5GCNA

Catalytic domain of tetrahymena gcn5 histone acetyltransferase in complex with coenzyme a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
166
structure length
166
Chain Sequence
MKGLLDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE ACETYLTRANSFERASE GCN5
publication title Solution structure of the catalytic domain of GCN5 histone acetyltransferase bound to coenzyme A
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Transferase
total genus 32
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 1999-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5gcnA00
3TO6A 3WR7A 5IV0A 3TE4A 4FD6A 5E96A 4PK2A 2H5MA 3DSBA 2CY2A 4FD7A 4QUSA 5EC4A 3GY9A 1K4JA 4IF5A 1B6BA 2QECA 2AJ6A 4MHDA 3FYNA 1XEBA 1S60A 3TFYA 3GKRA 4HNYB 1CM0A 3BJ8A 1U6MA 3IWGA 3FNCA 3G8WA 1RXTA 1J4JA 4UBRA 1UFHA 2PR8A 4L89A 4E2AA 4KLWA 1B87A 2FCKA 4DNCA 4B5PB 1MJAA 1CJWA 4AVCA 2B4BA 1KUVA 2Q7BA 1NSLA 1TIQA 4XPDB 4KVOE 4R3LA 4AG7A 2GANA 5C88A 1WWZA 2Z10A 4LX9A 2I79A 1VKCA 3EFAA 1I1DA 1PUAA 3H4QA 4R87A 3D3SA 4XPDC 4H6ZA 1S7NA 2CNSA 4ORFA 3D2PA 1RO5A 2Z11A 3S6FA 4AB7A 5DWNA 3FB3A 2JLMA 4Y49C 4F0YA 4CRYB 1QSNA 3DNSA 2GE3A 1NE9A 1IYLA 3TOAA 4F6AA 1M4GA 5FVJA 1YREA 1LRZA 4FD5A 4KVME 5JQ4A 3VWDA 1XMTA 4AG9A 2J8RA 1Y7RA 3QB8A 3R9EA 2REEA 2NMTA 3FBUA 1Z4RA 3B8GA 1KZFA 4ONUA 3TCVA 2ZW7A 3GYAA 2Q0YA 1M4IA 1MK4A 5I0CA 4PSXA 4PSWA 2Q04A 2J8MA 3OWCA 3S6KA 5H86A 4M3SA 2VQYA 4AVBA 4JXRA 2I00A 1YLEA 4UWJA 1PU9A 4KLVA 3TO9A 3BLNA 2G3AA 5GCNA 4M85A 2B58A 2GIVA 3DR8A 3ZJ0A 5ISVA 2Y0MA 2WPWA 3EY5A 2B4DA 3CXPA 1Q2DA 1L0CA 3EXNA 2PR1A 3I3GA 3G3SA 3S6GA 1YX0A 2HV2A 3W6XA 2PSWA 4XPKA 5IX3A 4XNHB 3FXTA 3TTHA 2BL1A 4L8AA 2VZYA 4CAVA 4KOTA 2B5GB 4LUAA 2BEIA 3JUWA 4AVAA 1XIXA 4ZBGA 2VXKA 4XPLA 1QSMA 2OZGA 2O28A 1NMTA 4OLLA 1QSTA 2HUZA 3V8IA 2OB0A 2FXFA 2K5TA 4RS2A 4NXYA 4PK3A 1KUXA 2EUIA 5J8FA 1XF8A 2OZUA 1GHEA 1M4DA 4U9YA 4IUSA 4CAWA 1Y9WA 5HMNA 1WK4A 1Z9UA 1YR0A 2G0BA 2FE7A 1Q2YA 1Q2CA 2P6EA 4EVYA 5F49A 5F47A 3N7ZA 4HKFA 2J8NA 4JLYA 3F8KA 4CRZB 1YGHA 2ATRA 2PC1A 4HNWB 4QBJA 4JD6A 4MBUA 4HNXB 1YK3A 5F46A 5DWMA 3QAHA 4QVTA 3SXNA 4B5PA 2DXQA 4KOVA 3TOBA 4NEXA 3R1KA 4NF1A 4UWIA 2C27A 4BMHA 5J8CA 2AE6A 3I9SA 2G3TA 2P0WA 1R57A 2BUEA 1YVKA 2EVNA 5F48A 1YVOA 2WPXA 2REFA 5H84A 2PQ8A 3SXOA 4JXQA 1S7LA 2OZHA 2FIAA 3R95A 3MGDA 4KOXA 1S7KA 1IB1E 2D4PA 1Z4EA 2JDCA 3EC4A 1XE4A 1KUYA 4J3GA 1FY7A 4KOYA 2FS5A 2ZW5A 4E0AA 3C26A 2VBQA 2Q4YA 1V0CA 3SHPA 3T9YA 4E8OA 4NSQA 1N71A 3TT2A 2R8VA 1Y9KA 4R3KA 3K9UA 2ZW6A 4QC6A 4R57A 2A4NA 3KKWA 3PZJA 2P6FA 5HH1A 3EO4A 5KTCA 4YFJA 4U5YA 4FD4A 2QMLA 2Z0ZA 2B3UA 3NE7A 1S3ZA 3R9GA 3LODA 2R98A 4MY3A 2Q44A 4GS4A 3W6SA 3E0KA 1M1DA 2KCWA 1BOBA 3F5BA 4XNHC 3DR6A 3F0AA 1QSOA 2ZPAA 4PV6A 5KTDA 4I49A 2D4OA 2JDDA 3UY5A 2R7HA 3P2FA 1QSRA 2VI7A 1S5KA 3IGRA 2PDOA 4OAEA 4RI1A 5EBVA 4MJ8A 5KTAA 4B5OA 4R9MA 4KOSA 3FIXA 4K30A 2ARHA 4U9ZA 4CAXA 3S6HA 3R9FA 2VZZA 2FT0A 1OZPA 4KUBA 4KUAA 1P0HA 3LD2A 5JPHA 2OH1A 3T90A 2RC4A 2FL4A 4II9A 4Y49B 2VEZA 4X5KA 1SQHA 2B3VA 2FSRA 2IL4A 2F5IA 2B5GA 1M44A 1I21A 3VWEA 3TO7A 1VHSA 3JVNA 4UA3A 3CXSA 3PGPA 1IICA 4YRHA 2CNTA 2CNMA 2BSWA 2ZXVA 4QB9A 2FIWA 3DDDA 2R1IA 4KVXA 2B4DB 3D8PA 4KOWA 4KZTA 1S7FA 1MJBA 2X7BA 2Q4VA 4KORA 5CNPA 3BJ7A 1I12A 5IB0A 4H89A 4MY0A 1MJ9A 3CXQA 4OADA 3W91A 2ZW4A 1ON0A 1IYKA 4YGOA 4JWPA 1IIDA 3R96A 2PRBA 2QIRA 4H6UA 5C82A 2OU2A 2HQYA 3RYOA 2JEVA 3P2HA 3D2MA 4CS0B 2P6GA 4MI4A 1P4NA 4NCZA 3FRMA 3ZZIA 4JJXA 1BO4A 4KOUA 3PP9A
chains in the Genus database with same CATH superfamily
