5GGQH

Crystal structure of nivolumab fab fragment
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
208
structure length
208
Chain Sequence
VQLVESGGGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nivolumab light chain
publication title Structural basis of checkpoint blockade by monoclonal antibodies in cancer immunotherapy
pubmed doi rcsb
molecule tags Immune system
total genus 48
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2016-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ggqH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ggqH01
2R1XA 1OGAD 3PWLA 4GW1B 5FGRA 3VE0B 3OKEA 4N0CD 4QHKI 5HYJA 4FNLH 5C9JA 3PL6C 5F7HA 1FNLA 1QFUL 4S2SA 1RU9H 1F6LL 4KRPB 4XPTL 1P53A 3PL6A 2OQJB 1OAZL 2HT4C 3FMGH 3UX9B 5IHZB 4K7PL 5H35A 2O61B 1KEMH 5I18H 3C5JA 1IBGL 1LO2L 5IOPB 2W9EH 3MNVA 2MCG1 4OLXH 4P2CG 5C0AB 3VXUA 1BZ7B 5JHDB 2OJEB 1D5IH 1N6UA 4BUHA 1WBXB 3VI4E 2EIZA 3IJYB 3F65A 3RY5A 3ZTNH 1DQTA 1MNUH 1UWEL 3B4NA 3W39B 1IAKA 3PWUA 4KK9C 3FTGA 3QT2A 1A7QL 4IJ3B 1MI5B 1V8HA 3C8DA 2WSKA 5I1KL 1WZMA 3QPXH 4I13B 1SJHA 2Z8VC 1K4DA 2VSDA 1QOKA 3RWDA 3V5DB 1NAMB 4JFPA 4DGVL 3E6FA 3WFCH 4O58L 4S1QH 2XZQL 4ZSOA 4UB0H 2VKWA 5FA4A 3T65A 4M7KH 5E99L 4XCYB 1C5BL 2G5BA 4ZUTA 5C08D 1TZIB 2G75A 3GSQA 5FK9B 5GS2D 3WNMA 3QB7C 1BM3L 4JR9L 1JYNA 1FFOA 5FUCC 4NKIL 5FFLA 2ED8A 4P9HL 3FQXA 4PJHA 3ZE0F 1CLYL 4K3JH 3SJVB 3RZWA 3T2NH 5FYLD 5D7JD 4G9FE 1A6ZA 4R7DB 1MUJB 5CMAB 2OMNA 4FXKA 1N7MH 1XF3A 3O0RL 1INEH 1KV3A 4J3SA 1T0MB 4BQ9A 2DIAA 4HXAL 3O2WH 2VTFA 4XI5D 4FABH 1I3RA 2VLKB 5FYKL 1YUHA 5I1IH 1I1YA 1R5IB 4MLSA 3N0PB 4NJ9H 1NL0H 1YMMA 4WIQA 5D72H 5JQHC 2NTFB 2XOTA 1MLCB 2XTJC 1V3LA 3IFPA 3FFCA 2I26N 2X4QA 4A2MA 5IHUH 2MPAH 3IU3B 3VFUA 3MA7A 5F7NC 4PGBA 1JN6A 1CFVH 5BRZA 4NQDA 5DC0A 3DVGB 5EU6E 2PXYD 2HVKA 2MFNA 5CGYD 1KLGA 3SDXB 1NBVL 3LS5L 4LAQH 2XY2A 3AS1A 4OCSH 4G3YH 5HYSG 4TUJB 2VDRH 5D1ZD 3U0WL 4ALAL 5EZOL 1A02N 2X4SA 1HHJB 3NACL 1T21B 3DRTA 3UBXG 3IDIB 1GL4B 2V2XB 5CJ8A 2IALA 3Q6FA 4M1GH 5L2KE 1TJIL 4XCFH 1SJVA 1DFBH 4M61B 3F12B 1JRHI 3D39B 4DAGL 1VGKA 4G8EA 2RFXA 4KY1L 4MMXC 4P3WA 2EH7H 2FO4A 4MX7B 1ZT7A 2MJWA 4TVPL 5BZWA 2X7LB 4BH7A 5AZ2H 2GUOA 3LS4L 3P73A 1MJJA 4G8GE 4IRJB 1QA9A 3AXLB 4G6KL 4ISVB 3WD5L 4M43L 4GW1A 1FL6B 2W0FB 1C08B 5ANME 4PV9B 4KRPC 5I30L 1AGDB 5BO1L 5C3LD 3LPFA 3DV4B 4XPBH 5C07B 5LKNA 4HMEA 4HUVB 2HKHL 2OQJA 4H20H 4QHMB 5IHZA 2MOVA 4D94A 3UTZB 4DFHA 5CAYB 1MVUB 2BVOB 4GQ9H 3CAFA 4AIOA 2O61A 4LIQH 3NVQA 3QJFB 1RJZB 4AYFA 4L3AA 5IOPA 4Y19B 1YEIH 2X41A 1HN1A 1BZ7A 1CGYA 5JHDA 2OJEA 2XRAL 2I24N 4I1NB 4KKBD 2JELL 3QUYD 1OAYL 1I9RH 5GS3A 5EBGA 1J87A 3IJYA 3GSOB 1RIVL 4IJ3C 3W39A 4L8SB 2D3VA 5C0IB 2HVJA 3L3OB 