5GCNA

Catalytic domain of tetrahymena gcn5 histone acetyltransferase in complex with coenzyme a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
166
structure length
166
Chain Sequence
b'MKGLLDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE ACETYLTRANSFERASE GCN5
publication title Solution structure of the catalytic domain of GCN5 histone acetyltransferase bound to coenzyme A
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Transferase
total genus 32
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 1999-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5gcnA00
2NMTA 3V8IA 2B3UA 1J4JA 3MGDA 5JQ4A 1IYKA 5HH1A 3E0KA 2FT0A 3PP9A 4R3LA 3R1KA 4M3SA 3K9UA 4KOSA 3SXOA 3CXSA 1KZFA 1MJBA 2REEA 4RS2A 1Y9KA 5DWMA 1XEBA 3QB8A 1TIQA 2A4NA 4NCZA 2C27A 4Y49C 1S7NA 4JWPA 3W91A 4CAVA 2G3TA 4GS4A 1V0CA 3C26A 1P0HA 2HV2A 2ZXVA 3ZZIA 5GCNA 4MBUA 2FL4A 4HNXB 4R9MA 2P0WA 3F0AA 1M44A 5J8FA 3LD2A 1IYLA 1Y9WA 3JUWA 1Z4EA 1XF8A 2QIRA 4XPDC 2OZUA 4KOWA 1S5KA 2FIAA 2REFA 2JDDA 1YK3A 2D4OA 1Q2DA 5J8CA 1WWZA 2BSWA 1Q2YA 2R98A 4CS0B 2EUIA 2PQ8A 3DDDA 5C88A 4M85A 2Z11A 3I3GA 1LRZA 4PV6A 3VWDA 4MJ8A 2OH1A 4UBRA 1GHEA 1RO5A 4NXYA 3EFAA 1M1DA 1QSRA 1BOBA 1KUXA 4KOYA 3FRMA 1WK4A 4YFJA 3NE7A 2OB0A 5C82A 4CRZB 1CJWA 5FVJA 3D2MA 4KUAA 2F5IA 2R8VA 5F46A 4FD5A 4CAXA 2ZW5A 1S60A 1Z9UA 4B5PA 3F8KA 1OZPA 2CNMA 1K4JA 3W6XA 4UA3A 2Q7BA 5IB0A 2BUEA 4AVAA 1YR0A 5F48A 2Q44A 4KUBA 1U6MA 5H84A 2B5GA 5EBVA 4CRYB 1Q2CA 4B5OA 1S7LA 3IGRA 3R95A 4AVCA 4XNHB 4YRHA 2B4BA 2WPWA 3P2HA 4KLVA 4JJXA 4KOTA 4B5PB 4IUSA 4CAWA 2Q4YA 1FY7A 2FXFA 2G3AA 2GE3A 4QC6A 4ONUA 4PSXA 2OZHA 2B5GB 2JDCA 4JLYA 4AB7A 4R57A 3I9SA 2PRBA 4AVBA 5E96A 4PK2A 4QBJA 2FIWA 5EC4A 3KKWA 1I21A 4L89A 3S6HA 4NSQA 1Z4RA 5ISVA 3T90A 2J8RA 2OZGA 3BLNA 4E0AA 5KTCA 4HNWB 1YVOA 4MY3A 5F49A 2I00A 2BEIA 3SXNA 2Y0MA 4NF1A 3DNSA 4XPKA 1ON0A 3TO9A 4L8AA 4LUAA 4KOVA 5CNPA 3IWGA 1VKCA 2VI7A 1NSLA 4RI1A 2PR8A 4KZTA 1Y7RA 3F5BA 2PR1A 1MJ9A 3B8GA 2FCKA 1B87A 2IL4A 4PSWA 4Y49B 2J8NA 5KTAA 4XPLA 4H6ZA 3FBUA 3TO7A 4MHDA 2CY2A 2B58A 2GANA 1M4DA 2HQYA 2JLMA 3R9FA 3OWCA 4JD6A 3TOAA 4I49A 3UY5A 3FB3A 4R3KA 2K5TA 4NEXA 3JVNA 2Q0YA 3G3SA 2PSWA 2Q4VA 4KOUA 2EVNA 3VWEA 1I12A 4K30A 1XMTA 4KOXA 4MY0A 4XPDB 4IF5A 3TOBA 1XIXA 5KTDA 5DWNA 4II9A 3TT2A 5JPHA 2VXKA 4U5YA 2D4PA 2DXQA 1XE4A 3TO6A 2ZPAA 3EXNA 1L0CA 2VZZA 1YX0A 1PU9A 4JXQA 2CNTA 4DNCA 4F6AA 2PDOA 4HNYB 2R7HA 2Z10A 2PC1A 3BJ8A 5H86A 5I0CA 1KUYA 4AG9A 3QAHA 1S7KA 2VEZA 1P4NA 2KCWA 3TE4A 2AJ6A 4U9ZA 1NE9A 2P6FA 3R96A 2X7BA 4JXRA 1QSOA 2VBQA 2P6GA 2QMLA 4R87A 4OADA 1CM0A 1QSNA 3TTHA 4QVTA 3R9GA 4ZBGA 2I79A 2H5MA 4YGOA 4EVYA 2ZW7A 1R57A 1M4IA 2Q04A 1YVKA 2R1IA 3DSBA 1I1DA 4UWIA 1N71A 4LX9A 4X5KA 1NMTA 3FIXA 5HMNA 3S6FA 3BJ7A 3G8WA 1IICA 2G0BA 2QECA 3GKRA 1KUVA 4QB9A 1UFHA 1QSTA 3DR8A 2AE6A 3FXTA 4E8OA 2RC4A 2BL1A 4FD6A 4H6UA 4KVME 4KORA 3T9YA 3D3SA 3S6GA 2HUZA 2ARHA 2JEVA 3TFYA 4BMHA 4J3GA 4U9YA 3LODA 4E2AA 1RXTA 4H89A 3W6SA 1MK4A 1YREA 4OLLA 2GIVA 5IX3A 3D2PA 4KVOE 4XNHC 3SHPA 1M4GA 3FYNA 4PK3A 1VHSA 2ATRA 3PZJA 3TCVA 3PGPA 4F0YA 1PUAA 1IIDA 4FD7A 2FSRA 3GY9A 1YLEA 1MJAA 2B4DA 2CNSA 2O28A 3H4QA 1S3ZA 5F47A 3EY5A 1SQHA 2B3VA 4ORFA 4AG7A 2VZYA 3ZJ0A 2J8MA 2OU2A 4MI4A 2Z0ZA 3CXPA 3D8PA 3DR6A 3EC4A 2FE7A 2ZW4A 4KVXA 4HKFA 1B6BA 5IV0A 4QUSA 4KLWA 4FD4A 3N7ZA 2B4DB 1QSMA 4UWJA 3RYOA 3EO4A 2P6EA 2WPXA 2FS5A 4OAEA 3GYAA 3R9EA 1YGHA 3CXQA 3FNCA 1IB1E 3S6KA 1S7FA 2VQYA 1BO4A 3WR7A 2ZW6A 3P2FA
chains in the Genus database with same CATH superfamily