3TO6A 3WR7A 4AXVA 5IV0A 4YU9A 2YNCA 3KI9A 3TE4A 3GB0A 4FD6A 4C2XA 5E96A 4PK2A 4CYOA 4C7IA 2H5MA 3DSBA 2CY2A 3FVLA 4FD7A 2YNDA 4QUSA 1AUGA 4A33A 5I4MA 3NE8A 5EC4A 3GY9A 3BXMA 3CPXA 1K4JA 4IF5A 4F0XA 1B6BA 6CPAA 1Z2LA 2QECA 2DPSA 8CPAA 2PJ4A 2AJ6A 3FF3A 5IB9A 3WT4A 4MHDA 3FYNA 2V8DA 1XEBA 1S60A 2AFWA 3TFYA 3GKRA 4HNYB 2GREA 2ZOFA 3CT9A 4LQ6A 1CM0A 4P4BA 3BJ8A 3PRTA 4WJBA 2Q4ZA 2RFHA 4OC5A 4NFRA 5AG4A 1U6MA 3IWGA 2WSAA 3FNCA 4UCNA 3G8WA 3WABA 1RXTA 1J4JA 2EK9A 4UBRA 1UFHA 3H8GA 4F9VA 4B6ZA 2PR8A 5JGFA 4L89A 4UFXA 1NSAA 1VHOA 3NH5A 4E2AA 4OMEA 4CGPA 5F09A 1HDQA 4P10A 2G9DA 4KLWA 1B87A 4UF4A 2FCKA 4MHYA 2POKA 1VHEA 4DNCA 2WZNA 4B5PB 5HVHA 5K8OA 1MJAA 1CJWA 3H8FA 2B4BA 2CF4A 4AVCA 1CX8A 1KUVA 3MRUA 1VIXA 4PXEA 2Q7BA 2YGWA 1NSLA 3B3CA 1TIQA 4XPDB 5J1QA 2PJ7A 4DYOA 4NJQA 4KVOE 2ZENA 2EBJA 3IO1A 1YSJA 2QYVA 3D7DA 4R3LA 2Q51A 4AG7A 1ELLP 1XOVA 4IK2A 2O4HA 2GANA 5C88A 3N5FA 5A27A 1WWZA 4ZX9A 2Z10A 3D7HA 1Z5RA 4KSFA 4LX9A 2I79A 1VKCA 3EFAA 4OC3A 1I1DA 1PUAA 3H4QA 4R87A 1TKJA 1M4LA 4ONWA 3D3SA 4XPDC 4H6ZA 1S7NA 2CNSA 4A30A 4ORFA 2JBJA 3D2PA 1ZLIA 4K3NA 1IGBA 1RO5A 5HVGA 2PRQA 2Z11A 5G1ZA 2QVPA 3S6FA 3V7ZA 4AB7A 5DWNA 3FB3A 2JLMA 4Y49C 4F0YA 4CRYB 1QSNA 3DNSA 2GE3A 2PJCA 1NE9A 4PPZA 1X10A 3LACA 1IYLA 4Q36A 3TOAA 4F6AA 1BLLE 1M4GA 3QAYA 3IWWA 5FVJA 3T8WA 3KR5A 1QQ9A 4C7HA 2Z3PA 3SJFA 1CP7A 1FNOA 4A2ZA 1YREA 3FMCA 3PB7X 1LRZA 4FD5A 4KVME 3H8EA 5JQ4A 1ZG9A 3VWDA 1XMTA 4AG9A 2J8RA 1Y7RA 3QB8A 4NJRA 5AGEA 3R9EA 2REEA 4BBHA 4YWYA 2NMTA 3FBUA 5THWA 1Z4RA 1BPNA 3LMSA 4WWVA 4F9UA 1OBRA 3B8GA 5JM6A 1KZFA 3KGQA 4ONUA 3KQXA 3TC8A 3TCVA 2DEAA 2ZW7A 4PXBA 4CYPA 3GYAA 5K8MA 3NH8A 2Q0YA 1M4IA 1MK4A 5I0CA 2PVWA 2I3CA 4PSXA 4PSWA 2Q04A 4A31A 3HLPA 2DF5A 2J8MA 3OWCA 3S6KA 4RN7A 1Z8LA 3BHXA 3FEEA 1Z8WA 3LWUA 5H86A 4ZY0A 2V8GA 2XEJA 4DUKA 4Q7AA 2AFUA 3RNZA 2PJ6A 4M3SA 3B3TA 2VQYA 4AVBA 3IWEA 4JXRA 2ZELA 2I00A 5JH9A 1YLEA 4UWJA 1PU9A 4KLVA 1HDUA 3RO0A 5K8PA 2PCUA 3TO9A 1F2PA 2WYRA 3BLNA 3RAMA 5EMIA 2F8HA 2G3AA 5GCNA 4M85A 2B58A 2GIVA 3DR8A 3ZJ0A 3FJUA 2ZEDA 1X12A 4UCMA 5DS0A 5ISVA 4OC1A 2Y0MA 2WPWA 3EY5A 4O23A 4X3RA 4M6HA 2B4DA 3CXPA 1Q2DA 1L0CA 1CPXA 2PR1A 3EXNA 3PB4X 2Z3OA 5CBMA 3I3GA 2IMOA 3G3SA 1YX0A 3IFEA 2HV2A 3S6GA 1ZG7A 3W6XA 2PSWA 4XPKA 5IX3A 4XNHB 3WC5A 4ZGYB 4MCQA 1R43A 3FXTA 1DE4C 3TTHA 2BL1A 4FUUA 5AG6A 1EE3P 1TKHA 4L8AA 2ZEFA 2XEIA 2PE3A 3DGVA 2C6CA 2AFSA 2VZYA 4CAVA 4KOTA 4G1PA 2B5GB 4C2ZA 3ISXA 3B2YA 1CBXA 4LUAA 4KSIA 2BEIA 4PXCA 1F57A 3JUWA 4AVAA 1XIXA 4ZBGA 2ANPA 2VXKA 3V38A 2EO8A 4A39A 4XPLA 1QSMA 2OZGA 2RB7A 4KOUA 2O28A 1NMTA 4OLLA 1QSTA 1CPSA 2HUZA 3V8IA 3D7GA 2WUUA 2OB0A 3B3WA 2FXFA 2K5TA 4RS2A 4A37A 2JBKA 2BCOA 1TF8A 4NXYA 4P4IA 2PVVA 3VATA 1LAMA 4PK3A 1KUXA 2EUIA 4MHPA 3WC6A 2C6GA 5J8FA 1XF8A 4CAFA 1RTQA 2OZUA 1GHEA 3GIUA 2AFOA 4Q38A 1M4DA 3PFOA 4TNUA 4U9YA 4CGLA 4IUSA 1XMBA 1JQGA 4HPSA 4CAWA 1Y9WA 4JYWA 3KR4A 2ZEGA 3A9LA 5HMNA 4C68A 4R6TA 1WK4A 4NGMA 3D67A 4MHNA 5D8NA 4W9YA 1Z9UA 1YR0A 1LOKA 2G0BA 1TXRA 2FE7A 4UIAA 4A95A 1Q2YA 3D66A 1Q2CA 4M6GA 2P6EA 4EVYA 5CPAA 4NGTA 4NGQA 4UEZA 5F49A 3RBUA 2CIJA 3B3VA 4LQGA 3IEHA 1Z8XA 4UEEA 1ELMP 3FECA 4KS9A 1CP6A 2CTCA 5F47A 3N7ZA 4CAEA 4HKFA 2O53A 5LYLA 2Z3MA 4TWEA 1Z8TA 1F2OA 2C1CA 2J8NA 2OR4A 4CPAA 2QJ8A 4JLYA 3F8KA 2BO9A 4CRZB 1YGHA 5LYDA 3B7IA 4UIBA 2ATRA 4P4FA 2PC1A 4EWTA 5LYIA 4HNWB 2PJ5A 4JD6A 4MBUA 4P44A 2NSMA 4QBJA 4HNXB 1YK3A 3BI0A 3S9MA 4OKOA 2ZEEA 5F46A 3SI2A 5DWMA 2PJ2A 3QAHA 4QVTA 3SXNA 4B5PA 2DXQA 4A32A 2CTBA 4KOVA 5LRGA 5AG7A 3TOBA 4NEXA 3R1KA 1IU8A 4NF1A 4UWIA 2C27A 2ZOGA 4R7MA 4BMHA 1PCAA 5J8CA 4MRIA 2AE6A 2J9AA 3I9SA 2G3TA 2P0WA 3IU2A 1R57A 2ZEOA 4OP4A 4Z65A 2BUEA 2V8VA 1YVKA 2EVNA 5F48A 1YVOA 2F7VA 3H5ZA 4MFZA 5ELYA 1A2ZA 2WPXA 1LFWA 1IY7A 2REFA 5H84A 2PIYA 2PQ8A 3SXOA 2PJ8A 4ZI6A 2XEGA 3B35A 4JXQA 5LYFA 1FT7A 1S7LA 2OZHA 2FIAA 5G21A 4BINA 2VL1A 3FH4A 1JWQA 2NYQA 3R95A 2V77A 3MGDA 3K9TA 4KOXA 2PIZA 1S7KA 1IB1E 2D4PA 4OIWA 1Z4EA 2JDCA 3EC4A 1XBUA 2ABZA 1LAPA 1TF9A 1XE4A 1KUYA 2EWBA 4J3GA 1FY7A 4KOYA 4P6YA 2FS5A 2ZW5A 2AFZA 4E0AA 4MMOA 3C26A 4P4EA 4OC2A 4F8ZA 3SJGA 2VBQA 2CXAA 3IU1A 4NGSA 2Q4YA 1V0CA 3SHPA 3T9YA 4NGNA 4UEFA 3I1UA 4NSQA 4E8OA 1YLOA 1ARMA 1N71A 3TT2A 2R8VA 1Y9KA 4ZX8A 3KHXA 3PB8X 3K9UA 2JEWA 2ZW6A 4QC6A 4R57A 4R3KA 2A4NA 3KKWA 3PZJA 2P6FA 2DPTA 5HH1A 4DJLA 3EO4A 2GLFA 3IIBA 1DTDA 3PB9X 5KTCA 4YFJA 4U5YA 4FD4A 1Q7LA 1ZLHA 2QMLA 1CG2A 4CGOA 2Z0ZA 3GLJA 4R8FA 3KZWA 4MFLA 2B3UA 1ARLA 3NE7A 4GXHA 4IAVA 4MFQA 2AFXA 5K8NA 2ODFA 2ZEPA 1IOFA 1S3ZA 3B3SA 3R9GA 3LODA 4ZYQA 1Y0RA 2R98A 3KL9A 4MY3A 3ISZA 2Q44A 2PJ9A 4GS4A 1PYTB 3W6SA 2Z3LA 