5GCNA

Catalytic domain of tetrahymena gcn5 histone acetyltransferase in complex with coenzyme a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
166
structure length
166
Chain Sequence
MKGLLDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE ACETYLTRANSFERASE GCN5
publication title Solution structure of the catalytic domain of GCN5 histone acetyltransferase bound to coenzyme A
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Transferase
total genus 32
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 1999-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5gcnA00
3D8PA 4MI4A 3DDDA 2AJ6A 4F0YA 1YVOA 2ZW6A 1Z4RA 3DR8A 2NMTA 4KOUA 1Q2YA 4RS2A 5H86A 4R9MA 3SXNA 4AVAA 3W6SA 1P0HA 4JJXA 4JXRA 4XPDB 3TTHA 1MJBA 5F48A 1XMTA 3KKWA 5I0CA 4KVOE 5JPHA 2G3AA 5IV0A 5IB0A 5CNPA 2JDDA 1NMTA 3QAHA 4CRYB 2HUZA 4UWIA 3VWDA 4B5PB 2Z0ZA 1V0CA 3PZJA 4KOWA 2OH1A 5ISVA 3LODA 5EC4A 3TOAA 1NE9A 2B5GB 2G3TA 1Y9KA 3IGRA 3W6XA 4MY0A 1KUVA 2P0WA 4E0AA 3FXTA 3SXOA 2J8RA 1BO4A 4M3SA 4PSXA 3RYOA 2VQYA 4M85A 3GYAA 4E8OA 5C88A 2Q4YA 4KOVA 1KUXA 3F5BA 4KLVA 1NSLA 4F6AA 4PK3A 1XF8A 1IICA 2G0BA 2B58A 1QSRA 1VHSA 4UA3A 3JUWA 2QMLA 4YFJA 4DNCA 2I00A 2R1IA 1S5KA 4IUSA 3W91A 2O28A 2Z10A 2J8NA 4R3KA 2PR1A 2FCKA 3EO4A 2GANA 3TO6A 1KZFA 2R8VA 1TIQA 4AG9A 5EBVA 2FE7A 4CRZB 2FL4A 3TCVA 4JWPA 1YREA 4KUAA 1MK4A 2F5IA 1YK3A 4MHDA 1B6BA 2QECA 4K30A 4MY3A 1B87A 1S60A 4OAEA 1VKCA 4MJ8A 3GY9A 4OLLA 4QB9A 3BLNA 4KVME 1CJWA 3LD2A 1Q2DA 4UBRA 1QSTA 3R9GA 3R9FA 2REFA 4KZTA 4U9YA 2D4OA 3T9YA 3S6HA 4NXYA 1WK4A 2HQYA 2R7HA 1K4JA 5FVJA 4B5OA 2PC1A 4AB7A 3H4QA 2B3UA 2VBQA 5KTAA 1L0CA 3GKRA 2FS5A 4FD4A 4E2AA 2R98A 2CNTA 2CNSA 1CM0A 2REEA 3DR6A 4QUSA 2CNMA 1P4NA 1RXTA 2I79A 2WPWA 4KOSA 1M1DA 3F8KA 3BJ8A 1I21A 4KOYA 4XNHC 1RO5A 4PV6A 1KUYA 3TE4A 4R3LA 5HMNA 4U9ZA 1QSNA 3EXNA 2PRBA 2FIWA 1IIDA 1I1DA 1SQHA 4MBUA 3S6KA 1U6MA 3ZZIA 2B4DA 4BMHA 3SHPA 4AG7A 5F47A 5IX3A 1Q2CA 2OZHA 4QC6A 4PSWA 2GIVA 3S6FA 5E96A 2Q7BA 1M4DA 4LX9A 2BUEA 5H84A 2PQ8A 1GHEA 2QIRA 5HH1A 4H6UA 4HKFA 5J8FA 1S7FA 4FD6A 1S7NA 3EC4A 4YRHA 4XNHB 2RC4A 2Q44A 3CXQA 5KTCA 3F0AA 3EY5A 2VEZA 1YR0A 3PGPA 2J8MA 2EVNA 3E0KA 2VXKA 2JDCA 2ZXVA 1S3ZA 2A4NA 4KOXA 3S6GA 3D2PA 1YLEA 3FYNA 3D2MA 1WWZA 5KTDA 3IWGA 3CXSA 2HV2A 4KORA 3T90A 3QB8A 3TOBA 3K9UA 2ATRA 4OADA 3FBUA 1YVKA 4KUBA 4NEXA 2P6EA 2VZYA 4GS4A 5F49A 4XPLA 2GE3A 3R95A 4II9A 4R57A 2B3VA 4R87A 3TO7A 3MGDA 2WPXA 3DNSA 3UY5A 2ZW7A 2PR8A 2X7BA 1M4IA 1UFHA 4Y49B 2P6FA 3CXPA 3C26A 4NCZA 1OZPA 4PK2A 2EUIA 2BEIA 5DWNA 1ON0A 1IYKA 3I9SA 3FRMA 4YGOA 2FT0A 4HNWB 4X5KA 2VZZA 2OZGA 3OWCA 1BOBA 4J3GA 1R57A 2IL4A 2BSWA 1M4GA 3R9EA 3R96A 4ZBGA 4JD6A 3B8GA 3TO9A 1MJ9A 3P2HA 4CAWA 3JVNA 3TFYA 1I12A 3R1KA 1J4JA 4KOTA 1QSMA 2FXFA 2JLMA 4JLYA 4ORFA 1IB1E 1FY7A 3WR7A 2VI7A 5C82A 4L8AA 4I49A 1Y9WA 1Z9UA 2D4PA 2Q0YA 4KVXA 3VWEA 2Q4VA 4EVYA 1XE4A 4HNXB 2PDOA 4JXQA 1XIXA 2KCWA 5GCNA 3NE7A 2B4BA 4UWJA 1S7KA 4CS0B 4LUAA 1PU9A 4XPKA 2ZW5A 3TT2A 4H89A 4IF5A 2H5MA 2Z11A 5F46A 3DSBA 1YGHA 2ZPAA 2P6GA 4AVBA 4QBJA 3PP9A 4FD7A 3FIXA 3I3GA 4KLWA 1IYLA 5JQ4A 4U5YA 2AE6A 3G8WA 2CY2A 4NF1A 4QVTA 1MJAA 4AVCA 1LRZA 2FSRA 3FNCA 5DWMA 2Q04A 4B5PA 5J8CA 4Y49C 1XEBA 3BJ7A 1Z4EA 3D3SA 4RI1A 2OU2A 2B5GA 1Y7RA 2PSWA 1PUAA 3N7ZA 3EFAA 3V8IA 2Y0MA 2FIAA 4H6ZA 4CAXA 4ONUA 3ZJ0A 4XPDC 4FD5A 1S7LA 2DXQA 2JEVA 2K5TA 4HNYB 2BL1A 3FB3A 2C27A 4NSQA 4L89A 2ZW4A 3G3SA 1N71A 1M44A 1QSOA 1YX0A 2ARHA 2OZUA 3P2FA 4CAVA 2B4DB 2OB0A
chains in the Genus database with same CATH superfamily
