5GCNA

Catalytic domain of tetrahymena gcn5 histone acetyltransferase in complex with coenzyme a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
166
structure length
166
Chain Sequence
MKGLLDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the catalytic domain of GCN5 histone acetyltransferase bound to coenzyme A
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Transferase
molecule keywords HISTONE ACETYLTRANSFERASE GCN5
total genus 32
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 1999-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5gcnA00
4PK2A 3W6XA 4PK3A 1OZPA 1XIXA 1XE4A 4HNWB 2FT0A 3T9YA 2KCWA 4RS2A 1S7KA 1Q2DA 1NSLA 3FNCA 5IB0A 3SXOA 3D8PA 3R9EA 4FD7A 4XPLA 1Z4RA 4B5PA 3EO4A 4XPKA 5FVJA 2EUIA 2FIAA 3BJ8A 3DR6A 1Z4EA 4PV6A 2D4OA 1V0CA 4E2AA 1M1DA 2FCKA 5F49A 3DR8A 2VEZA 3V8IA 4YGOA 3KKWA 2O28A 4FD6A 2P6GA 3BLNA 2GIVA 2P0WA 4CRZB 1YVOA 2FL4A 4LUAA 3W6SA 1VKCA 2BEIA 4CS0B 2Q4YA 3RYOA 4QC6A 1IYLA 3G3SA 2Z10A 1IB1E 2Z11A 2HQYA 3QAHA 2G0BA 4XPDC 2OZUA 3FIXA 2EVNA 2VBQA 4QB9A 1M4IA 4FD4A 2NMTA 2ZW7A 5HMNA 4KLVA 3DDDA 2BUEA 4ZBGA 4QBJA 4R3KA 1IYKA 4KOVA 3LODA 4CAWA 1YX0A 4AG9A 4UWIA 4LX9A 1CM0A 2F5IA 3WR7A 1KUXA 2GANA 1SQHA 1MJBA 1XF8A 1BO4A 2ZW5A 4BMHA 2REFA 5KTCA 4JD6A 4K30A 3P2HA 2CNMA 2R8VA 1J4JA 1ON0A 1KUVA 4YRHA 2B3UA 4UA3A 4JWPA 1Y9KA 3TOBA 2ZW4A 1MJAA 5H84A 4U9ZA 1QSMA 2AJ6A 1KZFA 2OB0A 1S7NA 1YR0A 2R7HA 1B87A 2CNSA 2RC4A 2H5MA 4R9MA 1IIDA 2K5TA 3UY5A 2IL4A 2OZHA 4HKFA 4R87A 4B5PB 2R98A 2PSWA 4PSWA 2DXQA 1N71A 3ZZIA 4B5OA 1QSRA 4R57A 2WPWA 2J8NA 1NE9A 1IICA 3E0KA 4MY0A 1Y7RA 4RI1A 3VWEA 3PZJA 1YREA 4IF5A 2QIRA 4KORA 1XEBA 2B4BA 3JVNA 2X7BA 1XMTA 4PSXA 4X5KA 4KVXA 1YVKA 1QSNA 3R95A 4AVBA 4EVYA 3PP9A 4KUAA 4XPDB 2FSRA 1S60A 4NF1A 1RXTA 1S7FA 2VQYA 4IUSA 4J3GA 3EXNA 3TOAA 1I1DA 2I79A 5C82A 1P0HA 2P6FA 5HH1A 5J8FA 2PDOA 3R1KA 4KVOE 4CRYB 5C88A 3QB8A 1Q2YA 4M3SA 2G3AA 1LRZA 3CXQA 4HNXB 4KOSA 4MY3A 4OADA 1QSOA 2C27A 4MI4A 1U6MA 2PR8A 3D2PA 5DWMA 4JJXA 4KUBA 5H86A 1KUYA 2JEVA 4FD5A 4MJ8A 3DNSA 2OU2A 3R9GA 3H4QA 2R1IA 2VXKA 3FRMA 1M4DA 1YGHA 5GCNA 3PGPA 1FY7A 3C26A 2Q7BA 4QUSA 3IGRA 4KVME 4XNHC 4AVCA 5F46A 3LD2A 4AVAA 4E0AA 4XNHB 3SHPA 4Y49B 2B5GB 1K4JA 4U5YA 1BOBA 2AE6A 1QSTA 3TO9A 1M44A 2FS5A 3EY5A 2PR1A 2I00A 2REEA 4H6UA 1YK3A 3T90A 3TCVA 1B6BA 2FXFA 3P2FA 2Z0ZA 3JUWA 2B5GA 1CJWA 5F48A 2ZXVA 1VHSA 5KTDA 4L8AA 2VZZA 4NEXA 1S3ZA 4NXYA 2FE7A 3FXTA 4YFJA 3F8KA 4KOUA 3EFAA 2B4DB 3G8WA 4AB7A 4KZTA 2PRBA 2BSWA 3S6GA 3IWGA 3TO6A 1R57A 1S5KA 3W91A 3K9UA 3FBUA 1L0CA 3I9SA 2B3VA 2QMLA 2OZGA 2CNTA 2JDDA 2J8RA 3GKRA 3F0AA 3S6KA 4KOYA 5JQ4A 1NMTA 3F5BA 3TFYA 2OH1A 4OAEA 3CXPA 2QECA 2GE3A 2VI7A 4CAVA 1I21A 4QVTA 4H89A 4KOWA 1GHEA 4UWJA 3D2MA 2A4NA 2FIWA 2ARHA 3NE7A 1RO5A 2JDCA 1YLEA 3D3SA 4UBRA 2Q04A 3BJ7A 3MGDA 1Z9UA 1PUAA 5EBVA 4HNYB 1UFHA 4AG7A 5KTAA 4NCZA 2D4PA 3TTHA 5I0CA 1MJ9A 2P6EA 3TE4A 5ISVA 1WWZA 2BL1A 2JLMA 3OWCA 3I3GA 4JXRA 5JPHA 1TIQA 3FYNA 3S6HA 1MK4A 4H6ZA 3S6FA 4E8OA 4II9A 1WK4A 1M4GA 4JXQA 4GS4A 3GYAA 4NSQA 2PC1A 1Q2CA 4Y49C 4MHDA 4MBUA 2G3TA 3SXNA 3B8GA 4KOTA 2VZYA 2Q44A 4R3LA 2B58A 4M85A 2J8MA 3VWDA 3CXSA 4ORFA 5J8CA 4KOXA 5E96A 3ZJ0A 1P4NA 4L89A 3R96A 1Y9WA 4U9YA 1I12A 2B4DA 2HUZA 4DNCA 4ONUA 5F47A 3DSBA 1S7LA 2ZW6A 2ZPAA 3N7ZA 2Y0MA 3R9FA 2PQ8A 4JLYA 4CAXA 1PU9A 4F0YA 3TO7A 2WPXA 2Q0YA 4OLLA 3TT2A 5CNPA 4KLWA 2HV2A 4F6AA 5IX3A 5IV0A 4I49A 3FB3A 2ATRA 5EC4A 3GY9A 3EC4A 5DWNA 2Q4VA 2CY2A
chains in the Genus database with same CATH superfamily