3E0KA 1M1DA 2FVGA 2KCWA 2GFQA 1BOBA 3F5BA 3D68A 4XNHC 3DR6A 4RUHA 3F0AA 4PQAA 1QSOA 2ZPAA 1LCPA 4OIDA 4PV6A 5KTDA 2V8HA 2ZEHA 4I49A 4PXDA 3WC7A 4X8IA 2JDDA 3UY5A 4B10A 2XEFA 3S9LA 4CGNA 1QMUA 2R7HA 4UCPA 2PJ1A 3P2FA 1QSRA 2VI7A 1S5KA 3IGRA 2PDOA 3IJ3A 4A94A 4OAEA 4B14A 4RI1A 5EBVA 4MJ8A 5KTAA 4B5OA 4R9MA 4ZY2A 4KOSA 2HC9A 3FIXA 4MCRA 4K30A 3BI1A 1VGYA 2ARHA 3QNVA 4U9ZA 4CAXA 3S6HA 5LRKA 2IQ6A 1TKFA 5D29A 4UFVA 3R9FA 3SI1A 4P4DA 3RZAA 3JTKA 4P45A 4EFDA 4B11A 2VZZA 3CPAA 1AMPA 3D7FA 1KWMA 2FT0A 2PJ3A 1OZPA 3FX6A 4KUBA 2PJ0A 3IC1A 3KQZA 1P0HA 2IJZA 4KUAA 1GYTA 1ZO0A 1YMEA 2OH1A 3LD2A 5JPHA 3T90A 2RC4A 5LRJA 7CPAA 3K2KA 2FL4A 3NH4A 4MXUA 4OC4A 4II9A 1UWYA 4MCSA 4OC0A 1YQEA 2AFMA 2VEZA 4MCPA 4Y49B 4CGMA 2C6PA 3PBEA 4R76A 4X5KA 1SQHA 4FWUA 2B3VA 2FSRA 2IL4A 2EK8A 1BPMA 2F5IA 2Q43A 2B5GA 3PB6X 4X2TA 3DLJA 4CYNA 1M44A 3SJEA 1I21A 3VWEA 3VH9A 2ZEMA 1XJOA 3TO7A 5HXDA 1VHSA 3S9NA 4MHZA 4ZY1A 3JRUA 3JVNA 4UA3A 3CXSA 4CYQA 2YNEA 2Z3KA 3PGPA 3KHZA 4BD9A 5A28A 1IICA 4YRHA 1AYEA 2PJAA 3HUVA 2CNTA 2CNMA 3L2NA 2BSWA 2ZXVA 4QB9A 2FIWA 4NGRA 3DDDA 1Y0YA 2R1IA 1XFOA 4KVXA 2B4DB 3TX8A 2Q7SA 3D8PA 4KOWA 4C2YA 5BWAB 4KZTA 1YW6A 4M6IA 1S7FA 5HVFA 4JZ0A 1MJBA 4UFWA 2GLJA 2X7BA 2Q4VA 4KORA 3NFZA 5CNPA 4NGPA 2HB6A 4MFKA 1XRYA 5G22A 3BJ7A 2YNCC 1I12A 5IB0A 4H89A 4H2KA 4MFPA 4MY0A 5G20A 4FAIA 1MJ9A 3CXQA 4OADA 3W91A 2ZW4A 3MN8A 1ON0A 2BOAA 1IYKA 4YGOA 1Y7EA 4JWPA 4A38A 3CZXA 4FBEA 3ZZIA 5AG5A 1IIDA 3R96A 4MFJA 3D4UA 2PRBA 2QIRA 4H6UA 3VARA 5C82A 2OU2A 4IHMA 2HQYA 4KSAA 2Z3NA 3RYOA 3PFEA 2JEVA 3NA6A 3FEDA 1HEEA 1R3NA 2GU2A 1H8LA 3CDXA 3D2MA 3P2HA 4B12A 1ZG8A 3KASA 4CS0B 1YW4A 4EMEA 3SJXA 2P6GA 4MI4A 1IOIA 1P4NA 3PBBA 4P4JA 4B13A 4NCZA 2OOTA 3SI0A 3FRMA 3GUXA 2PJBA 4GM5A 4JJXA 1LANA 3PEIA 1BO4A 1BAVA 2D4OA 3PP9A
chains in the Genus database with same CATH topology
3TO6A 3WR7A 5IV0A 2YNCA 3TE4A 4FD6A 4C2XA 5E96A 4PK2A 4CYOA 4C7IA 2H5MA 3DSBA 2CY2A 4FD7A 4QUSA 2YNDA 4A33A 5EC4A 3GY9A 1K4JA 4IF5A 4F0XA 1B6BA 2QECA 2DPSA 2AJ6A 4MHDA 3FYNA 1XEBA 1S60A 3TFYA 3GKRA 4HNYB 1CM0A 3BJ8A 5AG4A 1U6MA 3IWGA 2WSAA 3FNCA 4UCNA 3G8WA 1RXTA 1J4JA 4UBRA 1UFHA 2PR8A 4L89A 4UFXA 4E2AA 4CGPA 4KLWA 1B87A 2FCKA 4DNCA 4B5PB 1MJAA 1CJWA 4AVCA 2B4BA 1KUVA 2Q7BA 2YGWA 1NSLA 1TIQA 4XPDB 4KVOE 4R3LA 4AG7A 2GANA 5C88A 5A27A 1WWZA 2Z10A 4KSFA 4LX9A 2I79A 1VKCA 3EFAA 1I1DA 1PUAA 3H4QA 4R87A 3D3SA 4XPDC 4H6ZA 1S7NA 2CNSA 4A30A 4ORFA 3D2PA 1RO5A 2Z11A 5G1ZA 3S6FA 4AB7A 5DWNA 3FB3A 2JLMA 4Y49C 4F0YA 4CRYB 1QSNA 3DNSA 2GE3A 1NE9A 4Q36A 1IYLA 3TOAA 4F6AA 1M4GA 5FVJA 4C7HA 2Z3PA 4A2ZA 1YREA 1LRZA 4FD5A 4KVME 5JQ4A 3VWDA 1XMTA 4AG9A 2J8RA 1Y7RA 3QB8A 5AGEA 3R9EA 2REEA 4BBHA 2NMTA 3FBUA 1Z4RA 3B8GA 1KZFA 4ONUA 3TCVA 4CYPA 2ZW7A 3GYAA 2Q0YA 1M4IA 1MK4A 5I0CA 4PSXA 4PSWA 2Q04A 4A31A 2J8MA 3OWCA 3S6KA 5H86A 4M3SA 2VQYA 4AVBA 3IWEA 4JXRA 2I00A 1YLEA 4UWJA 1PU9A 4KLVA 3TO9A 3BLNA 2G3AA 5GCNA 4M85A 2B58A 2GIVA 3DR8A 3ZJ0A 4UCMA 5ISVA 2Y0MA 2WPWA 3EY5A 2B4DA 3EXNA 1Q2DA 1L0CA 3CXPA 2PR1A 2Z3OA 3I3GA 3G3SA 3S6GA 1YX0A 2HV2A 3W6XA 2PSWA 4XPKA 5IX3A 4XNHB 4ZGYB 3FXTA 3TTHA 2BL1A 5AG6A 4L8AA 2VZYA 4CAVA 4KOTA 2B5GB 4C2ZA 4LUAA 2BEIA 3JUWA 4AVAA 1XIXA 4ZBGA 2VXKA 4XPLA 1QSMA 2OZGA 4KOUA 2O28A 1NMTA 4OLLA 1QSTA 2HUZA 3V8IA 2WUUA 2OB0A 2FXFA 2K5TA 4RS2A 4NXYA 4PK3A 1KUXA 2EUIA 5J8FA 1XF8A 4CAFA 2OZUA 1GHEA 4Q38A 1M4DA 4U9YA 4CGLA 4IUSA 4CAWA 1Y9WA 3A9LA 5HMNA 4C68A 1WK4A 1Z9UA 1YR0A 2G0BA 2FE7A 4A95A 1Q2YA 1Q2CA 2P6EA 4EVYA 5F49A 4KS9A 5F47A 3N7ZA 4CAEA 4HKFA 2Z3MA 2J8NA 4JLYA 3F8KA 4CRZB 1YGHA 2ATRA 2PC1A 4HNWB 4QBJA 4JD6A 4MBUA 4HNXB 1YK3A 5F46A 5DWMA 3QAHA 4QVTA 3SXNA 4B5PA 2DXQA 4A32A 4KOVA 5AG7A 3TOBA 4NEXA 3R1KA 4NF1A 4UWIA 2C27A 4BMHA 5J8CA 2AE6A 3I9SA 2G3TA 2P0WA 3IU2A 1R57A 2BUEA 1YVKA 2EVNA 5F48A 1YVOA 3H5ZA 4MFZA 2WPXA 2REFA 5H84A 2PQ8A 3SXOA 4JXQA 1S7LA 2OZHA 2FIAA 5G21A 3R95A 3MGDA 4KOXA 1S7KA 1IB1E 2D4PA 1Z4EA 2JDCA 3EC4A 1XE4A 1KUYA 4J3GA 1FY7A 4KOYA 2FS5A 2ZW5A 4E0AA 3C26A 2VBQA 2CXAA 3IU1A 2Q4YA 1V0CA 3SHPA 3T9YA 4E8OA 4NSQA 1N71A 3TT2A 2R8VA 1Y9KA 4R3KA 