 2CP5A 4WF2A 1YBYA 3VUZA 3SD4A 4BE1A 3FC3A 4ATOA 1AWXA 2GTOA 2EQKA 3MPUB 4N4IA 5KYXA 5FRNA 3OBWA 3F70A 2R57A 1BBZA 1QCFA 2QEXQ 2ENMA 5A2QE 4HT9A 3CBMA 3HHTB 1WI7A 4HCCA 3GBQA 4QQ6A 1PC0A 5CCAA 3QZ9B 1M2VA 1ZSZA 1M3AA 1M3BA 2E12A 5IAYA 2ABLA 2KXCA 4J6YA 1PKSA 2D6FA 1T3LA 4Z8AA 2LQ8A 4OVAA 3QO3A 2EQJA 3CCQA 4EMHA 2LQNA 1HXDA 4M7AC 3C12A 4Z89A 3EH2A 3ER0A 3R6OA 4FYYB 1SKUB 1VQMT 1BI2A 2HKNA 3PIPA 1KC8C 3DB4A 3Q1JA 2L3PA 3CD6T 2JMAA 3JSCA 1AHJB 3E9FA 7AT1B 4E7LA 4JRIA 4OMLA 4B9XA 4QVZA 3OW2P 4JJDA 2RHXA 4RCCA 2DEQA 5CQYA 3OYFA 1NEGA 2DNUA 5KH6A 1JQQA 1TS9A 2IG0A 4FL6A 2EYYA 4IUUA 1NLOC 2RF0A 3V8KA 1X43A 1ZBXA 2K3YA 3L1AA 1ZQ1A 4HCBA 3M9QA 4A53A 2F5TX 3CCST 1ARKA 2FB7A 2EYZA 3SFMA 1VYTA 3VS3A 3BE3A 3S3OA 1WYXA 1K9MC 3J7AF 2XDDA 2IPOB 2ZPEB 1QVFP 2OX7A 3I55A 2Z0WA 3QUIA 4M7AD 2XI9A 4PJOC 4PK4A 3HPWA 1FXXA 5CR2A 1GXIE 2DL8A 1N8RR 3V7RA 2FRWA 2PQWA 2P0KA 4OB2B 5AYFA 5LJ5f 4WCIA 1CSKA 2JT4A 4D6WA 1NZ9A 4C0DB 3MP6A 3M0UA 3M57A 4J7IA 3UWNA 1MNDA 3OYDA 4Y91A 1K8AR 3JB9I 2HD0A 4IUQA 1K0XA 1WFWA 2FG0A 2LJ1A 1VQ6T 1KK7A 4LNPA 1YIJQ 5GMKi 5LJ3d 4C92C 3OW2S 1VQKQ 4Y92A 4Z02A 4C5GA 2HBWA 3RIRA 1IHVA 2YSQA 2JS0A 3CCRQ 2P0PA 4FU6A 1TTHB 4FSSA 3ZL7C 2RK1A 2QI2A 1KHIA 5DLQE 3S6WA 3RBBB 1UGRB 3EFOA 4IUTA 4C5EA 5LJ3j 3FB9A 2LT1A 4F04B 3OW2A 3THKA 2ZZDA 5HK3A 4RUGA 1WJRA 4J8OA 2V8IA 4PJOD 2DD4A 1UHCA 2DTHA 4BY6C 5EC7A 3X28B 4RTVA 1YJWQ 1QVFS 1EIFA 1JXMA 4M7DG 2MMPA 1K73U 3CCET 1WHHA 1ZLMA 4M77C 2NLUA 4BI3A 3CC2Q 4X1VA 5D6XA 2CH4A 1QVFA 2C0IA 2KSSA 1G83A 1KG1A 3H8ZA 4NOYA 3CCUA 2DKGA 3HKSA 1M5Q1 3H6ZA 1NE8A 1C0MA 5GANh 1T0HA 5J26A 2BUDA 1PRMC 3QBYA 3VV0A 1V76A 1GBQA 4JJCA 2J7IA 1CKBA 1XJWB 3SWNB 4J9IA 1M4ZA 2F5KA 4A4HA 2RI2A 1NPPA 5GANe 5KCHA 3PIOA 4PL6A 2K9GA 3MCAB 3PGGA 4OGEA 4ESRA 1YITA 4LDXA 2B8AA 1YI2Q 4J9BA 1YJ9T 3BDLA 2ESWA 3CBOA 2E4HA 3BDUA 1T0JA 1OPLA 2FPFA 4F14A 5DLOA 4XTUA 1G8XA 5FLXE 1VIFA 4OMNA
chains in the Genus database with same CATH topology
2JVVA 3E1SA 2HNIA 1BI3A 3G6ET 4BUGA 2E5QA 1M1KC 4JRQA 2HAXA 3OQ5A 2DJZA 3FLGA 1Q81C 4VUBA 1Q82C 1BIAA 2JTFA 1OZ2A 3I55T 2L89A 5LJ5d 1VQOT 3J80E 1X6OA 5GAMh 1KC8U 3FDRA 4OP0A 2G3RA 2Y4XA 1KQSS 2JZ2A 3OMCA 3MEAA 5CKEA 1VQKA 4X34A 2VYTA 2GFUA 3JB9G 3HRUA 1VQPA 2XD0A 4M78D 5FRMA 3QIIA 1WQ7A 3FEOA 4IURA 1VQ4A 4E7KA 1OZ3A 1VQLT 2JN0A 4J6XA 4UC4A 3URGA 4E7IA 1N8RU 3PFSA 4C92E 1KHCA 1DJ7B 4QVCA 2Y4YA 3M53A 5GAMe 1YIJT 1XQHA 2O4XA 2CS7A 4TVRA 3LWHA 1KD1C 2ZCFB 3OYGA 1VQKT 1VQPT 2A7YA 2EAYA 5M9OA 4N4HA 4C92A 1I4K1 2DXCA 5FU7B 1VQ4T 2HQEA 5J39A 5GAMg 3VYHB 3INZA 1PSEA 4NL2A 3CCRT 1HK9A 2LTOA 1K8AU 3JB9F 4M7AG 4J7FA 2OTJT 3L2UA 4C0DC 3L42A 4RMOA 2VXFA 3X26B 4QVDA 5LJ5h 3CCJT 2VUBA 1WJSA 3S3NA 1YJWA 2QQSA 3TREA 1IREB 2RJCA 4MMKA 4NL3A 4GLKA 5DM7R 4XU3A 1I8FA 2EKOA 3RMQA 5A0GA 1G3TA 3GNGA 3CC4T 2E64A 1K9MU 2M0OA 3P8BB 2RO0A 4L6V5 3M58A 2CZ6B 2DZCA 1Y96B 2PUKB 1BKBA 2VGMA 3M5AA 4M7AB 4F7UE 3GPLA 4A54A 2DIGA 1YJNT 5FU6B 5LJ5e 4FT2A 3FRNA 4ME7A 1YJWT 4EMKB 5CIUA 1N27A 4QQDA 4C8QE 4ZN3A 1R8OB 5GAOq 5LJ3h 1JB0E 4M77E 3X25B 4F7UA 2AHJB 3PT9A 4GY5A 3JCMf 3X24B 1X75C 2CZ1B 5GAN8 3OS1A 4LD9K 3MHXA 2EWNA 5LJ5g 2BIVA 5GANf 3HP9A 1WGSA 2E10A 4C8QA 3CC2T 4M75E 3L2RA 4M77A 4PKCC 3OYEA 1Q7YC 4JLGA 4J6WA 2X4XA 2RHUA 3BW1A 1M9SA 2CZ7B 5CK9A 4XTWA 4QQGA 3CCVA 3QDRB 2KDSA 2L5QA 1G3YA 2WSEE 4M78B 1UGSB 2PVOB 3QZ5B 4M75A 2X4JA 5LJ3e 2XICA 3RUXA 1BI1A 1O9SA 4M78F 2KMTA 3JCMc 2EIFA 5HY6A 1QP2A 3WVDB 5CO7A 2DTOA 4C92D 1V29B 2DD5A 3OS5A 4XQ3A 5FU6C 2JTMA 5LJ3g 2LNVA 5CAIA 3WXMB 2O01E 3FIFA 3OB9A 1YI2A 4LD6A 4NS5A 3ZBDA 3NTKA 4N0AC 4PJOG 3GLXA 2GF7A 2K2VA 4RKUE 3CCUT 5A0DA 2RA2A 3NTIA 2WACA 1G5VA 4XTYA 4X9CA 3CCMT 4BACA 1VQ8A 1VQ9T 3KUFA 3QPHA 2GCXA 4E47A 4JRPA 1NJIU 3OYYA 2RI3A 4R55A 1N9SA 1WJQA 1VIEA 1G3SA 5J3BA 3OYMA 4DQ2A 1YI2T 2E6ZA 4M7DE 2ZPFB 3CMEA 3CCSA 3CMAA 3JCMW 4MZPA 4EPCA 3L2VA 4PJOB 2CYZB 4JS4A 3VU3C 3CC7A 2L8DA 3JCMX 4M7DC 2RJDA 4FT4A 4XU1A 4IKFA 3CBPA 4M7DA 5HK0A 1QVGS 5GAOm 1VQNT 2H3JA 4LDUA 3JB9J 2YLBA 3A8MB 5L8RE 3RKWA 5GAMf 3LWIA 5EG2A 3LLRA 5CVIA 5CKDA 1YITT 2ZPGB 3A5ZB 2HQXA 4X9DA 3V7CA 1UGPB 4C8QD 3CMET 3CMAT 4M77D 4JS5A 2Y90A 4HKEA 4MZTA 4B9WA 2EYQA 2QQAA 1WNLA 2VXEA 3HRTA 3SWNC 4C92G 3JCMJ 3CC7T 4JUVA 2FYKA 1Y71A 1JRIA 1QVGA 2C06A 4XU0A 4KULA 4M75D 2XHCA 3A8LB 4DOVA 4C5HA 3J81E 4J5YA 5A0LA 4BD3A 4XTZA 3G7ZA 5IT9E 2XDBA 3QJYA 2E41A 2OTLA 1YCYA 3TU4K 3LGFA 3KXTA 2O4XB 3JCMb 3S3MA 2XK0A 1OI1A 3A8GB 3VKIA 2M1HA 4C92B 2KY9A 3L2WA 2D0QB 3V8LA 1K73C 2DVEA 2EJGA 2OAUA 4L59A 4C92F 3OS0A 4C0GA 3C4SA 4XTVA 2LT4A 3I56A 2I2LA 4JDSA 4WF2A 1B34B 4FM4B 2YHTA 3G71A 3PTAA 2QEXA 1D3BA 1VQ6A 1WPYA 1YBYA 2PU9B 2X4WA 3PMTA 5I21A 4KUDK 2KK4A 4ELYC 4ZGJB 3G4SA 2LCLA 3RMSA 3FJPA 3VUZA 3SD4A 4BE1A 2D9TA 3FC3A 5GAOl 4KUIA 2KAFA 2MI6A 4ATOA 2EQKA 3ME9A 3SDZA 4N4IA 4OMFB 5FRNA 3QHSA 1N9RA 4A4KA 2K5FA 3OBWA 3RKYA 4M7DD 1Q86U 3F70A 3LGLA 2R57A 2XIDA 4BY6B 5GAN7 5I2SA 4M75G 4HT9A 5IN1A 4R56A 5A2QE 3G4ST 1VQ7A 4PLIA 2JNGA 2R5AA 4OGCA 4ZN1A 5GAN3 4F7UB 3CBMA 3HHTB 3CPFA 3UPUA 1KQ2A 4ZGDB 3C95A 2RD1A 2DTIA 4F7UF 4HCCA 1JBMA 4C8QB 4QQ6A 2EFIA 3L2QA 3NFCA 4M78G 2MAMA 4M77B 