3D8PA 4OIWA 4F0XA 4A37A 4MI4A 4NGSA 4IAVA 3DDDA 4MHZA 4OIDA 4A38A 2AJ6A 5AGEA 4F0YA 1YVOA 2AFOA 2ZW6A 5F09A 2IJZA 3B3SA 3PB6X 3SJEA 2ABZA 1Z4RA 3DR8A 4PXCA 2NMTA 4KOUA 1Q2YA 4NGQA 4RS2A 4FBEA 1ZLHA 5H86A 3IU2A 4R9MA 3PB9X 4A2ZA 3SXNA 4AVAA 1QQ9A 1Z2LA 3W6SA 4P4IA 1P0HA 2ZEOA 4JJXA 4JXRA 3NE8A 2Z3OA 4XPDB 5THWA 3TTHA 1MJBA 5F48A 1Z5RA 4MHPA 1XMTA 3KKWA 4P45A 5I0CA 3JTKA 4UEZA 4KVOE 4CGMA 5JPHA 1DE4C 2G3AA 4MFLA 5IV0A 5IB0A 3H8FA 5CNPA 2JDDA 1NMTA 3FEDA 3KGQA 2PIYA 3QAHA 4CRYB 2HUZA 4UWIA 3SJFA 3VWDA 1XJOA 4B5PB 2Z0ZA 1V0CA 3D4UA 2AFWA 3PZJA 5AG4A 5HXDA 3KQZA 4ZYQA 4CYPA 4KOWA 2OH1A 4GM5A 4Q36A 2V77A 3D7DA 5ISVA 2PJ2A 3LODA 2PJ7A 5EC4A 3TOAA 1NE9A 2B5GB 2G3TA 2XEJA 1TKJA 2JBKA 5G22A 4BBHA 4CGPA 1Y9KA 4OC2A 3IGRA 3W6XA 4MY0A 1KUVA 1Q7LA 2P0WA 4E0AA 3FXTA 4Z65A 1R43A 4X2TA 3SXOA 3FF3A 2J8RA 3PBEA 1BO4A 1CG2A 4M3SA 1ZLIA 3IEHA 4M6IA 1LFWA 4PSXA 4KSAA 3PFEA 4PXBA 4C7HA 1IY7A 3NH5A 4P4DA 3RYOA 2ZEDA 2VQYA 1JWQA 2AFZA 4M85A 2YNDA 3GYAA 4E8OA 5C88A 2Q4YA 1NSAA 1ZG9A 4KOVA 1KUXA 3F5BA 4KLVA 3RBUA 1BLLE 1NSLA 5LYFA 1CPXA 4BINA 4F6AA 4PK3A 1XF8A 3GLJA 1IICA 2G0BA 3KR4A 1BPMA 2B58A 3CT9A 2NYQA 1QSRA 2ZOGA 1VHSA 4UA3A 3JUWA 2QMLA 2PJAA 5ELYA 4DNCA 2PJ1A 3FVLA 4YFJA 2I00A 1AMPA 4F9VA 2R1IA 4NGPA 3PBBA 3PEIA 1S5KA 4CYNA 1X12A 2Z3LA 4B13A 3PFOA 4BD9A 1A2ZA 4IUSA 3W91A 2OOTA 4FWUA 4P10A 1GYTA 1CP7A 2O28A 2Z10A 3H8GA 2J8NA 4R3KA 4A39A 1TKFA 2YNEA 5AG5A 2PR1A 4MFJA 2FCKA 3BI0A 1QMUA 3EO4A 3LWUA 3VH9A 2CXAA 4DYOA 4NGNA 2GANA 3TO6A 3WC7A 4F8ZA 1KZFA 2R8VA 3NFZA 4HPSA 2EK8A 1TIQA 4AG9A 3D66A 2CTCA 3BXMA 3SJGA 5EBVA 2FE7A 4CRZB 2FL4A 4UFWA 4UF4A 3TCVA 4JWPA 1YREA 2QYVA 4C68A 3PB8X 1F2PA 2AFMA 1H8LA 4KUAA 4MFZA 1MK4A 2F5IA 2V8HA 3PB4X 4Q38A 4A30A 2EWBA 3FH4A 3PB7X 2Z3PA 1LCPA 1YK3A 4MHDA 1B6BA 4O23A 2QECA 4K30A 2YNCC 4MY3A 1B87A 1S60A 2Q51A 4OAEA 2PVWA 1VKCA 2I3CA 4MJ8A 2O4HA 3GY9A 4OLLA 1BPNA 3HUVA 1IGBA 4MFQA 4QB9A 3BLNA 4MHNA 4UEEA 4KVME 3RNZA 1HDUA 1ARLA 4CYOA 2XEGA 1CJWA 3LD2A 1Q2DA 4UBRA 4X3RA 1QSTA 2C1CA 3R9GA 5A28A 4R8FA 3B3WA 3MRUA 3MN8A 5LYLA 2F8HA 3KR5A 3R9FA 2PIZA 4OKOA 2REFA 1YQEA 4KZTA 2HC9A 4U9YA 4UIAA 2D4OA 3T9YA 3S6HA 3CDXA 1VHEA 4NXYA 1WK4A 2F7VA 2HQYA 2R7HA 1K4JA 5FVJA 3RAMA 4B5OA 4MCPA 4UCPA 2OR4A 2PC1A 3HLPA 3LACA 4AB7A 4RN7A 3H4QA 2B3UA 1F57A 2VBQA 1L0CA 2Z3MA 3QNVA 5KTAA 2G9DA 2PJ5A 3RZAA 3GKRA 2FS5A 2Z3KA 1AYEA 4FD4A 4E2AA 2POKA 4TNUA 4A95A 1VGYA 2R98A 2CNTA 2CNSA 5IB9A 3NA6A 1XMBA 1CM0A 2REEA 4OC4A 3DR6A 4P4FA 5JH9A 4QUSA 1KWMA 2CNMA 1P4NA 3KQXA 1RXTA 1XBUA 2I79A 2WPWA 4KOSA 1M1DA 3F8KA 4C2YA 2ZEGA 4ZY1A 3BJ8A 1YW6A 3IFEA 4WJBA 3B3CA 1Z8WA 4NFRA 3V38A 4RUHA 1I21A 4KOYA 4P44A 4B6ZA 3LMSA 4OC0A 5CBMA 1PCAA 4UFVA 4XNHC 3SI1A 1LOKA 1VHOA 2XEFA 1RO5A 4PV6A 4ZX8A 4H2KA 1KUYA 3B7IA 3TE4A 2IMOA 4R3LA 5HMNA 2V8VA 4U9ZA 1QSNA 1Y0RA 2WUUA 1YLOA 5LYIA 3EXNA 1UWYA 5AG6A 4R6TA 2CF4A 2PRBA 4UEFA 2FIWA 2O53A 4MFKA 4A32A 2PJ3A 1IIDA 1I1DA 1SQHA 4MBUA 3S6KA 2AFSA 4PQAA 1U6MA 3ZZIA 2RFHA 2B4DA 4MCQA 4OMEA 1TF8A 3SHPA 4BMHA 1Z8LA 4AG7A 5F47A 5IX3A 1Q2CA 2OZHA 1LAPA 1HDQA 2AFUA 4QC6A 4PSWA 2PCUA 4KS9A 2GIVA 3S6FA 3CZXA 5E96A 2Q7BA 3IO1A 1CX8A 3D7FA 1M4DA 4LX9A 2BUEA 4ZY0A 2WZNA 5H84A 2J9AA 2PQ8A 3FECA 1GHEA 2QIRA 5HH1A 4H6UA 3D7HA 4HKFA 4A31A 5J8FA 1S7FA 4FD6A 1OBRA 1YSJA 2PJ6A 1S7NA 4OC1A 3EC4A 5BWAB 4YRHA 4XNHB 2RC4A 2Q44A 2PJ4A 4JZ0A 4Q7AA 3CXQA 1X10A 4ZI6A 8CPAA 1ZG8A 5K8OA 5KTCA 5D8NA 2RB7A 1PYTB 2WSAA 3EY5A 2VEZA 3F0AA 1YR0A 3PGPA 2J8MA 4NGMA 2DF5A 4EFDA 1DTDA 2EVNA 3KZWA 4MCSA 3E0KA 2VXKA 2JDCA 2ZXVA 1F2OA 2ZEPA 4P4JA 1S3ZA 2A4NA 3JRUA 3KASA 4KOXA 5LRJA 3FEEA 1CBXA 3S6GA 3D2PA 1YLEA 3FYNA 2V8DA 3D2MA 1WWZA 1IOIA 2ZEHA 3A9LA 3H8EA 5KTDA 3IWGA 3CXSA 1YMEA 2HV2A 2GLJA 2DEAA 4KORA 2PJCA 3T90A 1FT7A 3B2YA 3QB8A 3RO0A 3TOBA 2GREA 3K9UA 3DLJA 2ATRA 3NH4A 4YWYA 5K8NA 4OADA 1EE3P 3GB0A 3FBUA 1BAVA 1AUGA 4DJLA 1YVKA 3IIBA 2PRQA 3CPAA 4LQGA 4KUBA 4NEXA 1VIXA 2P6EA 2VZYA 4GS4A 5F49A 4ZY2A 3L2NA 4XPLA 1CP6A 2ODFA 3K9TA 2GE3A 3R95A 4II9A 2PJBA 3QAYA 4R57A 5G1ZA 2B3VA 4F9UA 3VARA 1ZG7A 4R87A 3TO7A 6CPAA 4MFPA 3MGDA 5J1QA 4UIBA 2WPXA 3DNSA 4B14A 3D68A 2ZW7A 3ISXA 3UY5A 2PR8A 1TF9A 2X7BA 1M4IA 1UFHA 4Y49B 3T8WA 4A33A 4A94A 4ZGYB 5K8PA 2P6FA 1ELLP 2HB6A 4FUUA 3NH8A 2EK9A 5JM6A 3CXPA 4M6GA 3ISZA 3WABA 3C26A 2ZENA 3GUXA 4NCZA 3WC5A 3BI1A 1OZPA 2GLFA 4LQ6A 4PK2A 2EUIA 2XEIA 2BEIA 5EMIA 5DWNA 1ON0A 3KI9A 1IYKA 3I9SA 2VL1A 3VATA 2DPSA 5K8MA 2BCOA 3FRMA 2GU2A 4YGOA 4NJQA 2FT0A 3PRTA 3WT4A 4HNWB 4X5KA 4C7IA 3FX6A 1XRYA 3IC1A 2VZZA 5LYDA 2OZGA 1CPSA 3OWCA 4R76A 1BOBA 4J3GA 4B12A 4CAEA 4P6YA 4CGLA 2DPTA 4CGOA 1R57A 2ZOFA 4AXVA 