3K9UA 2ZW6A 4QC6A 4R57A 2A4NA 3KKWA 3PZJA 2P6FA 2DPTA 5HH1A 3EO4A 5KTCA 4YFJA 4U5YA 4FD4A 2QMLA 4CGOA 2Z0ZA 4MFLA 2B3UA 4MFQA 3NE7A 1S3ZA 3R9GA 3LODA 2R98A 4MY3A 2Q44A 4GS4A 3W6SA 2Z3LA 3E0KA 1M1DA 2KCWA 1BOBA 3F5BA 4XNHC 3DR6A 3F0AA 1QSOA 2ZPAA 4PV6A 5KTDA 4I49A 2JDDA 3UY5A 4B10A 4CGNA 4UCPA 2R7HA 3P2FA 1QSRA 2VI7A 1S5KA 3IGRA 2PDOA 4OAEA 4B14A 4RI1A 5EBVA 4MJ8A 5KTAA 4B5OA 4R9MA 4KOSA 3FIXA 4K30A 2ARHA 4U9ZA 4CAXA 3S6HA 4UFVA 3R9FA 3JTKA 4B11A 2VZZA 2FT0A 1OZPA 4KUBA 4KUAA 1P0HA 1ZO0A 3LD2A 5JPHA 2OH1A 3T90A 2RC4A 2FL4A 4II9A 4Y49B 2VEZA 4CGMA 4X5KA 1SQHA 2B3VA 2FSRA 2IL4A 2F5IA 2B5GA 4CYNA 1M44A 1I21A 3VWEA 3TO7A 1VHSA 3JVNA 4UA3A 3CXSA 4CYQA 2YNEA 2Z3KA 3PGPA 5A28A 1IICA 4YRHA 2CNTA 2CNMA 2BSWA 2ZXVA 4QB9A 2FIWA 3DDDA 2R1IA 4KVXA 2B4DB 3D8PA 4KOWA 4C2YA 5BWAB 4KZTA 1S7FA 1MJBA 4UFWA 2X7BA 2Q4VA 4KORA 5CNPA 4MFKA 5G22A 3BJ7A 2YNCC 1I12A 5IB0A 4H89A 4MFPA 4MY0A 5G20A 1MJ9A 3CXQA 4OADA 3W91A 2ZW4A 1ON0A 1IYKA 4YGOA 4JWPA 5AG5A 1IIDA 3R96A 4MFJA 2PRBA 2QIRA 4H6UA 5C82A 2OU2A 2HQYA 4KSAA 2Z3NA 3RYOA 2JEVA 3P2HA 3D2MA 4B12A 4CS0B 2P6GA 4MI4A 1P4NA 4B13A 4NCZA 3FRMA 3ZZIA 4JJXA 1BO4A 2D4OA 3PP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TO6 A;  3WR7 A;  5IV0 A;  3TE4 A;  4FD6 A;  5E96 A;  4PK2 A;  2H5M A;  3DSB A;  2CY2 A;  4FD7 A;  4QUS A;  5EC4 A;  3GY9 A;  1K4J A;  4IF5 A;  1B6B A;  2QEC A;  2AJ6 A;  4MHD A;  3FYN A;  1XEB A;  1S60 A;  3TFY A;  3GKR A;  4HNY B;  1CM0 A;  3BJ8 A;  1U6M A;  3IWG A;  3FNC A;  3G8W A;  1RXT A;  1J4J A;  4UBR A;  1UFH A;  2PR8 A;  4L89 A;  4E2A A;  4KLW A;  1B87 A;  2FCK A;  4DNC A;  4B5P B;  1MJA A;  1CJW A;  4AVC A;  2B4B A;  1KUV A;  2Q7B A;  1NSL A;  1TIQ A;  4XPD B;  4KVO E;  4R3L A;  4AG7 A;  2GAN A;  5C88 A;  1WWZ A;  2Z10 A;  4LX9 A;  2I79 A;  1VKC A;  3EFA A;  1I1D A;  1PUA A;  3H4Q A;  4R87 A;  3D3S A;  4XPD C;  4H6Z A;  1S7N A;  2CNS A;  4ORF A;  3D2P A;  1RO5 A;  2Z11 A;  3S6F A;  4AB7 A;  5DWN A;  3FB3 A;  2JLM A;  4Y49 C;  4F0Y A;  4CRY B;  1QSN A;  3DNS A;  2GE3 A;  1NE9 A;  1IYL A;  3TOA A;  4F6A A;  1M4G A;  5FVJ A;  1YRE A;  1LRZ A;  4FD5 A;  4KVM E;  5JQ4 A;  3VWD A;  1XMT A;  4AG9 A;  2J8R A;  1Y7R A;  3QB8 A;  3R9E A;  2REE A;  2NMT A;  3FBU A;  1Z4R A;  3B8G A;  1KZF A;  4ONU A;  3TCV A;  2ZW7 A;  3GYA A;  2Q0Y A;  1M4I A;  1MK4 A;  5I0C A;  4PSX A;  4PSW A;  2Q04 A;  2J8M A;  3OWC A;  3S6K A;  5H86 A;  4M3S A;  2VQY A;  4AVB A;  4JXR A;  2I00 A;  1YLE A;  4UWJ A;  1PU9 A;  4KLV A;  3TO9 A;  3BLN A;  2G3A A;  5GCN A;  4M85 A;  2B58 A;  2GIV A;  3DR8 A;  3ZJ0 A;  5ISV A;  2Y0M A;  2WPW A;  3EY5 A;  2B4D A;  3CXP A;  1Q2D A;  1L0C A;  3EXN A;  2PR1 A;  3I3G A;  3G3S A;  3S6G A;  1YX0 A;  2HV2 A;  3W6X A;  2PSW A;  4XPK A;  5IX3 A;  4XNH B;  3FXT A;  3TTH A;  2BL1 A;  4L8A A;  2VZY A;  4CAV A;  4KOT A;  2B5G B;  4LUA A;  2BEI A;  3JUW A;  4AVA A;  1XIX A;  4ZBG A;  2VXK A;  4XPL A;  1QSM A;  2OZG A;  2O28 A;  1NMT A;  4OLL A;  1QST A;  2HUZ A;  3V8I A;  2OB0 A;  2FXF A;  2K5T A;  4RS2 A;  4NXY A;  4PK3 A;  1KUX A;  2EUI A;  5J8F A;  1XF8 A;  2OZU A;  1GHE A;  1M4D A;  4U9Y A;  4IUS A;  4CAW A;  1Y9W A;  5HMN A;  1WK4 A;  1Z9U A;  1YR0 A;  2G0B A;  2FE7 A;  1Q2Y A;  1Q2C A;  2P6E A;  4EVY A;  5F49 A;  5F47 A;  3N7Z A;  4HKF A;  2J8N A;  4JLY A;  3F8K A;  4CRZ B;  1YGH A;  2ATR A;  2PC1 A;  4HNW B;  4QBJ A;  4JD6 A;  4MBU A;  4HNX B;  1YK3 A;  5F46 A;  5DWM A;  3QAH A;  4QVT A;  3SXN A;  4B5P A;  2DXQ A;  4KOV A;  3TOB A;  4NEX A;  3R1K A;  4NF1 A;  4UWI A;  2C27 A;  4BMH A;  5J8C A;  2AE6 A;  3I9S A;  2G3T A;  2P0W A;  1R57 A;  2BUE A;  1YVK A;  2EVN A;  5F48 A;  1YVO A;  2WPX A;  2REF A;  5H84 A;  2PQ8 A;  3SXO A;  4JXQ A;  1S7L A;  2OZH A;  2FIA A;  3R95 A;  3MGD A;  4KOX A;  1S7K A;  1IB1 E;  2D4P A;  1Z4E A;  2JDC A;  3EC4 A;  1XE4 A;  1KUY A;  4J3G A;  1FY7 A;  4KOY A;  2FS5 A;  2ZW5 A;  4E0A A;  3C26 A;  2VBQ A;  2Q4Y A;  1V0C A;  3SHP A;  3T9Y A;  4E8O A;  4NSQ A;  1N71 A;  3TT2 A;  2R8V A;  1Y9K A;  4R3K A;  3K9U A;  2ZW6 A;  4QC6 