4PK2A 3W6XA 4PK3A 1OZPA 5D8NA 2ZOGA 1XIXA 1OBRA 1XE4A 1Z5RA 3S9MA 3WT4A 1ELMP 1LFWA 2FT0A 2PCUA 4HNWB 3T9YA 2XEIA 2KCWA 4F8ZA 1Z8XA 4RS2A 3KI9A 1S7KA 4ZX8A 2EK9A 1R43A 2C1CA 1Q2DA 1LAPA 1NSLA 3FNCA 5IB0A 2ZEDA 4RN7A 3SXOA 3D8PA 4O23A 1CBXA 3B3CA 3R9EA 4FD7A 3FEEA 4XPLA 1Z4RA 3BI1A 4KSFA 2CXAA 4B5PA 3EO4A 4XPKA 1NSAA 5FVJA 3RO0A 2EUIA 2FIAA 3HLPA 3BJ8A 3DGVA 3IJ3A 4OC4A 4A38A 2CTCA 1Z4EA 3DR6A 3IWEA 1VGYA 3FMCA 4PV6A 2O53A 3I1UA 4IHMA 2ZEGA 2D4OA 1V0CA 3SJEA 4UCMA 4X2TA 4E2AA 1M1DA 2DF5A 2FCKA 3SI0A 5F49A 1LANA 3SJFA 1IOFA 3D4UA 3D7FA 2IQ6A 2VEZA 3B3WA 3DR8A 3V8IA 4YGOA 1DTDA 3KKWA 2O28A 2PJ4A 4FD6A 2P6GA 3BLNA 2GIVA 2P0WA 4CRZB 4RUHA 4B14A 1X10A 1YVOA 2FL4A 4LUAA 3W6SA 1VKCA 2BEIA 2AFZA 2WSAA 3CT9A 4CS0B 4OIDA 2Q4YA 3IC1A 3RYOA 4QC6A 4F0XA 1IYLA 3G3SA 2Z10A 4TWEA 2I3CA 4MFPA 1IB1E 2Z11A 2HQYA 2O4HA 3FF3A 4UFXA 3QAHA 3T8WA 4KSIA 5G20A 2G0BA 4XPDC 3V38A 2OZUA 2EBJA 3FIXA 2EVNA 2VBQA 3A9LA 4ZI6A 3DLJA 4A31A 4QB9A 1M4IA 2Q51A 2ZEPA 2GLJA 4MCPA 4FD4A 2NMTA 2PJ9A 4R76A 2C6CA 2ZW7A 1Y0RA 5HMNA 3FECA 4Q36A 1XFOA 4KLVA 4MRIA 2EO8A 3QNVA 3DDDA 4IK2A 4KSAA 2BUEA 4NGQA 5DS0A 4PPZA 4ZBGA 4QBJA 1VHOA 3IWWA 2VL1A 3D7HA 3KASA 2JEWA 3VATA 4R3KA 1IYKA 4KOVA 3B35A 3LODA 4CAWA 4YU9A 1YX0A 4AG9A 4UWIA 1BAVA 4LX9A 3D68A 1CM0A 4P44A 3H8GA 2ZOFA 3S9NA 2F5IA 3WR7A 2QJ8A 1KUXA 2GANA 4Q38A 2PVVA 3SI1A 4IAVA 4OC0A 1Z8WA 1SQHA 1MJBA 5AG6A 2Z3LA 4P10A 1XF8A 2Z3KA 1BO4A 2QYVA 1CG2A 2ZW5A 3PBBA 1ELLP 4BMHA 6CPAA 2XEJA 1ZG8A 2REFA 5KTCA 1TF8A 1RTQA 4JD6A 1Z8LA 4K30A 4JZ0A 3P2HA 4R8FA 2CNMA 2XEGA 2R8VA 1J4JA 1ON0A 5K8MA 1KUVA 2PJ3A 4YRHA 2B3UA 4NJQA 4CYNA 4UA3A 4JWPA 1Y9KA 2AFUA 3TOBA 3KR5A 2ZW4A 1MJAA 2OR4A 2C6GA 4UCNA 4U9ZA 1QSMA 5H84A 2AJ6A 4A2ZA 3D66A 3ISZA 4F9UA 1KZFA 2OB0A 2ZEHA 2ODFA 1S7NA 1YR0A 3QAYA 4G1PA 2R7HA 4P4IA 4X3RA 1B87A 4NGMA 3GUXA 2CNSA 2RC4A 2H5MA 1HDUA 4R9MA 4FAIA 1IIDA 1YMEA 4A37A 2K5TA 3UY5A 5I4MA 5IB9A 2IL4A 3CZXA 4HPSA 5LYLA 2PJCA 2OZHA 4HKFA 1AUGA 4OC5A 4R87A 2Z3PA 2Z3OA 4B5PB 2R98A 2PSWA 1LCPA 3CPXA 1HEEA 4PSWA 2DXQA 4PXCA 1UWYA 4ZY2A 2ZEFA 5LYDA 1N71A 4CGLA 5F09A 1BLLE 3ZZIA 4B5OA 5HVGA 2QVPA 1IU8A 1TKFA 1QSRA 4MFLA 4PXBA 2AFMA 4R57A 3D7DA 4DUKA 2WPWA 5JM6A 2J8NA 3WC7A 4C7HA 1NE9A 4CYOA 4M6HA 2HB6A 1IICA 3VH9A 3IIBA 4ONWA 5LYIA 3E0KA 3PB8X 4BBHA 3B7IA 4M6GA 2PJ0A 4MFJA 2AFOA 4MY0A 1Y7RA 3B3SA 1HDQA 4RI1A 3PZJA 1YREA 5AG7A 3VWEA 5K8OA 4IF5A 2QIRA 4KORA 1XEBA 2CIJA 2B4BA 3JVNA 3K2KA 2X7BA 1XMTA 4PSXA 2Q7SA 1YW4A 4X5KA 5LRJA 4KVXA 1YVKA 1QSNA 3H8EA 1Z2LA 4NGTA 4P45A 1M4LA 4LQGA 3R95A 1XJOA 4AVBA 4EVYA 3PP9A 2V8DA 4KUAA 4XPDB 2FSRA 3CPAA 1S60A 4NF1A 2ZEOA 1RXTA 1S7FA 3BI0A 3GLJA 2VQYA 3IFEA 1PCAA 4IUSA 1VHEA 1F2PA 4J3GA 4UFVA 4UF4A 3EXNA 3PFEA 4P4JA 3RAMA 2GU2A 3TOAA 1I1DA 2I79A 2JBJA 5G22A 1QQ9A 4A30A 4B11A 3IU1A 2YNCA 4MFZA 4ZY0A 5C82A 4ZY1A 1P0HA 1CP6A 2PJ2A 2P6FA 1TXRA 3GB0A 2ZEEA 5HH1A 1R3NA 5J8FA 2PDOA 2V8GA 2ANPA 3R1KA 4KVOE 2G9DA 5A28A 4A39A 1LOKA 3NH4A 4CRYB 5C88A 2BO9A 2PJBA 2ZELA 3D7GA 3QB8A 1Q2YA 4M3SA 2G3AA 1LRZA 3CXQA 4HNXB 3GIUA 3NH8A 4KOSA 4MY3A 4OADA 1QSOA 4A32A 2C27A 1TKJA 4EFDA 3N5FA 1U6MA 2PR8A 4MI4A 1ZLHA 2POKA 3PRTA 3D2PA 4BINA 3BXMA 3JRUA 3SJXA 5DWMA 4JJXA 4KUBA 5H86A 1F57A 1KUYA 4MCRA 3H5ZA 4CYPA 2JBKA 2JEVA 4FD5A 4MJ8A 4X8IA 1Y0YA 2GREA 3DNSA 4M6IA 1XOVA 2OU2A 3R9GA 1BPMA 3H8FA 4C2YA 3H4QA 2R1IA 2Q4ZA 2VXKA 3K9TA 4OKOA 5JH9A 3FRMA 1M4DA 2PRQA 4P4DA 4BD9A 4MMOA 1YGHA 3NA6A 5GCNA 3PGPA 4P4FA 2WZNA 1FY7A 3C26A 4NGSA 1PYTB 4P6YA 2Q7BA 1JWQA 3IGRA 4QUSA 4KVME 4XNHC 2ABZA 2NSMA 1IGBA 4AVCA 4B10A 1EE3P 1BPNA 4B12A 5F46A 4C68A 1ARLA 3LD2A 4CGMA 5AGEA 4AVAA 3KQXA 4E0AA 3WC5A 3PB4X 4XNHB 3SHPA 5BWAB 2CTBA 4Y49B 5D29A 3MRUA 2B5GB 1K4JA 2V8HA 4P4BA 1BOBA 4TNUA 4U5YA 2AE6A 1QSTA 1XBUA 3TO9A 1M44A 2FS5A 3RNZA 4EWTA 3EY5A 4AXVA 1TKHA 2GFQA 2PR1A 2I00A 4MCQA 5LRGA 1YSJA 2PVWA 3FEDA 2REEA 5HVHA 4H6UA 4MHZA 1YK3A 3T90A 3TCVA 3MN8A 1B6BA 2FXFA 3P2FA 1GYTA 4C2ZA 2WUUA 2Z0ZA 3PEIA 2Z3NA 2DPTA 3JUWA 2B5GA 5EMIA 1CJWA 1IOIA 4MFQA 3BHXA 1ZG9A 2ZXVA 3PFOA 1VHSA 1ZLIA 2GLFA 2PJ6A 4UEEA 3IEHA 4CGOA 5KTDA 3B3TA 3WC6A 4F9VA 4FUUA 4L8AA 4P4EA 2VZZA 2PJ5A 3D67A 1S3ZA 4NEXA 4NFRA 4NXYA 2YNCC 2FE7A 3FXTA 4YFJA 3VARA 1F2OA 3F8KA 2PJAA 4KOUA 3PB6X 4CAEA 1IY7A 2ZEMA 3EFAA 2B4DB 2EWBA 3PBEA 4CYQA 3G8WA 3LACA 2V8VA 4AB7A 3S9LA 4KZTA 2PRBA 2BSWA 3S6GA 1JQGA 1YQEA 1ZO0A 3IWGA 4OIWA 4B13A 4KS9A 4UFWA 1TF9A 1R57A 3TO6A 1KWMA 2YNEA 1S5KA 3W91A 4GM5A 3K9UA 2F8HA 3FBUA 4UEFA 4CGNA 1L0CA 3I9SA 2B3VA 2QMLA 2OZGA 2CNTA 2JDDA 5AG5A 3KQZA 4ZX9A 3ISXA 2YGWA 2J8RA 3GKRA 4W9YA 3F0AA 3S6KA 4KOYA 3FH4A 3RZAA 5JQ4A 2Q43A 1H8LA 1NMTA 3F5BA 