5CCAA 4XTXA 2R5MA 2RK2A 3QZ9B 3L2ZA 3EFRA 4C8QF 4LDVA 5FU7C 4M77F 1VQ7T 1XOVA 1I5LA 4M75B 2FVUA 1M1KU 2ZPHB 4II1A 2M9UA 4ELZC 3JCMd 2RJEA 3PMIA 2L3RA 5LL6S 1Q81U 1O75A 2E12A 2XG8D 2QQRA 5IAYA 2DZ9A 4M75F 5GANd 3GF5A 5GAN6 3DLLA 2RB6A 3A8OB 3VYGA 3JAME 3CCEA 1LOJA 4J6YA 4OF1A 1VQMA 2D6FA 1I81A 4BE0A 4IUVA 2XKOC 1QP3A 4E7JA 4ZTFA 2LQ8A 4OVAA 3P8HA 3CD6A 4M7AE 3QO3A 2RHZA 2EQJA 3CCQA 1M90U 1QVPA 4EMHA 1UEBA 4FSXA 3QG1A 3QSUA 3P8DA 5GANj 1HXDA 3SB2A 4P5NA 3C12A 4M7AC 3ER0A 3R6OA 4CRIA 4BI4A 2EJFA 3OYJA 4M7AA 4OB1B 3GIBA 1VQMT 1BI2A 3CCVT 2DAQA 4EMKC 5HKCA 5GMKj 5GAOp 4JJNK 3PIPA 1U8RA 1KC8C 1Y7XA 3M4GA 3JCMQ 3BFMA 1KD1U 3DB4A 3Q1JA 3CD6T 4J83A 2K5LA 2LX9A 3JSCA 4N0AA 3CCQT 3MO8A 1AHJB 2WSCE 5CKFA 1SSFA 3E9FA 4E7LA 5GAOr 3GOXA 1N6AA 4LDWA 4JRIA 1NPRA 4RCBA 4ZTJA 1N8RC 2RM4A 2V8KA 4RG2A 3GP8A 4B9XA 2DPPB 3A8HB 4QVZA 4RCCA 2RHXA 4M78C 2CKKA 2DEQA 5CQYA 1M8VA 4M7DF 3OYFA 2PVGB 3GNFB 3LYIA 4JLIA 5CKBA 4MDWA 5KH6A 3JRZA 2IG0A 3M55A 3CPWA 2DK3A 4LDYA 3VUBA 4FL6A 4A4FA 3UT1A 5GAOn 1VUBA 4IUUA 4PLLA 3JCMP 3V8KA 1YJ9A 1W2BS 1Y07A 3OBYA 1VQ8T 3JCMe 2MWOA 1ZBXA 2K3YA 2M16A 1K8AC 3L1AA 3NTHA 1ZQ1A 4HCBA 3CCLA 3M9QA 4A53A 2F5TX 5GAMd 3UDCA 5GAN5 3CCST 1FX7A 4BDYA 2IVWA 2PVDB 2LQKA 4MZMA 1OYXA 2DO3A 3JCMg 3TCJA 3MEUA 2FB7A 3HFNA 4L5GA 3SWNA 2K4YA 1W2BA 3SFMA 2QDYB 3T9NA 3S3OA 3RESA 2BKDN 3G6EA 1K9MC 3J7AF 1BIBA 2XDDA 4O6JA 2VC8A 3OYNA 2ZPEB 4PJOE 2QXFA 1Q7YU 3META 5GAMj 1MHNA 2QQ9A 3V7SA 3I55A 2QA4A 2GFAA 4OB3B 1XTDA 4BE2A 3QUIA 4M7AD 2XI9A 2X35A 4HT8A 3MEVA 4PJOC 3ZFJA 4PJOA 1QW1A 3HPWA 1FXXA 5CR2A 1GXIE 1D3BB 1P92A 1KQ1A 2VV5A 2EQMA 2ZPIB 2XDPA 3V7RA 2PQWA 2P0KA 4OB2B 5CKHA 5AYFA 1LJOA 5LJ5f 2E6NA 3EAEA 1BYMA 1VQLA 2VGNA 2LVMA 2QA4T 3RKXA 2OTLT 4D6WA 1NZ9A 3MP1A 3BY7A 5FROA 4C0DB 3MP6A 1PSFA 3M57A 4HCZA 2ZGWA 3HFOA 5KE3A 4J7IA 2V8JA 3N5BB 2FL7A 3UWNA 1YIJA 4E7HA 1G3WA 4RG8A 5GAN2 4F7UG 3OYDA 4Y91A 2XU8A 1M90C 2RHIA 4V2SA 3MP8A 3JB9I 3QYHB 3OYLA 2HD0A 4C8QG 1M1FA 2K57A 4OB0B 4IUQA 2DXTA 4M77G 3CCRA 3I56T 4QW2A 5LJ5j 3EFSA 2OTJA 2E1HA 3ASKA 3ZEHA 3G71T 1MGQA 5LJ3f 2QEXT 3E9GA 1M1GA 1VQ6T 3CCJA 1KQSA 3LW5E 5GMKi 5LJ3d 3CXCS 4C92C 2A3LA 3DB3A 2ZPBB 3OW2S 4Z02A 4C5GA 3CEYA 3V8JA 3RIRA 3QYGB 3M56A 4CI0C 5GMKl 3AHUA 3CC4A 1JJ2S 3QJ6A 2QTXA 2P0PA 4FU6A 1NJIC 2FHDA 4O5VA 2LC4A 3OSVA 4C0ZA 2RK1A 2QI2A 1KHIA 1B34A 3HL8A 5DLQE 1TH7A 3S6WA 1YJNA 2DIQA 3M59A 1UGRB 3QXEB 4IUTA 3MEWA 4C5EA 3WVEB 1LNXA 2LT1A 3FB9A 5LJ3j 2MWPA 3OYHA 3CXCA 3OW2A 1Q82U 2ZZDA 5HK3A 2RH2A 1WJRA 1ZHIA 4J8OA 2KVQG 5GAN4 2V8IA 3QKJA 1JJ2A 2RI5A 5I2MA 3OYCA 4PJOD 2DD4A 3OSSC 4Q5WA 2P0QA 3OYIA 2DTHA 1H641 3OYAA 3CC2A 2JOYA 5C0MA 2E65A 2LRQA 4BY6C 4C0FA 3OMGA 3RERA 4BI8B 4HA8A 1XNIA 2RJFA 3X28B 1UGQB 2R58A 4M7AF 1QVFS 1RL2A 1EIFA 4YTLA 2DXUA 3LH0A 4M7DG 1Y96A 2MMPA 1WQWA 4DOWA 4KT0E 5C6SA 1K73U 3CCET 3C94A 2P4TA 4C8QC 4MMLA 3JB9H 2EQUA 4M77C 5KE2A 2NLUA 4EMKA 3OYBA 4BI3A 3O8VA 4XK8E 2GQVA 5D6XA 3DKMA 1QVFA 2KSSA 4M75C 3X20B 3CPWS 3VJPA 5D6YA 2CZ0B 4XU2A 1KG1A 3H8ZA 4MDXA 4NOYA 4M78E 3JCMh 3OYKA 3CCUA 4N4GA 2DKGA 3HKSA 3HSBA 1M5Q1 3H6ZA 1NE8A 4M7DB 5GANh 5J26A 3OY9A 1FWZA 2BUDA 4BDZA 1VQ5A 3E19A 3CCMA 3QBYA 4JRKA 4KBMB 3VV0A 4C5IA 4EDUA 1S72A 4M78A 5GMKh 1VQ9A 1UB4A 5KCOA 2QQBA 2K5IA 4ZGEB 1U1TA 2LDMA 2CGHA 2YLCA 3SWNB 4EMGA 3PNWC 1M4ZA 2F5KA 4IUPA 4A4HA 3JB9D 2E70A 1NPPA 2LCCA 2RI2A 3LX7A 5DY9A 5GANe 1YHQA 1VQ5T 5KCHA 2K3XA 1S72T 3PIOA 1X01A 1VQNA 3TEEA 1BI0A 4PL6A 3PGGA 3MCAB 5D6WA 4Y28E 5GMKe 1IZ6A 3KBGA 4OGEA 1Q86C 2HBPA 1RI0A 1YITA 2RHYA 4FIBA 4LDXA 4XAXB 3M54A 4A4GA 2B8AA 3DLMA 5GANg 2KQWA 1YJ9T 2EJ9A 2F69A 3BDLA 1W4SA 3CBOA 5GMKm 3BDUA 1U1SA 4PNOA 2X4YA 2WSFE 1YHQT 2MF2A 3CCLT 5DLOA 4PJOF 3HRSA 3JCMV 2JUFA 4XTUA 4BB7A 3M4YA 4A4EA 3OA6A 1VQOA 5FLXE 1VIFA 3OS2A 1H3ZA 4DA4A 2PUOB 5CQXA 2DXBA 2YRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HNI A;  1MGQ A;  2RB6 A;  5LJ3 f;  1LOJ A;  4J6Y A;  4XTY A;  4X9C A;  1I81 A;  5GMK i;  2DJZ A;  5LJ3 d;  4C92 C;  1BIA A;  1N9S A;  3V8J A;  4M7A E;  3QO3 A;  3RIR A;  4DQ2 A;  5GMK l;  5LJ5 d;  3AHU A;  4M7D E;  5GAN d;  4EMH A;  5GAM h;  3JCM W;  3QSU A;  2QTX A;  4OP0 A;  4PJO B;  5GAN j;  1HXD A;  3SB2 A;  4M7A C;  3VU3 C;  3JCM X;  4M7A A;  1B34 A;  2EJF A;  3JB9 G;  1TH7 A;  3GIB A;  4XU1 A;  4M7D C;  4M78 D;  4EMK C;  4M7D A;  5GMK j;  5GAO m;  5GAO p;  3JB9 J;  1WQ7 A;  1LNX A;  2YLB A;  3FB9 A;  3M4G A;  5LJ3 j;  3JCM Q;  3BFM A;  3RKW A;  5GAM f;  2JN0 A;  4J6X A;  4N0A A;  5GAN 4;  4X9D A;  3V7C A;  4C92 E;  4C8Q D;  4QVC A;  5GAM e;  4M77 D;  4PJO D;  2Y90 A;  5GAO r;  2DTH A;  2VXE A;  1H64 1;  1WNL A;  3SWN C;  3JCM J;  4C92 G;  4JRI A;  4JUV A;  2FYK A;  4RCB A;  2E65 A;  2RM4 A;  3RER A;  1JRI A;  2EAY A;  4C92 A;  4HA8 A;  1I4K 1;  4XU0 A;  4M75 D;  4RCC A;  4M7A F;  4M78 C;  2DEQ A;  1M8V A;  5GAM g;  3INZ A;  4J5Y A;  4NL2 A;  4M7D F;  1HK9 A;  4JLI A;  3JB9 F;  4HT8 A;  4M7A G;  4XTZ A;  2DXU A;  2E41 A;  4M7D G;  1Y96 A;  1WQW A;  1YCY A;  5GAO n;  2VXF A;  4QVD A;  4C8Q C;  5LJ5 h;  4MML A;  3V8K A;  3JCM b;  3JCM P;  3JB9 H;  4M77 C;  3JCM