1D5BA 1B6DA 5SWZB 3PP3H 3SHSA 1MI5A 3UO1L 3BD4A 1WBYB 1QSEE 2L7JA 2PR4L 5B3JE 1GVIA 5T3ZL 2W59A 5ILTH 2XQBH 5GGVL 3V5DA 1NAMA 1B4JL 5B38B 5CJOH 4RGOL 4Z7NE 1BAFL 4NKOB 4Y8DC 2OZ4H 5TQ0H 5HYIA 5L8JB 4XCYA 1BQLL 1NKOA 2IQ9H 3S35L 4PJIE 3ARRA 1TZIA 3CX5J 1A6PA 4PUBH 5FK9A 5I74B 4EDXB 4HKBA 1IFHL 4KK5C 4OCYL 1E4XI 4B7IA 2CMRL 2X1XR 1GGIH 4XCEB 1HH6B 5ACZB 1JGVH 3SJVA 5D7IE 3TIEA 4Z0BH 1QBLH 4R7DA 1MUJA 4U1HB 5CMAA 4QXTB 4PRHB 2ZCHH 1CYGA 4L8CB 1T0MA 5EPMB 4M02A 4OLUL 2VLKA 5EDXA 1YPZF 3BDYL 1R5IA 3RX8A 3DRQB 3HA0A 2OTWB 2NTFA 1MLCA 4P46D 3IDUA 3X14B 1G6VK 2DL2A 4OF5A 3PGFL 5I8OL 3QXUA 1ZLUK 7FABL 4I2XE 5I19H 5HHXH 3HUJF 5LGKA 2OK0H 4NC2B 1I1AC 3LH2H 5JDSB 3L6FB 5GGRB 3DVGA 4Z7WF 4KZEH 3O2DA 4I3GA 3SDXA 3VDBA 3RPIB 3ULUE 3K74B 4TUJA 1KJ2B 5FUOL 1HHJA 4M00A 1D3CA 1KXTB 4NP4H 4O2FB 1T21A 4FNLL 3IDIA 1I1RA 2V2XA 3DXAB 1UB5A 1RU9L 1S9VB 1G7MB 1T2QH 2GFBA 3LKPB 4M61A 3F12A 3D39A 5E6IB 1TTFA 4GBXB 3I02B 3O81A 4O2EB 4OUOA 1L6XA 1YEDB 3FMGL 1K5NB 1MFAH 3MLVL 4LSDA 4MX7A 4IRJC 4MVBD 1LEIB 4MXQC 2B1HH 2X7LA 1NKRA 1KEML 5I18L 5J89A 4IRJA 3AXLA 2I9LB 4ISVA 3N1GC 5GPRA 2W9EL 2W0FA 5JW3H 4BKLB 1C08A 3WNPA 2D03H 2XACC 1AGDA 1D5IL 2WLZA 5EZIH 3T0BA 4LNVA 4WJ5A 3SE9H 2YPLB 3F7YB 4GRLC 1F5WA 3DV4A 4WUKH 5C07A 2X9YA 4AZ8A 4HUVA 2BY1A 2E7CA 3ZTNL 3VFGL 4XCCH 2LV4A 1EVUA 2G2RB 4HQQH 4QHMA 4UBDC 2NZIA 1UKSA 4LCWE 2BVOA 1F11B 1RJZA 3OKDB 4QRRB 3QPXL 4Y19A 1HSAB 2Y6SC 1EVTC 1MCIA 1K6QH 4HS6B 4DQOH 1H3XA 1BJ1J 4EN3D 2DJUA 2CO7B 3MGTB 1BFSA 4S1QL 4L8SC 4RAHA 3KPMB 4P99A 4UB0L 1QSFB 4M7KL 3GSOA 5KSAB 4L8SA 5MERB 5C0IA 3L3OA 3FN0H 1EEQA 3OB0H 4Z7UB 5SWZA 5CJQH 3ZKNC 5IMLB 3BRGC 2X6MA 1RZGB 1U8PB 2QKIB 4ODVH 4MA8H 1WBYA 3VI4F 2FLBT 1CZ8H 4K3JL 2ZUWA 4S10A 3T2NL 1NC4D 1VACB 1SJXA 1ZOXA 5DHYB 4F58H 3V7AG 3AAZB 1BD2B 4OCNC 5B38A 6FABH 1BVZA 4NCC2 3O2WL 4EI5A 1MCHA 5HPMB 4FABL 5I74C 4NKOA 4WI4A 5F9WB 5IW3A 5I1IL 4O51B 4M1CD 3S6CA 1NL0L 4KXZI 5D72L 4EDXA 2EDJA 2ZSVB 1WZLA 4XCEA 1HH6A 4JANB 4FTVD 4JO2H 2MPAL 4HS8H 5ACZA 4U1HA 2FH6A 25C8H 4QXTA 4PRHA 1CFVL 4L8CA 4YHMH 5DWUL 1D6VH 4DGIH 4TNWK 4LAQL 3IDGB 1IZJA 1XF4B 4OCSL 4P2OA 2VDRL 5F93C 3IU4H 2F53B 3DRQA 3WFHB 2F15A 2OTWA 3W11C 1TJGL 1KJ2H 1WIPA 3X14A 2YZ8A 2P5ED 3DARA 4M7ZB 4M1GL 1DFBL 4PJ9D 1AFVL 4XX1G 1RHHB 4HGWB 5C08E 3QDGD 1Q0XL 3OJMB 5JDSA 2EH7L 2FECL 3L6FA 3QUXD 5GGRA 2OBGA 5IB5A 5HYEA 1K8IB 5AZ2L 3RPIA 1J12A 1FNAA 4FQLL 1KJ2A 1M05B 3GMMB 1Z9MA 3Q5TA 5FYLE 5CBEB 4CNIB 1CFNB 2OL3L 4O2FA 3BH8B 3KG5A 4TPRH 5E6IC 4GBXC 1S7TB 4K94H 5IVZB 4WWID 3DXAA 1S9VA 1G7MA 3LKPA 2IBGA 3BSZH 5E6IA 4GBXA 3I02A 4O2EA 5F6HJ 4H20L 1YEDA 4Q58C 5D6DC 1LEIA 5HHMD 1OAUH 4OZFG 4GQ9L 5I75B 1CK0H 4LIQL 2W60B 4NPYB 2PW1B 4ODSH 5ICYB 1AQDB 