4R7MA 5LYFA 3TFYA 2OH1A 1VIXA 4MFKA 5THWA 4OAEA 3CXPA 1Y7EA 1CP7A 1QMUA 5LRKA 2PJ1A 2DEAA 2QECA 2GE3A 1DE4C 2V77A 4CGPA 1XMBA 2VI7A 3V7ZA 4CAVA 1I21A 2BOAA 3IU2A 4OC2A 4B6ZA 4QVTA 1Q7LA 4Z65A 4H89A 3B2YA 3KZWA 4KOWA 4MXUA 3CDXA 1ARMA 4OMEA 1GHEA 4UWJA 3D2MA 2A4NA 2FIWA 5HXDA 2ARHA 3NE7A 4WWVA 1RO5A 4NGPA 2FVGA 2JDCA 3FX6A 4C7IA 2ZENA 1YLEA 7CPAA 2AFXA 3D3SA 4UBRA 2Q04A 3BJ7A 3MGDA 4OC1A 4MHYA 2BCOA 1Z9UA 1PUAA 5EBVA 4HNYB 1UFHA 3IO1A 3TC8A 4AG7A 4H2KA 4CAFA 2PIYA 1FNOA 3LWUA 2PIZA 5KTAA 4NCZA 2D4PA 1CX8A 4MHPA 1MJ9A 3TTHA 3KHZA 5I0CA 4PXDA 2PJ8A 2P6EA 2RB7A 3TE4A 4C2XA 5ISVA 5K8NA 1FT7A 1WWZA 4DJLA 2BL1A 3B3VA 2JLMA 4EMEA 2NYQA 3OWCA 3I3GA 4JXRA 5J1QA 3RBUA 3KL9A 3SI2A 8CPAA 5JPHA 5G21A 3KGQA 1TIQA 3PB7X 1AYEA 1YLOA 3FYNA 3S6HA 1MK4A 4H6ZA 4JYWA 3S6FA 3SJGA 4E8OA 5CPAA 4II9A 2IMOA 3NFZA 4R6TA 1WK4A 4NJRA 1M4GA 4JXQA 5A27A 4GS4A 3GYAA 2CF4A 4NSQA 4MHNA 2C6PA 2PC1A 1Q2CA 4MCSA 3JTKA 1CPSA 4NGNA 5ELYA 5CBMA 1AMPA 2AFSA 4Y49C 3WABA 4MHDA 4A94A 2J9AA 3KR4A 1ZG7A 4MBUA 2PE3A 4A95A 5JGFA 2G3TA 5K8PA 3SXNA 3B8GA 4KOTA 2VZYA 4WJBA 5F48A 3NH5A 2PJ7A 2Q44A 4FWUA 3L2NA 4R3LA 2B58A 4M85A 4UCPA 2J8MA 4FBEA 1A2ZA 3VWDA 1CPXA 3CXSA 4ORFA 1X12A 1Z8TA 5J8CA 4KOXA 2IJZA 5E96A 3PB9X 1XRYA 2DPSA 3ZJ0A 2OOTA 1YW6A 1P4NA 4L89A 5G1ZA 4ZYQA 3R96A 1Y9WA 4U9YA 4LQ6A 2Z3MA 2AFWA 1I12A 2B4DA 5HVFA 3TX8A 4DYOA 3FJUA 2HUZA 4DNCA 4ONUA 3LMSA 2RFHA 5F47A 3DSBA 3HUVA 1S7LA 2ZW6A 4K3NA 2ZPAA 3N7ZA 2Y0MA 2EK8A 2PQ8A 4JLYA 3R9FA 4ZGYB 2WYRA 4CAXA 1PU9A 2YNDA 4NGRA 4F0YA 2HC9A 3KHXA 3NE8A 4UEZA 3TO7A 2WPXA 2F7VA 2Q0YA 4OLLA 1LAMA 3TT2A 5CNPA 4OC3A 4A33A 4KLWA 2HV2A 4F6AA 4PQAA 4Q7AA 5AG4A 5IX3A 5IV0A 4I49A 3FB3A 3FVLA 4PXEA 4UIBA 4CPAA 2ATRA 4UIAA 2XEFA 4GXHA 3GY9A 5EC4A 4YWYA 4OP4A 3EC4A 5DWNA 2Q4VA 2CY2A
chains in the Genus database with same CATH topology
4PK2A 3W6XA 4PK3A 1OZPA 1XIXA 1XE4A 4HNWB 2FT0A 3T9YA 2KCWA 4RS2A 1S7KA 1Q2DA 1NSLA 3FNCA 5IB0A 3SXOA 3D8PA 3R9EA 4FD7A 4XPLA 1Z4RA 4KSFA 2CXAA 4B5PA 3EO4A 4XPKA 5FVJA 2EUIA 2FIAA 3BJ8A 3DR6A 1Z4EA 3IWEA 4PV6A 2D4OA 1V0CA 4UCMA 4E2AA 1M1DA 2FCKA 5F49A 3DR8A 2VEZA 3V8IA 4YGOA 3KKWA 2O28A 4FD6A 2P6GA 3BLNA 2GIVA 2P0WA 4CRZB 4B14A 1YVOA 2FL4A 4LUAA 3W6SA 1VKCA 2BEIA 2WSAA 4CS0B 2Q4YA 3RYOA 4QC6A 4F0XA 1IYLA 3G3SA 2Z10A 4MFPA 1IB1E 2Z11A 2HQYA 4UFXA 3QAHA 5G20A 2G0BA 4XPDC 2OZUA 3FIXA 2EVNA 2VBQA 3A9LA 4A31A 4QB9A 1M4IA 4FD4A 2NMTA 2ZW7A 5HMNA 4Q36A 4KLVA 3DDDA 4KSAA 2BUEA 4ZBGA 4QBJA 4R3KA 1IYKA 4KOVA 3LODA 4CAWA 1YX0A 4AG9A 4UWIA 4LX9A 1CM0A 2F5IA 3WR7A 1KUXA 2GANA 4Q38A 1SQHA 1MJBA 5AG6A 2Z3LA 1XF8A 2Z3KA 1BO4A 2ZW5A 4BMHA 2REFA 5KTCA 4JD6A 4K30A 3P2HA 2CNMA 2R8VA 1J4JA 1ON0A 1KUVA 4YRHA 2B3UA 4CYNA 4UA3A 4JWPA 1Y9KA 3TOBA 2ZW4A 1MJAA 4UCNA 4U9ZA 1QSMA 5H84A 2AJ6A 4A2ZA 1KZFA 2OB0A 1S7NA 1YR0A 2R7HA 1B87A 2CNSA 2RC4A 2H5MA 4R9MA 1IIDA 2K5TA 3UY5A 2IL4A 2OZHA 4HKFA 4R87A 2Z3PA 2Z3OA 4B5PB 2R98A 2PSWA 4PSWA 2DXQA 4CGLA 1N71A 3ZZIA 4B5OA 1QSRA 4MFLA 4R57A 2WPWA 2J8NA 4C7HA 1NE9A 4CYOA 1IICA 3E0KA 4BBHA 4MFJA 4MY0A 1Y7RA 4RI1A 3VWEA 3PZJA 1YREA 5AG7A 4IF5A 2QIRA 4KORA 1XEBA 2B4BA 3JVNA 2X7BA 1XMTA 4PSXA 4X5KA 4KVXA 1YVKA 1QSNA 3R95A 4AVBA 4EVYA 3PP9A 4KUAA 4XPDB 2FSRA 1S60A 4NF1A 1RXTA 1S7FA 2VQYA 4IUSA 4J3GA 4UFVA 3EXNA 3TOAA 1I1DA 2I79A 5G22A 4A30A 4B11A 3IU1A 2YNCA 4MFZA 5C82A 1P0HA 2P6FA 5HH1A 5J8FA 2PDOA 3R1KA 4KVOE 5A28A 4CRYB 5C88A 3QB8A 1Q2YA 4M3SA 2G3AA 1LRZA 3CXQA 4HNXB 4KOSA 4MY3A 4OADA 1QSOA 4A32A 2C27A 4MI4A 1U6MA 2PR8A 3D2PA 5DWMA 4JJXA 4KUBA 5H86A 1KUYA 3H5ZA 4CYPA 2JEVA 4FD5A 4MJ8A 3DNSA 2OU2A 3R9GA 4C2YA 3H4QA 2R1IA 2VXKA 3FRMA 1M4DA 1YGHA 5GCNA 3PGPA 1FY7A 3C26A 2Q7BA 4QUSA 3IGRA 4KVME 4XNHC 4AVCA 4B10A 4B12A 5F46A 4C68A 3LD2A 4CGMA 5AGEA 4AVAA 4E0AA 4XNHB 3SHPA 5BWAB 4Y49B 2B5GB 1K4JA 1BOBA 4U5YA 2AE6A 1QSTA 3TO9A 1M44A 2FS5A 3EY5A 2PR1A 2I00A 2REEA 4H6UA 1YK3A 3T90A 3TCVA 1B6BA 2FXFA 3P2FA 4C2ZA 2WUUA 2Z0ZA 2Z3NA 2DPTA 3JUWA 2B5GA 1CJWA 4MFQA 5F48A 2ZXVA 1VHSA 5KTDA 4CGOA 4L8AA 2VZZA 4NEXA 1S3ZA 4NXYA 2YNCC 2FE7A 3FXTA 4YFJA 3F8KA 4CAEA 4KOUA 3EFAA 2B4DB 