e;  4EMK A;  4MMK A;  4NL3 A;  3L1A A;  4C92 B;  4XU3 A;  1I8F A;  3V8L A;  4A53 A;  5GAM d;  2DVE A;  5GAN 5;  4PJO C;  4M75 C;  2E64 A;  2EJG A;  4C92 F;  4XU2 A;  3JCM g;  4XTV A;  4NOY A;  4M78 E;  2DZC A;  1Y96 B;  3JCM h;  2FB7 A;  2I2L A;  3HFN A;  1B34 B;  2DKG A;  4WF2 A;  4M7A B;  1M5Q 1;  2YHT A;  3SWN A;  4A54 A;  4F7U E;  3HSB A;  5LJ5 e;  5GAN h;  4M7D B;  1D3B A;  3RES A;  1WPY A;  4EMK B;  5I21 A;  1BIB A;  4JRK A;  2VC8 A;  4C8Q E;  4M78 A;  5GMK h;  4M75 F;  5GAO q;  5LJ3 h;  4M77 E;  5GAN 7;  3FJP A;  4F7U A;  4PJO E;  3JCM f;  5GAM j;  5GAN 8;  3V7S A;  5GAO l;  1U1T A;  2EWN A;  5LJ5 g;  5GAN f;  3QUI A;  4M7A D;  2E10 A;  2CGH A;  1N9R A;  2YLC A;  3QHS A;  4M75 E;  3RKY A;  3SWN B;  4C8Q A;  4EMG A;  4M77 A;  4M7D D;  4PJO A;  3JB9 D;  5DY9 A;  5GAN e;  1D3B B;  4J6W A;  3BW1 A;  1KQ1 A;  4M75 G;  4XTW A;  4HT9 A;  1X01 A;  4M78 B;  3V7R A;  5GAN 3;  5GMK e;  1LJO A;  3PGG A;  4M75 A;  4F7U B;  5LJ3 e;  5LJ5 f;  3RKX A;  3RUX A;  4M78 F;  3JCM c;  3BY7 A;  1KQ2 A;  2RD1 A;  2DTI A;  4F7U F;  5GAN g;  1JBM A;  2ZGW A;  3HFO A;  2EJ9 A;  4C8Q B;  4M78 G;  5GMK m;  3BDU A;  4M77 B;  2DTO A;  4C92 D;  5GAN 2;  1U1S A;  4XTX A;  4PNO A;  4XQ3 A;  4F7U G;  5LJ3 g;  4Y91 A;  3L2Z A;  3EFR A;  4C8Q F;  5CAI A;  4M77 F;  4PJO F;  1I5L A;  3JCM V;  4V2S A;  3FIF A;  4XTU A;  3JB9 I;  4M75 B;  4C8Q G;  3JCM d;  2K57 A;  4M77 G;  2DXT A;  4N0A C;  4PJO G;  5LJ5 j;  3EFS A;  2DZ9 A;  2E1H A;  5GAN 6;  2RA2 A; 
#chains in the Genus database with same CATH topology
 2JVV A;  2HNI A;  2LX7 A;  1MUZ A;  2DA9 A;  2E5Q A;  3QDF A;  1C6V X;  1Q81 C;  1OZ2 A;  5LJ5 d;  1GCQ C;  1C1A A;  1M30 A;  3FDR A;  4J9E A;  2LQW A;  3OMC A;  2V1R A;  1VQK A;  2VYT A;  2H8H A;  4M78 D;  5FRM A;  3QII A;  1OZ3 A;  1VQL T;  1EX4 A;  2QYZ A;  4E7I A;  1SHG A;  1KHC A;  1TOV A;  1HSQ A;  2Y4Y A;  5IH2 A;  2O4X A;  2CS7 A;  4TVR A;  3LWH A;  2OTL Q;  1VQP T;  4Z88 A;  2EAY A;  4N4H A;  2L2P A;  3INZ A;  4FW1 A;  1HK9 A;  1Y0M A;  1EZZ B;  2OTJ T;  1TG0 A;  3L2U A;  3L42 A;  2E3H A;  1WJS A;  4KGZ B;  1RAF B;  1YJW A;  4MMK A;  1NLP C;  5DM7 R;  1M1K R;  1I8F A;  3G71 Q;  1OU8 A;  3CC4 T;  1HD3 A;  3G4S Q;  2M0O A;  2DZC A;  1X2Q A;  2YUP A;  3M5A A;  4M7A B;  4A54 A;  2DIG A;  4PFZ A;  5CIU A;  1N27 A;  4J9D A;  5GAN 7;  4QKU A;  3JCM f;  3OS1 A;  1VYU A;  4AT1 B;  3MHX A;  2EWN A;  5LJ5 g;  1ABQ A;  1BCO A;  2FEI A;  5HCK A;  2CUD A;  4C8Q A;  4M75 E;  2O9S A;  1AWJ A;  4PKC C;  3OYE A;  5GJV B;  1KD1 R;  2X4X A;  2CZ7 B;  5CK9 A;  4M4Z A;  2KDS A;  2A0F B;  5IXB A;  1UTI A;  3QZ5 B;  3RUX A;  1BI1 A;  2VKN A;  1AZE A;  2EIF A;  1QP2 A;  3WVD B;  1KFZ A;  2EGA A;  2FZG B;  3OS5 A;  2JTM A;  3EHR A;  5CAI A;  3EGX B;  3FIF A;  3OB9 A;  3CCV Q;  1YI2 A;  2HMA A;  4NS5 A;  3ZBD A;  3NTK A;  4N0A C;  1M27 C;  2GF7 A;  1SEM A;  1VOM A;  2RA2 A;  3CQT A;  2WAC A;  5KYY A;  3CCM T;  2PNI A;  3H9N A;  2GCX A;  2ED0 A;  1NJI U;  1G3S A;  4M7D E;  2VVK A;  1PD0 A;  4EPC A;  3L2V A;  4ANJ A;  4PJO B;  1PCX A;  3VU3 C;  2L8D A;  2CP7 A;  2AKK A;  1WXU A;  2EGC A;  3A8M B;  2KR3 A;  5GAM f;  2E5K A;  2HQX A;  2K2M A;  4JS5 A;  2Y90 A;  4HKE A;  4B9W A;  2EYQ A;  3CC7 T;  1TUC A;  2CH4 W;  1JRI A;  4KUL A;  2KRM A;  4HVW A;  1SPK A;  5IXF A;  1R0C B;  3PVQ A;  4XTZ A;  5I11 A;  2XDB A;  3QJY A;  2OTL A;  1KJW A;  2DVJ A;  1ZBJ A;  2YRC A;  1D1C A;  2JTE A;  3A8G B;  4JPB W;  4C92 B;  5FWC A;  1HJD A;  2OAU A;  4C92 F;  2RQV A;  2RQW A;  1E6H A;  2HZY A;  4FM4 B;  3G71 A;  1BCM A;  4AFU C;  3EH1 A;  4KUD K;  3G4S A;  4ELY C;  1Q95 G;  3RMS A;  3R6N A;  2D9T A;  4KUI A;  3ME9 A;  3SDZ A;  4OMF B;  3QHS A;  1N9R A;  3RKY A;  5KYU B;  1MNE A;  2XID A;  4BY6 B;  4ZN1 A;  4F7U B;  2E3I A;  2B86 A;  1AD5 A;  1KQ2 A;  2RD1 A;  2DTI A;  4F7U F;  2EQI A;  2EFI A;  2JXB A;  2MAM A;  4M77 B;  4HCK A;  2R5M A;  5FU7 C;  4M77 F;  3CCJ Q;  2CP2 A;  1RAA B;  3JCM d;  5LL6 S;  1JXO A;  1O75 A;  1RAC B;  2XG8 D;  2QQR A;  3GF5 A;  3A8O B;  3VYG A;  1I81 A;  2YRD A;  1QP3 A;  4D8K A;  4ZTF A;  1YJN Q;  4PJM A;  1M90 U;  2BE9 B;  4FSX A;  2DYB A;  3QG1 A;  3P8D A;  1FMK A;  4PFP A;  4CRI A;  4M7A A;  1Z9Z A;  2EJF A;  1NEB A;  1FYN A;  1PRL C;  4EMK C;  5HKC A;  5GMK j;  3JCM Q;  4RTZ A;  2F1L A;  2LX9 A;  2J05 A;  3CCQ T;  3MO8 A;  2WSC E;  5CKF A;  1SSF A;  1KIK A;  2COW A;  4D8D A;  1NPR A;  2V26 A;  4RCB A;  1I0C A;  1N8R C;  1M3C A;  2DBM A;  3GP8 A;  2DPP B;  1M8V A;  4DEY A;  3H0F A;  2SRC A;  5CKB A;  1JJ2 P;  4J9C A;  4LDY A;  4E2F B;  3JCM P;  1VQ8 T;  2MWO A;  1K8A C;  5GAM d;  1S72 Q;  4BDY A;  2IVW A;  1VQ9 Q;  1OYX A;  3JCM g;  1UGV A;  3MEU A;  1WHK A;  5D7U A;  4FYW B;  2QDY B;  3RES A;  3G6E A;  1BIB A;  4JZ3 A;  3M0Q A;  2VC8 A;  3OYN A;  2HCK A;  1AT1 B;  1QWE A;  1Q7Y U;  5GAM j;  2QQ9 A;  3A98 A;  2ATC B;  2GFA A;  1XTD A;  4BE2 A;  2X35 A;  1NBE B;  4PJO A;  1QW1 A;  4PFO A;  1D3B B;  1KQ1 A;  1IXD A;  3EHQ A;  1LJO A;  3EAE A;  2K79 A;  3I55 Q;  1UE9 A;  2W0Z A;  2SEM A;  5FRO