2Q4ZA 2IL4A 2BSWA 5D29A 1M4GA 3R9EA 3R96A 4ZBGA 4JD6A 1LAMA 4ZX9A 3B8GA 1Z8TA 3TO9A 3DGVA 2PJ9A 1JQGA 3KHZA 4B10A 1MJ9A 3P2HA 4X8IA 4CAWA 4W9YA 3JVNA 4PXDA 5JGFA 3TFYA 4KSIA 1I12A 2BOAA 3R1KA 1J4JA 1TKHA 2PVVA 5DS0A 3B35A 4GXHA 4CGNA 4FAIA 5HVGA 4KOTA 2Q43A 2NSMA 4M6HA 1QSMA 2FXFA 2JLMA 3BHXA 4UCMA 3N5FA 4IK2A 4TWEA 4JLYA 4IHMA 4ORFA 2QJ8A 2C6CA 1IB1E 4P4EA 1LANA 2ZEMA 1FY7A 3WR7A 4R7MA 2VI7A 4JYWA 4NGTA 4MCRA 4KSFA 1HEEA 5C82A 3B3VA 4L8AA 5CPAA 1YW4A 4K3NA 4I49A 1Y9WA 1Z9UA 4MRIA 1FNOA 2D4PA 4WWVA 3WC6A 2Q0YA 4KVXA 5AG7A 3VWEA 2Q4VA 4EVYA 2QVPA 1IOFA 1XE4A 2PDOA 2C6GA 4HNXB 4JXQA 4P4BA 4UCNA 1XIXA 2KCWA 5GCNA 3NE7A 2B4BA 5A27A 4OC3A 4UWJA 3SJXA 1S7KA 4MHYA 4CS0B 1IU8A 4LUAA 1PU9A 1ELMP 1XOVA 2ANPA 2ZW5A 3FMCA 4ONWA 4XPKA 3TT2A 1TXRA 4H89A 4IF5A 1ARMA 2H5MA 2IQ6A 1M4LA 2Z11A 4G1PA 5F46A 4NJRA 3DSBA 2PE3A 3H5ZA 2PJ8A 1YGHA 2ZPAA 2P6GA 4AVBA 4QBJA 2WYRA 3PP9A 5HVFA 2PJ0A 4FD7A 2GFQA 3FIXA 3I3GA 4PPZA 4KLWA 1IYLA 5JQ4A 4U5YA 2AE6A 3G8WA 5HVHA 2C6PA 2JEWA 2CY2A 4NF1A 4QVTA 5G20A 1MJAA 4AVCA 3S9MA 1LRZA 4CAFA 2BO9A 2ZEEA 4PXEA 2FSRA 3FNCA 3IJ3A 3FJUA 2YNCA 5DWMA 2Q04A 4C2XA 4CYQA 5I4MA 4B5PA 4B11A 2Q7SA 5J8CA 4Y49C 1XEBA 2JBJA 1R3NA 3BJ7A 3I1UA 2Z3NA 3B3TA 1Z4EA 3D3SA 4MMOA 3IWWA 4RI1A 3TX8A 2OU2A 3S9LA 2B5GA 1Y7RA 3V7ZA 2YGWA 2PSWA 1ZO0A 1PUAA 2FVGA 3CPXA 4CPAA 1Y0YA 2AFXA 4C2ZA 4DUKA 3N7ZA 3IU1A 5LRKA 4OC5A 4UFXA 3EFAA 3S9NA 2EO8A 3V8IA 1XFOA 2Y0MA 2FIAA 2CIJA 4NGRA 3SI2A 2EBJA 4H6ZA 1Z8XA 7CPAA 3D67A 3KL9A 4CAXA 4ONUA 3IWEA 3ZJ0A 5G21A 1RTQA 4XPDC 4FD5A 3K2KA 1S7LA 2DXQA 2CTBA 2JEVA 2K5TA 2V8GA 5LRGA 4HNYB 1Y7EA 4YU9A 4OP4A 2BL1A 2ZEFA 4EWTA 3FB3A 3D7GA 2C27A 2ZELA 4L89A 4NSQA 3TC8A 4EMEA 2ZW4A 3G3SA 1N71A 3KHXA 1M44A 3SI0A 1QSOA 1YX0A 2ARHA 3GIUA 2OZUA 3P2FA 4CAVA 2B4DB 4MXUA 2OB0A
chains in the Genus database with same CATH topology
3D8PA 4F0XA 4MI4A 3DDDA 2AJ6A 5AGEA 4F0YA 1YVOA 2ZW6A 1Z4RA 3DR8A 2NMTA 4KOUA 1Q2YA 4RS2A 5H86A 3IU2A 4R9MA 4A2ZA 3SXNA 4AVAA 3W6SA 1P0HA 4JJXA 4JXRA 2Z3OA 4XPDB 3TTHA 1MJBA 5F48A 1XMTA 3KKWA 5I0CA 3JTKA 4KVOE 4CGMA 5JPHA 2G3AA 4MFLA 5IV0A 5IB0A 5CNPA 2JDDA 1NMTA 3QAHA 4CRYB 2HUZA 4UWIA 3VWDA 4B5PB 2Z0ZA 1V0CA 3PZJA 5AG4A 4CYPA 4KOWA 2OH1A 4Q36A 5ISVA 3LODA 5EC4A 3TOAA 1NE9A 2B5GB 2G3TA 5G22A 4BBHA 4CGPA 1Y9KA 3IGRA 3W6XA 4MY0A 1KUVA 2P0WA 4E0AA 3FXTA 3SXOA 2J8RA 1BO4A 4M3SA 4PSXA 4C7HA 4KSAA 3RYOA 2VQYA 4M85A 2YNDA 3GYAA 4E8OA 5C88A 2Q4YA 4KOVA 1KUXA 3F5BA 4KLVA 1NSLA 4F6AA 4PK3A 1XF8A 1IICA 2G0BA 2B58A 1QSRA 1VHSA 4UA3A 3JUWA 2QMLA 4YFJA 4DNCA 2I00A 2R1IA 1S5KA 4CYNA 2Z3LA 4B13A 4IUSA 3W91A 2O28A 2Z10A 2J8NA 4R3KA 5AG5A 2YNEA 2PR1A 4MFJA 2FCKA 3EO4A 2CXAA 2GANA 3TO6A 1KZFA 2R8VA 1TIQA 4AG9A 5EBVA 2FE7A 4CRZB 2FL4A 4UFWA 3TCVA 4JWPA 1YREA 4C68A 4KUAA 4MFZA 1MK4A 2F5IA 4Q38A 4A30A 2Z3PA 1YK3A 4MHDA 1B6BA 2QECA 4K30A 2YNCC 4MY3A 1B87A 1S60A 4OAEA 1VKCA 4MJ8A 3GY9A 4OLLA 4QB9A 4MFQA 3BLNA 4KVME 4CYOA 1CJWA 3LD2A 1Q2DA 4UBRA 1QSTA 3R9GA 5A28A 3R9FA 2REFA 4KZTA 4U9YA 2D4OA 3T9YA 3S6HA 4NXYA 1WK4A 2HQYA 2R7HA 1K4JA 5FVJA 4B5OA 4UCPA 2PC1A 4AB7A 3H4QA 2B3UA 2VBQA 2Z3MA 1L0CA 5KTAA 3GKRA 2FS5A 2Z3KA 4FD4A 4E2AA 4A95A 2R98A 2CNTA 2CNSA 1CM0A 2REEA 3DR6A 4QUSA 2CNMA 1P4NA 1RXTA 2I79A 2WPWA 4KOSA 1M1DA 3F8KA 4C2YA 3BJ8A 1I21A 4KOYA 4UFVA 4XNHC 1RO5A 4PV6A 1KUYA 3TE4A 4R3LA 5HMNA 4U9ZA 1QSNA 2WUUA 3EXNA 5AG6A 2PRBA 2FIWA 4MFKA 4A32A 1IIDA 1I1DA 1SQHA 4MBUA 3S6KA 1U6MA 3ZZIA 2B4DA 4BMHA 3SHPA 4AG7A 5F47A 5IX3A 1Q2CA 2OZHA 4QC6A 4PSWA 4KS9A 2GIVA 3S6FA 5E96A 2Q7BA 1M4DA 4LX9A 2BUEA 5H84A 2PQ8A 1GHEA 2QIRA 5HH1A 4H6UA 4HKFA 4A31A 5J8FA 1S7FA 4FD6A 1S7NA 3EC4A 5BWAB 4YRHA 4XNHB 2RC4A 2Q44A 3CXQA 5KTCA 2WSAA 3EY5A 2VEZA 3F0AA 1YR0A 3PGPA 2J8MA 2EVNA 3E0KA 2VXKA 2JDCA 2ZXVA 1S3ZA 2A4NA 4KOXA 3S6GA 3D2PA 1YLEA 3FYNA 3D2MA 1WWZA 3A9LA 5KTDA 3IWGA 3CXSA 2HV2A 4KORA 3T90A 3QB8A 3TOBA 3K9UA 2ATRA 4OADA 3FBUA 1YVKA 4KUBA 4NEXA 2P6EA 2VZYA 4GS4A 5F49A 4XPLA 2GE3A 3R95A 4II9A 5G1ZA 4R57A 2B3VA 4R87A 3TO7A 4MFPA 3MGDA 2WPXA 3DNSA 4B14A 3UY5A 2ZW7A 2PR8A 2X7BA 1M4IA 1UFHA 4Y49B 4A33A 