4CYQA 3G8WA 4AB7A 4KZTA 2PRBA 2BSWA 3S6GA 1ZO0A 3IWGA 4B13A 4KS9A 4UFWA 3TO6A 1R57A 2YNEA 1S5KA 3W91A 3K9UA 3FBUA 4CGNA 1L0CA 3I9SA 2B3VA 2QMLA 2OZGA 2CNTA 2JDDA 5AG5A 2YGWA 2J8RA 3GKRA 3F0AA 3S6KA 4KOYA 5JQ4A 1NMTA 3F5BA 3TFYA 2OH1A 4MFKA 4OAEA 3CXPA 2QECA 2GE3A 4CGPA 2VI7A 4CAVA 1I21A 3IU2A 4QVTA 4H89A 4KOWA 1GHEA 4UWJA 3D2MA 2A4NA 2FIWA 2ARHA 3NE7A 1RO5A 2JDCA 4C7IA 1YLEA 3D3SA 4UBRA 2Q04A 3BJ7A 3MGDA 1Z9UA 1PUAA 5EBVA 4HNYB 1UFHA 4AG7A 4CAFA 5KTAA 4NCZA 2D4PA 3TTHA 5I0CA 1MJ9A 2P6EA 3TE4A 4C2XA 5ISVA 1WWZA 2BL1A 2JLMA 3OWCA 3I3GA 4JXRA 5JPHA 5G21A 1TIQA 3FYNA 3S6HA 1MK4A 4H6ZA 3S6FA 4E8OA 4II9A 1WK4A 1M4GA 4JXQA 5A27A 4GS4A 3GYAA 4NSQA 2PC1A 1Q2CA 3JTKA 4Y49C 4MHDA 4MBUA 4A95A 2G3TA 3SXNA 3B8GA 4KOTA 2VZYA 2Q44A 4R3LA 2B58A 4M85A 4UCPA 2J8MA 3VWDA 3CXSA 4ORFA 5J8CA 4KOXA 5E96A 2DPSA 3ZJ0A 1P4NA 4L89A 5G1ZA 3R96A 1Y9WA 4U9YA 2Z3MA 1I12A 2B4DA 2HUZA 4DNCA 4ONUA 5F47A 3DSBA 1S7LA 2ZW6A 2ZPAA 3N7ZA 2Y0MA 3R9FA 2PQ8A 4JLYA 4ZGYB 4CAXA 1PU9A 2YNDA 4F0YA 3TO7A 2WPXA 2Q0YA 4OLLA 3TT2A 5CNPA 4A33A 4KLWA 2HV2A 4F6AA 5IX3A 5IV0A 5AG4A 4I49A 3FB3A 2ATRA 5EC4A 3GY9A 3EC4A 5DWNA 2Q4VA 2CY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PK2 A;  3W6X A;  4PK3 A;  1OZP A;  1XIX A;  1XE4 A;  4HNW B;  2FT0 A;  3T9Y A;  2KCW A;  4RS2 A;  1S7K A;  1Q2D A;  1NSL A;  3FNC A;  5IB0 A;  3SXO A;  3D8P A;  3R9E A;  4FD7 A;  4XPL A;  1Z4R A;  4B5P A;  3EO4 A;  4XPK A;  5FVJ A;  2EUI A;  2FIA A;  3BJ8 A;  3DR6 A;  1Z4E A;  4PV6 A;  2D4O A;  1V0C A;  4E2A A;  1M1D A;  2FCK A;  5F49 A;  3DR8 A;  2VEZ A;  3V8I A;  4YGO A;  3KKW A;  2O28 A;  4FD6 A;  2P6G A;  3BLN A;  2GIV A;  2P0W A;  4CRZ B;  1YVO A;  2FL4 A;  4LUA A;  3W6S A;  1VKC A;  2BEI A;  4CS0 B;  2Q4Y A;  3RYO A;  4QC6 A;  1IYL A;  3G3S A;  2Z10 A;  1IB1 E;  2Z11 A;  2HQY A;  3QAH A;  2G0B A;  4XPD C;  2OZU A;  3FIX A;  2EVN A;  2VBQ A;  4QB9 A;  1M4I A;  4FD4 A;  2NMT A;  2ZW7 A;  5HMN A;  4KLV A;  3DDD A;  2BUE A;  4ZBG A;  4QBJ A;  4R3K A;  1IYK A;  4KOV A;  3LOD A;  4CAW A;  1YX0 A;  4AG9 A;  4UWI A;  4LX9 A;  1CM0 A;  2F5I A;  3WR7 A;  1KUX A;  2GAN A;  1SQH A;  1MJB A;  1XF8 A;  1BO4 A;  2ZW5 A;  4BMH A;  2REF A;  5KTC A;  4JD6 A;  4K30 A;  3P2H A;  2CNM A;  2R8V A;  1J4J A;  1ON0 A;  1KUV A;  4YRH A;  2B3U A;  4UA3 A;  4JWP A;  1Y9K A;  3TOB A;  2ZW4 A;  1MJA A;  5H84 A;  4U9Z A;  1QSM A;  2AJ6 A;  1KZF A;  2OB0 A;  1S7N A;  1YR0 A;  2R7H A;  1B87 A;  2CNS A;  2RC4 A;  2H5M A;  4R9M A;  1IID A;  2K5T A;  3UY5 A;  2IL4 A;  2OZH A;  4HKF A;  4R87 A;  4B5P B;  2R98 A;  2PSW A;  4PSW A;  2DXQ A;  1N71 A;  3ZZI A;  4B5O A;  1QSR A;  4R57 A;  2WPW A;  2J8N A;  1NE9 A;  1IIC A;  3E0K A;  4MY0 A;  1Y7R A;  4RI1 A;  3VWE A;  3PZJ A;  1YRE A;  4IF5 A;  2QIR A;  4KOR A;  1XEB A;  2B4B A;  3JVN A;  2X7B A;  1XMT A;  4PSX A;  4X5K A;  4KVX A;  1YVK A;  1QSN A;  3R95 A;  4AVB A;  4EVY A;  3PP9 A;  4KUA A;  4XPD B;  2FSR A;  1S60 A;  4NF1 A;  1RXT A;  1S7F A;  2VQY A;  4IUS A;  4J3G A;  3EXN A;  3TOA A;  1I1D A;  2I79 A;  5C82 A;  1P0H A;  2P6F A;  5HH1 A;  5J8F A;  2PDO A;  3R1K A;  4KVO E;  4CRY B;  5C88 A;  3QB8 A;  1Q2Y A;  4M3S A;  2G3A A;  1LRZ A;  3CXQ A;  4HNX B;  4KOS A;  4MY3 A;  4OAD A;  1QSO A;  2C27 A;  4MI4 A;  1U6M A;  2PR8 A;  3D2P A;  5DWM A;  4JJX A;  4KUB A;  5H86 A;  1KUY A;  2JEV A;  4FD5 A;  4MJ8 A;  3DNS A;  2OU2 A;  3R9G A;  3H4Q A;  2R1I A;  2VXK A;  3FRM A;  1M4D A;  1YGH A;  5GCN A;  3PGP A;  1FY7 A;  3C26 A;  2Q7B A;  4QUS A;  3IGR A;  4KVM E;  4XNH C;  4AVC A;  5F46 A;  3LD2 A;  4AVA A;  4E0A A;  4XNH B;  3SHP A;  4Y49 B;  2B5G B;  1K4J A;  4U5Y A;  1BOB A;  2AE6 A;  1QST A;  3TO9 A;  1M44 A;  2FS5 A;  3EY5 A;  2PR1 A;  2I00 A;  2REE A;  4H6U A;  1YK3 A;  3T90 A;  3TCV A;  1B6B A;  2FXF A;  3P2F A;  2Z0Z A;  3JUW A;  2B5G A;  1CJW A;  5F48 A;  2ZXV A;  1VHS A;  5KTD A;  4L8A A;  2VZZ A;  4NEX A;  1S3Z A;  4NXY A;  2FE7 A;  3FXT A;  4YFJ A;  3F8K A;  4KOU A;  3EFA A;  2B4D B;  3G8W A;  4AB7 A;  4KZT A;  2PRB A;  2BSW A;  3S6G A;  