2PJ1A 3CPAA 4PQAA 1Z8TA 2NMTA 3CDXA 3V8IA 3IWEA 2B3UA 3PB6X 4Q7AA 4BBHA 1J4JA 1ELMP 4ZX8A 3BI1A 4P4DA 3MGDA 1LANA 3IWWA 2FVGA 3QNVA 5JQ4A 1IYKA 5HH1A 1CBXA 3E0KA 2XEGA 2FT0A 4P4BA 3PP9A 4R3LA 1ZLHA 3GB0A 3V38A 3R1KA 2ZENA 3K9UA 4M3SA 2YNCC 4KOSA 3SXOA 1DTDA 3CXSA 1KZFA 4CGPA 1MJBA 2REEA 4RS2A 4NJRA 4CYPA 3IU1A 1Y9KA 2Z3MA 1Y0YA 5DWMA 1XEBA 2PJ2A 1BLLE 3QB8A 5ELYA 1TIQA 4FAIA 1AUGA 2A4NA 4MHPA 2C27A 1Z8LA 4NCZA 5G1ZA 4Y49C 4CAEA 3H5ZA 2QVPA 4F9UA 4OIWA 1S7NA 4JWPA 2PJ9A 4FUUA 3W91A 4CAVA 2ZEGA 3WC5A 1DE4C 1EE3P 2G3TA 2GLJA 2Q43A 4GS4A 1GYTA 3NE8A 1V0CA 3C26A 1P0HA 2HV2A 3BHXA 2ZXVA 4NGQA 4M6GA 4OMEA 3ZZIA 4M6HA 1H8LA 4CGOA 4P4EA 2NYQA 2WUUA 2Q51A 5GCNA 4MBUA 2FL4A 4HNXB 4R9MA 4YU9A 4CGNA 2P0WA 3KHZA 3F0AA 3I1UA 1M44A 3B3TA 1UWYA 5J8FA 2IQ6A 3LD2A 1IYLA 3B35A 4PXCA 2WYRA 1IOIA 1Y9WA 4PPZA 3JUWA 1Z4EA 2AFSA 1YMEA 1XF8A 3PB8X 1ZLIA 2QIRA 4XPDC 2OZUA 1Z8WA 4UCMA 4KOWA 4TWEA 1S5KA 2FIAA 1A2ZA 2REFA 2V8HA 2JDDA 3VATA 1YK3A 2D4OA 3D66A 1Q2DA 4P10A 5J8CA 1WWZA 2BSWA 3FMCA 2V8VA 4PXEA 2PVVA 1Q2YA 2R98A 4CS0B 2EUIA 2Q7SA 3BXMA 2PJ3A 2POKA 2CIJA 2AFOA 2PQ8A 2EK9A 3DDDA 1R3NA 4M85A 5C88A 2Z11A 1TKJA 4OC4A 5G20A 3I3GA 1LRZA 4PV6A 4CAFA 1X12A 3VWDA 5K8MA 4MJ8A 6CPAA 3H8FA 1QQ9A 2PJ8A 2OH1A 4B6ZA 4UBRA 3D7FA 1GHEA 1RO5A 4B13A 3KI9A 3HUVA 4NXYA 4NGTA 3PRTA 2Z3NA 3EFAA 2ZEHA 8CPAA 1TKFA 4OP4A 1M1DA 1FT7A 1QSRA 1BOBA 1Z5RA 2GLFA 3B3VA 3GLJA 4MFKA 1KUXA 4KOYA 2GU2A 2DF5A 3FRMA 1WK4A 2AFWA 3WC7A 4YFJA 4CGLA 5CBMA 2YNDA 3NE7A 2OB0A 3KQXA 5C82A 3QAYA 4CRZB 1YLOA 2EBJA 3B3CA 5I4MA 2IMOA 1CJWA 1XOVA 5FVJA 3D2MA 1LAMA 4C2YA 4KUAA 2F5IA 2R8VA 1CG2A 1F2OA 5F46A 4OIDA 4CYOA 4ZY2A 2OOTA 3RO0A 4FD5A 2O4HA 3S9NA 4CAXA 4LQ6A 4P4IA 2ZW5A 1S60A 1Z9UA 1CP7A 2Z3LA 5D8NA 3NA6A 4B5PA 5A28A 3WABA 2EO8A 3F8KA 3KASA 1OZPA 4KSAA 2CNMA 1K4JA 3W6XA 3IEHA 1ZO0A 3S9MA 3L2NA 2HB6A 4UA3A 1LFWA 4IAVA 2BUEA 2Q7BA 3SI1A 1JWQA 5IB0A 4AVAA 4CYNA 3NFZA 3FJUA 1YR0A 2JBJA 5F48A 4MHZA 5LYFA 2Q44A 4ZBGA 4KUBA 4EFDA 2CTCA 1U6MA 5G22A 4F0XA 5H84A 5BWAB 2B5GA 5EBVA 4C7IA 4CRYB 1Q2CA 4NGSA 1S7LA 4B5OA 4BINA 3SJFA 1AMPA 3IGRA 3R95A 4XNHB 4AVCA 4YRHA 1ARMA 2B4BA 4OC5A 4ZX9A 5J1QA 2QJ8A 2WPWA 3FEDA 3P2HA 4KLVA 4MFJA 2PJ5A 2PE3A 4JJXA 4KOTA 4B5PB 4IUSA 4OKOA 1F57A 4CAWA 2Q4YA 3CT9A 2DEAA 3B2YA 1FY7A 2FXFA 2G3AA 2ZEDA 2GE3A 3B3SA 1LAPA 4F8ZA 4H2KA 4QC6A 4X3RA 4X8IA 4ONUA 4G1PA 3V7ZA 4PSXA 1TF8A 4JYWA 5AG5A 2OZHA 4IHMA 2B5GB 3WT4A 4TNUA 2PCUA 2JDCA 4JLYA 4AB7A 2PJ6A 4R57A 2JEWA 3N5FA 2DPTA 3I9SA 5HXDA 2PRBA 4AVBA 4CGMA 3D68A 5E96A 4MFQA 4PK2A 4QBJA 2FIWA 4MHYA 4DUKA 3FX6A 4EWTA 2Q4ZA 5LYLA 5EC4A 1M4LA 4FBEA 3KKWA 4UFWA 2ZEOA 1I21A 2Z3PA 2ZEEA 4L89A 3S6HA 4NSQA 2AFUA 3R9GA 2YNCA 3WC6A 1Z4RA 4UEZA 4KSFA 4OC0A 1IGBA 5ISVA 3T90A 2J8RA 2OZGA 3BLNA 4KS9A 4NGMA 4E0AA 5KTCA 4HNWB 1ZG9A 1YVOA 7CPAA 4C68A 4MY3A 4YWYA 4UIAA 4UIBA 1TF9A 3MN8A 3PFEA 2PJBA 5F49A 2I00A 2BEIA 4K3NA 4PXBA 3SXNA 2ODFA 2AFMA 5F09A 2Y0MA 4NF1A 2PJ7A 4WJBA 4OC2A 3DNSA 4XPKA 1ON0A 4A33A 3TO9A 4L8AA 3ISXA 4LUAA 4KOVA 5CNPA 3IWGA 3T8WA 3TX8A 1VKCA 2VI7A 3TC8A 4UEEA 2IJZA 5G21A 4Q36A 1NSLA 3K2KA 4MCRA 4RI1A 3MRUA 2PR8A 4KZTA 1Y7RA 4UFVA 4B12A 2ABZA 2AFXA 2PIZA 2C6CA 3F5BA 2F7VA 3KR5A 2PR1A 4NJQA 1MJ9A 3B8GA 1AYEA 3D4UA 2FCKA 1B87A 1BPMA 1LCPA 3NH5A 1VHEA 1ELLP 2IL4A 4A38A 4PSWA 4Y49B 2J8NA 5KTAA 3K9TA 4H6ZA 4XPLA 2PJ0A 5AG6A 3RBUA 3SJGA 3FBUA 1YW6A 3TO7A 4AXVA 4MHDA 4MCQA 2XEIA 4OC1A 2CY2A 1YQEA 2B58A 2GANA 1M4DA 5AGEA 1Y0RA 2HQYA 2EK8A 2JLMA 3R9FA 3PFOA 3OWCA 5THWA 4JD6A 4Q38A 4I49A 3TOAA 1IU8A 3UY5A 3FB3A 4R3KA 1ZG7A 2K5TA 3NH4A 4NEXA 3GIUA 4P4FA 3JVNA 4Z65A 1TKHA 3IJ3A 4ZI6A 4UEFA 2Q0YA 3G3SA 2PSWA 2Q4VA 3PB9X 4KOUA 4P45A 2EVNA 4MCSA 1Z8XA 3KZWA 3FH4A 5EMIA 1VHOA 5K8NA 4RN7A 3VWEA 4A30A 1I12A 4K30A 2OR4A 4CPAA 1XMTA 4ZGYB 3PB4X 3FF3A 4KOXA 4MY0A 4XPDB 4IF5A 3TOBA 4KSIA 2YNEA 1HDUA 1XIXA 2HC9A 2ANPA 1CP6A 5KTDA 1ZG8A 3FVLA 4A95A 3LMSA 5DWNA 4A31A 4JZ0A 4II9A 3ISZA 3DGVA 5K8PA 5D29A 3TT2A 4C2XA 2PJCA 5JPHA 2CXAA 4A37A 4UCNA 2I3CA 5LYIA 1RTQA 2VXKA 4U5YA 1HEEA 2D4PA 5K8OA 2DXQA 1XE4A 2XEJA 2RFHA 3TO6A 3D67A 2ZPAA 4UCPA 2BOAA 3KL9A 3EXNA 3LACA 4NGNA 2C1CA 1L0CA 1CX8A 1FNOA 2VZZA 4UFXA 4LQGA 2QYVA 1YX0A 3JRUA 3NH8A 4ONWA 3VH9A 1PU9A 4JXQA 4MCPA 4DJLA 3BI0A 2CNTA 3PBEA 4DNCA 2PDOA 4F6AA 2GREA 1PCAA 5JM6A 3CPXA 3LWUA 4HNYB 4MFLA 2R7HA 4RUHA 2Z10A 2DPSA 1Z2LA 3D7GA 2PC1A 3BJ8A 3PBBA 5H86A 3PEIA 5I0CA 2J9AA 4MHNA 3DLJA 1KUYA 4AG9A 3QAHA 1IY7A 1S7KA 2VEZA 1BPNA 1P4NA 5JH9A 1ARLA 2VL1A 1XMBA 2KCWA 3D7DA 3TE4A 1BAVA 2PVWA 2AJ6A 4U9ZA 1NE9A 2CTBA 3B7IA 4CYQA 3RAMA 4R76A 3HLPA 3SI2A 2P6FA 3SI0A 4WWVA 3R96A 