A;  3H41 A;  5KE3 A;  1K4U S;  2BE7 D;  3HFO A;  5GAN 2;  2M0Y A;  1UFF A;  4R0K A;  2QDL A;  2JM9 A;  1FMV A;  3MP8 A;  4C8Q G;  1M1F A;  2FO0 A;  1AOJ A;  4QW2 A;  3VS2 A;  1YWO A;  2E1H A;  4J9G A;  3ASK A;  5LJ3 f;  2QEX T;  2ROT A;  3CCJ A;  2PZ1 A;  1KQS A;  2PTK A;  4EIK A;  2A3L A;  3V8J A;  2K7A A;  3AHU A;  4CI0 C;  1JJ2 S;  1VQ4 Q;  1MMN A;  2GTJ A;  4O5V A;  2LC4 A;  1QWF A;  1I1J A;  1TH7 A;  1YJN A;  2DIQ A;  1WXB A;  2HL3 A;  3WVE B;  1OPK A;  2AT1 B;  1Q82 U;  1TWB A;  1ZHI A;  1JJ2 A;  2QAS A;  1H8K A;  1WHM A;  5I2M A;  4Q5W A;  1K9A A;  2P0Q A;  4AG1 C;  3OYI A;  1H64 1;  2LMJ A;  2JOY A;  3RER A;  2LRQ A;  3OMG A;  4BI8 B;  1UGQ B;  2R58 A;  1M90 R;  2M51 A;  5FW9 A;  4AFQ C;  2OJ2 A;  3JB9 H;  5KE2 A;  4QT7 A;  2GQV A;  4KH1 B;  3DKM A;  3X20 B;  4M75 C;  3EG1 A;  5D6Y A;  2CZ0 B;  4K11 A;  4N4G A;  3HSB A;  2DLP A;  4BDZ A;  1FWZ A;  3D7S B;  3E19 A;  1D1B A;  1S72 A;  1VQ9 A;  1UUE A;  1Z9Q A;  4JZ4 A;  4M78 A;  4EDU A;  2LDM A;  2YWW A;  3PNW C;  3CCU Q;  4IUP A;  2LCC A;  5DY9 A;  1QCO A;  1BI0 A;  1Q86 C;  3G1J A;  3VRZ A;  4FIB A;  4A4G A;  3DLM A;  3QWY A;  5GMK m;  1U1S A;  4PNO A;  1TU0 B;  3CCL T;  3JCM V;  2JUF A;  2DFU A;  4A4E A;  5KYN A;  1PKT A;  4JJB A;  2CSI A;  3EG9 B;  2DXB A;  2O9V A;  1YIT Q;  3CCS Q;  4BUG A;  1M1K C;  4JRQ A;  1OEB A;  1BIA A;  3EG3 A;  1GCQ A;  1VA7 A;  1KC8 U;  3EGD A;  4RTU A;  2Y4X A;  3MEA A;  4IUR A;  1VQ4 A;  4E7K A;  3TVT A;  1U06 A;  1LVK A;  1KSW A;  1DJ7 B;  1S1N A;  1YIJ T;  1XQH A;  3M0S A;  4HVU A;  1KD1 C;  2COZ A;  1VQK T;  4J9H A;  4DBF A;  5FU7 B;  3CCR T;  2LTO A;  3JB9 F;  4M7A G;  4J7F A;  4RMO A;  2VXF A;  5LJ5 h;  2QQS A;  1QVG P;  2RJC A;  2EYX A;  1Q82 R;  1VQ6 Q;  2E64 A;  2LZ6 B;  1K9M U;  2RO0 A;  1Y96 B;  2VGM A;  1UJY A;  5LJ5 e;  3FRN A;  4ME7 A;  4DEX A;  1YJW T;  4EMK B;  2VB6 A;  4C8Q E;  1JB0 E;  2AHJ B;  4FCY A;  4LD9 K;  2CZ1 B;  1VQ7 Q;  5GAN f;  2E10 A;  1MMD A;  3CC2 T;  3MKD A;  1WHJ A;  4JLG A;  3ULR B;  2H3E B;  1UGS B;  1SF9 A;  1SG5 A;  2PVO B;  2X4J A;  1MMA A;  2KYB A;  4AFS C;  4C92 D;  3TQ7 P;  1PNJ A;  5FU6 C;  5LJ3 g;  1TUG B;  3CCE Q;  2J6O A;  4PJO G;  1YP5 A;  4RKU E;  5A0D A;  3NTI A;  2CP6 A;  4BAC A;  4JRP A;  1N9S A;  1WJQ A;  5J3B A;  1YI2 T;  1YN8 A;  4DQ2 A;  4DBR A;  2ZPF B;  2KRS A;  3CCS A;  3JCM W;  2HSE B;  2A28 A;  3JCM X;  1QVG S;  1VQN T;  2H3J A;  3LWI A;  3RKW A;  3VS0 A;  2ZPG B;  3A5Z B;  3V7C A;  1UGP B;  1D09 B;  4M77 D;  1ACM B;  3JCM J;  4C92 G;  2FYK A;  1Y71 A;  1QVG A;  2C06 A;  1YJ9 Q;  2DL7 A;  2DYI A;  4DOV A;  1X6B A;  4J5Y A;  5A0L A;  5IT9 E;  4E7S A;  3TU4 K;  3LGF A;  3KXT A;  4ZNX A;  3I5R A;  3JCM b;  2CRE A;  1N5Z A;  3V8L A;  3OS0 A;  1IGU A;  3QWX X;  1ZUK A;  2QA4 Q;  4OMM A;  2YHT A;  3PE0 A;  3PTA A;  1VQ6 A;  1WPY A;  2PU9 B;  2X4W A;  2KK4 A;  4ZGJ B;  1YFN A;  1SHF A;  2LCL A;  1HYO A;  3FJP A;  5GAO l;  2MPX C;  1ZA1 B;  1RAG B;  1VQL Q;  4A4K A;  2K5F A;  1W2B P;  3LGL A;  5I2S A;  5IN1 A;  3G4S T;  1VQ7 A;  2JNG A;  5GAN 3;  1K9M R;  3U23 A;  3UPU A;  3REA B;  3C95 A;  1JBM A;  1GFD A;  2QGG A;  3L2Q A;  4M78 G;  4XTX A;  2RK2 A;  3E2U A;  3EFR A;  4LDV A;  1SRM A;  1I5L A;  4M75 B;  2FVU A;  2ZPH B;  4II1 A;  2M9U A;  1K73 R;  1Q81 U;  2L3R A;  5GAN d;  4M75 F;  5KYW B;  5GAN 6;  2X51 A;  3CCE A;  3JAM E;  1W70 A;  3CC4 Q;  4IIO A;  2F2V A;  2QTV A;  1E6G A;  4E7J A;  1IB8 A;  4M7A E;  2RHZ A;  5IHK A;  2YXY A;  3KFV A;  3UF4 A;  4HVV A;  1M2O A;  5GAN j;  4P5N A;  2FPD A;  4BI4 A;  3OYJ A;  3CCV T;  2DAQ A;  2X3W D;  1D0X A;  2JW4 A;  1Y7X A;  3M4G A;  3VRY A;  2K5L A;  2QG9 B;  5GAO r;  3GOX A;  1WDX A;  2V8K A;  3CXC P;  4M7D F;  2YDL A;  3LYI A;  3RR6 A;  4MDW A;  3CPW A;  4WTO B;  3VUB A;  3UT1 A;  1W2B S;  1YJ9 A;  1Y07 A;  2KBT A;  3JCM e;  2DL3 A;  2NUT B;  1D1A A;  2GNC A;  3UDC A;  1VQ5 Q;  2PVD B;  2LQK A;  4MZM A;  1H92 A;  2MOX A;  1X6G A;  4L5G A;  3SWN A;  2FPE A;  2K4Y A;  1W2B A;  2BKD N;  1VYV A;  2J6K A;  2QAZ A;  4O6J A;  4PJO E;  1K1Z A;  3MET A;  2QA4 A;  2AK5 A;  3V7S A;  1YHQ Q;  1WXT A;  4OB3 B;  3UAT A;  2AZS A;  3MEV A;  1LPL A;  3RDV A;  1R0B G;  2VV5 A;  2ZPI B;  2XDP A;  1OQK A;  3G6E Q;  1BYM A;  1VQL A;  3RKX A;  2EVR A;  3MP1 A;  3BY7 A;  2RMO A;  1PSF A;  4HCZ A;  1VQO Q;  1UG1 A;  2RN8 A;  4E7H A;  1A0N B;  1WZO A;  4RTX A;  4LUD A;  1M90 C;  3A1P A;  1GFC A;  3QYH B;  3I5S A;  1H3H A;  2K57 A;  4OB0 B;  2DMO A;  2DXT A;  3I56 T;  3EFS A;  2OTJ A;  1MGQ A;  3CXC S;  2FRY A;  1GL5 A;  1QCN A;  1M2V B;  2ZPB B;  3DB3 A;  4KH0 B;  2GQI A;  1TXQ A;  4PJN A;  2BZX A;  1WHL A;  3CC4 A;  2QTX A;  4HXJ A;  1QQJ A;  1NG2 A;  2FHD A;  2KT8 A;  3HL8 A;  1ZSG A;  2C0T A;  3M59 A;  3QXE B;  3MEW A;  3CXC A;  1Q81 R;  2KVQ G;  3QKJ A;  1V1C A;  3OYC A;  1QKW A;  1UHF A;  3FJ5 A;  3OYA A;  1OUL A;  1I5O B;  1XNI A;  1RL2 A;  2DXU A;  1OU9 A;  2AIR B;  4DOW A;  1KQS P;  3C94 A;  1ZUU A;  2P4T A;  4MML A;  4C8Q C;  4OMQ A;  4XK8 E;  4XU2 A;  4LE9 A;  2LJ3 A;  4M78 E;  