3WUWB 2I9LA 1YEIL 5DUPH 3ISWA 4OFYD 4BKLA 3SDAB 5EUOB 3B9EA 2OS7A 2BFVL 4LSPH 3QQNA 5B4MD 5MEND 2YPLA 3F7YA 4XAKD 4XRCB 1EV2E 1T7YA 1I9RL 1KCLA 2O26U 3C60D 3FZUC 4XHJD 2BCKB 2G2RA 2MQ3A 4PRPB 4G6FD 3VGAB 3V4UH 2F54B 3O4LD 4JVWA 4X6BA 1F11A 4FFVD 2X4NB 4RFEB 4JFHD 4DTGH 2MQ0A 3OKDA 4QRRA 1G0YR 5I16B 4Z7QE 1NC2D 1HSAA 5ILTL 4HS6A 2XQBL 3P9LB 4MHHI 5CJOL 3MGTA 1ZGLA 3EOYG 5FO8B 5KSAC 5L7XL 4R96A 1QSFA 3QWRA 3RZCD 2OZ4L 5TQ0L 2IQ9L 4JKKA 5MERA 3RQ3A 4PUBL 4Z7UA 1F2QA 2FLRT 5IMLA 1EHXA 1RZGA 5FYJD 1U8PA 2C3VB 2QKIA 3FRUB 1GGIL 3VXOB 5IIEB 1JGVL 4FFWC 1GHFH 2R0LH 4Z0BL 1QBLL 1VACA 5DHYA 2ATKB 1MJ7H 1BD2A 5F9WC 2W9DH 3HB3D 1E4JA 3D69B 4HWZB 4JRXE 2DS4A 4BFEA 5HPMA 4OZIE 3BP6B 3EYUH 1VADB 2ATPB 3H8NA 1H3WM 5B3JF 4P5TD 2FJFB 4O51A 4KHXL 2AVGA 4QEGA 1F90H 3S4SB 3MUZ1 4K3HA 4Z7NF 3EDJA 4L4VE 4JANA 3D3VD 3BWUC 5I19L 2ITCB 5HHXL 4PP2B 3SE8H 2VZ1A 2DMBA 4PJIF 1FNGB 2OK0L 3LH2L 1Y6KR 4XHQA 1S9XB 4P59H 3H9SB 4KZEL 1CI5A 5B39G 3BKML 4Y0GA 4OCMC 4HIXL 5D7IF 3IDGA 4BQ8A 1T03H 1XF4A 3EDKA 3TV3H 1B0WA 4V2CB 2F53A 3WFHA 2VR5A 1KPRB 4NP4L 2VKXA 3QI9B 5J1AA 3WNKA 5C71A 4JFED 1T2QL 5FOBB 1HXMB 3QFDB 1MCBA 1UCBH 1RHHA 1LDPH 2AEQH 2QQQA 3LKNB 4HGWA 3Q5YA 1MFAL 4GOSA 2VDPH 3BW9B 2NY0C 3PJSB 2B1HL 3HI6H 5DVLA 5IW6B 4ELMA 1K8IA 1L0XA 4IOFD 1M05A 5H2BB 3GMMA 3QSKB 4LLMB 1VFBB 4IOSD 4LPWA 1MCPH 4TULH 4WWKD 2CK0H 4XTRC 5CBEA 3VFWB 4CNIA 5ALCH 4PS4H 4RGMB 5JW3L 1EO7A 5M94B 1CFNA 2D03L 3C8KB 4ZAKB 2VN4A 3AUVA 5EZIL 1S7TA 4I9WD 3D2UB 5IVZA 2H1PH 4WUKL 3ULUF 5I17B 4ODUB 4XCCL 5I75C 4HQQL 4F80A 2GHWB 3KJ6L 4JGJA 3MBEB 1T7ZA 1SEQL 1CGUA 2IPUG 3DGGB 3EGSB 3MXVH 4W4NA 1NFDE 1P4LB 3MNZB 4FZEH 3SDAC 5KANG 4XWOC 2W60A 4NPYA 2PW1A 5ICYA 2R0WH 4URTB 1AQDA 3WUWA 1JYVA 4QRQB 3SDAA 5EUOA 4MWFB 4DQOL 3G6JE 1JWMA 1X5FA 1LO3H 1ZA3B 3IAPA 2VABA 2VC2L 4XRCA 5KW9H 1KPVB 2A1WH 3MACH 1YEJH 4KK6C 4ZPTA 3VGAC 3VI3E 4YEFA 3EJYC 4GG6E 3MLXL 3I75B 4PREB 3WCYA 3FN0L 4PRPA 2ENYA 4I48B 2F54A 4H25B 1AY1H 4ODVL 2X4NA 3RVTD 4MA8L 4RFEA 4JPWL 1ZLWK 3VMPA 1CZ8L 5F89B 2NY2D 5I16A 2HLFD 4ZS6D 4F58L 4Z9KB 3CD4A 5FO8A 1KLUB 1HKFA 1IC4L 4XP4H 4HUMB 4HFWB 5I2IB 3HMXH 3MREB 4X8XA 4MB3A 3SGJC 3NFNB 1A6VH 2C3VA 3FRUA 1QG3A 2BNUB 5IIEA 2Y06L 4PJDB 3SGJA 4HS8L 4WEBH 2ERJC 5FYJU 3SOBH 43C9B 25C8L 2ATKA 3IS1X 5CD3B 4NC1C 1MVFA 4W68A 4YGVB 3BD5A 3BGMA 4YHML 3D69A 1CT8B 4HWZA 3IYLW 5KZCB 2YEZB 3BP6A 2Z8SA 3V95A 1VADA 2ATPA 1ZVHA 4MSWB 4CVZB 3WS3A 2FJFA 2IC2A 3R4DA 3RU8H 3IU4L 5F7MC 1KFAH 4NFCA 2X44D 3S4SA 1KJ2L 1H3TA 4LSTH 5DEGB 5GHWH 3VFNA 3QO0B 3B43A 4AG4H 2WIIA 3QQ9C 2ITCA 4WDIB 4PP2A 2DLGA 2XWBB 1FNGA 5GGQH 2XN9A 2BNRB 4Z18A 4DKDC 3H9SA 2GJJA 2A74B 2WNGA 5ADPH 1WFOA 3QI9C 1ZLSH 1EK3A 4OLZH 4PY8I 2BX5A 