3VARA 4ZY1A 2PIYA 2X7BA 4JXRA 1QSOA 2VBQA 2P6GA 4MRIA 2QMLA 1Q7LA 4R87A 4OC3A 4GM5A 1CM0A 4OADA 2V8DA 1QSNA 3TTHA 1X10A 4F9VA 2CF4A 1NSAA 3B3WA 3RZAA 4QVTA 4A2ZA 3IFEA 3A9LA 4R6TA 2I79A 2H5MA 4MFPA 5DS0A 4P44A 1PYTB 2ZW7A 4YGOA 1R57A 5CPAA 1M4IA 2Q04A 3FECA 4EVYA 1YVKA 2WSAA 5LRJA 2R1IA 5HVHA 2PJAA 4A94A 3D7HA 2V8GA 2XEFA 4W9YA 5LRGA 1VIXA 3KR4A 1JQGA 2Z3KA 3DSBA 1I1DA 2AFZA 4UWIA 1N71A 2C6GA 4LX9A 4X5KA 1NMTA 2ZELA 3FIXA 2ZEMA 5HMNA 4A39A 3S6FA 3IC1A 5AG4A 1CPSA 4X2TA 3BJ7A 3G8WA 3KGQA 1IICA 1HDQA 2G0BA 3H8GA 2QECA 3GKRA 1YSJA 1KUVA 3CZXA 4QB9A 4BD9A 3H8EA 4GXHA 5IB9A 1UFHA 1YW4A 2ZOGA 1QSTA 4B14A 3DR8A 2AE6A 3FXTA 4E8OA 2RC4A 2BL1A 4FD6A 4H6UA 4KVME 2ZEFA 1XJOA 3IO1A 4KORA 3SJEA 2GFQA 3T9YA 3D3SA 3S6GA 2HUZA 2ARHA 2JEVA 5LRKA 2RB7A 3TFYA 4BMHA 4J3GA 2F8HA 3KHXA 4U9YA 4ZY0A 3LODA 1TXRA 1QMUA 3KQZA 4M6IA 1RXTA 2V77A 4R7MA 1Y7EA 4E2AA 2ZEPA 4H89A 1MK4A 1YREA 4OLLA 3W6SA 1F2PA 2GIVA 3GUXA 5IX3A 3D2PA 2C6PA 4KVOE 1LOKA 4MMOA 2ZOFA 4XNHC 3SHPA 1M4GA 3FYNA 1CPXA 4DYOA 4PK3A 1VHSA 2ATRA 3PZJA 4C2ZA 4C7HA 3TCVA 3PGPA 4F0YA 1PUAA 1IIDA 1XRYA 3FEEA 4FD7A 2FSRA 3GY9A 1YLEA 5JGFA 4R8FA 3SJXA 1MJAA 2B4DA 2CNSA 2O28A 3H4QA 4O23A 1S3ZA 4B11A 2G9DA 1KWMA 5F47A 2JBKA 3EY5A 1SQHA 4NGRA 2B3VA 1IOFA 4ORFA 5A27A 4AG7A 2VZYA 2O53A 3ZJ0A 1XBUA 2J8MA 2OU2A 4MI4A 2Z0ZA 4B10A 2BCOA 3CXPA 4MXUA 3D8PA 5AG7A 1XFOA 3DR6A 3EC4A 2FE7A 2ZW4A 4KVXA 4NFRA 2PRQA 1B6BA 4HKFA 3RNZA 4A32A 2BO9A 5IV0A 1R43A 4QUSA 5HVFA 4KLWA 4ZYQA 4FD4A 3N7ZA 2B4DB 4P4JA 4HPSA 2PJ4A 2WZNA 1QSMA 4EMEA 2YGWA 4UWJA 5LYDA 3RYOA 3IU2A 3EO4A 4UF4A 4IK2A 2P6EA 2WPXA 4NGPA 3PB7X 2FS5A 4OAEA 3GYAA 2NSMA 3IIBA 3R9EA 5HVGA 3S9LA 1VGYA 1YGHA 3CXQA 3FNCA 4FWUA 1IB1E 4P6YA 1S7FA 1OBRA 2VQYA 1BO4A 4PXDA 3S6KA 3WR7A 2ZW6A 3JTKA 4MFZA 3P2FA 2EWBA 2Z3OA
chains in the Genus database with same CATH topology
2NMTA 4BBHA 3V8IA 3IWEA 2B3UA 1J4JA 3MGDA 5JQ4A 1IYKA 5HH1A 3E0KA 2FT0A 3PP9A 4R3LA 3R1KA 4M3SA 3K9UA 2YNCC 4KOSA 3SXOA 3CXSA 1KZFA 4CGPA 1MJBA 2REEA 4RS2A 4CYPA 3IU1A 1Y9KA 2Z3MA 5DWMA 1XEBA 3QB8A 1TIQA 2A4NA 4NCZA 2C27A 5G1ZA 4Y49C 4CAEA 3H5ZA 1S7NA 4JWPA 3W91A 4CAVA 2G3TA 4GS4A 1V0CA 3C26A 1P0HA 2HV2A 2ZXVA 3ZZIA 4CGOA 2WUUA 5GCNA 4MBUA 2FL4A 4HNXB 4R9MA 4CGNA 2P0WA 3F0AA 1M44A 5J8FA 3LD2A 1IYLA 1Y9WA 3JUWA 1Z4EA 1XF8A 2QIRA 4XPDC 2OZUA 4UCMA 4KOWA 1S5KA 2FIAA 2REFA 2JDDA 1YK3A 2D4OA 1Q2DA 5J8CA 1WWZA 2BSWA 1Q2YA 2R98A 4CS0B 2EUIA 2PQ8A 3DDDA 5C88A 4M85A 2Z11A 5G20A 3I3GA 1LRZA 4PV6A 4CAFA 3VWDA 4MJ8A 2OH1A 4UBRA 1GHEA 1RO5A 4B13A 4NXYA 2Z3NA 3EFAA 1M1DA 1QSRA 1BOBA 4MFKA 1KUXA 4KOYA 3FRMA 1WK4A 4YFJA 4CGLA 2YNDA 3NE7A 2OB0A 5C82A 4CRZB 1CJWA 5FVJA 3D2MA 4C2YA 4KUAA 2F5IA 2R8VA 5F46A 4CYOA 4FD5A 4CAXA 2ZW5A 1S60A 1Z9UA 2Z3LA 4B5PA 5A28A 3F8KA 1OZPA 4KSAA 2CNMA 1K4JA 3W6XA 1ZO0A 4UA3A 2Q7BA 5IB0A 2BUEA 4AVAA 4CYNA 1YR0A 5F48A 2Q44A 4KUBA 1U6MA 5G22A 4F0XA 5H84A 5BWAB 2B5GA 5EBVA 4C7IA 4CRYB 1Q2CA 4B5OA 1S7LA 3IGRA 3R95A 4AVCA 4XNHB 4YRHA 2B4BA 2WPWA 4MFJA 3P2HA 4KLVA 4JJXA 4KOTA 4B5PB 4IUSA 4CAWA 2Q4YA 1FY7A 2FXFA 2G3AA 2GE3A 4QC6A 4ONUA 4PSXA 5AG5A 2OZHA 2B5GB 2JDCA 4JLYA 4AB7A 4R57A 2DPTA 3I9SA 2PRBA 4AVBA 4CGMA 5E96A 4MFQA 4PK2A 4QBJA 2FIWA 5EC4A 3KKWA 4UFWA 1I21A 2Z3PA 4L89A 3S6HA 4NSQA 2YNCA 1Z4RA 4KSFA 5ISVA 3T90A 2J8RA 2OZGA 3BLNA 4KS9A 4E0AA 5KTCA 4HNWB 1YVOA 4C68A 4MY3A 5F49A 2I00A 2BEIA 3SXNA 2Y0MA 4NF1A 3DNSA 4XPKA 1ON0A 4A33A 3TO9A 4L8AA 4LUAA 4KOVA 5CNPA 3IWGA 1VKCA 2VI7A 5G21A 4Q36A 1NSLA 4RI1A 4UFVA 2PR8A 4KZTA 1Y7RA 4B12A 3F5BA 2PR1A 1MJ9A 3B8GA 2FCKA 1B87A 2IL4A 4PSWA 4Y49B 2J8NA 5KTAA 4XPLA 4H6ZA 5AG6A 3FBUA 3TO7A 4MHDA 2CY2A 2B58A 2GANA 1M4DA 5AGEA 2HQYA 2JLMA 3R9FA 3OWCA 4JD6A 4Q38A 4I49A 3TOAA 3UY5A 3FB3A 4R3KA 2K5TA 4NEXA 3JVNA 2Q0YA 3G3SA 2PSWA 2Q4VA 4KOUA 2EVNA 3VWEA 4A30A 1I12A 4K30A 1XMTA 4ZGYB 4KOXA 4MY0A 4XPDB 4IF5A 3TOBA 2YNEA 1XIXA 5KTDA 4A95A 5DWNA 4A31A 4II9A 3TT2A 4C2XA 5JPHA 2CXAA 4UCNA 2VXKA 4U5YA 2D4PA 2DXQA 1XE4A 3TO6A 2ZPAA 4UCPA 3EXNA 1L0CA 2VZZA 4UFXA 1YX0A 1PU9A 4JXQA 2CNTA 4DNCA 4F6AA 2PDOA 4HNYB 4MFLA 2R7HA 2Z10A 