4ZGYB 2P6FA 3CXPA 3C26A 4NCZA 1OZPA 4PK2A 2EUIA 2BEIA 5DWNA 1ON0A 1IYKA 3I9SA 2DPSA 3FRMA 4YGOA 2FT0A 4HNWB 4X5KA 4C7IA 2VZZA 2OZGA 3OWCA 1BOBA 4J3GA 4B12A 4CAEA 4CGLA 2DPTA 4CGOA 1R57A 2IL4A 2BSWA 1M4GA 3R9EA 3R96A 4ZBGA 4JD6A 3B8GA 3TO9A 4B10A 1MJ9A 3P2HA 4CAWA 3JVNA 3TFYA 1I12A 3R1KA 1J4JA 4CGNA 4KOTA 1QSMA 2FXFA 2JLMA 4UCMA 4JLYA 4ORFA 1IB1E 1FY7A 3WR7A 2VI7A 4KSFA 5C82A 4L8AA 4I49A 1Y9WA 1Z9UA 2D4PA 2Q0YA 4KVXA 5AG7A 3VWEA 2Q4VA 4EVYA 1XE4A 4HNXB 2PDOA 4UCNA 4JXQA 1XIXA 2KCWA 5GCNA 3NE7A 2B4BA 5A27A 4UWJA 1S7KA 4CS0B 4LUAA 1PU9A 4XPKA 2ZW5A 3TT2A 4H89A 4IF5A 2H5MA 2Z11A 5F46A 3DSBA 3H5ZA 1YGHA 2ZPAA 2P6GA 4AVBA 4QBJA 3PP9A 4FD7A 3FIXA 3I3GA 4KLWA 1IYLA 5JQ4A 4U5YA 2AE6A 3G8WA 2CY2A 4NF1A 4QVTA 5G20A 1MJAA 4AVCA 1LRZA 4CAFA 2FSRA 3FNCA 2YNCA 5DWMA 2Q04A 4C2XA 4CYQA 4B5PA 4B11A 5J8CA 4Y49C 1XEBA 3BJ7A 2Z3NA 1Z4EA 3D3SA 4RI1A 2OU2A 2B5GA 1Y7RA 2YGWA 2PSWA 1ZO0A 1PUAA 4C2ZA 3N7ZA 3IU1A 4UFXA 3EFAA 3V8IA 2Y0MA 2FIAA 4H6ZA 4CAXA 4ONUA 3IWEA 3ZJ0A 5G21A 4XPDC 4FD5A 1S7LA 2DXQA 2JEVA 2K5TA 4HNYB 2BL1A 3FB3A 2C27A 4NSQA 4L89A 2ZW4A 3G3SA 1N71A 1M44A 1QSOA 1YX0A 2ARHA 2OZUA 3P2FA 4CAVA 2B4DB 2OB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D8P A;  4MI4 A;  3DDD A;  2AJ6 A;  4F0Y A;  1YVO A;  2ZW6 A;  1Z4R A;  3DR8 A;  2NMT A;  4KOU A;  1Q2Y A;  4RS2 A;  5H86 A;  4R9M A;  3SXN A;  4AVA A;  3W6S A;  1P0H A;  4JJX A;  4JXR A;  4XPD B;  3TTH A;  1MJB A;  5F48 A;  1XMT A;  3KKW A;  5I0C A;  4KVO E;  5JPH A;  2G3A A;  5IV0 A;  5IB0 A;  5CNP A;  2JDD A;  1NMT A;  3QAH A;  4CRY B;  2HUZ A;  4UWI A;  3VWD A;  4B5P B;  2Z0Z A;  1V0C A;  3PZJ A;  4KOW A;  2OH1 A;  5ISV A;  3LOD A;  5EC4 A;  3TOA A;  1NE9 A;  2B5G B;  2G3T A;  1Y9K A;  3IGR A;  3W6X A;  4MY0 A;  1KUV A;  2P0W A;  4E0A A;  3FXT A;  3SXO A;  2J8R A;  1BO4 A;  4M3S A;  4PSX A;  3RYO A;  2VQY A;  4M85 A;  3GYA A;  4E8O A;  5C88 A;  2Q4Y A;  4KOV A;  1KUX A;  3F5B A;  4KLV A;  1NSL A;  4F6A A;  4PK3 A;  1XF8 A;  1IIC A;  2G0B A;  2B58 A;  1QSR A;  1VHS A;  4UA3 A;  3JUW A;  2QML A;  4YFJ A;  4DNC A;  2I00 A;  2R1I A;  1S5K A;  4IUS A;  3W91 A;  2O28 A;  2Z10 A;  2J8N A;  4R3K A;  2PR1 A;  2FCK A;  3EO4 A;  2GAN A;  3TO6 A;  1KZF A;  2R8V A;  1TIQ A;  4AG9 A;  5EBV A;  2FE7 A;  4CRZ B;  2FL4 A;  3TCV A;  4JWP A;  1YRE A;  4KUA A;  1MK4 A;  2F5I A;  1YK3 A;  4MHD A;  1B6B A;  2QEC A;  4K30 A;  4MY3 A;  1B87 A;  1S60 A;  4OAE A;  1VKC A;  4MJ8 A;  3GY9 A;  4OLL A;  4QB9 A;  3BLN A;  4KVM E;  1CJW A;  3LD2 A;  1Q2D A;  4UBR A;  1QST A;  3R9G A;  3R9F A;  2REF A;  4KZT A;  4U9Y A;  2D4O A;  3T9Y A;  3S6H A;  4NXY A;  1WK4 A;  2HQY A;  2R7H A;  1K4J A;  5FVJ A;  4B5O A;  2PC1 A;  4AB7 A;  3H4Q A;  2B3U A;  2VBQ A;  5KTA A;  1L0C A;  3GKR A;  2FS5 A;  4FD4 A;  4E2A A;  2R98 A;  2CNT A;  2CNS A;  1CM0 A;  2REE A;  3DR6 A;  4QUS A;  2CNM A;  1P4N A;  1RXT A;  2I79 A;  2WPW A;  4KOS A;  1M1D A;  3F8K A;  3BJ8 A;  1I21 A;  4KOY A;  4XNH C;  1RO5 A;  4PV6 A;  1KUY A;  3TE4 A;  4R3L A;  5HMN A;  4U9Z A;  1QSN A;  3EXN A;  2PRB A;  2FIW A;  1IID A;  1I1D A;  1SQH A;  4MBU A;  3S6K A;  1U6M A;  3ZZI A;  2B4D A;  4BMH A;  3SHP A;  4AG7 A;  5F47 A;  5IX3 A;  1Q2C A;  2OZH A;  4QC6 A;  4PSW A;  2GIV A;  3S6F A;  5E96 A;  2Q7B A;  1M4D A;  4LX9 A;  2BUE A;  5H84 A;  2PQ8 A;  1GHE A;  2QIR A;  5HH1 A;  4H6U A;  4HKF A;  5J8F A;  1S7F A;  4FD6 A;  1S7N A;  3EC4 A;  4YRH A;  4XNH B;  2RC4 A;  2Q44 A;  3CXQ A;  5KTC A;  3F0A A;  3EY5 A;  2VEZ A;  1YR0 A;  3PGP A;  2J8M A;  2EVN A;  3E0K A;  2VXK A;  2JDC A;  2ZXV A;  1S3Z A;  2A4N A;  4KOX A;  3S6G A;  3D2P A;  1YLE A;  3FYN A;  3D2M A;  1WWZ A;  5KTD A;  3IWG A;  3CXS A;  2HV2 A;  4KOR A;  3T90 A;  3QB8 A;  3TOB A;  3K9U A;  2ATR A;  4OAD A;  3FBU A;  1YVK A;  4KUB A;  4NEX A;  2P6E A;  2VZY A;  4GS4 A;  5F49 A;  4XPL A;  2GE3 A;  3R95 A;  4II9 A;  4R57 A;  2B3V A;  4R87 A;  3TO7 A;  3MGD A;  2WPX A;  3DNS A;  3UY5 A;  2ZW7 A;  2PR8 A;  2X7B A;  1M4I A;  1UFH A;  4Y49 B;  2P6F A;  3CXP A;  3C26 A;  4NCZ A;  1OZP