4LRIC 1JBJA 4TPRL 1MCFA 2PN5A 3QI9A 1QR1B 4K94L 3VFMA 4G42B 5FOBA 1HXMA 3QFDA 3BSZL 2ZKHH 2MWCA 4UOJA 1PG7X 1Z9OA 3LKNA 4NNXB 5HPOA 5E1HB 3BW9A 3OJDA 3PJSA 2APWA 5IW6A 4RGMC 1R6VA 2YOCA 4ODSL 4ZAKC 4FTVE 4GAJH 4LLMA 4X5WB 1VFBA 3KXFD 1JUFB 3L7FB 5DUPL 2WV3A 3FKUS 3VFWA 1A6AB 3EYOA 4CU6A 3WXVH 1RJCA 3M17B 3C8KA 4ZAKA 1I9EA 4LSPL 3HUJB 1UWGH 5HYQB 5GJSH 3D2UA 1XR8B 3OF6A 4JY6B 5IJKC 2ADIA 3MBEC 5E03A 4UT6L 5I17A 3VXMB 1IC1A 4MNQB 4XP9L 4Y5VA 4WW2F 3MBEA 2BP3A 3V4UL 3DGGA 3EGSA 1P4LA 3LEYH 3MNZA 3SGEI 5I71B 1N0LA 3EW3B 1NUNB 3IFLH 2P5EE 1MHPH 4LPYA 1XIWD 4JQIH 2MQCA 4QRQA 4MWFA 3DVNA 2W65B 3O3EA 1J8HD 1NCWH 1YY9D 1ZA3A 3QDGE 5EORH 3V5HA 1KPVA 1G7PB 2H9GA 4Z77A 2R2HB 4BZYA 1YEHH 3I75A 3UROR 3U7WL 1LHZA 4PREA 1WT5C 3MOBH 3ZSTA 3KHQA 4I48A 4H25A 3VW3H 1BBDH 3CXDH 5IB3B 4JDVB 4GKSB 2AV7B 4F37F 5F89A 4R4NC 2HFGH 1GHFL 1CIUA 3NCJH 5CGMA 1H3PH 4HEME 1MJ7L 4R2GB 5KOMC 2W9DL 1ZSDB 3EYSH 1KLUA 5H94B 4J12A 3BPOC 4HFWA 5I2IA 3GSNL 2QTEA 3EYUL 3F6IA 4Z7QF 2P43B 2DQEH 3MREA 4YXLH 4W4OC 1C7TA 1IC5H 1YJDH 3FO9B 5T3XH 3L7EB 3BJLA 2Z9TA 5CWSB 1F90L 3W82A 3NFNA 4W4OA 2VN7A 3OKNA 4KKCD 5DJXB 4XAKE 1K4CB 4PJDA 1C5CH 5DFWH 3QUMB 3SE8L 43C9A 4KAQL 5CD3A 2HAZA 4LVHB 4JRYB 4YGVA 1YJDC 3REVB 5C2BH 3NCEB 3B2VL 1CT8A 1A22B 4P59L 2YEZA 3O4LE 4Y2DB 1T03L 4JFHE 1DQDH 3FQUB 4MSWA 4CVZA 3TV3L 4BQCA 4KH2A 3AROA 3VWKD 4EIZC 1OTUC 3GMNA 5DEGA 3EDFA 3QO0A 2ZG2A 4OZIF 4LLWB 2AEWA 4H1LB 1UCBL 4WDIA 1QFHA 2WUCL 1LDPL 2XWBA 3HZKB 1DVFA 2FX9H 2BNRA 3MUJA 5E2TH 4TVSa 1PKQB 2MTPA 2VDPL 5AWNH 3QDJB 3VD5A 3QEUB 4EKXA 3HI6L 2A74A 3LQZB 5FYJE 1S5HA 4YH6A 4ZUVB 3CSBA 1HSBB 1JRHH 1MCPL 4TULL 2CK0L 4MB4A 5ALCL 2DTSA 1KJ3H 3AM8C 1IKFH 2A9MH 5IVXE 2FH8A 1QR1A 1K2DB 2H1PL 2PTUA 4G42A 5AG9A 1U8NB 5FYKD 1T0NB 2IF7A 3RDTB 4HG4K 1ND0B 1FLTX 1YPZA 3JV0A 4G9FB 1JF1B 4KKLD 2ZNXA 2KH2B 2VZSA 3PQYD 4B0MM 3K8KA 2N7AA 3IFNH 2GY7B 3ARGD 4X5WA 5IWLC 4CN1A 3L7FA 1A6AA 3M17A 5IFJB 2EDHA 3HUJA 4Y1AB 3TJEH 5HYQA 3QHTC 5IWLA 1LO4H 1XR8A 3PWVB 4NO3B 4HCRL 4JY6A 5KW9L 1J0JA 2ZUSA 2FGZA 3MACL 1YEJL 1RULH 4JM2B 4O4YL 3VXMA 3K80A 1GGCH 4MNQA 4WFHE 4LLUB 3RIFF 5I71C 3KPRD 2A0LD 1WTGT 4LEOB 2CDFB 4J3OC 4KUCD 4YDJB 1AY1L 1KELH 1XF1A 4JFEE 2A6DB 2DWDA 4JKLA 3E3QE 5D1QA 4K7FB 1DTUA 4UIMB 2W65A 1G9EA 3BN9D 5LQBH 3HG1D 1ZEAH 5KVEL 1NFDF 3QRFM 1U8IB 3EIFA 1G7PA 1MHEB 3HMXL 4JY4B 2R2HA 5HGHB 5DMGD 1VFMA 3G6JF 5AZEH 1EBPA 3M45A 1A6VL 1IEBB 4JDVA 4GKSA 5E9DD 5IB3A 1ZXQA 4I9WE 4R2GC 3VI3F 4WEBL 3CMOH 3SOBL 3BUTA 4GG6F 3ZDYE 1GSMA 4IOIB 1NGQH 4G8GB 1E6OH 2DIBA 3ZKQD 3QUMH 3MRFB 2I25N 1X5KA 5H94A 1E4XH 1QRKA 1I8KB 1P5VA 1Y6MR 3UTTD 3MJ6A 4M7LT 4EUPB 3BGFB 3RU8L 4UILH 5HJ3B 1KFAL 3FO9A 5CWSA 2O93L 2V9RA 4OI9A 4LSTL 1CDJA 