A;  4R57 A;  2A4N A;  3KKW A;  3PZJ A;  2P6F A;  5HH1 A;  3EO4 A;  5KTC A;  4YFJ A;  4U5Y A;  4FD4 A;  2QML A;  2Z0Z A;  2B3U A;  3NE7 A;  1S3Z A;  3R9G A;  3LOD A;  2R98 A;  4MY3 A;  2Q44 A;  4GS4 A;  3W6S A;  3E0K A;  1M1D A;  2KCW A;  1BOB A;  3F5B A;  4XNH C;  3DR6 A;  3F0A A;  1QSO A;  2ZPA A;  4PV6 A;  5KTD A;  4I49 A;  2D4O A;  2JDD A;  3UY5 A;  2R7H A;  3P2F A;  1QSR A;  2VI7 A;  1S5K A;  3IGR A;  2PDO A;  4OAE A;  4RI1 A;  5EBV A;  4MJ8 A;  5KTA A;  4B5O A;  4R9M A;  4KOS A;  3FIX A;  4K30 A;  2ARH A;  4U9Z A;  4CAX A;  3S6H A;  3R9F A;  2VZZ A;  2FT0 A;  1OZP A;  4KUB A;  4KUA A;  1P0H A;  3LD2 A;  5JPH A;  2OH1 A;  3T90 A;  2RC4 A;  2FL4 A;  4II9 A;  4Y49 B;  2VEZ A;  4X5K A;  1SQH A;  2B3V A;  2FSR A;  2IL4 A;  2F5I A;  2B5G A;  1M44 A;  1I21 A;  3VWE A;  3TO7 A;  1VHS A;  3JVN A;  4UA3 A;  3CXS A;  3PGP A;  1IIC A;  4YRH A;  2CNT A;  2CNM A;  2BSW A;  2ZXV A;  4QB9 A;  2FIW A;  3DDD A;  2R1I A;  4KVX A;  2B4D B;  3D8P A;  4KOW A;  4KZT A;  1S7F A;  1MJB A;  2X7B A;  2Q4V A;  4KOR A;  5CNP A;  3BJ7 A;  1I12 A;  5IB0 A;  4H89 A;  4MY0 A;  1MJ9 A;  3CXQ A;  4OAD A;  3W91 A;  2ZW4 A;  1ON0 A;  1IYK A;  4YGO A;  4JWP A;  1IID A;  3R96 A;  2PRB A;  2QIR A;  4H6U A;  5C82 A;  2OU2 A;  2HQY A;  3RYO A;  2JEV A;  3P2H A;  3D2M A;  4CS0 B;  2P6G A;  4MI4 A;  1P4N A;  4NCZ A;  3FRM A;  3ZZI A;  4JJX A;  1BO4 A;  4KOU A;  3PP9 A; 
#chains in the Genus database with same CATH topology
 3TO6 A;  3WR7 A;  4AXV A;  5IV0 A;  4YU9 A;  2YNC A;  3KI9 A;  3TE4 A;  3GB0 A;  4FD6 A;  4C2X A;  5E96 A;  4PK2 A;  4CYO A;  4C7I A;  2H5M A;  3DSB A;  2CY2 A;  3FVL A;  4FD7 A;  2YND A;  4QUS A;  1AUG A;  4A33 A;  5I4M A;  3NE8 A;  5EC4 A;  3GY9 A;  3BXM A;  3CPX A;  1K4J A;  4IF5 A;  4F0X A;  1B6B A;  6CPA A;  1Z2L A;  2QEC A;  2DPS A;  8CPA A;  2PJ4 A;  2AJ6 A;  3FF3 A;  5IB9 A;  3WT4 A;  4MHD A;  3FYN A;  2V8D A;  1XEB A;  1S60 A;  2AFW A;  3TFY A;  3GKR A;  4HNY B;  2GRE A;  2ZOF A;  3CT9 A;  4LQ6 A;  1CM0 A;  4P4B A;  3BJ8 A;  3PRT A;  4WJB A;  2Q4Z A;  2RFH A;  4OC5 A;  4NFR A;  5AG4 A;  1U6M A;  3IWG A;  2WSA A;  3FNC A;  4UCN A;  3G8W A;  3WAB A;  1RXT A;  1J4J A;  2EK9 A;  4UBR A;  1UFH A;  3H8G A;  4F9V A;  4B6Z A;  2PR8 A;  5JGF A;  4L89 A;  4UFX A;  1NSA A;  1VHO A;  3NH5 A;  4E2A A;  4OME A;  4CGP A;  5F09 A;  1HDQ A;  4P10 A;  2G9D A;  4KLW A;  1B87 A;  4UF4 A;  2FCK A;  4MHY A;  2POK A;  1VHE A;  4DNC A;  2WZN A;  4B5P B;  5HVH A;  5K8O A;  1MJA A;  1CJW A;  3H8F A;  2B4B A;  2CF4 A;  4AVC A;  1CX8 A;  1KUV A;  3MRU A;  1VIX A;  4PXE A;  2Q7B A;  2YGW A;  1NSL A;  3B3C A;  1TIQ A;  4XPD B;  5J1Q A;  2PJ7 A;  4DYO A;  4NJQ A;  4KVO E;  2ZEN A;  2EBJ A;  3IO1 A;  1YSJ A;  2QYV A;  3D7D A;  4R3L A;  2Q51 A;  4AG7 A;  1ELL P;  1XOV A;  4IK2 A;  2O4H A;  2GAN A;  5C88 A;  3N5F A;  5A27 A;  1WWZ A;  4ZX9 A;  2Z10 A;  3D7H A;  1Z5R A;  4KSF A;  4LX9 A;  2I79 A;  1VKC A;  3EFA A;  4OC3 A;  1I1D A;  1PUA A;  3H4Q A;  4R87 A;  1TKJ A;  1M4L A;  4ONW A;  3D3S A;  4XPD C;  4H6Z A;  1S7N A;  2CNS A;  4A30 A;  4ORF A;  2JBJ A;  3D2P A;  1ZLI A;  4K3N A;  1IGB A;  1RO5 A;  5HVG A;  2PRQ A;  2Z11 A;  5G1Z A;  2QVP A;  3S6F A;  3V7Z A;  4AB7 A;  5DWN A;  3FB3 A;  2JLM A;  4Y49 C;  4F0Y A;  4CRY B;  1QSN A;  3DNS A;  2GE3 A;  2PJC A;  1NE9 A;  4PPZ A;  1X10 A;  3LAC A;  1IYL A;  4Q36 A;  3TOA A;  4F6A A;  1BLL E;  1M4G A;  3QAY A;  3IWW A;  5FVJ A;  3T8W A;  3KR5 A;  1QQ9 A;  4C7H A;  2Z3P A;  3SJF A;  1CP7 A;  1FNO A;  4A2Z A;  1YRE A;  3FMC A;  3PB7 X;  1LRZ A;  4FD5 A;  4KVM E;  3H8E A;  5JQ4 A;  1ZG9 A;  3VWD A;  1XMT A;  4AG9 A;  2J8R A;  1Y7R A;  3QB8 A;  4NJR A;  5AGE A;  3R9E A;  2REE A;  4BBH A;  4YWY A;  2NMT A;  3FBU A;  5THW A;  1Z4R A;  1BPN A;  3LMS A;  4WWV A;  4F9U A;  1OBR A;  3B8G A;  5JM6 A;  1KZF A;  3KGQ A;  4ONU A;  3KQX A;  3TC8 A;  3TCV A;  2DEA A;  2ZW7 A;  4PXB A;  4CYP A;  3GYA A;  5K8M A;  3NH8 A;  2Q0Y A;  1M4I A;  1MK4 A;  5I0C A;  2PVW A;  2I3C A;  4PSX A;  4PSW A;  2Q04 A;  