A;  4PK2 A;  2EUI A;  2BEI A;  5DWN A;  1ON0 A;  1IYK A;  3I9S A;  3FRM A;  4YGO A;  2FT0 A;  4HNW B;  4X5K A;  2VZZ A;  2OZG A;  3OWC A;  1BOB A;  4J3G A;  1R57 A;  2IL4 A;  2BSW A;  1M4G A;  3R9E A;  3R96 A;  4ZBG A;  4JD6 A;  3B8G A;  3TO9 A;  1MJ9 A;  3P2H A;  4CAW A;  3JVN A;  3TFY A;  1I12 A;  3R1K A;  1J4J A;  4KOT A;  1QSM A;  2FXF A;  2JLM A;  4JLY A;  4ORF A;  1IB1 E;  1FY7 A;  3WR7 A;  2VI7 A;  5C82 A;  4L8A A;  4I49 A;  1Y9W A;  1Z9U A;  2D4P A;  2Q0Y A;  4KVX A;  3VWE A;  2Q4V A;  4EVY A;  1XE4 A;  4HNX B;  2PDO A;  4JXQ A;  1XIX A;  2KCW A;  5GCN A;  3NE7 A;  2B4B A;  4UWJ A;  1S7K A;  4CS0 B;  4LUA A;  1PU9 A;  4XPK A;  2ZW5 A;  3TT2 A;  4H89 A;  4IF5 A;  2H5M A;  2Z11 A;  5F46 A;  3DSB A;  1YGH A;  2ZPA A;  2P6G A;  4AVB A;  4QBJ A;  3PP9 A;  4FD7 A;  3FIX A;  3I3G A;  4KLW A;  1IYL A;  5JQ4 A;  4U5Y A;  2AE6 A;  3G8W A;  2CY2 A;  4NF1 A;  4QVT A;  1MJA A;  4AVC A;  1LRZ A;  2FSR A;  3FNC A;  5DWM A;  2Q04 A;  4B5P A;  5J8C A;  4Y49 C;  1XEB A;  3BJ7 A;  1Z4E A;  3D3S A;  4RI1 A;  2OU2 A;  2B5G A;  1Y7R A;  2PSW A;  1PUA A;  3N7Z A;  3EFA A;  3V8I A;  2Y0M A;  2FIA A;  4H6Z A;  4CAX A;  4ONU A;  3ZJ0 A;  4XPD C;  4FD5 A;  1S7L A;  2DXQ A;  2JEV A;  2K5T A;  4HNY B;  2BL1 A;  3FB3 A;  2C27 A;  4NSQ A;  4L89 A;  2ZW4 A;  3G3S A;  1N71 A;  1M44 A;  1QSO A;  1YX0 A;  2ARH A;  2OZU A;  3P2F A;  4CAV A;  2B4D B;  2OB0 A; 
#chains in the Genus database with same CATH topology
 3D8P A;  4OIW A;  4F0X A;  4A37 A;  4MI4 A;  4NGS A;  4IAV A;  3DDD A;  4MHZ A;  4OID A;  4A38 A;  2AJ6 A;  5AGE A;  4F0Y A;  1YVO A;  2AFO A;  2ZW6 A;  5F09 A;  2IJZ A;  3B3S A;  3PB6 X;  3SJE A;  2ABZ A;  1Z4R A;  3DR8 A;  4PXC A;  2NMT A;  4KOU A;  1Q2Y A;  4NGQ A;  4RS2 A;  4FBE A;  1ZLH A;  5H86 A;  3IU2 A;  4R9M A;  3PB9 X;  4A2Z A;  3SXN A;  4AVA A;  1QQ9 A;  1Z2L A;  3W6S A;  4P4I A;  1P0H A;  2ZEO A;  4JJX A;  4JXR A;  3NE8 A;  2Z3O A;  4XPD B;  5THW A;  3TTH A;  1MJB A;  5F48 A;  1Z5R A;  4MHP A;  1XMT A;  3KKW A;  4P45 A;  5I0C A;  3JTK A;  4UEZ A;  4KVO E;  4CGM A;  5JPH A;  1DE4 C;  2G3A A;  4MFL A;  5IV0 A;  5IB0 A;  3H8F A;  5CNP A;  2JDD A;  1NMT A;  3FED A;  3KGQ A;  2PIY A;  3QAH A;  4CRY B;  2HUZ A;  4UWI A;  3SJF A;  3VWD A;  1XJO A;  4B5P B;  2Z0Z A;  1V0C A;  3D4U A;  2AFW A;  3PZJ A;  5AG4 A;  5HXD A;  3KQZ A;  4ZYQ A;  4CYP A;  4KOW A;  2OH1 A;  4GM5 A;  4Q36 A;  2V77 A;  3D7D A;  5ISV A;  2PJ2 A;  3LOD A;  2PJ7 A;  5EC4 A;  3TOA A;  1NE9 A;  2B5G B;  2G3T A;  2XEJ A;  1TKJ A;  2JBK A;  5G22 A;  4BBH A;  4CGP A;  1Y9K A;  4OC2 A;  3IGR A;  3W6X A;  4MY0 A;  1KUV A;  1Q7L A;  2P0W A;  4E0A A;  3FXT A;  4Z65 A;  1R43 A;  4X2T A;  3SXO A;  3FF3 A;  2J8R A;  3PBE A;  1BO4 A;  1CG2 A;  4M3S A;  1ZLI A;  3IEH A;  4M6I A;  1LFW A;  4PSX A;  4KSA A;  3PFE A;  4PXB A;  4C7H A;  1IY7 A;  3NH5 A;  4P4D A;  3RYO A;  2ZED A;  2VQY A;  1JWQ A;  2AFZ A;  4M85 A;  2YND A;  3GYA A;  4E8O A;  5C88 A;  2Q4Y A;  1NSA A;  1ZG9 A;  4KOV A;  1KUX A;  3F5B A;  4KLV A;  3RBU A;  1BLL E;  1NSL A;  5LYF A;  1CPX A;  4BIN A;  4F6A A;  4PK3 A;  1XF8 A;  3GLJ A;  1IIC A;  2G0B A;  3KR4 A;  1BPM A;  2B58 A;  3CT9 A;  2NYQ A;  1QSR A;  2ZOG A;  1VHS A;  4UA3 A;  3JUW A;  2QML A;  2PJA A;  5ELY A;  4DNC A;  2PJ1 A;  3FVL A;  4YFJ A;  2I00 A;  1AMP A;  4F9V A;  2R1I A;  4NGP A;  3PBB A;  3PEI A;  1S5K A;  4CYN A;  1X12 A;  2Z3L A;  4B13 A;  3PFO A;  4BD9 A;  1A2Z A;  4IUS A;  3W91 A;  2OOT A;  4FWU A;  4P10 A;  1GYT A;  1CP7 A;  2O28 A;  2Z10 A;  3H8G A;  2J8N A;  4R3K A;  4A39 A;  1TKF A;  2YNE A;  5AG5 A;  2PR1 A;  4MFJ A;  2FCK A;  3BI0 A;  1QMU A;  3EO4 A;  3LWU A;  3VH9 A;  2CXA A;  4DYO A;  4NGN A;  2GAN A;  3TO6 A;  3WC7 A;  4F8Z A;  1KZF A;  2R8V A;  3NFZ A;  4HPS A;  2EK8 A;  1TIQ A;  4AG9 A;  3D66 A;  2CTC A;  3BXM A;  3SJG A;  5EBV A;  2FE7 A;  4CRZ B;  2FL4 A;  4UFW A;  4UF4 A;  3TCV A;  4JWP A;  1YRE A;  2QYV A;  4C68 A;  3PB8 X;  1F2P A;  2AFM A;  1H8L A;  4KUA A;  4MFZ A;  1MK4 A;  2F5I A;  2V8H A;  