5DJXA 4KGLA 5GHWL 2XY1A 1K4CA 1IC7H 4AG4L 1IAII 1TIUA 4P3CH 4MA1B 4Y2DC 5GGQL 4JRYA 4X98A 5DJAB 3REVA 4H1LH 3T08A 3D87B 1KIUA 4MJID 4I77H 2VWEC 5C0CB 4Y2DA 5HY9B 5ADPL 3FQUA 4NFDA 5T3ZD 4JM4H 1PY9A 1ZLSL 1J11A 3N1QC 4CN4A 3SKUD 4YDKH 3P3YA 5EU7E 3RHWK 1I8MB 1QD0A 4H1LA 1V3JA 1F3JB 2ZKHL 3N06B 4JVPA 2H8PB 4OAWB 3HZKA 4QT5A 1E6JL 1AD9A 3WFBL 1PKQA 1TDQA 3QEUA 2DTMH 5DEFB 4LLVB 4JJ5B 3LQZA 4X7FC 2AXJA 4OLVH 3QCUH 4NKMB 4N0RA 1IGJB 4JY5H 4GAJL 4NRZA 2CDGB 1N6QH 4P23C 1AIFB 2NR6D 4X7EC 3UTQB 2DQDH 3RDTC 1UWGL 2EE6A 4JQXA 1RHFA 1K2DA 5L8KB 1U8NA 1T0NA 3RDTA 3K8MA 1ND0A 4UT9H 3ZT7A 5HDLA 4PJ5D 1MIML 4G9FA 1JF1A 1MCKA 4U7MA 2NXYD 5D70H 1O5DT 4HH8A 5HYJD 3IFLL 4EBQH 5DZLA 4JQIL 1GYAA 5F70A 3MRMB 1S7XB 1KC5H 5FKPB 4EIGB 1NCWL 3PL6D 5IFJA 4JM2C 4Y1AA 5EORL 1EFXB 3PWVA 3C6LB 3K4DA 2KQMA 4NO3A 1CFTB 4K8RH 5DJ2B 3RAJH 4UNVA 1I1FB 2HT4D 1YEHL 4LLUA 1DEDA 3MOBL 3KPSB 1RZ8B 4LEOA 4NRXA 1DN0A 2CDFA 3OG4B 3VW3L 4YDJA 2D0GA 2I5YH 2VDNH 3TA3B 3CXDL 3VXUD 1VA9A 3KPLB 2A6DA 1OAQL 5SV3A 1WFTA 2C1OB 3NCJL 4K7FA 2UYLB 3FN3A 1KACB 2D7TH 1AD0B 2AJYH 3EYSL 5EIQA 2DQFB 2H32B 1C12A 3QXTA 5DK2B 3H3BC 5HGHA 3KXFE 1IC5L 1G84A 4KK9D 2ZUUA 1YJDL 4EUPH 2NX5D 1IEBA 2WWKT 2FO1A 1XMWA 5A40E 1F45A 5F8QC 4LVEA 1C5CL 3ULVF 2BNQB 2WP3O 1QFWI 1FFNB 4IOIA 1RUPL 4G8GA 2BVYA 5C2BL 4KXZH 3MRFA 3BGFC 4MD4A 1I8KA 3R06A 4GMSH 4Q9CA 1DQDL 4EUPA 3UJIL 4GLRI 4NNYB 5HJ3A 4R8WH 1YA5A 3EZJB 1J8HE 1MRFH 2DQTH 1TVHB 3ET9F 4KPHH 2A83B 4LCWB 5IT2H 3ZYZA 1UFUA 2XPGB 2B4CH 3X3FH 4PGJA 5DJAA 2FX9L 1TZHB 5E2TL 3VWJB 5AWNL 3WMSA 1V7ML 2B5IB 5C0CA 1J0HA 4LF3B 4PB9H 5HY9A 1T7XA 1UVQB 4UIKH 1HXYB 1JRHL 2QADB 4QXGH 1KJ3L 4ZQKB 2XTJD 2A9ML 3VD3A 1JYWA 4K7PX 1IE5A 1KB5B 1I8MA 5BRZD 1F3JA 3C2AH 2B0SH 2H8PA 1N8ZB 4OAWA 1LILA 1QSEA 1ZTXL 4EXKA 2UUDH 5DEFA 4LLVA 3V6OE 4G6JH 4D3CH 3MV7B 4NN5B 4DCQB 5JA8B 2X1PA 1A9BB 1IGJA 2COQA 3IFNL 2CDGA 4Y8AA 5IEHB 1TQCC 1AIFA 1U93B 4L29B 3UTQA 2R69H 4Q9BA 3TJEL 3T0AA 1LO4L 2DQIH 4CJ0A 2DYPB 3QDAA 1RULL 2VIRB 2CUHA 2J6EH 4C59B 1GGCL 5CLTA 2VL5B 3QHFH 4JZNB 2YMXH 2QL1A 3WXWH 1J0IA 5I8EB 2VDMH 5IVXF 1JK8B 3LIZH 1MCSA 2X40A 2ARJB 1KELL 2GKIA 2E3VA 2H2PC 4LGSB 2AGJL 4GRWE 1OSPH 4E9LA 2L7UA 4P5KB 5EBMB 4RWHA 3MRMA 3C6LC 3BKJH 1HI6B 1S7XA 4KRPD 3IT8D 5IMOB 1CS6A 3GSWB 4WTZG 2BHYA 5ALBH 1EFXA 1W72H 3HCVB 3C6LA 2X2YA 1CFTA 3PV6B 3JXAA 5DJ2A 4Y4FA 2ZSWB 5CJ5A 5TF1H 2B8OT 3EO9H 1I1FA 5SX5H 5ENWA 3TA3C 2H32H 5LG1A 5AZEL 3KPSA 4YZFE 1RZ8A 4MGXA 5JOFB 2R0ZH 4IS6B 3SPVA 2CLZB 4HPYH 2CDEB 3UZEA 1KYOK 4N0UE 5C0AD 3TA3A 2FHFA 5JHDD 3CDYA 3O6LL 5GRJH 3WNOA 3KPLA 5L6YH 3CGTA 3CMOL 5EWIH 5FYKE 5IGXH 2C1OA 3U9UB 5D7KD 4PLNC 3HPLB 3EFFB 2UYLA 4LPCA 4LHUB 1AD0A 3QUML 4AEEA 1U95B 4ZFGH 