2DPSA 2PC1A 3BJ8A 5H86A 5I0CA 1KUYA 4AG9A 3QAHA 1S7KA 2VEZA 1P4NA 2KCWA 3TE4A 2AJ6A 4U9ZA 1NE9A 4CYQA 2P6FA 3R96A 2X7BA 4JXRA 1QSOA 2VBQA 2P6GA 2QMLA 4R87A 4OADA 1CM0A 1QSNA 3TTHA 4QVTA 4A2ZA 3A9LA 4ZBGA 2I79A 2H5MA 4MFPA 3R9GA 4YGOA 4EVYA 2ZW7A 1R57A 1M4IA 2Q04A 1YVKA 2WSAA 2R1IA 2Z3KA 3DSBA 1I1DA 4UWIA 1N71A 4LX9A 4X5KA 1NMTA 3FIXA 5HMNA 3S6FA 5AG4A 3BJ7A 3G8WA 1IICA 2G0BA 2QECA 3GKRA 1KUVA 4QB9A 1UFHA 4B14A 1QSTA 3DR8A 2AE6A 3FXTA 4E8OA 2RC4A 2BL1A 4FD6A 4H6UA 4KVME 4KORA 3T9YA 3D3SA 3S6GA 2HUZA 2ARHA 2JEVA 3TFYA 4BMHA 4J3GA 4U9YA 3LODA 4E2AA 1RXTA 4H89A 3W6SA 1MK4A 1YREA 4OLLA 2GIVA 5IX3A 3D2PA 4KVOE 4XNHC 3SHPA 1M4GA 3FYNA 4PK3A 1VHSA 2ATRA 3PZJA 4C2ZA 4C7HA 3TCVA 3PGPA 4F0YA 1PUAA 1IIDA 4FD7A 2FSRA 3GY9A 1YLEA 1MJAA 2B4DA 2CNSA 2O28A 3H4QA 1S3ZA 4B11A 5F47A 3EY5A 1SQHA 2B3VA 4ORFA 5A27A 4AG7A 2VZYA 3ZJ0A 2J8MA 2OU2A 4MI4A 2Z0ZA 4B10A 3CXPA 3D8PA 5AG7A 3DR6A 3EC4A 2FE7A 2ZW4A 4KVXA 4HKFA 1B6BA 4A32A 5IV0A 4QUSA 4KLWA 4FD4A 3N7ZA 2B4DB 1QSMA 2YGWA 4UWJA 3RYOA 3IU2A 3EO4A 2P6EA 2WPXA 2FS5A 4OAEA 3GYAA 3R9EA 1YGHA 3CXQA 3FNCA 1IB1E 3S6KA 1S7FA 2VQYA 1BO4A 3WR7A 2ZW6A 3JTKA 4MFZA 3P2FA 2Z3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NMT A;  3V8I A;  2B3U A;  1J4J A;  3MGD A;  5JQ4 A;  1IYK A;  5HH1 A;  3E0K A;  2FT0 A;  3PP9 A;  4R3L A;  3R1K A;  4M3S A;  3K9U A;  4KOS A;  3SXO A;  3CXS A;  1KZF A;  1MJB A;  2REE A;  4RS2 A;  1Y9K A;  5DWM A;  1XEB A;  3QB8 A;  1TIQ A;  2A4N A;  4NCZ A;  2C27 A;  4Y49 C;  1S7N A;  4JWP A;  3W91 A;  4CAV A;  2G3T A;  4GS4 A;  1V0C A;  3C26 A;  1P0H A;  2HV2 A;  2ZXV A;  3ZZI A;  5GCN A;  4MBU A;  2FL4 A;  4HNX B;  4R9M A;  2P0W A;  3F0A A;  1M44 A;  5J8F A;  3LD2 A;  1IYL A;  1Y9W A;  3JUW A;  1Z4E A;  1XF8 A;  2QIR A;  4XPD C;  2OZU A;  4KOW A;  1S5K A;  2FIA A;  2REF A;  2JDD A;  1YK3 A;  2D4O A;  1Q2D A;  5J8C A;  1WWZ A;  2BSW A;  1Q2Y A;  2R98 A;  4CS0 B;  2EUI A;  2PQ8 A;  3DDD A;  5C88 A;  4M85 A;  2Z11 A;  3I3G A;  1LRZ A;  4PV6 A;  3VWD A;  4MJ8 A;  2OH1 A;  4UBR A;  1GHE A;  1RO5 A;  4NXY A;  3EFA A;  1M1D A;  1QSR A;  1BOB A;  1KUX A;  4KOY A;  3FRM A;  1WK4 A;  4YFJ A;  3NE7 A;  2OB0 A;  5C82 A;  4CRZ B;  1CJW A;  5FVJ A;  3D2M A;  4KUA A;  2F5I A;  2R8V A;  5F46 A;  4FD5 A;  4CAX A;  2ZW5 A;  1S60 A;  1Z9U A;  4B5P A;  3F8K A;  1OZP A;  2CNM A;  1K4J A;  3W6X A;  4UA3 A;  2Q7B A;  5IB0 A;  2BUE A;  4AVA A;  1YR0 A;  5F48 A;  2Q44 A;  4KUB A;  1U6M A;  5H84 A;  2B5G A;  5EBV A;  4CRY B;  1Q2C A;  4B5O A;  1S7L A;  3IGR A;  3R95 A;  4AVC A;  4XNH B;  4YRH A;  2B4B A;  2WPW A;  3P2H A;  4KLV A;  4JJX A;  4KOT A;  4B5P B;  4IUS A;  4CAW A;  2Q4Y A;  1FY7 A;  2FXF A;  2G3A A;  2GE3 A;  4QC6 A;  4ONU A;  4PSX A;  2OZH A;  2B5G B;  2JDC A;  4JLY A;  4AB7 A;  4R57 A;  3I9S A;  2PRB A;  4AVB A;  5E96 A;  4PK2 A;  4QBJ A;  2FIW A;  5EC4 A;  3KKW A;  1I21 A;  4L89 A;  3S6H A;  4NSQ A;  1Z4R A;  5ISV A;  3T90 A;  2J8R A;  2OZG A;  3BLN A;  4E0A A;  5KTC A;  4HNW B;  1YVO A;  4MY3 A;  5F49 A;  2I00 A;  2BEI A;  3SXN A;  2Y0M A;  4NF1 A;  3DNS A;  4XPK A;  1ON0 A;  3TO9 A;  4L8A A;  4LUA A;  4KOV A;  5CNP A;  3IWG A;  1VKC A;  2VI7 A;  1NSL A;  4RI1 A;  2PR8 A;  4KZT A;  1Y7R A;  3F5B A;  2PR1 A;  1MJ9 A;  3B8G A;  2FCK A;  1B87 A;  2IL4 A;  4PSW A;  4Y49 B;  2J8N A;  5KTA A;  4XPL A;  4H6Z A;  3FBU A;  3TO7 A;  4MHD A;  2CY2 A;  2B58 A;  2GAN A;  1M4D A;  2HQY A;  2JLM A;  3R9F A;  3OWC A;  4JD6 A;  3TOA A;  4I49 A;  3UY5 A;  3FB3 A;  4R3K A;  2K5T A;  4NEX A;  3JVN A;  2Q0Y A;  3G3S A;  2PSW A;  2Q4V A;  4KOU A;  2EVN A;  3VWE A;  1I12 A;  4K30 A;  1XMT A;  4KOX A;  4MY0 A;  4XPD B;  4IF5 A;  3TOB A;  1XIX A;  5KTD A;  5DWN A;  4II9 A;  3TT2 A;  5JPH A;  2VXK A;  4U5Y A;  2D4P A;  2DXQ A;  1XE4 A;  3TO6 A;  2ZPA A;  3EXN A;  1L0C A;  2VZZ A;  1YX0 A;  1PU9 A;  4JXQ A;  2CNT A;  4DNC A;  4F6A A;  2PDO A;  4HNY B;  2R7H A;  2Z10 A;  2PC1 A;  3BJ8 A;  5H86 A;  5I0C A;  1KUY A;  4AG9 A;  3QAH A;  1S7K A;  2VEZ A;  1P4N A;  2KCW A;  3TE4 A;  2AJ6 A;  