4A31 A;  3HLP A;  2DF5 A;  2J8M A;  3OWC A;  3S6K A;  4RN7 A;  1Z8L A;  3BHX A;  3FEE A;  1Z8W A;  3LWU A;  5H86 A;  4ZY0 A;  2V8G A;  2XEJ A;  4DUK A;  4Q7A A;  2AFU A;  3RNZ A;  2PJ6 A;  4M3S A;  3B3T A;  2VQY A;  4AVB A;  3IWE A;  4JXR A;  2ZEL A;  2I00 A;  5JH9 A;  1YLE A;  4UWJ A;  1PU9 A;  4KLV A;  1HDU A;  3RO0 A;  5K8P A;  2PCU A;  3TO9 A;  1F2P A;  2WYR A;  3BLN A;  3RAM A;  5EMI A;  2F8H A;  2G3A A;  5GCN A;  4M85 A;  2B58 A;  2GIV A;  3DR8 A;  3ZJ0 A;  3FJU A;  2ZED A;  1X12 A;  4UCM A;  5DS0 A;  5ISV A;  4OC1 A;  2Y0M A;  2WPW A;  3EY5 A;  4O23 A;  4X3R A;  4M6H A;  2B4D A;  3CXP A;  1Q2D A;  1L0C A;  1CPX A;  2PR1 A;  3EXN A;  3PB4 X;  2Z3O A;  5CBM A;  3I3G A;  2IMO A;  3G3S A;  1YX0 A;  3IFE A;  2HV2 A;  3S6G A;  1ZG7 A;  3W6X A;  2PSW A;  4XPK A;  5IX3 A;  4XNH B;  3WC5 A;  4ZGY B;  4MCQ A;  1R43 A;  3FXT A;  1DE4 C;  3TTH A;  2BL1 A;  4FUU A;  5AG6 A;  1EE3 P;  1TKH A;  4L8A A;  2ZEF A;  2XEI A;  2PE3 A;  3DGV A;  2C6C A;  2AFS A;  2VZY A;  4CAV A;  4KOT A;  4G1P A;  2B5G B;  4C2Z A;  3ISX A;  3B2Y A;  1CBX A;  4LUA A;  4KSI A;  2BEI A;  4PXC A;  1F57 A;  3JUW A;  4AVA A;  1XIX A;  4ZBG A;  2ANP A;  2VXK A;  3V38 A;  2EO8 A;  4A39 A;  4XPL A;  1QSM A;  2OZG A;  2RB7 A;  4KOU A;  2O28 A;  1NMT A;  4OLL A;  1QST A;  1CPS A;  2HUZ A;  3V8I A;  3D7G A;  2WUU A;  2OB0 A;  3B3W A;  2FXF A;  2K5T A;  4RS2 A;  4A37 A;  2JBK A;  2BCO A;  1TF8 A;  4NXY A;  4P4I A;  2PVV A;  3VAT A;  1LAM A;  4PK3 A;  1KUX A;  2EUI A;  4MHP A;  3WC6 A;  2C6G A;  5J8F A;  1XF8 A;  4CAF A;  1RTQ A;  2OZU A;  1GHE A;  3GIU A;  2AFO A;  4Q38 A;  1M4D A;  3PFO A;  4TNU A;  4U9Y A;  4CGL A;  4IUS A;  1XMB A;  1JQG A;  4HPS A;  4CAW A;  1Y9W A;  4JYW A;  3KR4 A;  2ZEG A;  3A9L A;  5HMN A;  4C68 A;  4R6T A;  1WK4 A;  4NGM A;  3D67 A;  4MHN A;  5D8N A;  4W9Y A;  1Z9U A;  1YR0 A;  1LOK A;  2G0B A;  1TXR A;  2FE7 A;  4UIA A;  4A95 A;  1Q2Y A;  3D66 A;  1Q2C A;  4M6G A;  2P6E A;  4EVY A;  5CPA A;  4NGT A;  4NGQ A;  4UEZ A;  5F49 A;  3RBU A;  2CIJ A;  3B3V A;  4LQG A;  3IEH A;  1Z8X A;  4UEE A;  1ELM P;  3FEC A;  4KS9 A;  1CP6 A;  2CTC A;  5F47 A;  3N7Z A;  4CAE A;  4HKF A;  2O53 A;  5LYL A;  2Z3M A;  4TWE A;  1Z8T A;  1F2O A;  2C1C A;  2J8N A;  2OR4 A;  4CPA A;  2QJ8 A;  4JLY A;  3F8K A;  2BO9 A;  4CRZ B;  1YGH A;  5LYD A;  3B7I A;  4UIB A;  2ATR A;  4P4F A;  2PC1 A;  4EWT A;  5LYI A;  4HNW B;  2PJ5 A;  4JD6 A;  4MBU A;  4P44 A;  2NSM A;  4QBJ A;  4HNX B;  1YK3 A;  3BI0 A;  3S9M A;  4OKO A;  2ZEE A;  5F46 A;  3SI2 A;  5DWM A;  2PJ2 A;  3QAH A;  4QVT A;  3SXN A;  4B5P A;  2DXQ A;  4A32 A;  2CTB A;  4KOV A;  5LRG A;  5AG7 A;  3TOB A;  4NEX A;  3R1K A;  1IU8 A;  4NF1 A;  4UWI A;  2C27 A;  2ZOG A;  4R7M A;  4BMH A;  1PCA A;  5J8C A;  4MRI A;  2AE6 A;  2J9A A;  3I9S A;  2G3T A;  2P0W A;  3IU2 A;  1R57 A;  2ZEO A;  4OP4 A;  4Z65 A;  2BUE A;  2V8V A;  1YVK A;  2EVN A;  5F48 A;  1YVO A;  2F7V A;  3H5Z A;  4MFZ A;  5ELY A;  1A2Z A;  2WPX A;  1LFW A;  1IY7 A;  2REF A;  5H84 A;  2PIY A;  2PQ8 A;  3SXO A;  2PJ8 A;  4ZI6 A;  2XEG A;  3B35 A;  4JXQ A;  5LYF A;  1FT7 A;  1S7L A;  2OZH A;  2FIA A;  5G21 A;  4BIN A;  2VL1 A;  3FH4 A;  1JWQ A;  2NYQ A;  3R95 A;  2V77 A;  3MGD A;  3K9T A;  4KOX A;  2PIZ A;  1S7K A;  1IB1 E;  2D4P A;  4OIW A;  1Z4E A;  2JDC A;  3EC4 A;  1XBU A;  2ABZ A;  1LAP A;  1TF9 A;  1XE4 A;  1KUY A;  2EWB A;  4J3G A;  1FY7 A;  4KOY A;  4P6Y A;  2FS5 A;  2ZW5 A;  2AFZ A;  4E0A A;  4MMO A;  3C26 A;  4P4E A;  4OC2 A;  4F8Z A;  3SJG A;  2VBQ A;  2CXA A;  3IU1 A;  4NGS A;  2Q4Y A;  1V0C A;  3SHP A;  3T9Y A;  4NGN A;  4UEF A;  3I1U A;  4NSQ A;  4E8O A;  1YLO A;  1ARM A;  1N71 A;  3TT2 A;  2R8V A;  1Y9K A;  4ZX8 A;  3KHX A;  3PB8 X;  3K9U A;  2JEW A;  2ZW6 A;  4QC6 A;  4R57 A;  4R3K A;  2A4N A;  3KKW A;  3PZJ A;  2P6F A;  2DPT A;  5HH1 A;  4DJL A;  3EO4 A;  2GLF A;  3IIB A;  1DTD A;  3PB9 X;  5KTC A;  4YFJ A;  4U5Y A;  4FD4 A;  1Q7L A;  1ZLH A;  2QML A;  1CG2 A;  4CGO A;  2Z0Z A;  3GLJ A;  4R8F A;  3KZW A;  4MFL A;  