3IWG A;  3TO6 A;  1R57 A;  1S5K A;  3W91 A;  3K9U A;  3FBU A;  1L0C A;  3I9S A;  2B3V A;  2QML A;  2OZG A;  2CNT A;  2JDD A;  2J8R A;  3GKR A;  3F0A A;  3S6K A;  4KOY A;  5JQ4 A;  1NMT A;  3F5B A;  3TFY A;  2OH1 A;  4OAE A;  3CXP A;  2QEC A;  2GE3 A;  2VI7 A;  4CAV A;  1I21 A;  4QVT A;  4H89 A;  4KOW A;  1GHE A;  4UWJ A;  3D2M A;  2A4N A;  2FIW A;  2ARH A;  3NE7 A;  1RO5 A;  2JDC A;  1YLE A;  3D3S A;  4UBR A;  2Q04 A;  3BJ7 A;  3MGD A;  1Z9U A;  1PUA A;  5EBV A;  4HNY B;  1UFH A;  4AG7 A;  5KTA A;  4NCZ A;  2D4P A;  3TTH A;  5I0C A;  1MJ9 A;  2P6E A;  3TE4 A;  5ISV A;  1WWZ A;  2BL1 A;  2JLM A;  3OWC A;  3I3G A;  4JXR A;  5JPH A;  1TIQ A;  3FYN A;  3S6H A;  1MK4 A;  4H6Z A;  3S6F A;  4E8O A;  4II9 A;  1WK4 A;  1M4G A;  4JXQ A;  4GS4 A;  3GYA A;  4NSQ A;  2PC1 A;  1Q2C A;  4Y49 C;  4MHD A;  4MBU A;  2G3T A;  3SXN A;  3B8G A;  4KOT A;  2VZY A;  2Q44 A;  4R3L A;  2B58 A;  4M85 A;  2J8M A;  3VWD A;  3CXS A;  4ORF A;  5J8C A;  4KOX A;  5E96 A;  3ZJ0 A;  1P4N A;  4L89 A;  3R96 A;  1Y9W A;  4U9Y A;  1I12 A;  2B4D A;  2HUZ A;  4DNC A;  4ONU A;  5F47 A;  3DSB A;  1S7L A;  2ZW6 A;  2ZPA A;  3N7Z A;  2Y0M A;  3R9F A;  2PQ8 A;  4JLY A;  4CAX A;  1PU9 A;  4F0Y A;  3TO7 A;  2WPX A;  2Q0Y A;  4OLL A;  3TT2 A;  5CNP A;  4KLW A;  2HV2 A;  4F6A A;  5IX3 A;  5IV0 A;  4I49 A;  3FB3 A;  2ATR A;  5EC4 A;  3GY9 A;  3EC4 A;  5DWN A;  2Q4V A;  2CY2 A; 
#chains in the Genus database with same CATH topology
 4PK2 A;  3W6X A;  4PK3 A;  1OZP A;  5D8N A;  2ZOG A;  1XIX A;  1OBR A;  1XE4 A;  1Z5R A;  3S9M A;  3WT4 A;  1ELM P;  1LFW A;  2FT0 A;  2PCU A;  4HNW B;  3T9Y A;  2XEI A;  2KCW A;  4F8Z A;  1Z8X A;  4RS2 A;  3KI9 A;  1S7K A;  4ZX8 A;  2EK9 A;  1R43 A;  2C1C A;  1Q2D A;  1LAP A;  1NSL A;  3FNC A;  5IB0 A;  2ZED A;  4RN7 A;  3SXO A;  3D8P A;  4O23 A;  1CBX A;  3B3C A;  3R9E A;  4FD7 A;  3FEE A;  4XPL A;  1Z4R A;  3BI1 A;  4KSF A;  2CXA A;  4B5P A;  3EO4 A;  4XPK A;  1NSA A;  5FVJ A;  3RO0 A;  2EUI A;  2FIA A;  3HLP A;  3BJ8 A;  3DGV A;  3IJ3 A;  4OC4 A;  4A38 A;  2CTC A;  1Z4E A;  3DR6 A;  3IWE A;  1VGY A;  3FMC A;  4PV6 A;  2O53 A;  3I1U A;  4IHM A;  2ZEG A;  2D4O A;  1V0C A;  3SJE A;  4UCM A;  4X2T A;  4E2A A;  1M1D A;  2DF5 A;  2FCK A;  3SI0 A;  5F49 A;  1LAN A;  3SJF A;  1IOF A;  3D4U A;  3D7F A;  2IQ6 A;  2VEZ A;  3B3W A;  3DR8 A;  3V8I A;  4YGO A;  1DTD A;  3KKW A;  2O28 A;  2PJ4 A;  4FD6 A;  2P6G A;  3BLN A;  2GIV A;  2P0W A;  4CRZ B;  4RUH A;  4B14 A;  1X10 A;  1YVO A;  2FL4 A;  4LUA A;  3W6S A;  1VKC A;  2BEI A;  2AFZ A;  2WSA A;  3CT9 A;  4CS0 B;  4OID A;  2Q4Y A;  3IC1 A;  3RYO A;  4QC6 A;  4F0X A;  1IYL A;  3G3S A;  2Z10 A;  4TWE A;  2I3C A;  4MFP A;  1IB1 E;  2Z11 A;  2HQY A;  2O4H A;  3FF3 A;  4UFX A;  3QAH A;  3T8W A;  4KSI A;  5G20 A;  2G0B A;  4XPD C;  3V38 A;  2OZU A;  2EBJ A;  3FIX A;  2EVN A;  2VBQ A;  3A9L A;  4ZI6 A;  3DLJ A;  4A31 A;  4QB9 A;  1M4I A;  2Q51 A;  2ZEP A;  2GLJ A;  4MCP A;  4FD4 A;  2NMT A;  2PJ9 A;  4R76 A;  2C6C A;  2ZW7 A;  1Y0R A;  5HMN A;  3FEC A;  4Q36 A;  1XFO A;  4KLV A;  4MRI A;  2EO8 A;  3QNV A;  3DDD A;  4IK2 A;  4KSA A;  2BUE A;  4NGQ A;  5DS0 A;  4PPZ A;  4ZBG A;  4QBJ A;  1VHO A;  3IWW A;  2VL1 A;  3D7H A;  3KAS A;  2JEW A;  3VAT A;  4R3K A;  1IYK A;  4KOV A;  3B35 A;  3LOD A;  4CAW A;  4YU9 A;  1YX0 A;  4AG9 A;  4UWI A;  1BAV A;  4LX9 A;  3D68 A;  1CM0 A;  4P44 A;  3H8G A;  2ZOF A;  3S9N A;  2F5I A;  3WR7 A;  2QJ8 A;  1KUX A;  2GAN A;  4Q38 A;  2PVV A;  3SI1 A;  4IAV A;  4OC0 A;  1Z8W A;  1SQH A;  1MJB A;  5AG6 A;  2Z3L A;  4P10 A;  1XF8 A;  2Z3K A;  1BO4 A;  2QYV A;  1CG2 A;  2ZW5 A;  3PBB A;  1ELL P;  4BMH A;  6CPA A;  2XEJ A;  1ZG8 A;  2REF A;  5KTC A;  1TF8 A;  1RTQ A;  4JD6 A;  1Z8L A;  4K30 A;  4JZ0 A;  3P2H A;  4R8F A;  2CNM A;  2XEG A;  2R8V A;  1J4J A;  1ON0 A;  5K8M A;  1KUV A;  2PJ3 A;  4YRH A;  2B3U A;  4NJQ A;  4CYN A;  4UA3 A;  4JWP A;  1Y9K A;  2AFU A;  3TOB A;  3KR5 A;  2ZW4 A;  1MJA A;  2OR4 A;  2C6G A;  4UCN A;  4U9Z A;  1QSM A;  5H84 A;  2AJ6 A;  