4U9Z A;  1NE9 A;  2P6F A;  3R96 A;  2X7B A;  4JXR A;  1QSO A;  2VBQ A;  2P6G A;  2QML A;  4R87 A;  4OAD A;  1CM0 A;  1QSN A;  3TTH A;  4QVT A;  3R9G A;  4ZBG A;  2I79 A;  2H5M A;  4YGO A;  4EVY A;  2ZW7 A;  1R57 A;  1M4I A;  2Q04 A;  1YVK A;  2R1I A;  3DSB A;  1I1D A;  4UWI A;  1N71 A;  4LX9 A;  4X5K A;  1NMT A;  3FIX A;  5HMN A;  3S6F A;  3BJ7 A;  3G8W A;  1IIC A;  2G0B A;  2QEC A;  3GKR A;  1KUV A;  4QB9 A;  1UFH A;  1QST A;  3DR8 A;  2AE6 A;  3FXT A;  4E8O A;  2RC4 A;  2BL1 A;  4FD6 A;  4H6U A;  4KVM E;  4KOR A;  3T9Y A;  3D3S A;  3S6G A;  2HUZ A;  2ARH A;  2JEV A;  3TFY A;  4BMH A;  4J3G A;  4U9Y A;  3LOD A;  4E2A A;  1RXT A;  4H89 A;  3W6S A;  1MK4 A;  1YRE A;  4OLL A;  2GIV A;  5IX3 A;  3D2P A;  4KVO E;  4XNH C;  3SHP A;  1M4G A;  3FYN A;  4PK3 A;  1VHS A;  2ATR A;  3PZJ A;  3TCV A;  3PGP A;  4F0Y A;  1PUA A;  1IID A;  4FD7 A;  2FSR A;  3GY9 A;  1YLE A;  1MJA A;  2B4D A;  2CNS A;  2O28 A;  3H4Q A;  1S3Z A;  5F47 A;  3EY5 A;  1SQH A;  2B3V A;  4ORF A;  4AG7 A;  2VZY A;  3ZJ0 A;  2J8M A;  2OU2 A;  4MI4 A;  2Z0Z A;  3CXP A;  3D8P A;  3DR6 A;  3EC4 A;  2FE7 A;  2ZW4 A;  4KVX A;  4HKF A;  1B6B A;  5IV0 A;  4QUS A;  4KLW A;  4FD4 A;  3N7Z A;  2B4D B;  1QSM A;  4UWJ A;  3RYO A;  3EO4 A;  2P6E A;  2WPX A;  2FS5 A;  4OAE A;  3GYA A;  3R9E A;  1YGH A;  3CXQ A;  3FNC A;  1IB1 E;  3S6K A;  1S7F A;  2VQY A;  1BO4 A;  3WR7 A;  2ZW6 A;  3P2F A; 
#chains in the Genus database with same CATH topology
 2PJ1 A;  3CPA A;  4PQA A;  1Z8T A;  2NMT A;  3CDX A;  3V8I A;  3IWE A;  2B3U A;  3PB6 X;  4Q7A A;  4BBH A;  1J4J A;  1ELM P;  4ZX8 A;  3BI1 A;  4P4D A;  3MGD A;  1LAN A;  3IWW A;  2FVG A;  3QNV A;  5JQ4 A;  1IYK A;  5HH1 A;  1CBX A;  3E0K A;  2XEG A;  2FT0 A;  4P4B A;  3PP9 A;  4R3L A;  1ZLH A;  3GB0 A;  3V38 A;  3R1K A;  2ZEN A;  3K9U A;  4M3S A;  2YNC C;  4KOS A;  3SXO A;  1DTD A;  3CXS A;  1KZF A;  4CGP A;  1MJB A;  2REE A;  4RS2 A;  4NJR A;  4CYP A;  3IU1 A;  1Y9K A;  2Z3M A;  1Y0Y A;  5DWM A;  1XEB A;  2PJ2 A;  1BLL E;  3QB8 A;  5ELY A;  1TIQ A;  4FAI A;  1AUG A;  2A4N A;  4MHP A;  2C27 A;  1Z8L A;  4NCZ A;  5G1Z A;  4Y49 C;  4CAE A;  3H5Z A;  2QVP A;  4F9U A;  4OIW A;  1S7N A;  4JWP A;  2PJ9 A;  4FUU A;  3W91 A;  4CAV A;  2ZEG A;  3WC5 A;  1DE4 C;  1EE3 P;  2G3T A;  2GLJ A;  2Q43 A;  4GS4 A;  1GYT A;  3NE8 A;  1V0C A;  3C26 A;  1P0H A;  2HV2 A;  3BHX A;  2ZXV A;  4NGQ A;  4M6G A;  4OME A;  3ZZI A;  4M6H A;  1H8L A;  4CGO A;  4P4E A;  2NYQ A;  2WUU A;  2Q51 A;  5GCN A;  4MBU A;  2FL4 A;  4HNX B;  4R9M A;  4YU9 A;  4CGN A;  2P0W A;  3KHZ A;  3F0A A;  3I1U A;  1M44 A;  3B3T A;  1UWY A;  5J8F A;  2IQ6 A;  3LD2 A;  1IYL A;  3B35 A;  4PXC A;  2WYR A;  1IOI A;  1Y9W A;  4PPZ A;  3JUW A;  1Z4E A;  2AFS A;  1YME A;  1XF8 A;  3PB8 X;  1ZLI A;  2QIR A;  4XPD C;  2OZU A;  1Z8W A;  4UCM A;  4KOW A;  4TWE A;  1S5K A;  2FIA A;  1A2Z A;  2REF A;  2V8H A;  2JDD A;  3VAT A;  1YK3 A;  2D4O A;  3D66 A;  1Q2D A;  4P10 A;  5J8C A;  1WWZ A;  2BSW A;  3FMC A;  2V8V A;  4PXE A;  2PVV A;  1Q2Y A;  2R98 A;  4CS0 B;  2EUI A;  2Q7S A;  3BXM A;  2PJ3 A;  2POK A;  2CIJ A;  2AFO A;  2PQ8 A;  2EK9 A;  3DDD A;  1R3N A;  4M85 A;  5C88 A;  2Z11 A;  1TKJ A;  4OC4 A;  5G20 A;  3I3G A;  1LRZ A;  4PV6 A;  4CAF A;  1X12 A;  3VWD A;  5K8M A;  4MJ8 A;  6CPA A;  3H8F A;  1QQ9 A;  2PJ8 A;  2OH1 A;  4B6Z A;  4UBR A;  3D7F A;  1GHE A;  1RO5 A;  4B13 A;  3KI9 A;  3HUV A;  4NXY A;  4NGT A;  3PRT A;  2Z3N A;  3EFA A;  2ZEH A;  8CPA A;  1TKF A;  4OP4 A;  1M1D A;  1FT7 A;  1QSR A;  1BOB A;  1Z5R A;  2GLF A;  3B3V A;  3GLJ A;  4MFK A;  1KUX A;  4KOY A;  2GU2 A;  2DF5 A;  3FRM A;  1WK4 A;  2AFW A;  3WC7 A;  4YFJ A;  4CGL A;  5CBM A;  2YND A;  3NE7 A;  2OB0 A;  3KQX A;  5C82 A;  3QAY A;  4CRZ B;  1YLO A;  2EBJ A;  3B3C A;  5I4M A;  2IMO A;  1CJW A;  1XOV A;  5FVJ A;  3D2M A;  1LAM A;  4C2Y A;  4KUA A;  2F5I A;  2R8V A;  1CG2 A;  1F2O A;  5F46 A;  4OID A;  4CYO A;  4ZY2 A;  2OOT A;  3RO0 A;  4FD5 A;  2O4H A;  3S9N A;  4CAX A;  4LQ6 A;  4P4I A;  2ZW5 A;  