1E4XL 3NIGE 1M6OB 2DQFA 2H32A 2J1KA 5DK2A 1ZV5A 1MI5D 4MQ7B 3VG0H 4ZOAA 3TFKC 4UILL 1INQB 4DZBB 5FUZH 2XWJB 5ESQB 1FFRA 2J8UE 4QY8B 1NGYB 1IC7L 5DVNA 1HZHH 1FFNA 1NBYA 4LSVH 4PR5B 2DAVA 4P3CL 4S11A 2DMKA 3KPRE 5BXFA 4PLOB 5GRWA 4I77L 4ZO6A 5IMKA 3BIBX 4L5FH 4JZJA 4MCZB 2R4SH 4JM4L 3ZDYF 4NNYA 2WLYA 3SJVD 4KK5D 4IRZL 2YA2A 2C4FT 5KS9F 5E2UH 2ICWB 5C2UB 3NAAH 4YDKL 4XNYH 1TVHA 5E08H 3HI1B 2VLJB 3V4PH 1IGYA 2A83A 4LCWA 2HLAB 3VWJC 3U36B 2GI7A 3WSQH 2B5IC 2JJSC 2XPGA 3LB6C 2VLKD 1KB5H 5HHPB 5GISH 1TZHA 4ODTH 3MMEB 4M8QB 3VWJA 5IJVB 3RWEB 3QDMB 2DTML 4ZS7H 2QADC 5FHAH 3MPCA 1J5OH 2CH8A 4LF3A 5E9DE 4OLVL 3RWCB 3QCUL 1UVQA 4JY5L 3TF7C 2VLRD 1HXYA 5GJTH 1EEZB 1UACH 4MQSB 4WY7H 4RZCB 4ZQKA 5DSCB 2XTLA 3QEGH 3RVUC 1WICA 3BE1L 1KB5A 2R8SH 3GHBH 3WLWC 4WEMB 5HBBA 4X80H 2D7MA 1N8ZA 4JRWA 4UT9L 1I1AD 1FYTB 4NN5C 3VXNB 3U2SB 5C0DB 4LKXB 3VA2C 5D70L 3A0OA 3MV7A 5CEZD 1T7WA 4DCQA 1A9BA 4JRXB 4WFGD 1MCWW 3V79C 4EBQL 2DM7A 4RWYH 4M8VA 4OZIB 5IEHA 4L29A 1U93A 1KC5L 3D39D 4APQB 2D9QB 3TGXA 1ZHKB 3U48A 4K8RL 3MTRA 1X5GA 2DYPA 3RAJL 2ADJB 2VIRA 4L4VB 2LQRA 5SX4I 5T3ZE 3HZMB 2VL5A 2WBWB 4JZNA 2BERA 3OR7B 4IRJD 4MXQD 3VG9B 2ZG3A 5E00B 5I8EA 1JK8A 2CJUL 2I5YL 2VDNL 2H41A 2ARJA 4U0RB 1Q38A 3P77B 5J9PB 5EBMA 1UM5H 1Z9SA 5C07D 1HI6A 1ZHLA 5IMOA 2ICES 3GSWA 2D7TL 3NH7H 4PD4K 2AJYL 1CDGA 4DWHA 3HCVA 4GRLD 5GGVY 5A43C 4ZTPL 2ZSWA 3PP4L 2CIIB 4O00A 5F7FA 4N0YH 4LASH 4UBDD 1PGRB 2IPTH 4I3SH 1FAIH 4Y19D 5JOFA 2OSLB 4IS6A 2CLZA 2P8PB 4G8FB 2CDEA 3OKKB 5D5ME 4U3CA 4YPJA 2PETA 4GS7B 3MNWB 3TBSB 4FMFA 3X13B 2Y6SD 3U9UA 2ED7A 3EFFA 4DVBB 4FA8A 5DF0A 4LHUA 4PJ5E 4OFVA 3CH8A 1M6OA 4LFHG 1DEEB 3CX2A 3WHE0 5SWZD 1EGJH 2P49B 3DBXB 4GMSL 5IM7B 1L7IL 2HRLA 2VRAA 3D1MC 4HBCH 1INQA 4DZBA 3FO0L 4R8WL 4OGYH 3ZKND 2XWJA 3BP7B 1EBAA 1MRFL 2GYSA 2DQTL 5ESQA 1OTSC 2W9LA 5TH2B 1NGYA 4KPHL 1NMCB 1QR4A 2BY0A 3Q6GL 1C5DB 4LP4A 5A1AA 3BZEB 4H88L 4P46B 5EFIB 1UXWB 1U91B 1F58H 2B4CL 3V6FB 4JKWA 3X3FL 4F3FB 2BVTA 1WIUA 1EGJA 4NOBA 2UUDK 4M4PA 1SHMA 3VXUE 1RK0B 4PB9L 3BFOA 3TLRA 4MCZA 4KMQA 2CIKA 4UIKL 4MXVE 1NUGA 2W0KA 3S96A 5MEPB 2XG5A 4QXGL 2ICWA 1EA9C 5D1ZA 2DDQH 4PRHD 3GIZH 3HI1A 2VLJA 2NPLX 2VXUH 2HLAA 3U36A 3VGBA 5HGDB 3C2AL 4HMCA 3NZHH 2B0SL 4HV8B 1AC0A 5T5NG 5E8EB 2OM5A 5HHPA 5LGJB 1UKTA 3MMEA 4M8QA 5IJVA 3RWEA 1OM3H 2B1AH 3QDMA 1U8OB 3IDJB 4XBGB 5ESVB 2NX5E 3JUZA 4G6JL 4LL9A 4D3CL 3RWCA 1EAJA 2RCSH 5I73B 3MLYH 2PUQT 3RUGB 4ZSOE 4KDWA 4GAYB 3W11D 2ID5A 5CSBA 3OX8B 2R69L 3CNKA 5CHNB 1HH9B 4HEPG 2DQIL 5ID0B 3TBTB 1N5YH 2A6IB 5SX5K 2J6EL 3P11H 1VEMA 3QHFL 2YMXL 4PJHE 5E0QA 3VXNA 1CGTA 3U2SA 1QZ1A 3WXWL 5C0DA 4F7CB 4LKXA 1MWAL 2VDML 2XA8H 1RVFH 1X5LA 3LIZL 4WW1A 5FUCE 1KNOB 1I3UA 4POYA 