4A2Z A;  3D66 A;  3ISZ A;  4F9U A;  1KZF A;  2OB0 A;  2ZEH A;  2ODF A;  1S7N A;  1YR0 A;  3QAY A;  4G1P A;  2R7H A;  4P4I A;  4X3R A;  1B87 A;  4NGM A;  3GUX A;  2CNS A;  2RC4 A;  2H5M A;  1HDU A;  4R9M A;  4FAI A;  1IID A;  1YME A;  4A37 A;  2K5T A;  3UY5 A;  5I4M A;  5IB9 A;  2IL4 A;  3CZX A;  4HPS A;  5LYL A;  2PJC A;  2OZH A;  4HKF A;  1AUG A;  4OC5 A;  4R87 A;  2Z3P A;  2Z3O A;  4B5P B;  2R98 A;  2PSW A;  1LCP A;  3CPX A;  1HEE A;  4PSW A;  2DXQ A;  4PXC A;  1UWY A;  4ZY2 A;  2ZEF A;  5LYD A;  1N71 A;  4CGL A;  5F09 A;  1BLL E;  3ZZI A;  4B5O A;  5HVG A;  2QVP A;  1IU8 A;  1TKF A;  1QSR A;  4MFL A;  4PXB A;  2AFM A;  4R57 A;  3D7D A;  4DUK A;  2WPW A;  5JM6 A;  2J8N A;  3WC7 A;  4C7H A;  1NE9 A;  4CYO A;  4M6H A;  2HB6 A;  1IIC A;  3VH9 A;  3IIB A;  4ONW A;  5LYI A;  3E0K A;  3PB8 X;  4BBH A;  3B7I A;  4M6G A;  2PJ0 A;  4MFJ A;  2AFO A;  4MY0 A;  1Y7R A;  3B3S A;  1HDQ A;  4RI1 A;  3PZJ A;  1YRE A;  5AG7 A;  3VWE A;  5K8O A;  4IF5 A;  2QIR A;  4KOR A;  1XEB A;  2CIJ A;  2B4B A;  3JVN A;  3K2K A;  2X7B A;  1XMT A;  4PSX A;  2Q7S A;  1YW4 A;  4X5K A;  5LRJ A;  4KVX A;  1YVK A;  1QSN A;  3H8E A;  1Z2L A;  4NGT A;  4P45 A;  1M4L A;  4LQG A;  3R95 A;  1XJO A;  4AVB A;  4EVY A;  3PP9 A;  2V8D A;  4KUA A;  4XPD B;  2FSR A;  3CPA A;  1S60 A;  4NF1 A;  2ZEO A;  1RXT A;  1S7F A;  3BI0 A;  3GLJ A;  2VQY A;  3IFE A;  1PCA A;  4IUS A;  1VHE A;  1F2P A;  4J3G A;  4UFV A;  4UF4 A;  3EXN A;  3PFE A;  4P4J A;  3RAM A;  2GU2 A;  3TOA A;  1I1D A;  2I79 A;  2JBJ A;  5G22 A;  1QQ9 A;  4A30 A;  4B11 A;  3IU1 A;  2YNC A;  4MFZ A;  4ZY0 A;  5C82 A;  4ZY1 A;  1P0H A;  1CP6 A;  2PJ2 A;  2P6F A;  1TXR A;  3GB0 A;  2ZEE A;  5HH1 A;  1R3N A;  5J8F A;  2PDO A;  2V8G A;  2ANP A;  3R1K A;  4KVO E;  2G9D A;  5A28 A;  4A39 A;  1LOK A;  3NH4 A;  4CRY B;  5C88 A;  2BO9 A;  2PJB A;  2ZEL A;  3D7G A;  3QB8 A;  1Q2Y A;  4M3S A;  2G3A A;  1LRZ A;  3CXQ A;  4HNX B;  3GIU A;  3NH8 A;  4KOS A;  4MY3 A;  4OAD A;  1QSO A;  4A32 A;  2C27 A;  1TKJ A;  4EFD A;  3N5F A;  1U6M A;  2PR8 A;  4MI4 A;  1ZLH A;  2POK A;  3PRT A;  3D2P A;  4BIN A;  3BXM A;  3JRU A;  3SJX A;  5DWM A;  4JJX A;  4KUB A;  5H86 A;  1F57 A;  1KUY A;  4MCR A;  3H5Z A;  4CYP A;  2JBK A;  2JEV A;  4FD5 A;  4MJ8 A;  4X8I A;  1Y0Y A;  2GRE A;  3DNS A;  4M6I A;  1XOV A;  2OU2 A;  3R9G A;  1BPM A;  3H8F A;  4C2Y A;  3H4Q A;  2R1I A;  2Q4Z A;  2VXK A;  3K9T A;  4OKO A;  5JH9 A;  3FRM A;  1M4D A;  2PRQ A;  4P4D A;  4BD9 A;  4MMO A;  1YGH A;  3NA6 A;  5GCN A;  3PGP A;  4P4F A;  2WZN A;  1FY7 A;  3C26 A;  4NGS A;  1PYT B;  4P6Y A;  2Q7B A;  1JWQ A;  3IGR A;  4QUS A;  4KVM E;  4XNH C;  2ABZ A;  2NSM A;  1IGB A;  4AVC A;  4B10 A;  1EE3 P;  1BPN A;  4B12 A;  5F46 A;  4C68 A;  1ARL A;  3LD2 A;  4CGM A;  5AGE A;  4AVA A;  3KQX A;  4E0A A;  3WC5 A;  3PB4 X;  4XNH B;  3SHP A;  5BWA B;  2CTB A;  4Y49 B;  5D29 A;  3MRU A;  2B5G B;  1K4J A;  2V8H A;  4P4B A;  1BOB A;  4TNU A;  4U5Y A;  2AE6 A;  1QST A;  1XBU A;  3TO9 A;  1M44 A;  2FS5 A;  3RNZ A;  4EWT A;  3EY5 A;  4AXV A;  1TKH A;  2GFQ A;  2PR1 A;  2I00 A;  4MCQ A;  5LRG A;  1YSJ A;  2PVW A;  3FED A;  2REE A;  5HVH A;  4H6U A;  4MHZ A;  1YK3 A;  3T90 A;  3TCV A;  3MN8 A;  1B6B A;  2FXF A;  3P2F A;  1GYT A;  4C2Z A;  2WUU A;  2Z0Z A;  3PEI A;  2Z3N A;  2DPT A;  3JUW A;  2B5G A;  5EMI A;  1CJW A;  1IOI A;  4MFQ A;  3BHX A;  1ZG9 A;  2ZXV A;  3PFO A;  1VHS A;  1ZLI A;  2GLF A;  2PJ6 A;  4UEE A;  3IEH A;  4CGO A;  5KTD A;  3B3T A;  3WC6 A;  4F9V A;  4FUU A;  4L8A A;  4P4E A;  2VZZ A;  2PJ5 A;  3D67 A;  1S3Z A;  4NEX A;  4NFR A;  4NXY A;  2YNC C;  2FE7 A;  3FXT A;  4YFJ A;  3VAR A;  1F2O A;  3F8K A;  2PJA A;  4KOU A;  3PB6 X;  4CAE A;  1IY7 A;  2ZEM A;  3EFA A;  2B4D B;  2EWB A;  3PBE A;  4CYQ A;  3G8W A;  3LAC A;  2V8V A;  4AB7 A;  3S9L A;  4KZT A;  2PRB A;  2BSW A;  3S6G A;  1JQG A;  1YQE A;  1ZO0 A;  3IWG A;  4OIW A;  4B13 A;  4KS9 A;  4UFW A;  1TF9 A;  1R57 A;  3TO6 A;  1KWM A;  2YNE A;  1S5K A;  3W91 A;  4GM5 A;  3K9U A;  2F8H