1S60 A;  1Z9U A;  1CP7 A;  2Z3L A;  5D8N A;  3NA6 A;  4B5P A;  5A28 A;  3WAB A;  2EO8 A;  3F8K A;  3KAS A;  1OZP A;  4KSA A;  2CNM A;  1K4J A;  3W6X A;  3IEH A;  1ZO0 A;  3S9M A;  3L2N A;  2HB6 A;  4UA3 A;  1LFW A;  4IAV A;  2BUE A;  2Q7B A;  3SI1 A;  1JWQ A;  5IB0 A;  4AVA A;  4CYN A;  3NFZ A;  3FJU A;  1YR0 A;  2JBJ A;  5F48 A;  4MHZ A;  5LYF A;  2Q44 A;  4ZBG A;  4KUB A;  4EFD A;  2CTC A;  1U6M A;  5G22 A;  4F0X A;  5H84 A;  5BWA B;  2B5G A;  5EBV A;  4C7I A;  4CRY B;  1Q2C A;  4NGS A;  1S7L A;  4B5O A;  4BIN A;  3SJF A;  1AMP A;  3IGR A;  3R95 A;  4XNH B;  4AVC A;  4YRH A;  1ARM A;  2B4B A;  4OC5 A;  4ZX9 A;  5J1Q A;  2QJ8 A;  2WPW A;  3FED A;  3P2H A;  4KLV A;  4MFJ A;  2PJ5 A;  2PE3 A;  4JJX A;  4KOT A;  4B5P B;  4IUS A;  4OKO A;  1F57 A;  4CAW A;  2Q4Y A;  3CT9 A;  2DEA A;  3B2Y A;  1FY7 A;  2FXF A;  2G3A A;  2ZED A;  2GE3 A;  3B3S A;  1LAP A;  4F8Z A;  4H2K A;  4QC6 A;  4X3R A;  4X8I A;  4ONU A;  4G1P A;  3V7Z A;  4PSX A;  1TF8 A;  4JYW A;  5AG5 A;  2OZH A;  4IHM A;  2B5G B;  3WT4 A;  4TNU A;  2PCU A;  2JDC A;  4JLY A;  4AB7 A;  2PJ6 A;  4R57 A;  2JEW A;  3N5F A;  2DPT A;  3I9S A;  5HXD A;  2PRB A;  4AVB A;  4CGM A;  3D68 A;  5E96 A;  4MFQ A;  4PK2 A;  4QBJ A;  2FIW A;  4MHY A;  4DUK A;  3FX6 A;  4EWT A;  2Q4Z A;  5LYL A;  5EC4 A;  1M4L A;  4FBE A;  3KKW A;  4UFW A;  2ZEO A;  1I21 A;  2Z3P A;  2ZEE A;  4L89 A;  3S6H A;  4NSQ A;  2AFU A;  3R9G A;  2YNC A;  3WC6 A;  1Z4R A;  4UEZ A;  4KSF A;  4OC0 A;  1IGB A;  5ISV A;  3T90 A;  2J8R A;  2OZG A;  3BLN A;  4KS9 A;  4NGM A;  4E0A A;  5KTC A;  4HNW B;  1ZG9 A;  1YVO A;  7CPA A;  4C68 A;  4MY3 A;  4YWY A;  4UIA A;  4UIB A;  1TF9 A;  3MN8 A;  3PFE A;  2PJB A;  5F49 A;  2I00 A;  2BEI A;  4K3N A;  4PXB A;  3SXN A;  2ODF A;  2AFM A;  5F09 A;  2Y0M A;  4NF1 A;  2PJ7 A;  4WJB A;  4OC2 A;  3DNS A;  4XPK A;  1ON0 A;  4A33 A;  3TO9 A;  4L8A A;  3ISX A;  4LUA A;  4KOV A;  5CNP A;  3IWG A;  3T8W A;  3TX8 A;  1VKC A;  2VI7 A;  3TC8 A;  4UEE A;  2IJZ A;  5G21 A;  4Q36 A;  1NSL A;  3K2K A;  4MCR A;  4RI1 A;  3MRU A;  2PR8 A;  4KZT A;  1Y7R A;  4UFV A;  4B12 A;  2ABZ A;  2AFX A;  2PIZ A;  2C6C A;  3F5B A;  2F7V A;  3KR5 A;  2PR1 A;  4NJQ A;  1MJ9 A;  3B8G A;  1AYE A;  3D4U A;  2FCK A;  1B87 A;  1BPM A;  1LCP A;  3NH5 A;  1VHE A;  1ELL P;  2IL4 A;  4A38 A;  4PSW A;  4Y49 B;  2J8N A;  5KTA A;  3K9T A;  4H6Z A;  4XPL A;  2PJ0 A;  5AG6 A;  3RBU A;  3SJG A;  3FBU A;  1YW6 A;  3TO7 A;  4AXV A;  4MHD A;  4MCQ A;  2XEI A;  4OC1 A;  2CY2 A;  1YQE A;  2B58 A;  2GAN A;  1M4D A;  5AGE A;  1Y0R A;  2HQY A;  2EK8 A;  2JLM A;  3R9F A;  3PFO A;  3OWC A;  5THW A;  4JD6 A;  4Q38 A;  4I49 A;  3TOA A;  1IU8 A;  3UY5 A;  3FB3 A;  4R3K A;  1ZG7 A;  2K5T A;  3NH4 A;  4NEX A;  3GIU A;  4P4F A;  3JVN A;  4Z65 A;  1TKH A;  3IJ3 A;  4ZI6 A;  4UEF A;  2Q0Y A;  3G3S A;  2PSW A;  2Q4V A;  3PB9 X;  4KOU A;  4P45 A;  2EVN A;  4MCS A;  1Z8X A;  3KZW A;  3FH4 A;  5EMI A;  1VHO A;  5K8N A;  4RN7 A;  3VWE A;  4A30 A;  1I12 A;  4K30 A;  2OR4 A;  4CPA A;  1XMT A;  4ZGY B;  3PB4 X;  3FF3 A;  4KOX A;  4MY0 A;  4XPD B;  4IF5 A;  3TOB A;  4KSI A;  2YNE A;  1HDU A;  1XIX A;  2HC9 A;  2ANP A;  1CP6 A;  5KTD A;  1ZG8 A;  3FVL A;  4A95 A;  3LMS A;  5DWN A;  4A31 A;  4JZ0 A;  4II9 A;  3ISZ A;  3DGV A;  5K8P A;  5D29 A;  3TT2 A;  4C2X A;  2PJC A;  5JPH A;  2CXA A;  4A37 A;  4UCN A;  2I3C A;  5LYI A;  1RTQ A;  2VXK A;  4U5Y A;  1HEE A;  2D4P A;  5K8O A;  2DXQ A;  1XE4 A;  2XEJ A;  2RFH A;  3TO6 A;  3D67 A;  2ZPA A;  4UCP A;  2BOA A;  3KL9 A;  3EXN A;  3LAC A;  4NGN A;  2C1C A;  1L0C A;  1CX8 A;  1FNO A;  2VZZ A;  4UFX A;  4LQG A;  2QYV A;  1YX0 A;  3JRU A;  3NH8 A;  4ONW A;  3VH9 A;  1PU9 A;  4JXQ A;  4MCP A;  4DJL A;  3BI0 A;  2CNT A;  3PBE A;  4DNC A;  2PDO A;  4F6A A;  2GRE A;  1PCA A;  5JM6 A;  3CPX A;  3LWU A;  4HNY B;  4MFL A;  2R7H A;  4RUH A;  2Z10 A;  2DPS A;  1Z2L A;  3D7G A;  2PC1 A;  3BJ8 A;  3PBB A;  5H86 A;  3PEI A;  5I0C A;  2J9A A;  4MHN A;  3DLJ A;  1KUY A;  4AG9 A;  3QAH A;  1IY7 A;  