2B3U A;  1ARL A;  3NE7 A;  4GXH A;  4IAV A;  4MFQ A;  2AFX A;  5K8N A;  2ODF A;  2ZEP A;  1IOF A;  1S3Z A;  3B3S A;  3R9G A;  3LOD A;  4ZYQ A;  1Y0R A;  2R98 A;  3KL9 A;  4MY3 A;  3ISZ A;  2Q44 A;  2PJ9 A;  4GS4 A;  1PYT B;  3W6S A;  2Z3L A;  3E0K A;  1M1D A;  2FVG A;  2KCW A;  2GFQ A;  1BOB A;  3F5B A;  3D68 A;  4XNH C;  3DR6 A;  4RUH A;  3F0A A;  4PQA A;  1QSO A;  2ZPA A;  1LCP A;  4OID A;  4PV6 A;  5KTD A;  2V8H A;  2ZEH A;  4I49 A;  4PXD A;  3WC7 A;  4X8I A;  2JDD A;  3UY5 A;  4B10 A;  2XEF A;  3S9L A;  4CGN A;  1QMU A;  2R7H A;  4UCP A;  2PJ1 A;  3P2F A;  1QSR A;  2VI7 A;  1S5K A;  3IGR A;  2PDO A;  3IJ3 A;  4A94 A;  4OAE A;  4B14 A;  4RI1 A;  5EBV A;  4MJ8 A;  5KTA A;  4B5O A;  4R9M A;  4ZY2 A;  4KOS A;  2HC9 A;  3FIX A;  4MCR A;  4K30 A;  3BI1 A;  1VGY A;  2ARH A;  3QNV A;  4U9Z A;  4CAX A;  3S6H A;  5LRK A;  2IQ6 A;  1TKF A;  5D29 A;  4UFV A;  3R9F A;  3SI1 A;  4P4D A;  3RZA A;  3JTK A;  4P45 A;  4EFD A;  4B11 A;  2VZZ A;  3CPA A;  1AMP A;  3D7F A;  1KWM A;  2FT0 A;  2PJ3 A;  1OZP A;  3FX6 A;  4KUB A;  2PJ0 A;  3IC1 A;  3KQZ A;  1P0H A;  2IJZ A;  4KUA A;  1GYT A;  1ZO0 A;  1YME A;  2OH1 A;  3LD2 A;  5JPH A;  3T90 A;  2RC4 A;  5LRJ A;  7CPA A;  3K2K A;  2FL4 A;  3NH4 A;  4MXU A;  4OC4 A;  4II9 A;  1UWY A;  4MCS A;  4OC0 A;  1YQE A;  2AFM A;  2VEZ A;  4MCP A;  4Y49 B;  4CGM A;  2C6P A;  3PBE A;  4R76 A;  4X5K A;  1SQH A;  4FWU A;  2B3V A;  2FSR A;  2IL4 A;  2EK8 A;  1BPM A;  2F5I A;  2Q43 A;  2B5G A;  3PB6 X;  4X2T A;  3DLJ A;  4CYN A;  1M44 A;  3SJE A;  1I21 A;  3VWE A;  3VH9 A;  2ZEM A;  1XJO A;  3TO7 A;  5HXD A;  1VHS A;  3S9N A;  4MHZ A;  4ZY1 A;  3JRU A;  3JVN A;  4UA3 A;  3CXS A;  4CYQ A;  2YNE A;  2Z3K A;  3PGP A;  3KHZ A;  4BD9 A;  5A28 A;  1IIC A;  4YRH A;  1AYE A;  2PJA A;  3HUV A;  2CNT A;  2CNM A;  3L2N A;  2BSW A;  2ZXV A;  4QB9 A;  2FIW A;  4NGR A;  3DDD A;  1Y0Y A;  2R1I A;  1XFO A;  4KVX A;  2B4D B;  3TX8 A;  2Q7S A;  3D8P A;  4KOW A;  4C2Y A;  5BWA B;  4KZT A;  1YW6 A;  4M6I A;  1S7F A;  5HVF A;  4JZ0 A;  1MJB A;  4UFW A;  2GLJ A;  2X7B A;  2Q4V A;  4KOR A;  3NFZ A;  5CNP A;  4NGP A;  2HB6 A;  4MFK A;  1XRY A;  5G22 A;  3BJ7 A;  2YNC C;  1I12 A;  5IB0 A;  4H89 A;  4H2K A;  4MFP A;  4MY0 A;  5G20 A;  4FAI A;  1MJ9 A;  3CXQ A;  4OAD A;  3W91 A;  2ZW4 A;  3MN8 A;  1ON0 A;  2BOA A;  1IYK A;  4YGO A;  1Y7E A;  4JWP A;  4A38 A;  3CZX A;  4FBE A;  3ZZI A;  5AG5 A;  1IID A;  3R96 A;  4MFJ A;  3D4U A;  2PRB A;  2QIR A;  4H6U A;  3VAR A;  5C82 A;  2OU2 A;  4IHM A;  2HQY A;  4KSA A;  2Z3N A;  3RYO A;  3PFE A;  2JEV A;  3NA6 A;  3FED A;  1HEE A;  1R3N A;  2GU2 A;  1H8L A;  3CDX A;  3D2M A;  3P2H A;  4B12 A;  1ZG8 A;  3KAS A;  4CS0 B;  1YW4 A;  4EME A;  3SJX A;  2P6G A;  4MI4 A;  1IOI A;  1P4N A;  3PBB A;  4P4J A;  4B13 A;  4NCZ A;  2OOT A;  3SI0 A;  3FRM A;  3GUX A;  2PJB A;  4GM5 A;  4JJX A;  1LAN A;  3PEI A;  1BO4 A;  1BAV A;  2D4O A;  3PP9 A; 
#chains in the Genus database with same CATH homology
 3TO6 A;  3WR7 A;  5IV0 A;  2YNC A;  3TE4 A;  4FD6 A;  4C2X A;  5E96 A;  4PK2 A;  4CYO A;  4C7I A;  2H5M A;  3DSB A;  2CY2 A;  4FD7 A;  4QUS A;  2YND A;  4A33 A;  5EC4 A;  3GY9 A;  1K4J A;  4IF5 A;  4F0X A;  1B6B A;  2QEC A;  2DPS A;  2AJ6 A;  4MHD A;  3FYN A;  1XEB A;  1S60 A;  3TFY A;  3GKR A;  4HNY B;  1CM0 A;  3BJ8 A;  5AG4 A;  1U6M A;  3IWG A;  2WSA A;  3FNC A;  4UCN A;  3G8W A;  1RXT A;  1J4J A;  4UBR A;  1UFH A;  2PR8 A;  4L89 A;  4UFX A;  4E2A A;  4CGP A;  4KLW A;  1B87 A;  2FCK A;  4DNC A;  4B5P B;  1MJA A;  1CJW A;  4AVC A;  2B4B A;  1KUV A;  2Q7B A;  2YGW A;  1NSL A;  1TIQ A;  4XPD B;  4KVO E;  4R3L A;  4AG7 A;  2GAN A;  5C88 A;  5A27 A;  1WWZ A;  2Z10 A;  4KSF A;  4LX9 A;  2I79 A;  1VKC A;  3EFA A;  1I1D A;  1PUA A;  3H4Q A;  4R87 A;  3D3S A;  4XPD C;  4H6Z A;  1S7N A;  2CNS A;  4A30 A;  4ORF A;  3D2P A;  1RO5 A;  2Z11 A;  5G1Z A;  3S6F A;  4AB7 A;  5DWN A;  3FB3 A;  2JLM A;  4Y49 C;  4F0Y A;  4CRY B;  1QSN A;  3DNS A;  2GE3 A;  1NE9 A;  4Q36 A;  1IYL A;  3TOA A;  4F6A