A;  3FBU A;  4UEF A;  4CGN A;  1L0C A;  3I9S A;  2B3V A;  2QML A;  2OZG A;  2CNT A;  2JDD A;  5AG5 A;  3KQZ A;  4ZX9 A;  3ISX A;  2YGW A;  2J8R A;  3GKR A;  4W9Y A;  3F0A A;  3S6K A;  4KOY A;  3FH4 A;  3RZA A;  5JQ4 A;  2Q43 A;  1H8L A;  1NMT A;  3F5B A;  4R7M A;  5LYF A;  3TFY A;  2OH1 A;  1VIX A;  4MFK A;  5THW A;  4OAE A;  3CXP A;  1Y7E A;  1CP7 A;  1QMU A;  5LRK A;  2PJ1 A;  2DEA A;  2QEC A;  2GE3 A;  1DE4 C;  2V77 A;  4CGP A;  1XMB A;  2VI7 A;  3V7Z A;  4CAV A;  1I21 A;  2BOA A;  3IU2 A;  4OC2 A;  4B6Z A;  4QVT A;  1Q7L A;  4Z65 A;  4H89 A;  3B2Y A;  3KZW A;  4KOW A;  4MXU A;  3CDX A;  1ARM A;  4OME A;  1GHE A;  4UWJ A;  3D2M A;  2A4N A;  2FIW A;  5HXD A;  2ARH A;  3NE7 A;  4WWV A;  1RO5 A;  4NGP A;  2FVG A;  2JDC A;  3FX6 A;  4C7I A;  2ZEN A;  1YLE A;  7CPA A;  2AFX A;  3D3S A;  4UBR A;  2Q04 A;  3BJ7 A;  3MGD A;  4OC1 A;  4MHY A;  2BCO A;  1Z9U A;  1PUA A;  5EBV A;  4HNY B;  1UFH A;  3IO1 A;  3TC8 A;  4AG7 A;  4H2K A;  4CAF A;  2PIY A;  1FNO A;  3LWU A;  2PIZ A;  5KTA A;  4NCZ A;  2D4P A;  1CX8 A;  4MHP A;  1MJ9 A;  3TTH A;  3KHZ A;  5I0C A;  4PXD A;  2PJ8 A;  2P6E A;  2RB7 A;  3TE4 A;  4C2X A;  5ISV A;  5K8N A;  1FT7 A;  1WWZ A;  4DJL A;  2BL1 A;  3B3V A;  2JLM A;  4EME A;  2NYQ A;  3OWC A;  3I3G A;  4JXR A;  5J1Q A;  3RBU A;  3KL9 A;  3SI2 A;  8CPA A;  5JPH A;  5G21 A;  3KGQ A;  1TIQ A;  3PB7 X;  1AYE A;  1YLO A;  3FYN A;  3S6H A;  1MK4 A;  4H6Z A;  4JYW A;  3S6F A;  3SJG A;  4E8O A;  5CPA A;  4II9 A;  2IMO A;  3NFZ A;  4R6T A;  1WK4 A;  4NJR A;  1M4G A;  4JXQ A;  5A27 A;  4GS4 A;  3GYA A;  2CF4 A;  4NSQ A;  4MHN A;  2C6P A;  2PC1 A;  1Q2C A;  4MCS A;  3JTK A;  1CPS A;  4NGN A;  5ELY A;  5CBM A;  1AMP A;  2AFS A;  4Y49 C;  3WAB A;  4MHD A;  4A94 A;  2J9A A;  3KR4 A;  1ZG7 A;  4MBU A;  2PE3 A;  4A95 A;  5JGF A;  2G3T A;  5K8P A;  3SXN A;  3B8G A;  4KOT A;  2VZY A;  4WJB A;  5F48 A;  3NH5 A;  2PJ7 A;  2Q44 A;  4FWU A;  3L2N A;  4R3L A;  2B58 A;  4M85 A;  4UCP A;  2J8M A;  4FBE A;  1A2Z A;  3VWD A;  1CPX A;  3CXS A;  4ORF A;  1X12 A;  1Z8T A;  5J8C A;  4KOX A;  2IJZ A;  5E96 A;  3PB9 X;  1XRY A;  2DPS A;  3ZJ0 A;  2OOT A;  1YW6 A;  1P4N A;  4L89 A;  5G1Z A;  4ZYQ A;  3R96 A;  1Y9W A;  4U9Y A;  4LQ6 A;  2Z3M A;  2AFW A;  1I12 A;  2B4D A;  5HVF A;  3TX8 A;  4DYO A;  3FJU A;  2HUZ A;  4DNC A;  4ONU A;  3LMS A;  2RFH A;  5F47 A;  3DSB A;  3HUV A;  1S7L A;  2ZW6 A;  4K3N A;  2ZPA A;  3N7Z A;  2Y0M A;  2EK8 A;  2PQ8 A;  4JLY A;  3R9F A;  4ZGY B;  2WYR A;  4CAX A;  1PU9 A;  2YND A;  4NGR A;  4F0Y A;  2HC9 A;  3KHX A;  3NE8 A;  4UEZ A;  3TO7 A;  2WPX A;  2F7V A;  2Q0Y A;  4OLL A;  1LAM A;  3TT2 A;  5CNP A;  4OC3 A;  4A33 A;  4KLW A;  2HV2 A;  4F6A A;  4PQA A;  4Q7A A;  5AG4 A;  5IX3 A;  5IV0 A;  4I49 A;  3FB3 A;  3FVL A;  4PXE A;  4UIB A;  4CPA A;  2ATR A;  4UIA A;  2XEF A;  4GXH A;  3GY9 A;  5EC4 A;  4YWY A;  4OP4 A;  3EC4 A;  5DWN A;  2Q4V A;  2CY2 A; 
#chains in the Genus database with same CATH homology
 4PK2 A;  3W6X A;  4PK3 A;  1OZP A;  1XIX A;  1XE4 A;  4HNW B;  2FT0 A;  3T9Y A;  2KCW A;  4RS2 A;  1S7K A;  1Q2D A;  1NSL A;  3FNC A;  5IB0 A;  3SXO A;  3D8P A;  3R9E A;  4FD7 A;  4XPL A;  1Z4R A;  4KSF A;  2CXA A;  4B5P A;  3EO4 A;  4XPK A;  5FVJ A;  2EUI A;  2FIA A;  3BJ8 A;  3DR6 A;  1Z4E A;  3IWE A;  4PV6 A;  2D4O A;  1V0C A;  4UCM A;  4E2A A;  1M1D A;  2FCK A;  5F49 A;  3DR8 A;  2VEZ A;  3V8I A;  4YGO A;  3KKW A;  2O28 A;  4FD6 A;  2P6G A;  3BLN A;  2GIV A;  2P0W A;  4CRZ B;  4B14 A;  1YVO A;  2FL4 A;  4LUA A;  3W6S A;  1VKC A;  2BEI A;  2WSA A;  4CS0 B;  2Q4Y A;  3RYO A;  4QC6 A;  4F0X A;  1IYL A;  3G3S A;  2Z10 A;  4MFP A;  1IB1 E;  2Z11 A;  2HQY A;  4UFX A;  3QAH A;  5G20 A;  2G0B A;  4XPD C;  2OZU A;  3FIX A;  2EVN A;  2VBQ A;  3A9L A;  4A31 A;  4QB9 A;  1M4I A;  4FD4 A;  2NMT A;  2ZW7 A;  5HMN A;  4Q36 A;  4KLV A;  3DDD A;  4KSA A;  2BUE A;  4ZBG A;  4QBJ A;  4R3K A;  1IYK A;  4KOV A;  3LOD A;  4CAW A;  1YX0 A;  4AG9 A;  4UWI A;  4LX9 A;  1CM0 A;  2F5I A;  3WR7 A;  1KUX A;  