1S7K A;  2VEZ A;  1BPN A;  1P4N A;  5JH9 A;  1ARL A;  2VL1 A;  1XMB A;  2KCW A;  3D7D A;  3TE4 A;  1BAV A;  2PVW A;  2AJ6 A;  4U9Z A;  1NE9 A;  2CTB A;  3B7I A;  4CYQ A;  3RAM A;  4R76 A;  3HLP A;  3SI2 A;  2P6F A;  3SI0 A;  4WWV A;  3R96 A;  3VAR A;  4ZY1 A;  2PIY A;  2X7B A;  4JXR A;  1QSO A;  2VBQ A;  2P6G A;  4MRI A;  2QML A;  1Q7L A;  4R87 A;  4OC3 A;  4GM5 A;  1CM0 A;  4OAD A;  2V8D A;  1QSN A;  3TTH A;  1X10 A;  4F9V A;  2CF4 A;  1NSA A;  3B3W A;  3RZA A;  4QVT A;  4A2Z A;  3IFE A;  3A9L A;  4R6T A;  2I79 A;  2H5M A;  4MFP A;  5DS0 A;  4P44 A;  1PYT B;  2ZW7 A;  4YGO A;  1R57 A;  5CPA A;  1M4I A;  2Q04 A;  3FEC A;  4EVY A;  1YVK A;  2WSA A;  5LRJ A;  2R1I A;  5HVH A;  2PJA A;  4A94 A;  3D7H A;  2V8G A;  2XEF A;  4W9Y A;  5LRG A;  1VIX A;  3KR4 A;  1JQG A;  2Z3K A;  3DSB A;  1I1D A;  2AFZ A;  4UWI A;  1N71 A;  2C6G A;  4LX9 A;  4X5K A;  1NMT A;  2ZEL A;  3FIX A;  2ZEM A;  5HMN A;  4A39 A;  3S6F A;  3IC1 A;  5AG4 A;  1CPS A;  4X2T A;  3BJ7 A;  3G8W A;  3KGQ A;  1IIC A;  1HDQ A;  2G0B A;  3H8G A;  2QEC A;  3GKR A;  1YSJ A;  1KUV A;  3CZX A;  4QB9 A;  4BD9 A;  3H8E A;  4GXH A;  5IB9 A;  1UFH A;  1YW4 A;  2ZOG A;  1QST A;  4B14 A;  3DR8 A;  2AE6 A;  3FXT A;  4E8O A;  2RC4 A;  2BL1 A;  4FD6 A;  4H6U A;  4KVM E;  2ZEF A;  1XJO A;  3IO1 A;  4KOR A;  3SJE A;  2GFQ A;  3T9Y A;  3D3S A;  3S6G A;  2HUZ A;  2ARH A;  2JEV A;  5LRK A;  2RB7 A;  3TFY A;  4BMH A;  4J3G A;  2F8H A;  3KHX A;  4U9Y A;  4ZY0 A;  3LOD A;  1TXR A;  1QMU A;  3KQZ A;  4M6I A;  1RXT A;  2V77 A;  4R7M A;  1Y7E A;  4E2A A;  2ZEP A;  4H89 A;  1MK4 A;  1YRE A;  4OLL A;  3W6S A;  1F2P A;  2GIV A;  3GUX A;  5IX3 A;  3D2P A;  2C6P A;  4KVO E;  1LOK A;  4MMO A;  2ZOF A;  4XNH C;  3SHP A;  1M4G A;  3FYN A;  1CPX A;  4DYO A;  4PK3 A;  1VHS A;  2ATR A;  3PZJ A;  4C2Z A;  4C7H A;  3TCV A;  3PGP A;  4F0Y A;  1PUA A;  1IID A;  1XRY A;  3FEE A;  4FD7 A;  2FSR A;  3GY9 A;  1YLE A;  5JGF A;  4R8F A;  3SJX A;  1MJA A;  2B4D A;  2CNS A;  2O28 A;  3H4Q A;  4O23 A;  1S3Z A;  4B11 A;  2G9D A;  1KWM A;  5F47 A;  2JBK A;  3EY5 A;  1SQH A;  4NGR A;  2B3V A;  1IOF A;  4ORF A;  5A27 A;  4AG7 A;  2VZY A;  2O53 A;  3ZJ0 A;  1XBU A;  2J8M A;  2OU2 A;  4MI4 A;  2Z0Z A;  4B10 A;  2BCO A;  3CXP A;  4MXU A;  3D8P A;  5AG7 A;  1XFO A;  3DR6 A;  3EC4 A;  2FE7 A;  2ZW4 A;  4KVX A;  4NFR A;  2PRQ A;  1B6B A;  4HKF A;  3RNZ A;  4A32 A;  2BO9 A;  5IV0 A;  1R43 A;  4QUS A;  5HVF A;  4KLW A;  4ZYQ A;  4FD4 A;  3N7Z A;  2B4D B;  4P4J A;  4HPS A;  2PJ4 A;  2WZN A;  1QSM A;  4EME A;  2YGW A;  4UWJ A;  5LYD A;  3RYO A;  3IU2 A;  3EO4 A;  4UF4 A;  4IK2 A;  2P6E A;  2WPX A;  4NGP A;  3PB7 X;  2FS5 A;  4OAE A;  3GYA A;  2NSM A;  3IIB A;  3R9E A;  5HVG A;  3S9L A;  1VGY A;  1YGH A;  3CXQ A;  3FNC A;  4FWU A;  1IB1 E;  4P6Y A;  1S7F A;  1OBR A;  2VQY A;  1BO4 A;  4PXD A;  3S6K A;  3WR7 A;  2ZW6 A;  3JTK A;  4MFZ A;  3P2F A;  2EWB A;  2Z3O A; 
#chains in the Genus database with same CATH homology
 2NMT A;  4BBH A;  3V8I A;  3IWE A;  2B3U A;  1J4J A;  3MGD A;  5JQ4 A;  1IYK A;  5HH1 A;  3E0K A;  2FT0 A;  3PP9 A;  4R3L A;  3R1K A;  4M3S A;  3K9U A;  2YNC C;  4KOS A;  3SXO A;  3CXS A;  1KZF A;  4CGP A;  1MJB A;  2REE A;  4RS2 A;  4CYP A;  3IU1 A;  1Y9K A;  2Z3M A;  5DWM A;  1XEB A;  3QB8 A;  1TIQ A;  2A4N A;  4NCZ A;  2C27 A;  5G1Z A;  4Y49 C;  4CAE A;  3H5Z A;  1S7N A;  4JWP A;  3W91 A;  4CAV A;  2G3T A;  4GS4 A;  1V0C A;  3C26 A;  1P0H A;  2HV2 A;  2ZXV A;  3ZZI A;  4CGO A;  2WUU A;  5GCN A;  4MBU A;  2FL4 A;  4HNX B;  4R9M A;  4CGN A;  2P0W A;  3F0A A;  1M44 A;  5J8F A;  3LD2 A;  1IYL A;  1Y9W A;  3JUW A;  1Z4E A;  1XF8 A;  2QIR A;  4XPD C;  2OZU A;  4UCM A;  4KOW A;  1S5K A;  2FIA A;  2REF A;  2JDD A;  1YK3 A;  2D4O A;  1Q2D A;  5J8C A;  1WWZ A;  2BSW A;  1Q2Y A;  2R98 A;  4CS0 B;  2EUI A;  2PQ8 A;  3DDD A;  5C88 A;  4M85 A;  2Z11 A;  5G20 A;  3I3G A;  1LRZ A;  4PV6 A;  4CAF A;  3VWD A;  4MJ8 A;  2OH1 A;  4UBR A;  1GHE A;  1RO5 A;  4B13 A;  4NXY A;  2Z3N A;  3EFA A;  1M1D