4APQC 4NBYB 4JRXA 4PFEA 1OSPL 1H15B 3B9DA 3DXAD 1NBZB 4JLRB 3BKJL 5C6WH 1P7QB 4LCUB 2LE9A 4OZIA 3GHEH 4M5YH 5E6ID 3MRKB 4APQA 4GBXD 5J4MA 5ALBL 3GM8A 1W72L 1ZHKA 4X9GA 3WV0A 1FSKB 3SGEH 1LK3H 3VG9C 2ADJA 4L4VA 5TF1L 3EO9L 3Q5OA 3GSXB 3HZMA 3W5NA 1Q9KA 5D7SL 5GGUB 5BMFH 4U0RC 4JB9L 5GRVK 5E00A 2R0ZL 3KS0H 2XTJE 4HPYL 1BPVA 2A9NH 5ERWB 5DQ9A 4R4FL 4I18B 5GRJL 4G7YH 3MRCB 5CUSH 5L6YL 5BRZE 4DN3H 2YPLD 3ARFC 5EWIL 1OP3H 5IGXL 9CGTA 3L3GB 3HAEH 1WSST 5DMYA 5TGBB 3FB6B 1FHGA 4U31A 4ZFGL 1AP2B 1KB9K 1LEGA 2JCCB 3KR3H 3W0WB 2CIIA 3FZUD 1FRGH 4GRWF 5A2FA 2I9TA 2AQ1A 1PAMA 1XCQB 5D96B 3EBAA 4QRRD 5J56B 4GS7C 4OTXL 2OSLA 3BKYH 5GRVL 5FUZL 2P8PA 4G8FA 3OKKA 1A6WH 3B9VA 4WVRA 1BQHG 2NNAB 3MNWA 2DM4A 5JLZB 4HUKB 3X13A 1HZHL 3OZ9H 4OCWH 4LSVL 4DVBA 3DI2B 1QSFD 4PJBB 1MELA 1B4RA 2CPCA 3T0EE 5KSAD 1DEEA 4UDUB 3DBXA 5IM7A 2ZWLT 5GSRB 4F7PB 2R4SL 35C8H 3AREB 1B9ZA 1NMCC 5E2UL 3SGKA 3BP7A 3NAAL 4AT6B 4XNYL 4U6VH 3NIGF 5E08L 1BD2D 3V4PL 5TH2A 3PGCB 3WO4B 4FFWD 2EDRA 1C5DA 3BZEA 4D2NA 4P46A 2PTVA 3ROLB 1UXWA 3WSQL 1U91A 5H37H 4F3FA 2FEDC 5GISL 1JTOA 1MQKH 1ZAGA 5FHAL 1J5OL 5C0AE 2J8UF 5E24E 5JHDE 2YXFA 2EDLA 4PJGE 4JFXA 4N8PA 1UACL 1RZIB 5MEPA 5CGTA 5E2VH 4M62H 3B83A 4WY7L 3CCHA 3QEGL 4RMSA 3IETB 3DVFA 1LEKB 4KUCF 3IDXH 4LIQE 3GHBL 3QZWG 4HV8A 5IF0B 3BJ91 3RP1A 4X80L 1MI5E 1NH6A 1CR9L 5E8EA 5LGJA 4RSVA 4L3CB 3RTQB 4S1RH 5BZDB 4HG4J 5I73C 2F53D 1U8OA 3IDJA 4Q6IB 4XBGA 5ESVA 1BJMA 1VGEH 5DUBB 3PIQB 5I1EH 2VLLA 4ZOBA 4NO5B 1I75A 2XICA 3KNBB 4F8TA 4RWYL 1ZVSB 3RUGA 5JPMB 5EOQH 3QR2A 4GAYA 2Y23A 3OX8A 2Z93B 2Q8AL 5CHNA 1HH9A 4U6XB 4ZO7A 5ID0A 3TBTA 2A6IA 3DSNA 1QP1A 1D9KB 3AS3A 3B9AA 4MNGE 3K0WA 2NY0D 3SJVE 1TFHA 4GKNA 1KNOA 1GGBH 4XTRD 4P9ML 3GEWB 3O4LB 1H15A 1HWHB 1NBZA 4JLRA 1P7QA 4LCUA 4UQ2B 3CFKB 3OL2A 2VLKE 3MRKA 5J13B 3NH7L 2FIRT 1U8MB 3QQ3B 3PWPE 4PTUB 1JF6A 5C3TA 3DHMA 2ZOLB 1T2JA 4M3JA 4N0YL 4LASL 4FFYH 1I9JH 2VUOA 2IG2H 2VLRE 4U1KA 4I18C 5GGUA 3UBXI 2IPTL 3CFBA 4I3SL 4WUUB 1WTLA 1EDQA 1FAIL 1CD9B 1E27B 4F37K 5ERWA 3I3BA 4XWOD 3SDAD 2VZOA 3EJJX 5IROC 3LD8B 4I18A 3MRCA 1I8LA 3OWEA 1UYWH 3S37H 3ARZA 4YNYB 5IROA 4M7LH 3SDXE 3L3GA 3LAFA 1DBKH 5TGBA 4UU9B 1J05B 3FB6A 1NC4A 5D96C 1AP2A 3L5WB 3BPLB 4TUOB 4PRPD 2JCCA 1L0YA 4KK6D 3W0WA 4Y4KB 1NANI 2F54D 3EJYD 1XCQA 4WFGE 3UAJC 3TYGH 5DJ6B 4HBCL 1FLRH 3D39E 3UC0H 1FNEA 5C6TH 3WJLC 5JLZA 1JVKA 5TJWK 2VAJA 4LP5A 1F58L 4PJBA 3T3ME 3G6DH 3LY6A 3WJLA 1YN7B 5D5MF 1R3HB 4D9RD 3AREC 4LRNH 4BH8B 4UDUA 4JPVH 4KTYA 1AI1H 3ES6B 1LQSR 1IAIH 4F7PA 3HRZB 1U42A 1P84K 3AREA 5C07E 3WO4C 2VMFA 3U1SH 5DVOA 2AK1H 3S88H 1F6FB 4AT6A 1RZKL 2DDQL 4LMQI 4RIRB 3RFZC 5AEAA 3PGCA 2VXUL 1IAOA 4HKZB 3NZHL 5AG8A 1G7IB 2E8YA 1OARL 