3PB4 X;  4Q38 A;  4A30 A;  2EWB A;  3FH4 A;  3PB7 X;  2Z3P A;  1LCP A;  1YK3 A;  4MHD A;  1B6B A;  4O23 A;  2QEC A;  4K30 A;  2YNC C;  4MY3 A;  1B87 A;  1S60 A;  2Q51 A;  4OAE A;  2PVW A;  1VKC A;  2I3C A;  4MJ8 A;  2O4H A;  3GY9 A;  4OLL A;  1BPN A;  3HUV A;  1IGB A;  4MFQ A;  4QB9 A;  3BLN A;  4MHN A;  4UEE A;  4KVM E;  3RNZ A;  1HDU A;  1ARL A;  4CYO A;  2XEG A;  1CJW A;  3LD2 A;  1Q2D A;  4UBR A;  4X3R A;  1QST A;  2C1C A;  3R9G A;  5A28 A;  4R8F A;  3B3W A;  3MRU A;  3MN8 A;  5LYL A;  2F8H A;  3KR5 A;  3R9F A;  2PIZ A;  4OKO A;  2REF A;  1YQE A;  4KZT A;  2HC9 A;  4U9Y A;  4UIA A;  2D4O A;  3T9Y A;  3S6H A;  3CDX A;  1VHE A;  4NXY A;  1WK4 A;  2F7V A;  2HQY A;  2R7H A;  1K4J A;  5FVJ A;  3RAM A;  4B5O A;  4MCP A;  4UCP A;  2OR4 A;  2PC1 A;  3HLP A;  3LAC A;  4AB7 A;  4RN7 A;  3H4Q A;  2B3U A;  1F57 A;  2VBQ A;  1L0C A;  2Z3M A;  3QNV A;  5KTA A;  2G9D A;  2PJ5 A;  3RZA A;  3GKR A;  2FS5 A;  2Z3K A;  1AYE A;  4FD4 A;  4E2A A;  2POK A;  4TNU A;  4A95 A;  1VGY A;  2R98 A;  2CNT A;  2CNS A;  5IB9 A;  3NA6 A;  1XMB A;  1CM0 A;  2REE A;  4OC4 A;  3DR6 A;  4P4F A;  5JH9 A;  4QUS A;  1KWM A;  2CNM A;  1P4N A;  3KQX A;  1RXT A;  1XBU A;  2I79 A;  2WPW A;  4KOS A;  1M1D A;  3F8K A;  4C2Y A;  2ZEG A;  4ZY1 A;  3BJ8 A;  1YW6 A;  3IFE A;  4WJB A;  3B3C A;  1Z8W A;  4NFR A;  3V38 A;  4RUH A;  1I21 A;  4KOY A;  4P44 A;  4B6Z A;  3LMS A;  4OC0 A;  5CBM A;  1PCA A;  4UFV A;  4XNH C;  3SI1 A;  1LOK A;  1VHO A;  2XEF A;  1RO5 A;  4PV6 A;  4ZX8 A;  4H2K A;  1KUY A;  3B7I A;  3TE4 A;  2IMO A;  4R3L A;  5HMN A;  2V8V A;  4U9Z A;  1QSN A;  1Y0R A;  2WUU A;  1YLO A;  5LYI A;  3EXN A;  1UWY A;  5AG6 A;  4R6T A;  2CF4 A;  2PRB A;  4UEF A;  2FIW A;  2O53 A;  4MFK A;  4A32 A;  2PJ3 A;  1IID A;  1I1D A;  1SQH A;  4MBU A;  3S6K A;  2AFS A;  4PQA A;  1U6M A;  3ZZI A;  2RFH A;  2B4D A;  4MCQ A;  4OME A;  1TF8 A;  3SHP A;  4BMH A;  1Z8L A;  4AG7 A;  5F47 A;  5IX3 A;  1Q2C A;  2OZH A;  1LAP A;  1HDQ A;  2AFU A;  4QC6 A;  4PSW A;  2PCU A;  4KS9 A;  2GIV A;  3S6F A;  3CZX A;  5E96 A;  2Q7B A;  3IO1 A;  1CX8 A;  3D7F A;  1M4D A;  4LX9 A;  2BUE A;  4ZY0 A;  2WZN A;  5H84 A;  2J9A A;  2PQ8 A;  3FEC A;  1GHE A;  2QIR A;  5HH1 A;  4H6U A;  3D7H A;  4HKF A;  4A31 A;  5J8F A;  1S7F A;  4FD6 A;  1OBR A;  1YSJ A;  2PJ6 A;  1S7N A;  4OC1 A;  3EC4 A;  5BWA B;  4YRH A;  4XNH B;  2RC4 A;  2Q44 A;  2PJ4 A;  4JZ0 A;  4Q7A A;  3CXQ A;  1X10 A;  4ZI6 A;  8CPA A;  1ZG8 A;  5K8O A;  5KTC A;  5D8N A;  2RB7 A;  1PYT B;  2WSA A;  3EY5 A;  2VEZ A;  3F0A A;  1YR0 A;  3PGP A;  2J8M A;  4NGM A;  2DF5 A;  4EFD A;  1DTD A;  2EVN A;  3KZW A;  4MCS A;  3E0K A;  2VXK A;  2JDC A;  2ZXV A;  1F2O A;  2ZEP A;  4P4J A;  1S3Z A;  2A4N A;  3JRU A;  3KAS A;  4KOX A;  5LRJ A;  3FEE A;  1CBX A;  3S6G A;  3D2P A;  1YLE A;  3FYN A;  2V8D A;  3D2M A;  1WWZ A;  1IOI A;  2ZEH A;  3A9L A;  3H8E A;  5KTD A;  3IWG A;  3CXS A;  1YME A;  2HV2 A;  2GLJ A;  2DEA A;  4KOR A;  2PJC A;  3T90 A;  1FT7 A;  3B2Y A;  3QB8 A;  3RO0 A;  3TOB A;  2GRE A;  3K9U A;  3DLJ A;  2ATR A;  3NH4 A;  4YWY A;  5K8N A;  4OAD A;  1EE3 P;  3GB0 A;  3FBU A;  1BAV A;  1AUG A;  4DJL A;  1YVK A;  3IIB A;  2PRQ A;  3CPA A;  4LQG A;  4KUB A;  4NEX A;  1VIX A;  2P6E A;  2VZY A;  4GS4 A;  5F49 A;  4ZY2 A;  3L2N A;  4XPL A;  1CP6 A;  2ODF A;  3K9T A;  2GE3 A;  3R95 A;  4II9 A;  2PJB A;  3QAY A;  4R57 A;  5G1Z A;  2B3V A;  4F9U A;  3VAR A;  1ZG7 A;  4R87 A;  3TO7 A;  6CPA A;  4MFP A;  3MGD A;  5J1Q A;  4UIB A;  2WPX A;  3DNS A;  4B14 A;  3D68 A;  2ZW7 A;  3ISX A;  3UY5 A;  2PR8 A;  1TF9 A;  2X7B A;  1M4I A;  1UFH A;  4Y49 B;  3T8W A;  4A33 A;  4A94 A;  4ZGY B;  5K8P A;  2P6F A;  1ELL P;  2HB6 A;  4FUU A;  3NH8 A;  2EK9 A;  5JM6 A;  3CXP A;  4M6G A;  3ISZ A;  3WAB A;  3C26 A;  2ZEN A;  3GUX A;  4NCZ A;  3WC5 A;  3BI1 A;  1OZP A;  2GLF A;  4LQ6 A;  4PK2 A;  2EUI A;  2XEI A;  2BEI A;  5EMI A;  5DWN A;  1ON0 A;  3KI9 A;  1IYK A;  3I9S A;  2VL1 A;  3VAT A;  2DPS A;  5K8M A;  2BCO A;  3FRM A;  2GU2 A;  4YGO A;  