2LNH B;  4RTY A;  4ORZ A;  4RTT A;  5KYW A;  1NJI R;  8ATC B;  5ECA A;  2HL5 C;  3OY9 A;  1VQ5 A;  1OX9 A;  3CCM A;  4C5I A;  4KBM B;  2CP0 A;  4ZGE B;  4CC2 A;  2DBK A;  2HDA A;  1X2K A;  2CGH A;  4EMG A;  1I07 A;  2E70 A;  3JB9 D;  1YHQ A;  4RTW A;  1S72 T;  3EGX A;  3TEE A;  2CUB A;  5D6W A;  4Y28 E;  1IZ6 A;  2X3X D;  2HBP A;  1RI0 A;  2RHY A;  4XAX B;  2EJ9 A;  2CT4 A;  1W4S A;  1EFN A;  2NYS A;  3OA6 A;  1VQO A;  1UEC A;  1H3Z A;  2QK0 A;  2ROL A;  2YRV A;  2O88 A;  1BI3 A;  3CME Q;  4FYX B;  3CMA Q;  2HAX A;  2XMF A;  3OQ5 A;  2DJZ A;  3FLG A;  4VUB A;  1Q82 C;  1OX8 A;  3I55 T;  2L89 A;  2QGF B;  3J80 E;  1X6O A;  1U3O A;  3C0C A;  4OP0 A;  2G3R A;  1KQS S;  3M0R A;  5CKE A;  4X34 A;  3JB9 G;  3HRU A;  3HTR A;  2RQU A;  3LH5 A;  5AT1 B;  2NWM A;  2JN0 A;  4J6X A;  4UC4 A;  1N8R U;  3M0P A;  1JU5 C;  3PFS A;  4QVC A;  4AFZ C;  4A63 B;  1R77 A;  2A7Y A;  3EFO B;  4C92 A;  1I4K 1;  2DXC A;  1VQ4 T;  5GAM g;  3VYH B;  4NL2 A;  1K8A U;  2AKL A;  3TSW A;  3X26 B;  4LXC A;  1Y57 A;  2OAW A;  4PJL A;  3TRE A;  1AZG B;  2EKO A;  3RMQ A;  3GNG A;  5I22 A;  4L6V 5;  3M58 A;  2EBP A;  2DEU A;  2PUK B;  1K76 A;  5KYU A;  4FT2 A;  1J3T A;  1RLP C;  2BTT A;  4QQD A;  5GAO q;  5LJ3 h;  3X25 B;  4F7U A;  4GY5 A;  3X24 B;  5GAN 8;  1X75 C;  2EW3 A;  2DL5 A;  2BIV A;  3HP9 A;  1WGS A;  3NMZ C;  3VS5 A;  3L2R A;  4M77 A;  1M8M A;  1TUD A;  2K6D A;  3EG2 A;  2FZC B;  1M9S A;  4QQG A;  2I0N A;  2L5Q A;  1G3Y A;  2WSE E;  5LJ3 e;  1B07 A;  2EPD A;  2RQT A;  1WIE A;  2KRO A;  1G2B A;  4LUE A;  3JCM c;  1WLP B;  5HY6 A;  2KT1 A;  2DTO A;  1V29 B;  4XQ3 A;  4J9F A;  2MCN A;  2GGR A;  2KGT A;  1VQM Q;  4LD6 A;  3H0I A;  4GLM A;  1FMW A;  3GLX A;  3CCU T;  3CD6 Q;  4XTY A;  4X9C A;  1VQ8 A;  3VS4 A;  3KUF A;  3QPH A;  4IIM A;  1PD1 A;  4E47 A;  1MV3 A;  2LJ0 A;  4R55 A;  1PG5 B;  1UDL A;  1VIE A;  3OYM A;  2C0O A;  2BZ8 A;  3CME A;  3CMA A;  2X9H A;  4AMC A;  1IRX A;  1AWW A;  2OI3 A;  4M7D C;  1GRI A;  4FT4 A;  4XU1 A;  4IKF A;  2D8J A;  5HK0 A;  2HQH A;  5GAO m;  1Q7Y R;  4LDU A;  2YLB A;  1W6X A;  5L8R E;  1QKX A;  3I35 A;  3IQL A;  5CVI A;  1RI9 A;  1YIT T;  4X9D A;  1PWT A;  2HKQ B;  1GCP A;  4XU0 A;  4M75 D;  5IHN A;  3A8L B;  4C5H A;  4PJJ A;  4BD3 A;  3CCL Q;  2E41 A;  4F17 A;  2O4X B;  2XK0 A;  1OI1 A;  3SEM A;  2KY9 A;  3L2W A;  1K73 C;  2DVE A;  2EJG A;  2G6F X;  4L59 A;  1MV0 B;  2DJQ A;  2MYS A;  4XTV A;  2L3S A;  2I2L A;  4JDS A;  1B34 B;  2D1X A;  4OMP A;  2QEX A;  1D3B A;  5I21 A;  3PMT A;  2NUZ A;  2KAF A;  2MI6 A;  6AT1 B;  3AT1 B;  2KI7 A;  2DET A;  4M7D D;  1Q86 U;  1BB9 A;  1AWO A;  3NPF A;  4M75 G;  4R56 A;  4PLI A;  2GBQ A;  2R5A A;  4OGC A;  2ECZ A;  3CPF A;  4ZGD B;  2YUN A;  4GBQ A;  4C8Q B;  3NFC A;  1ZSZ C;  3L2Z A;  4C8Q F;  1VQ7 T;  1XOV A;  1M1K U;  3MJX A;  4ELZ C;  2RJE A;  3PMI A;  2YUQ A;  3SHW A;  3VS7 A;  2DZ9 A;  3DLL A;  2RB6 A;  1ZUY A;  1LOJ A;  4OF1 A;  1VQM A;  4BE0 A;  2VWF A;  4IUV A;  2XKO C;  4CC4 B;  4AG2 C;  2O2O A;  2P4R A;  3P8H A;  3CD6 A;  2MIO A;  1QVP A;  1UEB A;  3QSU A;  1D0Z A;  1CKA A;  3SB2 A;  4OMO A;  1WX6 A;  2VAS A;  2CT3 A;  4OB1 B;  5KYY B;  3GIB A;  4JJN K;  5GAO p;  1U8R A;  3BFM A;  2RPN A;  1KD1 U;  4J83 A;  2RNA A;  4N0A A;  2KYM A;  3NHN A;  2AZV A;  1GBR A;  1N6A A;  4LDW A;  4ZTJ A;  8AT1 B;  2RM4 A;  4RG2 A;  2A36 A;  3A8H B;  4M78 C;  2CKK A;  2PVG B;  3GNF B;  4JLI A;  2DL4 A;  3JRZ A;  3M55 A;  2DK3 A;  4A4F A;  4CC3 A;  5GAO n;  1VUB A;  4PLL A;  1WHG A;  3OBY A;  2M16 A;  2HEQ A;  1AVZ C;  3NTH A;  2ED1 A;  3CCL A;  1UJ0 A;  2FZK B;  5GAN 5;  1FX7 A;  1PHT A;  2DO3 A;  3TCJ A;  3HFN A;  2DRK A;  3T9N A;  1RAD B;  1MMG A;  2QXF A;  1KC8 R;  2MK5 A;  1MHN A;  2LCS A;  3I9Q A;  1VQN Q;  2J6F A;  1NM7 A;  4HT8 A;  3ZFJ A;  1P92 A;  2EQM A;  5CKH A;  2E6N A;  3CPW P;  2VGN A;  2LVM A;  2QA4 T;  2OTL T;  1X27 A;  5GJW B;  3EG9 A;  2ZGW A;  2V8J A;  1RAE B;  2FL7 A;  3N5B B;  1YIJ A;  1G3W A;  4RG8 A;  4F7U G;  2JMC A;  3UA6 A;  2XU8 A;  2RHI A;  4V2S A;  2M02 A;  3OYL A;  3REB B;  1T3S A;  3CCR A;  4M77 G;  1SSH A;  1B3Q A;  1U5S A;  5LJ5 j;  3ZEH A;  3G71 T;  1Q86 R;  3E9G A;  1M1G A;  1RLQ C;  3LW5 E;  2CP3 A;  1JO8 A;  2J06 A;  3CEY A;  1VQP Q;  5GMK l;  3QYG B;  3M56 A;  3QJ6 A;  2JJ9 A;  3NGP A;  1NJI C;  2HSP A;  4LN2 A;  3OSV A;  4C0Z A;  2OTJ Q;  1B34 A;  2KEA A;  1LNX A;  2A08 A;  2MWP A;  3OYH A;  3H0H A;  1W1F A;  1WA7 A;  2RH2 A;  4B6M A;  5GAN 4;  1IGQ A;  2RI5 A;  3UA7 A;  3OSS C;  2D0N A;  3JV3 A;  3CC2 A;  1IO6 A;  5C0M A;  2E65 A;  4C0F A;  4HA8 A;  2RJF A;  4M7A F;  1ZX6 A;  4YTL A;  3LH0 A;  1Y96 A;  1WQW A;  5C6S A;  4KT0 E;  1B7T A;  2DER A;  4E6R A;  2EQU A;  5FWB A;  4EMK A;  3OYB A;  2D8H A;  3O8V A;  1BU1 A;  2DM1 A;  4CC7 A;  4E7Z A;  2P84 A;  2RQR A;  2NUP B;  3CPW S;  5L23 A;  3VJP A;  4MDX A;  3JCM h;  3OYK A;  4M7D B;  2V1Q A;  1RAI B;  4JRK A;  2EYW A;  5GMK h;  1UB4 A;  5KCO A;  2QQB A;  2K5I A;  1U1T A;  4FYV B;  2DIL A;  1SRL A;  2YLC A;  3LX7 A;  1IHW A;  1QMC A;  