A;  1QSR A;  1BOB A;  4MFK A;  1KUX A;  4KOY A;  3FRM A;  1WK4 A;  4YFJ A;  4CGL A;  2YND A;  3NE7 A;  2OB0 A;  5C82 A;  4CRZ B;  1CJW A;  5FVJ A;  3D2M A;  4C2Y A;  4KUA A;  2F5I A;  2R8V A;  5F46 A;  4CYO A;  4FD5 A;  4CAX A;  2ZW5 A;  1S60 A;  1Z9U A;  2Z3L A;  4B5P A;  5A28 A;  3F8K A;  1OZP A;  4KSA A;  2CNM A;  1K4J A;  3W6X A;  1ZO0 A;  4UA3 A;  2Q7B A;  5IB0 A;  2BUE A;  4AVA A;  4CYN A;  1YR0 A;  5F48 A;  2Q44 A;  4KUB A;  1U6M A;  5G22 A;  4F0X A;  5H84 A;  5BWA B;  2B5G A;  5EBV A;  4C7I A;  4CRY B;  1Q2C A;  4B5O A;  1S7L A;  3IGR A;  3R95 A;  4AVC A;  4XNH B;  4YRH A;  2B4B A;  2WPW A;  4MFJ A;  3P2H A;  4KLV A;  4JJX A;  4KOT A;  4B5P B;  4IUS A;  4CAW A;  2Q4Y A;  1FY7 A;  2FXF A;  2G3A A;  2GE3 A;  4QC6 A;  4ONU A;  4PSX A;  5AG5 A;  2OZH A;  2B5G B;  2JDC A;  4JLY A;  4AB7 A;  4R57 A;  2DPT A;  3I9S A;  2PRB A;  4AVB A;  4CGM A;  5E96 A;  4MFQ A;  4PK2 A;  4QBJ A;  2FIW A;  5EC4 A;  3KKW A;  4UFW A;  1I21 A;  2Z3P A;  4L89 A;  3S6H A;  4NSQ A;  2YNC A;  1Z4R A;  4KSF A;  5ISV A;  3T90 A;  2J8R A;  2OZG A;  3BLN A;  4KS9 A;  4E0A A;  5KTC A;  4HNW B;  1YVO A;  4C68 A;  4MY3 A;  5F49 A;  2I00 A;  2BEI A;  3SXN A;  2Y0M A;  4NF1 A;  3DNS A;  4XPK A;  1ON0 A;  4A33 A;  3TO9 A;  4L8A A;  4LUA A;  4KOV A;  5CNP A;  3IWG A;  1VKC A;  2VI7 A;  5G21 A;  4Q36 A;  1NSL A;  4RI1 A;  4UFV A;  2PR8 A;  4KZT A;  1Y7R A;  4B12 A;  3F5B A;  2PR1 A;  1MJ9 A;  3B8G A;  2FCK A;  1B87 A;  2IL4 A;  4PSW A;  4Y49 B;  2J8N A;  5KTA A;  4XPL A;  4H6Z A;  5AG6 A;  3FBU A;  3TO7 A;  4MHD A;  2CY2 A;  2B58 A;  2GAN A;  1M4D A;  5AGE A;  2HQY A;  2JLM A;  3R9F A;  3OWC A;  4JD6 A;  4Q38 A;  4I49 A;  3TOA A;  3UY5 A;  3FB3 A;  4R3K A;  2K5T A;  4NEX A;  3JVN A;  2Q0Y A;  3G3S A;  2PSW A;  2Q4V A;  4KOU A;  2EVN A;  3VWE A;  4A30 A;  1I12 A;  4K30 A;  1XMT A;  4ZGY B;  4KOX A;  4MY0 A;  4XPD B;  4IF5 A;  3TOB A;  2YNE A;  1XIX A;  5KTD A;  4A95 A;  5DWN A;  4A31 A;  4II9 A;  3TT2 A;  4C2X A;  5JPH A;  2CXA A;  4UCN A;  2VXK A;  4U5Y A;  2D4P A;  2DXQ A;  1XE4 A;  3TO6 A;  2ZPA A;  4UCP A;  3EXN A;  1L0C A;  2VZZ A;  4UFX A;  1YX0 A;  1PU9 A;  4JXQ A;  2CNT A;  4DNC A;  4F6A A;  2PDO A;  4HNY B;  4MFL A;  2R7H A;  2Z10 A;  2DPS A;  2PC1 A;  3BJ8 A;  5H86 A;  5I0C A;  1KUY A;  4AG9 A;  3QAH A;  1S7K A;  2VEZ A;  1P4N A;  2KCW A;  3TE4 A;  2AJ6 A;  4U9Z A;  1NE9 A;  4CYQ A;  2P6F A;  3R96 A;  2X7B A;  4JXR A;  1QSO A;  2VBQ A;  2P6G A;  2QML A;  4R87 A;  4OAD A;  1CM0 A;  1QSN A;  3TTH A;  4QVT A;  4A2Z A;  3A9L A;  4ZBG A;  2I79 A;  2H5M A;  4MFP A;  3R9G A;  4YGO A;  4EVY A;  2ZW7 A;  1R57 A;  1M4I A;  2Q04 A;  1YVK A;  2WSA A;  2R1I A;  2Z3K A;  3DSB A;  1I1D A;  4UWI A;  1N71 A;  4LX9 A;  4X5K A;  1NMT A;  3FIX A;  5HMN A;  3S6F A;  5AG4 A;  3BJ7 A;  3G8W A;  1IIC A;  2G0B A;  2QEC A;  3GKR A;  1KUV A;  4QB9 A;  1UFH A;  4B14 A;  1QST A;  3DR8 A;  2AE6 A;  3FXT A;  4E8O A;  2RC4 A;  2BL1 A;  4FD6 A;  4H6U A;  4KVM E;  4KOR A;  3T9Y A;  3D3S A;  3S6G A;  2HUZ A;  2ARH A;  2JEV A;  3TFY A;  4BMH A;  4J3G A;  4U9Y A;  3LOD A;  4E2A A;  1RXT A;  4H89 A;  3W6S A;  1MK4 A;  1YRE A;  4OLL A;  2GIV A;  5IX3 A;  3D2P A;  4KVO E;  4XNH C;  3SHP A;  1M4G A;  3FYN A;  4PK3 A;  1VHS A;  2ATR A;  3PZJ A;  4C2Z A;  4C7H A;  3TCV A;  3PGP A;  4F0Y A;  1PUA A;  1IID A;  4FD7 A;  2FSR A;  3GY9 A;  1YLE A;  1MJA A;  2B4D A;  2CNS A;  2O28 A;  3H4Q A;  1S3Z A;  4B11 A;  5F47 A;  3EY5 A;  1SQH A;  2B3V A;  4ORF A;  5A27 A;  4AG7 A;  2VZY A;  3ZJ0 A;  2J8M A;  2OU2 A;  4MI4 A;  2Z0Z A;  4B10 A;  3CXP A;  3D8P A;  5AG7 A;  3DR6 A;  3EC4 A;  2FE7 A;  2ZW4 A;  4KVX A;  4HKF A;  1B6B A;  4A32 A;  5IV0 A;  4QUS A;  4KLW A;  4FD4 A;  3N7Z A;  2B4D B;  1QSM A;  2YGW A;  4UWJ A;  3RYO A;  3IU2 A;  3EO4 A;  2P6E A;  2WPX A;  2FS5 A;  4OAE A;  3GYA A;  3R9E A;  1YGH A;  3CXQ A;  3FNC A;  1IB1 E;  3S6K A;  1S7F A;  2VQY A;  1BO4 A;  3WR7 A;  2ZW6 A;  3JTK A;  4MFZ A;  3P2F A;  2Z3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...