4NJQ A;  2FT0 A;  3PRT A;  3WT4 A;  4HNW B;  4X5K A;  4C7I A;  3FX6 A;  1XRY A;  3IC1 A;  2VZZ A;  5LYD A;  2OZG A;  1CPS A;  3OWC A;  4R76 A;  1BOB A;  4J3G A;  4B12 A;  4CAE A;  4P6Y A;  4CGL A;  2DPT A;  4CGO A;  1R57 A;  2ZOF A;  4AXV A;  2Q4Z A;  2IL4 A;  2BSW A;  5D29 A;  1M4G A;  3R9E A;  3R96 A;  4ZBG A;  4JD6 A;  1LAM A;  4ZX9 A;  3B8G A;  1Z8T A;  3TO9 A;  3DGV A;  2PJ9 A;  1JQG A;  3KHZ A;  4B10 A;  1MJ9 A;  3P2H A;  4X8I A;  4CAW A;  4W9Y A;  3JVN A;  4PXD A;  5JGF A;  3TFY A;  4KSI A;  1I12 A;  2BOA A;  3R1K A;  1J4J A;  1TKH A;  2PVV A;  5DS0 A;  3B35 A;  4GXH A;  4CGN A;  4FAI A;  5HVG A;  4KOT A;  2Q43 A;  2NSM A;  4M6H A;  1QSM A;  2FXF A;  2JLM A;  3BHX A;  4UCM A;  3N5F A;  4IK2 A;  4TWE A;  4JLY A;  4IHM A;  4ORF A;  2QJ8 A;  2C6C A;  1IB1 E;  4P4E A;  1LAN A;  2ZEM A;  1FY7 A;  3WR7 A;  4R7M A;  2VI7 A;  4JYW A;  4NGT A;  4MCR A;  4KSF A;  1HEE A;  5C82 A;  3B3V A;  4L8A A;  5CPA A;  1YW4 A;  4K3N A;  4I49 A;  1Y9W A;  1Z9U A;  4MRI A;  1FNO A;  2D4P A;  4WWV A;  3WC6 A;  2Q0Y A;  4KVX A;  5AG7 A;  3VWE A;  2Q4V A;  4EVY A;  2QVP A;  1IOF A;  1XE4 A;  2PDO A;  2C6G A;  4HNX B;  4JXQ A;  4P4B A;  4UCN A;  1XIX A;  2KCW A;  5GCN A;  3NE7 A;  2B4B A;  5A27 A;  4OC3 A;  4UWJ A;  3SJX A;  1S7K A;  4MHY A;  4CS0 B;  1IU8 A;  4LUA A;  1PU9 A;  1ELM P;  1XOV A;  2ANP A;  2ZW5 A;  3FMC A;  4ONW A;  4XPK A;  3TT2 A;  1TXR A;  4H89 A;  4IF5 A;  1ARM A;  2H5M A;  2IQ6 A;  1M4L A;  2Z11 A;  4G1P A;  5F46 A;  4NJR A;  3DSB A;  2PE3 A;  3H5Z A;  2PJ8 A;  1YGH A;  2ZPA A;  2P6G A;  4AVB A;  4QBJ A;  2WYR A;  3PP9 A;  5HVF A;  2PJ0 A;  4FD7 A;  2GFQ A;  3FIX A;  3I3G A;  4PPZ A;  4KLW A;  1IYL A;  5JQ4 A;  4U5Y A;  2AE6 A;  3G8W A;  5HVH A;  2C6P A;  2JEW A;  2CY2 A;  4NF1 A;  4QVT A;  5G20 A;  1MJA A;  4AVC A;  3S9M A;  1LRZ A;  4CAF A;  2BO9 A;  2ZEE A;  4PXE A;  2FSR A;  3FNC A;  3IJ3 A;  3FJU A;  2YNC A;  5DWM A;  2Q04 A;  4C2X A;  4CYQ A;  5I4M A;  4B5P A;  4B11 A;  2Q7S A;  5J8C A;  4Y49 C;  1XEB A;  2JBJ A;  1R3N A;  3BJ7 A;  3I1U A;  2Z3N A;  3B3T A;  1Z4E A;  3D3S A;  4MMO A;  3IWW A;  4RI1 A;  3TX8 A;  2OU2 A;  3S9L A;  2B5G A;  1Y7R A;  3V7Z A;  2YGW A;  2PSW A;  1ZO0 A;  1PUA A;  2FVG A;  3CPX A;  4CPA A;  1Y0Y A;  2AFX A;  4C2Z A;  4DUK A;  3N7Z A;  3IU1 A;  5LRK A;  4OC5 A;  4UFX A;  3EFA A;  3S9N A;  2EO8 A;  3V8I A;  1XFO A;  2Y0M A;  2FIA A;  2CIJ A;  4NGR A;  3SI2 A;  2EBJ A;  4H6Z A;  1Z8X A;  7CPA A;  3D67 A;  3KL9 A;  4CAX A;  4ONU A;  3IWE A;  3ZJ0 A;  5G21 A;  1RTQ A;  4XPD C;  4FD5 A;  3K2K A;  1S7L A;  2DXQ A;  2CTB A;  2JEV A;  2K5T A;  2V8G A;  5LRG A;  4HNY B;  1Y7E A;  4YU9 A;  4OP4 A;  2BL1 A;  2ZEF A;  4EWT A;  3FB3 A;  3D7G A;  2C27 A;  2ZEL A;  4L89 A;  4NSQ A;  3TC8 A;  4EME A;  2ZW4 A;  3G3S A;  1N71 A;  3KHX A;  1M44 A;  3SI0 A;  1QSO A;  1YX0 A;  2ARH A;  3GIU A;  2OZU A;  3P2F A;  4CAV A;  2B4D B;  4MXU A;  2OB0 A; 
#chains in the Genus database with same CATH homology
 3D8P A;  4F0X A;  4MI4 A;  3DDD A;  2AJ6 A;  5AGE A;  4F0Y A;  1YVO A;  2ZW6 A;  1Z4R A;  3DR8 A;  2NMT A;  4KOU A;  1Q2Y A;  4RS2 A;  5H86 A;  3IU2 A;  4R9M A;  4A2Z A;  3SXN A;  4AVA A;  3W6S A;  1P0H A;  4JJX A;  4JXR A;  2Z3O A;  4XPD B;  3TTH A;  1MJB A;  5F48 A;  1XMT A;  3KKW A;  5I0C A;  3JTK A;  4KVO E;  4CGM A;  5JPH A;  2G3A A;  4MFL A;  5IV0 A;  5IB0 A;  5CNP A;  2JDD A;  1NMT A;  3QAH A;  4CRY B;  2HUZ A;  4UWI A;  3VWD A;  4B5P B;  2Z0Z A;  1V0C A;  3PZJ A;  5AG4 A;  4CYP A;  4KOW A;  2OH1 A;  4Q36 A;  5ISV A;  3LOD A;  5EC4 A;  3TOA A;  1NE9 A;  2B5G B;  2G3T A;  5G22 A;  4BBH A;  4CGP A;  1Y9K A;  3IGR A;  3W6X A;  4MY0 A;  1KUV A;  2P0W A;  4E0A A;  3FXT A;  3SXO A;  2J8R A;  1BO4 A;  4M3S A;  4PSX A;  4C7H A;  4KSA A;  3RYO A;  2VQY A;  4M85 A;  2YND A;  3GYA A;  4E8O A;  5C88 A;  2Q4Y A;  4KOV A;  1KUX A;  3F5B A;  4KLV A;  1NSL A;  4F6A A;  4PK3 A;  1XF8 A;  1IIC A;  2G0B A;  2B58 A;  1QSR A;  1VHS A;  4UA3 A;  3JUW A;  2QML A;  4YFJ A;  4DNC A;  2I00 A;  2R1I