1VQ5 T;  1OV3 A;  2L3Q A;  2K3X A;  1X01 A;  1VQN A;  3CCM Q;  2EKH A;  5GMK e;  2EGE A;  3KBG A;  1QLY A;  3M54 A;  5GAN g;  2KQW A;  2F69 A;  1YWP A;  1AEY A;  1LCK A;  2X4Y A;  4DBQ A;  2WSF E;  1YHQ T;  2MF2 A;  4PJO F;  3HRS A;  4BB7 A;  3M4Y A;  1F1B B;  3OS2 A;  4DA4 A;  2PUO B;  5CQX A;  3E1S A;  3G6E T;  1NYG A;  2JS2 A;  3CC7 Q;  2JTF A;  1VQO T;  2W10 A;  5KYX B;  5GAM h;  2JZ2 A;  2KNB B;  1PM3 A;  2GFU A;  1VQP A;  2XD0 A;  2JM8 A;  1WQ7 A;  3FEO A;  3URG A;  4C92 E;  3M53 A;  5GAM e;  2ZCF B;  3OYG A;  1X69 A;  1ZSZ B;  5M9O A;  3EGU A;  3VS1 A;  2HQE A;  2DE0 X;  5J39 A;  4FW2 A;  1PSE A;  4DBH A;  4C0D C;  4QVD A;  3VS6 A;  2VUB A;  3CCJ T;  3EG0 A;  3S3N A;  1IRE B;  2F2W A;  3I56 Q;  4NL3 A;  4GLK A;  4XU3 A;  5A0G A;  1G3T A;  3P8B B;  2CZ6 B;  1BKB A;  4F7U E;  3GPL A;  1YJN T;  5FU6 B;  1D0Y A;  3PVL A;  4KRT A;  4ZN3 A;  1R8O B;  4M77 E;  2KE9 A;  3PT9 A;  1RAB B;  3M0T A;  1NYF A;  5IHI A;  1RAH B;  1Q7Y C;  2YT6 A;  4J6W A;  2RHU A;  3BW1 A;  3CCV A;  4XTW A;  2BZY A;  3QDR B;  4M78 B;  4M75 A;  2XIC A;  1O9S A;  4M78 F;  2KMT A;  2KRN A;  1JEG A;  5CO7 A;  2DD5 A;  1YCS B;  2LNV A;  1RUW A;  3WXM B;  2O01 E;  2K3B A;  2CSQ A;  4F16 A;  2F2X A;  2K2V A;  2COY A;  3CCQ Q;  1G5V A;  2LP5 A;  1VQ9 T;  3OYY A;  1YNZ A;  2RI3 A;  2IIM A;  2YUO A;  2E6Z A;  2O31 A;  2NUP A;  9ATC B;  4MZP A;  1BK2 A;  2CDT A;  2CYZ B;  3CC7 A;  4JS4 A;  2RJD A;  3RNJ A;  3CBP A;  4M7D A;  3O5Z A;  3JB9 J;  4KGV B;  1VQ8 Q;  1ZA2 B;  5EG2 A;  3LLR A;  5CKD A;  3CME T;  3CMA T;  4C8Q D;  3EGD B;  1OOT A;  2L0A A;  4MZT A;  2ZAE A;  2QQA A;  2VXE A;  1WNL A;  3HRT A;  3SWN C;  4JUV A;  2A37 A;  2NUT A;  3TSZ A;  2XHC A;  1ABO A;  3J81 E;  2DRM A;  3G7Z A;  2DF6 A;  1YCY A;  2DX1 A;  4KGX B;  1K0S A;  3S3M A;  3VKI A;  2M1H A;  2KXD A;  2D0Q B;  1TSF A;  4C0G A;  3C4S A;  1E7O A;  2LT4 A;  3I56 A;  2CP5 A;  4WF2 A;  1YBY A;  3VUZ A;  3SD4 A;  4BE1 A;  3FC3 A;  4ATO A;  1AWX A;  2GTO A;  2EQK A;  3MPU B;  4N4I A;  5KYX A;  5FRN A;  3OBW A;  3F70 A;  2R57 A;  1BBZ A;  1QCF A;  2QEX Q;  2ENM A;  5A2Q E;  4HT9 A;  3CBM A;  3HHT B;  1WI7 A;  4HCC A;  3GBQ A;  4QQ6 A;  1PC0 A;  5CCA A;  3QZ9 B;  1M2V A;  1ZSZ A;  1M3A A;  1M3B A;  2E12 A;  5IAY A;  2ABL A;  2KXC A;  4J6Y A;  1PKS A;  2D6F A;  1T3L A;  4Z8A A;  2LQ8 A;  4OVA A;  3QO3 A;  2EQJ A;  3CCQ A;  4EMH A;  2LQN A;  1HXD A;  4M7A C;  3C12 A;  4Z89 A;  3EH2 A;  3ER0 A;  3R6O A;  4FYY B;  1SKU B;  1VQM T;  1BI2 A;  2HKN A;  3PIP A;  1KC8 C;  3DB4 A;  3Q1J A;  2L3P A;  3CD6 T;  2JMA A;  3JSC A;  1AHJ B;  3E9F A;  7AT1 B;  4E7L A;  4JRI A;  4OML A;  4B9X A;  4QVZ A;  3OW2 P;  4JJD A;  2RHX A;  4RCC A;  2DEQ A;  5CQY A;  3OYF A;  1NEG A;  2DNU A;  5KH6 A;  1JQQ A;  1TS9 A;  2IG0 A;  4FL6 A;  2EYY A;  4IUU A;  1NLO C;  2RF0 A;  3V8K A;  1X43 A;  1ZBX A;  2K3Y A;  3L1A A;  1ZQ1 A;  4HCB A;  3M9Q A;  4A53 A;  2F5T X;  3CCS T;  1ARK A;  2FB7 A;  2EYZ A;  3SFM A;  1VYT A;  3VS3 A;  3BE3 A;  3S3O A;  1WYX A;  1K9M C;  3J7A F;  2XDD A;  2IPO B;  2ZPE B;  1QVF P;  2OX7 A;  3I55 A;  2Z0W A;  3QUI A;  4M7A D;  2XI9 A;  4PJO C;  4PK4 A;  3HPW A;  1FXX A;  5CR2 A;  1GXI E;  2DL8 A;  1N8R R;  3V7R A;  2FRW A;  2PQW A;  2P0K A;  4OB2 B;  5AYF A;  5LJ5 f;  4WCI A;  1CSK A;  2JT4 A;  4D6W A;  1NZ9 A;  4C0D B;  3MP6 A;  3M0U A;  3M57 A;  4J7I A;  3UWN A;  1MND A;  3OYD A;  4Y91 A;  1K8A R;  3JB9 I;  2HD0 A;  4IUQ A;  1K0X A;  1WFW A;  2FG0 A;  2LJ1 A;  1VQ6 T;  1KK7 A;  4LNP A;  1YIJ Q;  5GMK i;  5LJ3 d;  4C92 C;  3OW2 S;  1VQK Q;  4Y92 A;  4Z02 A;  4C5G A;  2HBW A;  3RIR A;  1IHV A;  2YSQ A;  2JS0 A;  3CCR Q;  2P0P A;  4FU6 A;  1TTH B;  4FSS A;  3ZL7 C;  2RK1 A;  2QI2 A;  1KHI A;  5DLQ E;  3S6W A;  3RBB B;  1UGR B;  3EFO A;  4IUT A;  4C5E A;  5LJ3 j;  3FB9 A;  2LT1 A;  4F04 B;  3OW2 A;  3THK A;  2ZZD A;  5HK3 A;  4RUG A;  1WJR A;  4J8O A;  2V8I A;  4PJO D;  2DD4 A;  1UHC A;  2DTH A;  4BY6 C;  5EC7 A;  3X28 B;  4RTV A;  1YJW Q;  1QVF S;  1EIF A;  1JXM A;  4M7D G;  2MMP A;  1K73 U;  3CCE T;  1WHH A;  1ZLM A;  4M77 C;  2NLU A;  4BI3 A;  3CC2 Q;  4X1V A;  5D6X A;  2CH4 A;  1QVF A;  2C0I A;  2KSS A;  1G83 A;  1KG1 A;  3H8Z A;  4NOY A;  3CCU A;  2DKG A;  3HKS A;  1M5Q 1;  3H6Z A;  1NE8 A;  1C0M A;  5GAN h;  1T0H A;  5J26 A;  2BUD A;  1PRM C;  3QBY A;  3VV0 A;  1V76 A;  1GBQ A;  4JJC A;  2J7I A;  1CKB A;  1XJW B;  3SWN B;  4J9I A;  1M4Z A;  2F5K A;  4A4H A;  2RI2 A;  1NPP A;  5GAN e;  5KCH A;  3PIO A;  4PL6 A;  2K9G A;  3MCA B;  3PGG A;  4OGE A;  4ESR A;  1YIT A;  4LDX A;  2B8A A;  1YI2 Q;  4J9B A;  1YJ9 T;  3BDL A;  2ESW A;  3CBO A;  2E4H A;  3BDU A;  1T0J A;  1OPL A;  2FPF A;  4F14 A;  5DLO A;  4XTU A;  1G8X A;  5FLX E;  1VIF A;  4OMN A; 
#chains in the Genus database with same CATH homology