A;  1M4G A;  5FVJ A;  4C7H A;  2Z3P A;  4A2Z A;  1YRE A;  1LRZ A;  4FD5 A;  4KVM E;  5JQ4 A;  3VWD A;  1XMT A;  4AG9 A;  2J8R A;  1Y7R A;  3QB8 A;  5AGE A;  3R9E A;  2REE A;  4BBH A;  2NMT A;  3FBU A;  1Z4R A;  3B8G A;  1KZF A;  4ONU A;  3TCV A;  4CYP A;  2ZW7 A;  3GYA A;  2Q0Y A;  1M4I A;  1MK4 A;  5I0C A;  4PSX A;  4PSW A;  2Q04 A;  4A31 A;  2J8M A;  3OWC A;  3S6K A;  5H86 A;  4M3S A;  2VQY A;  4AVB A;  3IWE A;  4JXR A;  2I00 A;  1YLE A;  4UWJ A;  1PU9 A;  4KLV A;  3TO9 A;  3BLN A;  2G3A A;  5GCN A;  4M85 A;  2B58 A;  2GIV A;  3DR8 A;  3ZJ0 A;  4UCM A;  5ISV A;  2Y0M A;  2WPW A;  3EY5 A;  2B4D A;  3EXN A;  1Q2D A;  1L0C A;  3CXP A;  2PR1 A;  2Z3O A;  3I3G A;  3G3S A;  3S6G A;  1YX0 A;  2HV2 A;  3W6X A;  2PSW A;  4XPK A;  5IX3 A;  4XNH B;  4ZGY B;  3FXT A;  3TTH A;  2BL1 A;  5AG6 A;  4L8A A;  2VZY A;  4CAV A;  4KOT A;  2B5G B;  4C2Z A;  4LUA A;  2BEI A;  3JUW A;  4AVA A;  1XIX A;  4ZBG A;  2VXK A;  4XPL A;  1QSM A;  2OZG A;  4KOU A;  2O28 A;  1NMT A;  4OLL A;  1QST A;  2HUZ A;  3V8I A;  2WUU A;  2OB0 A;  2FXF A;  2K5T A;  4RS2 A;  4NXY A;  4PK3 A;  1KUX A;  2EUI A;  5J8F A;  1XF8 A;  4CAF A;  2OZU A;  1GHE A;  4Q38 A;  1M4D A;  4U9Y A;  4CGL A;  4IUS A;  4CAW A;  1Y9W A;  3A9L A;  5HMN A;  4C68 A;  1WK4 A;  1Z9U A;  1YR0 A;  2G0B A;  2FE7 A;  4A95 A;  1Q2Y A;  1Q2C A;  2P6E A;  4EVY A;  5F49 A;  4KS9 A;  5F47 A;  3N7Z A;  4CAE A;  4HKF A;  2Z3M A;  2J8N A;  4JLY A;  3F8K A;  4CRZ B;  1YGH A;  2ATR A;  2PC1 A;  4HNW B;  4QBJ A;  4JD6 A;  4MBU A;  4HNX B;  1YK3 A;  5F46 A;  5DWM A;  3QAH A;  4QVT A;  3SXN A;  4B5P A;  2DXQ A;  4A32 A;  4KOV A;  5AG7 A;  3TOB A;  4NEX A;  3R1K A;  4NF1 A;  4UWI A;  2C27 A;  4BMH A;  5J8C A;  2AE6 A;  3I9S A;  2G3T A;  2P0W A;  3IU2 A;  1R57 A;  2BUE A;  1YVK A;  2EVN A;  5F48 A;  1YVO A;  3H5Z A;  4MFZ A;  2WPX A;  2REF A;  5H84 A;  2PQ8 A;  3SXO A;  4JXQ A;  1S7L A;  2OZH A;  2FIA A;  5G21 A;  3R95 A;  3MGD A;  4KOX A;  1S7K A;  1IB1 E;  2D4P A;  1Z4E A;  2JDC A;  3EC4 A;  1XE4 A;  1KUY A;  4J3G A;  1FY7 A;  4KOY A;  2FS5 A;  2ZW5 A;  4E0A A;  3C26 A;  2VBQ A;  2CXA A;  3IU1 A;  2Q4Y A;  1V0C A;  3SHP A;  3T9Y A;  4E8O A;  4NSQ A;  1N71 A;  3TT2 A;  2R8V A;  1Y9K A;  4R3K A;  3K9U A;  2ZW6 A;  4QC6 A;  4R57 A;  2A4N A;  3KKW A;  3PZJ A;  2P6F A;  2DPT A;  5HH1 A;  3EO4 A;  5KTC A;  4YFJ A;  4U5Y A;  4FD4 A;  2QML A;  4CGO A;  2Z0Z A;  4MFL A;  2B3U A;  4MFQ A;  3NE7 A;  1S3Z A;  3R9G A;  3LOD A;  2R98 A;  4MY3 A;  2Q44 A;  4GS4 A;  3W6S A;  2Z3L A;  3E0K A;  1M1D A;  2KCW A;  1BOB A;  3F5B A;  4XNH C;  3DR6 A;  3F0A A;  1QSO A;  2ZPA A;  4PV6 A;  5KTD A;  4I49 A;  2JDD A;  3UY5 A;  4B10 A;  4CGN A;  4UCP A;  2R7H A;  3P2F A;  1QSR A;  2VI7 A;  1S5K A;  3IGR A;  2PDO A;  4OAE A;  4B14 A;  4RI1 A;  5EBV A;  4MJ8 A;  5KTA A;  4B5O A;  4R9M A;  4KOS A;  3FIX A;  4K30 A;  2ARH A;  4U9Z A;  4CAX A;  3S6H A;  4UFV A;  3R9F A;  3JTK A;  4B11 A;  2VZZ A;  2FT0 A;  1OZP A;  4KUB A;  4KUA A;  1P0H A;  1ZO0 A;  3LD2 A;  5JPH A;  2OH1 A;  3T90 A;  2RC4 A;  2FL4 A;  4II9 A;  4Y49 B;  2VEZ A;  4CGM A;  4X5K A;  1SQH A;  2B3V A;  2FSR A;  2IL4 A;  2F5I A;  2B5G A;  4CYN A;  1M44 A;  1I21 A;  3VWE A;  3TO7 A;  1VHS A;  3JVN A;  4UA3 A;  3CXS A;  4CYQ A;  2YNE A;  2Z3K A;  3PGP A;  5A28 A;  1IIC A;  4YRH A;  2CNT A;  2CNM A;  2BSW A;  2ZXV A;  4QB9 A;  2FIW A;  3DDD A;  2R1I A;  4KVX A;  2B4D B;  3D8P A;  4KOW A;  4C2Y A;  5BWA B;  4KZT A;  1S7F A;  1MJB A;  4UFW A;  2X7B A;  2Q4V A;  4KOR A;  5CNP A;  4MFK A;  5G22 A;  3BJ7 A;  2YNC C;  1I12 A;  5IB0 A;  4H89 A;  4MFP A;  4MY0 A;  5G20 A;  1MJ9 A;  3CXQ A;  4OAD A;  3W91 A;  2ZW4 A;  1ON0 A;  1IYK A;  4YGO A;  4JWP A;  5AG5 A;  1IID A;  3R96 A;  4MFJ A;  2PRB A;  2QIR A;  4H6U A;  5C82 A;  2OU2 A;  2HQY A;  4KSA A;  2Z3N A;  3RYO A;  2JEV A;  3P2H A;  3D2M A;  4B12 A;  4CS0 B;  2P6G A;  4MI4 A;  1P4N A;  4B13 A;  4NCZ A;  3FRM A;  3ZZI A;  4JJX A;  1BO4 A;  2D4O A;  3PP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...