A;  1S5K A;  4CYN A;  2Z3L A;  4B13 A;  4IUS A;  3W91 A;  2O28 A;  2Z10 A;  2J8N A;  4R3K A;  5AG5 A;  2YNE A;  2PR1 A;  4MFJ A;  2FCK A;  3EO4 A;  2CXA A;  2GAN A;  3TO6 A;  1KZF A;  2R8V A;  1TIQ A;  4AG9 A;  5EBV A;  2FE7 A;  4CRZ B;  2FL4 A;  4UFW A;  3TCV A;  4JWP A;  1YRE A;  4C68 A;  4KUA A;  4MFZ A;  1MK4 A;  2F5I A;  4Q38 A;  4A30 A;  2Z3P A;  1YK3 A;  4MHD A;  1B6B A;  2QEC A;  4K30 A;  2YNC C;  4MY3 A;  1B87 A;  1S60 A;  4OAE A;  1VKC A;  4MJ8 A;  3GY9 A;  4OLL A;  4QB9 A;  4MFQ A;  3BLN A;  4KVM E;  4CYO A;  1CJW A;  3LD2 A;  1Q2D A;  4UBR A;  1QST A;  3R9G A;  5A28 A;  3R9F A;  2REF A;  4KZT A;  4U9Y A;  2D4O A;  3T9Y A;  3S6H A;  4NXY A;  1WK4 A;  2HQY A;  2R7H A;  1K4J A;  5FVJ A;  4B5O A;  4UCP A;  2PC1 A;  4AB7 A;  3H4Q A;  2B3U A;  2VBQ A;  2Z3M A;  1L0C A;  5KTA A;  3GKR A;  2FS5 A;  2Z3K A;  4FD4 A;  4E2A A;  4A95 A;  2R98 A;  2CNT A;  2CNS A;  1CM0 A;  2REE A;  3DR6 A;  4QUS A;  2CNM A;  1P4N A;  1RXT A;  2I79 A;  2WPW A;  4KOS A;  1M1D A;  3F8K A;  4C2Y A;  3BJ8 A;  1I21 A;  4KOY A;  4UFV A;  4XNH C;  1RO5 A;  4PV6 A;  1KUY A;  3TE4 A;  4R3L A;  5HMN A;  4U9Z A;  1QSN A;  2WUU A;  3EXN A;  5AG6 A;  2PRB A;  2FIW A;  4MFK A;  4A32 A;  1IID A;  1I1D A;  1SQH A;  4MBU A;  3S6K A;  1U6M A;  3ZZI A;  2B4D A;  4BMH A;  3SHP A;  4AG7 A;  5F47 A;  5IX3 A;  1Q2C A;  2OZH A;  4QC6 A;  4PSW A;  4KS9 A;  2GIV A;  3S6F A;  5E96 A;  2Q7B A;  1M4D A;  4LX9 A;  2BUE A;  5H84 A;  2PQ8 A;  1GHE A;  2QIR A;  5HH1 A;  4H6U A;  4HKF A;  4A31 A;  5J8F A;  1S7F A;  4FD6 A;  1S7N A;  3EC4 A;  5BWA B;  4YRH A;  4XNH B;  2RC4 A;  2Q44 A;  3CXQ A;  5KTC A;  2WSA A;  3EY5 A;  2VEZ A;  3F0A A;  1YR0 A;  3PGP A;  2J8M A;  2EVN A;  3E0K A;  2VXK A;  2JDC A;  2ZXV A;  1S3Z A;  2A4N A;  4KOX A;  3S6G A;  3D2P A;  1YLE A;  3FYN A;  3D2M A;  1WWZ A;  3A9L A;  5KTD A;  3IWG A;  3CXS A;  2HV2 A;  4KOR A;  3T90 A;  3QB8 A;  3TOB A;  3K9U A;  2ATR A;  4OAD A;  3FBU A;  1YVK A;  4KUB A;  4NEX A;  2P6E A;  2VZY A;  4GS4 A;  5F49 A;  4XPL A;  2GE3 A;  3R95 A;  4II9 A;  5G1Z A;  4R57 A;  2B3V A;  4R87 A;  3TO7 A;  4MFP A;  3MGD A;  2WPX A;  3DNS A;  4B14 A;  3UY5 A;  2ZW7 A;  2PR8 A;  2X7B A;  1M4I A;  1UFH A;  4Y49 B;  4A33 A;  4ZGY B;  2P6F A;  3CXP A;  3C26 A;  4NCZ A;  1OZP A;  4PK2 A;  2EUI A;  2BEI A;  5DWN A;  1ON0 A;  1IYK A;  3I9S A;  2DPS A;  3FRM A;  4YGO A;  2FT0 A;  4HNW B;  4X5K A;  4C7I A;  2VZZ A;  2OZG A;  3OWC A;  1BOB A;  4J3G A;  4B12 A;  4CAE A;  4CGL A;  2DPT A;  4CGO A;  1R57 A;  2IL4 A;  2BSW A;  1M4G A;  3R9E A;  3R96 A;  4ZBG A;  4JD6 A;  3B8G A;  3TO9 A;  4B10 A;  1MJ9 A;  3P2H A;  4CAW A;  3JVN A;  3TFY A;  1I12 A;  3R1K A;  1J4J A;  4CGN A;  4KOT A;  1QSM A;  2FXF A;  2JLM A;  4UCM A;  4JLY A;  4ORF A;  1IB1 E;  1FY7 A;  3WR7 A;  2VI7 A;  4KSF A;  5C82 A;  4L8A A;  4I49 A;  1Y9W A;  1Z9U A;  2D4P A;  2Q0Y A;  4KVX A;  5AG7 A;  3VWE A;  2Q4V A;  4EVY A;  1XE4 A;  4HNX B;  2PDO A;  4UCN A;  4JXQ A;  1XIX A;  2KCW A;  5GCN A;  3NE7 A;  2B4B A;  5A27 A;  4UWJ A;  1S7K A;  4CS0 B;  4LUA A;  1PU9 A;  4XPK A;  2ZW5 A;  3TT2 A;  4H89 A;  4IF5 A;  2H5M A;  2Z11 A;  5F46 A;  3DSB A;  3H5Z A;  1YGH A;  2ZPA A;  2P6G A;  4AVB A;  4QBJ A;  3PP9 A;  4FD7 A;  3FIX A;  3I3G A;  4KLW A;  1IYL A;  5JQ4 A;  4U5Y A;  2AE6 A;  3G8W A;  2CY2 A;  4NF1 A;  4QVT A;  5G20 A;  1MJA A;  4AVC A;  1LRZ A;  4CAF A;  2FSR A;  3FNC A;  2YNC A;  5DWM A;  2Q04 A;  4C2X A;  4CYQ A;  4B5P A;  4B11 A;  5J8C A;  4Y49 C;  1XEB A;  3BJ7 A;  2Z3N A;  1Z4E A;  3D3S A;  4RI1 A;  2OU2 A;  2B5G A;  1Y7R A;  2YGW A;  2PSW A;  1ZO0 A;  1PUA A;  4C2Z A;  3N7Z A;  3IU1 A;  4UFX A;  3EFA A;  3V8I A;  2Y0M A;  2FIA A;  4H6Z A;  4CAX A;  4ONU A;  3IWE A;  3ZJ0 A;  5G21 A;  4XPD C;  4FD5 A;  1S7L A;  2DXQ A;  2JEV A;  2K5T A;  4HNY B;  2BL1 A;  3FB3 A;  2C27 A;  4NSQ A;  4L89 A;  2ZW4 A;  3G3S A;  1N71 A;  1M44 A;  1QSO A;  1YX0 A;  2ARH A;  2OZU A;  3P2F A;  4CAV A;  2B4D B;  2OB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...