 2JVV A;  3E1S A;  2HNI A;  1BI3 A;  3G6E T;  4BUG A;  2E5Q A;  1M1K C;  4JRQ A;  2HAX A;  3OQ5 A;  2DJZ A;  3FLG A;  1Q81 C;  4VUB A;  1Q82 C;  1BIA A;  2JTF A;  1OZ2 A;  3I55 T;  2L89 A;  5LJ5 d;  1VQO T;  3J80 E;  1X6O A;  5GAM h;  1KC8 U;  3FDR A;  4OP0 A;  2G3R A;  2Y4X A;  1KQS S;  2JZ2 A;  3OMC A;  3MEA A;  5CKE A;  1VQK A;  4X34 A;  2VYT A;  2GFU A;  3JB9 G;  3HRU A;  1VQP A;  2XD0 A;  4M78 D;  5FRM A;  3QII A;  1WQ7 A;  3FEO A;  4IUR A;  1VQ4 A;  4E7K A;  1OZ3 A;  1VQL T;  2JN0 A;  4J6X A;  4UC4 A;  3URG A;  4E7I A;  1N8R U;  3PFS A;  4C92 E;  1KHC A;  1DJ7 B;  4QVC A;  2Y4Y A;  3M53 A;  5GAM e;  1YIJ T;  1XQH A;  2O4X A;  2CS7 A;  4TVR A;  3LWH A;  1KD1 C;  2ZCF B;  3OYG A;  1VQK T;  1VQP T;  2A7Y A;  2EAY A;  5M9O A;  4N4H A;  4C92 A;  1I4K 1;  2DXC A;  5FU7 B;  1VQ4 T;  2HQE A;  5J39 A;  5GAM g;  3VYH B;  3INZ A;  1PSE A;  4NL2 A;  3CCR T;  1HK9 A;  2LTO A;  1K8A U;  3JB9 F;  4M7A G;  4J7F A;  2OTJ T;  3L2U A;  4C0D C;  3L42 A;  4RMO A;  2VXF A;  3X26 B;  4QVD A;  5LJ5 h;  3CCJ T;  2VUB A;  1WJS A;  3S3N A;  1YJW A;  2QQS A;  3TRE A;  1IRE B;  2RJC A;  4MMK A;  4NL3 A;  4GLK A;  5DM7 R;  4XU3 A;  1I8F A;  2EKO A;  3RMQ A;  5A0G A;  1G3T A;  3GNG A;  3CC4 T;  2E64 A;  1K9M U;  2M0O A;  3P8B B;  2RO0 A;  4L6V 5;  3M58 A;  2CZ6 B;  2DZC A;  1Y96 B;  2PUK B;  1BKB A;  2VGM A;  3M5A A;  4M7A B;  4F7U E;  3GPL A;  4A54 A;  2DIG A;  1YJN T;  5FU6 B;  5LJ5 e;  4FT2 A;  3FRN A;  4ME7 A;  1YJW T;  4EMK B;  5CIU A;  1N27 A;  4QQD A;  4C8Q E;  4ZN3 A;  1R8O B;  5GAO q;  5LJ3 h;  1JB0 E;  4M77 E;  3X25 B;  4F7U A;  2AHJ B;  3PT9 A;  4GY5 A;  3JCM f;  3X24 B;  1X75 C;  2CZ1 B;  5GAN 8;  3OS1 A;  4LD9 K;  3MHX A;  2EWN A;  5LJ5 g;  2BIV A;  5GAN f;  3HP9 A;  1WGS A;  2E10 A;  4C8Q A;  3CC2 T;  4M75 E;  3L2R A;  4M77 A;  4PKC C;  3OYE A;  1Q7Y C;  4JLG A;  4J6W A;  2X4X A;  2RHU A;  3BW1 A;  1M9S A;  2CZ7 B;  5CK9 A;  4XTW A;  4QQG A;  3CCV A;  3QDR B;  2KDS A;  2L5Q A;  1G3Y A;  2WSE E;  4M78 B;  1UGS B;  2PVO B;  3QZ5 B;  4M75 A;  2X4J A;  5LJ3 e;  2XIC A;  3RUX A;  1BI1 A;  1O9S A;  4M78 F;  2KMT A;  3JCM c;  2EIF A;  5HY6 A;  1QP2 A;  3WVD B;  5CO7 A;  2DTO A;  4C92 D;  1V29 B;  2DD5 A;  3OS5 A;  4XQ3 A;  5FU6 C;  2JTM A;  5LJ3 g;  2LNV A;  5CAI A;  3WXM B;  2O01 E;  3FIF A;  3OB9 A;  1YI2 A;  4LD6 A;  4NS5 A;  3ZBD A;  3NTK A;  4N0A C;  4PJO G;  3GLX A;  2GF7 A;  2K2V A;  4RKU E;  3CCU T;  5A0D A;  2RA2 A;  3NTI A;  2WAC A;  1G5V A;  4XTY A;  4X9C A;  3CCM T;  4BAC A;  1VQ8 A;  1VQ9 T;  3KUF A;  3QPH A;  2GCX A;  4E47 A;  4JRP A;  1NJI U;  3OYY A;  2RI3 A;  4R55 A;  1N9S A;  1WJQ A;  1VIE A;  1G3S A;  5J3B A;  3OYM A;  4DQ2 A;  1YI2 T;  2E6Z A;  4M7D E;  2ZPF B;  3CME A;  3CCS A;  3CMA A;  3JCM W;  4MZP A;  4EPC A;  3L2V A;  4PJO B;  2CYZ B;  4JS4 A;  3VU3 C;  3CC7 A;  2L8D A;  3JCM X;  4M7D C;  2RJD A;  4FT4 A;  4XU1 A;  4IKF A;  3CBP A;  4M7D A;  5HK0 A;  1QVG S;  5GAO m;  1VQN T;  2H3J A;  4LDU A;  3JB9 J;  2YLB A;  3A8M B;  5L8R E;  3RKW A;  5GAM f;  3LWI A;  5EG2 A;  3LLR A;  5CVI A;  5CKD A;  1YIT T;  2ZPG B;  3A5Z B;  2HQX A;  4X9D A;  3V7C A;  1UGP B;  4C8Q D;  3CME T;  3CMA T;  4M77 D;  4JS5 A;  2Y90 A;  4HKE A;  4MZT A;  4B9W A;  2EYQ A;  2QQA A;  1WNL A;  2VXE A;  3HRT A;  3SWN C;  4C92 G;  3JCM J;  3CC7 T;  4JUV A;  2FYK A;  1Y71 A;  1JRI A;  1QVG A;  2C06 A;  4XU0 A;  4KUL A;  4M75 D;  2XHC A;  3A8L B;  4DOV A;  4C5H A;  3J81 E;  4J5Y A;  5A0L A;  4BD3 A;  4XTZ A;  3G7Z A;  5IT9 E;  2XDB A;  3QJY A;  2E41 A;  2OTL A;  1YCY A;  3TU4 K;  3LGF A;  3KXT A;  2O4X B;  3JCM b;  3S3M A;  2XK0 A;  1OI1 A;  3A8G B;  3VKI A;  2M1H A;  4C92 B;  2KY9 A;  3L2W A;  2D0Q B;  3V8L A;  1K73 C;  2DVE A;  2EJG A;  2OAU A;  4L59 A;  4C92 F;  3OS0 A;  4C0G A;  3C4S A;  4XTV A;  2LT4 A;  3I56 A;  2I2L A;  4JDS A;  4WF2 A;  1B34 B;  4FM4 B;  2YHT A;  3G71 A;  3PTA A;  2QEX A;  1D3B A;  1VQ6 A;  1WPY A;  1YBY A;  2PU9 B;  2X4W A;  3PMT A;  5I21 A;  4KUD K;  2KK4 A;  4ELY C;  4ZGJ B;  3G4S A;  2LCL A;  3RMS A;  3FJP A;  3VUZ A;  3SD4 A;  4BE1 A;  2D9T A;  3FC3 A;  5GAO l;  4KUI A;  2KAF A;  2MI6 A;  4ATO A;  2EQK A;  3ME9 A;  3SDZ A;  4N4I A;  4OMF B;  5FRN A;  3QHS A;  1N9R A;  4A4K A;  2K5F A;  3OBW A;  3RKY A;  4M7D D;  1Q86 U;  3F70 A;  3LGL A;  2R57 A;  2XID A;  4BY6 B;  5GAN 7;  5I2S A;  4M75 G;  4HT9 A;  5IN1 A;  4R56 A;  5A2Q E;  3G4S T;  1VQ7 A;  4PLI A;  2JNG A;  2R5A A;  4OGC A;  4ZN1 A;  5GAN 3;  4F7U B;  3CBM A;  3HHT B;  3CPF A;  3UPU A;  1KQ2 A;  4ZGD B;  3C95 A;  2RD1 A;  2DTI A;  4F7U F;  4HCC A;  1JBM A;  4C8Q B;  4QQ6 A;  2EFI A;  3L2Q A;  3NFC A;  4M78 G;  2MAM A;  4M77 B;  5CCA A;  4XTX A;  2R5M A;  2RK2 A;  3QZ9 B;  3L2Z A;  3EFR A;  4C8Q F;  4LDV A;  5FU7 C;  4M77 F;  1VQ7 T;  1XOV A;  1I5L A;  4M75 B;  2FVU A;  1M1K U;  2ZPH B;  4II1 A;  2M9U A;  4ELZ C;  3JCM d;  2RJE A;  3PMI A;  2L3R A;  5LL6 S;  1Q81 U;  1O75 A;  2E12 A;  2XG8 D;  2QQR A;  5IAY A;  2DZ9 A;  4M75 F;  5GAN d;  3GF5 A;  5GAN 6;  3DLL A;  2RB6 A;  3A8O B;  3VYG A;  3JAM E;  3CCE A;  1LOJ A;  4J6Y A;  4OF1 A;  1VQM A;  2D6F A;  1I81 A;  4BE0 A;  4IUV A;  2XKO C;  1QP3 A;  4E7J A;  4ZTF A;  2LQ8 A;  4OVA A;  3P8H A;  3CD6 A;  4M7A E;  3QO3 A;  2RHZ A;  2EQJ A;  3CCQ A;  1M90 U;  1QVP A;  4EMH A;  1UEB A;  4FSX