2GAN A;  4Q38 A;  1SQH A;  1MJB A;  5AG6 A;  2Z3L A;  1XF8 A;  2Z3K A;  1BO4 A;  2ZW5 A;  4BMH A;  2REF A;  5KTC A;  4JD6 A;  4K30 A;  3P2H A;  2CNM A;  2R8V A;  1J4J A;  1ON0 A;  1KUV A;  4YRH A;  2B3U A;  4CYN A;  4UA3 A;  4JWP A;  1Y9K A;  3TOB A;  2ZW4 A;  1MJA A;  4UCN A;  4U9Z A;  1QSM A;  5H84 A;  2AJ6 A;  4A2Z A;  1KZF A;  2OB0 A;  1S7N A;  1YR0 A;  2R7H A;  1B87 A;  2CNS A;  2RC4 A;  2H5M A;  4R9M A;  1IID A;  2K5T A;  3UY5 A;  2IL4 A;  2OZH A;  4HKF A;  4R87 A;  2Z3P A;  2Z3O A;  4B5P B;  2R98 A;  2PSW A;  4PSW A;  2DXQ A;  4CGL A;  1N71 A;  3ZZI A;  4B5O A;  1QSR A;  4MFL A;  4R57 A;  2WPW A;  2J8N A;  4C7H A;  1NE9 A;  4CYO A;  1IIC A;  3E0K A;  4BBH A;  4MFJ A;  4MY0 A;  1Y7R A;  4RI1 A;  3VWE A;  3PZJ A;  1YRE A;  5AG7 A;  4IF5 A;  2QIR A;  4KOR A;  1XEB A;  2B4B A;  3JVN A;  2X7B A;  1XMT A;  4PSX A;  4X5K A;  4KVX A;  1YVK A;  1QSN A;  3R95 A;  4AVB A;  4EVY A;  3PP9 A;  4KUA A;  4XPD B;  2FSR A;  1S60 A;  4NF1 A;  1RXT A;  1S7F A;  2VQY A;  4IUS A;  4J3G A;  4UFV A;  3EXN A;  3TOA A;  1I1D A;  2I79 A;  5G22 A;  4A30 A;  4B11 A;  3IU1 A;  2YNC A;  4MFZ A;  5C82 A;  1P0H A;  2P6F A;  5HH1 A;  5J8F A;  2PDO A;  3R1K A;  4KVO E;  5A28 A;  4CRY B;  5C88 A;  3QB8 A;  1Q2Y A;  4M3S A;  2G3A A;  1LRZ A;  3CXQ A;  4HNX B;  4KOS A;  4MY3 A;  4OAD A;  1QSO A;  4A32 A;  2C27 A;  4MI4 A;  1U6M A;  2PR8 A;  3D2P A;  5DWM A;  4JJX A;  4KUB A;  5H86 A;  1KUY A;  3H5Z A;  4CYP A;  2JEV A;  4FD5 A;  4MJ8 A;  3DNS A;  2OU2 A;  3R9G A;  4C2Y A;  3H4Q A;  2R1I A;  2VXK A;  3FRM A;  1M4D A;  1YGH A;  5GCN A;  3PGP A;  1FY7 A;  3C26 A;  2Q7B A;  4QUS A;  3IGR A;  4KVM E;  4XNH C;  4AVC A;  4B10 A;  4B12 A;  5F46 A;  4C68 A;  3LD2 A;  4CGM A;  5AGE A;  4AVA A;  4E0A A;  4XNH B;  3SHP A;  5BWA B;  4Y49 B;  2B5G B;  1K4J A;  1BOB A;  4U5Y A;  2AE6 A;  1QST A;  3TO9 A;  1M44 A;  2FS5 A;  3EY5 A;  2PR1 A;  2I00 A;  2REE A;  4H6U A;  1YK3 A;  3T90 A;  3TCV A;  1B6B A;  2FXF A;  3P2F A;  4C2Z A;  2WUU A;  2Z0Z A;  2Z3N A;  2DPT A;  3JUW A;  2B5G A;  1CJW A;  4MFQ A;  5F48 A;  2ZXV A;  1VHS A;  5KTD A;  4CGO A;  4L8A A;  2VZZ A;  4NEX A;  1S3Z A;  4NXY A;  2YNC C;  2FE7 A;  3FXT A;  4YFJ A;  3F8K A;  4CAE A;  4KOU A;  3EFA A;  2B4D B;  4CYQ A;  3G8W A;  4AB7 A;  4KZT A;  2PRB A;  2BSW A;  3S6G A;  1ZO0 A;  3IWG A;  4B13 A;  4KS9 A;  4UFW A;  3TO6 A;  1R57 A;  2YNE A;  1S5K A;  3W91 A;  3K9U A;  3FBU A;  4CGN A;  1L0C A;  3I9S A;  2B3V A;  2QML A;  2OZG A;  2CNT A;  2JDD A;  5AG5 A;  2YGW A;  2J8R A;  3GKR A;  3F0A A;  3S6K A;  4KOY A;  5JQ4 A;  1NMT A;  3F5B A;  3TFY A;  2OH1 A;  4MFK A;  4OAE A;  3CXP A;  2QEC A;  2GE3 A;  4CGP A;  2VI7 A;  4CAV A;  1I21 A;  3IU2 A;  4QVT A;  4H89 A;  4KOW A;  1GHE A;  4UWJ A;  3D2M A;  2A4N A;  2FIW A;  2ARH A;  3NE7 A;  1RO5 A;  2JDC A;  4C7I A;  1YLE A;  3D3S A;  4UBR A;  2Q04 A;  3BJ7 A;  3MGD A;  1Z9U A;  1PUA A;  5EBV A;  4HNY B;  1UFH A;  4AG7 A;  4CAF A;  5KTA A;  4NCZ A;  2D4P A;  3TTH A;  5I0C A;  1MJ9 A;  2P6E A;  3TE4 A;  4C2X A;  5ISV A;  1WWZ A;  2BL1 A;  2JLM A;  3OWC A;  3I3G A;  4JXR A;  5JPH A;  5G21 A;  1TIQ A;  3FYN A;  3S6H A;  1MK4 A;  4H6Z A;  3S6F A;  4E8O A;  4II9 A;  1WK4 A;  1M4G A;  4JXQ A;  5A27 A;  4GS4 A;  3GYA A;  4NSQ A;  2PC1 A;  1Q2C A;  3JTK A;  4Y49 C;  4MHD A;  4MBU A;  4A95 A;  2G3T A;  3SXN A;  3B8G A;  4KOT A;  2VZY A;  2Q44 A;  4R3L A;  2B58 A;  4M85 A;  4UCP A;  2J8M A;  3VWD A;  3CXS A;  4ORF A;  5J8C A;  4KOX A;  5E96 A;  2DPS A;  3ZJ0 A;  1P4N A;  4L89 A;  5G1Z A;  3R96 A;  1Y9W A;  4U9Y A;  2Z3M A;  1I12 A;  2B4D A;  2HUZ A;  4DNC A;  4ONU A;  5F47 A;  3DSB A;  1S7L A;  2ZW6 A;  2ZPA A;  3N7Z A;  2Y0M A;  3R9F A;  2PQ8 A;  4JLY A;  4ZGY B;  4CAX A;  1PU9 A;  2YND A;  4F0Y A;  3TO7 A;  2WPX A;  2Q0Y A;  4OLL A;  3TT2 A;  5CNP A;  4A33 A;  4KLW A;  2HV2 A;  4F6A A;  5IX3 A;  5IV0 A;  5AG4 A;  4I49 A;  3FB3 A;  2ATR A;  5EC4 A;  3GY9 A;  3EC4 A;  5DWN A;  2Q4V A;  2CY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...