A;  3QG1 A;  3QSU A;  3P8D A;  5GAN j;  1HXD A;  3SB2 A;  4P5N A;  3C12 A;  4M7A C;  3ER0 A;  3R6O A;  4CRI A;  4BI4 A;  2EJF A;  3OYJ A;  4M7A A;  4OB1 B;  3GIB A;  1VQM T;  1BI2 A;  3CCV T;  2DAQ A;  4EMK C;  5HKC A;  5GMK j;  5GAO p;  4JJN K;  3PIP A;  1U8R A;  1KC8 C;  1Y7X A;  3M4G A;  3JCM Q;  3BFM A;  1KD1 U;  3DB4 A;  3Q1J A;  3CD6 T;  4J83 A;  2K5L A;  2LX9 A;  3JSC A;  4N0A A;  3CCQ T;  3MO8 A;  1AHJ B;  2WSC E;  5CKF A;  1SSF A;  3E9F A;  4E7L A;  5GAO r;  3GOX A;  1N6A A;  4LDW A;  4JRI A;  1NPR A;  4RCB A;  4ZTJ A;  1N8R C;  2RM4 A;  2V8K A;  4RG2 A;  3GP8 A;  4B9X A;  2DPP B;  3A8H B;  4QVZ A;  4RCC A;  2RHX A;  4M78 C;  2CKK A;  2DEQ A;  5CQY A;  1M8V A;  4M7D F;  3OYF A;  2PVG B;  3GNF B;  3LYI A;  4JLI A;  5CKB A;  4MDW A;  5KH6 A;  3JRZ A;  2IG0 A;  3M55 A;  3CPW A;  2DK3 A;  4LDY A;  3VUB A;  4FL6 A;  4A4F A;  3UT1 A;  5GAO n;  1VUB A;  4IUU A;  4PLL A;  3JCM P;  3V8K A;  1YJ9 A;  1W2B S;  1Y07 A;  3OBY A;  1VQ8 T;  3JCM e;  2MWO A;  1ZBX A;  2K3Y A;  2M16 A;  1K8A C;  3L1A A;  3NTH A;  1ZQ1 A;  4HCB A;  3CCL A;  3M9Q A;  4A53 A;  2F5T X;  5GAM d;  3UDC A;  5GAN 5;  3CCS T;  1FX7 A;  4BDY A;  2IVW A;  2PVD B;  2LQK A;  4MZM A;  1OYX A;  2DO3 A;  3JCM g;  3TCJ A;  3MEU A;  2FB7 A;  3HFN A;  4L5G A;  3SWN A;  2K4Y A;  1W2B A;  3SFM A;  2QDY B;  3T9N A;  3S3O A;  3RES A;  2BKD N;  3G6E A;  1K9M C;  3J7A F;  1BIB A;  2XDD A;  4O6J A;  2VC8 A;  3OYN A;  2ZPE B;  4PJO E;  2QXF A;  1Q7Y U;  3MET A;  5GAM j;  1MHN A;  2QQ9 A;  3V7S A;  3I55 A;  2QA4 A;  2GFA A;  4OB3 B;  1XTD A;  4BE2 A;  3QUI A;  4M7A D;  2XI9 A;  2X35 A;  4HT8 A;  3MEV A;  4PJO C;  3ZFJ A;  4PJO A;  1QW1 A;  3HPW A;  1FXX A;  5CR2 A;  1GXI E;  1D3B B;  1P92 A;  1KQ1 A;  2VV5 A;  2EQM A;  2ZPI B;  2XDP A;  3V7R A;  2PQW A;  2P0K A;  4OB2 B;  5CKH A;  5AYF A;  1LJO A;  5LJ5 f;  2E6N A;  3EAE A;  1BYM A;  1VQL A;  2VGN A;  2LVM A;  2QA4 T;  3RKX A;  2OTL T;  4D6W A;  1NZ9 A;  3MP1 A;  3BY7 A;  5FRO A;  4C0D B;  3MP6 A;  1PSF A;  3M57 A;  4HCZ A;  2ZGW A;  3HFO A;  5KE3 A;  4J7I A;  2V8J A;  3N5B B;  2FL7 A;  3UWN A;  1YIJ A;  4E7H A;  1G3W A;  4RG8 A;  5GAN 2;  4F7U G;  3OYD A;  4Y91 A;  2XU8 A;  1M90 C;  2RHI A;  4V2S A;  3MP8 A;  3JB9 I;  3QYH B;  3OYL A;  2HD0 A;  4C8Q G;  1M1F A;  2K57 A;  4OB0 B;  4IUQ A;  2DXT A;  4M77 G;  3CCR A;  3I56 T;  4QW2 A;  5LJ5 j;  3EFS A;  2OTJ A;  2E1H A;  3ASK A;  3ZEH A;  3G71 T;  1MGQ A;  5LJ3 f;  2QEX T;  3E9G A;  1M1G A;  1VQ6 T;  3CCJ A;  1KQS A;  3LW5 E;  5GMK i;  5LJ3 d;  3CXC S;  4C92 C;  2A3L A;  3DB3 A;  2ZPB B;  3OW2 S;  4Z02 A;  4C5G A;  3CEY A;  3V8J A;  3RIR A;  3QYG B;  3M56 A;  4CI0 C;  5GMK l;  3AHU A;  3CC4 A;  1JJ2 S;  3QJ6 A;  2QTX A;  2P0P A;  4FU6 A;  1NJI C;  2FHD A;  4O5V A;  2LC4 A;  3OSV A;  4C0Z A;  2RK1 A;  2QI2 A;  1KHI A;  1B34 A;  3HL8 A;  5DLQ E;  1TH7 A;  3S6W A;  1YJN A;  2DIQ A;  3M59 A;  1UGR B;  3QXE B;  4IUT A;  3MEW A;  4C5E A;  3WVE B;  1LNX A;  2LT1 A;  3FB9 A;  5LJ3 j;  2MWP A;  3OYH A;  3CXC A;  3OW2 A;  1Q82 U;  2ZZD A;  5HK3 A;  2RH2 A;  1WJR A;  1ZHI A;  4J8O A;  2KVQ G;  5GAN 4;  2V8I A;  3QKJ A;  1JJ2 A;  2RI5 A;  5I2M A;  3OYC A;  4PJO D;  2DD4 A;  3OSS C;  4Q5W A;  2P0Q A;  3OYI A;  2DTH A;  1H64 1;  3OYA A;  3CC2 A;  2JOY A;  5C0M A;  2E65 A;  2LRQ A;  4BY6 C;  4C0F A;  3OMG A;  3RER A;  4BI8 B;  4HA8 A;  1XNI A;  2RJF A;  3X28 B;  1UGQ B;  2R58 A;  4M7A F;  1QVF S;  1RL2 A;  1EIF A;  4YTL A;  2DXU A;  3LH0 A;  4M7D G;  1Y96 A;  2MMP A;  1WQW A;  4DOW A;  4KT0 E;  5C6S A;  1K73 U;  3CCE T;  3C94 A;  2P4T A;  4C8Q C;  4MML A;  3JB9 H;  2EQU A;  4M77 C;  5KE2 A;  2NLU A;  4EMK A;  3OYB A;  4BI3 A;  3O8V A;  4XK8 E;  2GQV A;  5D6X A;  3DKM A;  1QVF A;  2KSS A;  4M75 C;  3X20 B;  3CPW S;  3VJP A;  5D6Y A;  2CZ0 B;  4XU2 A;  1KG1 A;  3H8Z A;  4MDX A;  4NOY A;  4M78 E;  3JCM h;  3OYK A;  3CCU A;  4N4G A;  2DKG A;  3HKS A;  3HSB A;  1M5Q 1;  3H6Z A;  1NE8 A;  4M7D B;  5GAN h;  5J26 A;  3OY9 A;  1FWZ A;  2BUD A;  4BDZ A;  1VQ5 A;  3E19 A;  3CCM A;  3QBY A;  4JRK A;  4KBM B;  3VV0 A;  4C5I A;  4EDU A;  1S72 A;  4M78 A;  5GMK h;  1VQ9 A;  1UB4 A;  5KCO A;  2QQB A;  2K5I A;  4ZGE B;  1U1T A;  2LDM A;  2CGH A;  2YLC A;  3SWN B;  4EMG A;  3PNW C;  1M4Z A;  2F5K A;  4IUP A;  4A4H A;  3JB9 D;  2E70 A;  1NPP A;  2LCC A;  2RI2 A;  3LX7 A;  5DY9 A;  5GAN e;  1YHQ A;  1VQ5 T;  5KCH A;  2K3X A;  1S72 T;  3PIO A;  1X01 A;  1VQN A;  3TEE A;  1BI0 A;  4PL6 A;  3PGG A;  3MCA B;  5D6W A;  4Y28 E;  5GMK e;  1IZ6 A;  3KBG A;  4OGE A;  1Q86 C;  2HBP A;  1RI0 A;  1YIT A;  2RHY A;  4FIB A;  4LDX A;  4XAX B;  3M54 A;  4A4G A;  2B8A A;  3DLM A;  5GAN g;  2KQW A;  1YJ9 T;  2EJ9 A;  2F69 A;  3BDL A;  1W4S A;  3CBO A;  5GMK m;  3BDU A;  1U1S A;  4PNO A;  2X4Y A;  2WSF E;  1YHQ T;  2MF2 A;  3CCL T;  5DLO A;  4PJO F;  3HRS A;  3JCM V;  2JUF A;  4XTU A;  4BB7 A;  3M4Y A;  4A4E A;  3OA6 A;  1VQO A;  5FLX E;  1VIF A;  3OS2 A;  1H3Z A;  4DA4 A;  2PUO B;  5CQX A;  2DXB A;  2YRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...