1OM3L 2B1AL 4Y19E 1S9YB 3CU7A 5E5UB 2H6PB 3QDGA 3ULVC 5D2LE 4U1GC 2RCSL 5K9JH 4JREB 3MLYL 1RZIA 3UJTL 1NCBH 1MFDH 2EYSA 2FDBP 3IETA 1PEZA 4RFOL 1LEKA 5EC2B 4HFUH 1N5YL 4KFZC 3RTQC 5SWZE 3H9SD 4P2QE 5IF0A 4Q6IC 4MXVF 2VZVA 3P11L 4X4MA 4LQFH 4XC3H 5M95B 4L3CA 3RTQA 1KGCD 5BZDA 4GQPH 2XA8L 3K1DA 1RVFL 4Q6IA 2BSRB 5KS9B 4J3WA 4XNQB 3PIQA 3GRWH 1M7XA 2Y5EA 3QI9D 4NO5A 1OP3K 3T2QA 3N1PC 2RBLA 5JPMA 1KT2B 3GHEL 4OLYL 4DVRH 4ZDHB 1MH5B 1F2XK 4M6OH 4UV4L 2Z93A 2DRUA 3B2UC 4NDMB 4LCIH 2YKLH 1D9KC 4U6XA 5JW4N 2F58H 3AB0B 4M5ZL 4NZJA 4J4PC 1LK3L 5EOCH 4PYHA 1D9KA 5BMFL 4J4PA 4I5BB 3IJSB 3GRWA 3DLQR 1CL7I 1AC6A 2A9NL 4PRHE 3CVIH 4ZAKD 4G7YL 2DI7A 1T66C 5CUSL 3BO8B 2A73B 4DN3L 3D2UD 3OF6D 3O4LA 5ESAB 4G8IB 5I8CB 4UQ2A 3CFKA 3CVHB 4PJHF 3HC3H 3SGDI 1R24B 3KPPB 1U8MA 2O5YH 3QQ3A 1KF9B 1X6NA 1AXTL 2RR3A 3MBED 1MSPA 1J8KA 1WIOA 2ZOLA 1FRGL 1JP5A 3LD8C 5F96H 1WGOA 4WUUA 1U3ZA 3HMWH 3B6SB 3RZCA 3BKYL 5E5RB 3A6CL 1Q94B 5FXCH 1A6WL 4HLZG 3DX9B 1RUQH 3T04D 3MV01 1J0YA 3NCCB 4ONGH 3RJQB 5IFAL 1DBBH 4K2UH 2XQYG 4YNYA 3OZ9L 3BPLC 4HLJA 4Y4KC 3F7RA 4AMKH 4UU9A 1J05A 2A77L 3MUGB 1L7TH 3L5WA 4OLWH 4TUOA 2B39A 5C86A 4Y4KA 1ZT4B 4AEIL 3GI9H 5KSBB 1QFWH 35C8L 3O6FB 4MDJB 2X4OB 5DJ6A 3B5GA 4GAFB 3T3PE 4V2BA 3FOLB 4OFKA 3EHBC 1IL1B 4R4ND 2BRRH 5JOEA 2N1KA 2OR7A 2D4DA 2D7QA 4GLRH 2WQ8A 1MQKL 1Q9OB 4R90H 1YN7A 1R3HA 4HT1L 4BH8A 2D0HA 1A9EA 3O11B 3ES6A 3IKKA 1Y18B 1KN4H 2CK2A 1LDSA 1HE7A 2V2WB 2YPLE 2R29L 4E42B 3W2DL 5E2VL 1WISA 1ZLVH 1B0GB 4M62L 3QXAA 2CKBB 4C54A 4RIRA 1YEGL 3IDXL 3QG6B 5KZCD 4HKZA 3RKDC 1WFNA 3OTTA 1RQ5A 5T3XD 1G7IA 4TSCH 4QRRE 1NLDH 4S1RL 1HILB 1S9YA 4JREC 5CCKL 32C2B 3CPLB 2H6PA 1WJ3A 1KPUB 1FBIH 1IQWH 5FM5M 4TNWF 5I1EL 5JMRA 1KG0B 4ODBD 5EOQL 1QSFE 1OTUD 4WWKA 2PW2B 5CP3H 1RZJH 5EC2A 4PJGF 5KSUB 2EO1A 3MLRH 1RUAH 2M8XA 4MCYA 5F1NB 5J12B 2BSRA 5KS9A 4XNQA 4JZOB 5EU4B 1N6VA 4OT1H 1BD2E 4BFBD 4C55A 4XC1H 1REIA 2AI0H 3MZTA 5CP3A 1KT2A 4A6YB 4NC0B 4ZDHA 1MH5A 4NN7B 4NDMA 3CVHH 1X4YA 5DMIH 1BBJB 5CFHA 5SWSD 1F4XH 4FFYL 1I9JL 4DKEH 2W0PA 4I5BA 3IJSA 4RGNB 3G5XB 4W70A 1BFVH 5C0NC 4MDIB 3H9ZA 3BO8A 2A73A 4NHUB 1QKZH 2IMNA 5ESAA 1SY6L 3S37L 1CFSB 4G8IA 1IGTB 5I8CA 3HTLX 3IDNB 5K9QG 1PFCA 3H3KA 3JUYA 4M7LL 3CVHA 2PYFB 3S5LG 5BV7L 1F42A 1R24A 1A1MA 1DBKL 3KPPA 1GZPB 3VXMD 4MNQD 5DD0H 1HIMH 4GFTB 1G6RA 4QTIH 2F53E 1FZJB 4HULB 1PVHA 5FHBL 2YUVA 5JW4Q 2BJML 5D6CB 3TYGL 5AAMA 4G80B 1FLRL 3IXTB 5DJZB 3B6SA 1RIHH 1Q94A 3GZKA 4TOYH 3UC0L 3DX9A 1IGFH 4L4TB 3BH9B 1DQLH 5C6TL 1X5AA 4YPGB 2NMSA 3FB5A 2EH8H 1AR1C 3PABB 1GIGH 4HDIB 3G6DL 4XZUB 1CGVA 3ARWA 2GSIB 5FM8A 3MUGA 3O6FC 4JO4H 4ZODA 4LRNL 2EDQA 4JPVL 1ZT4A 4NKDB 4L1DA 1IAIL 4JO3H 3O6FA 4MDJA 2X4OA 5DHXB 3QIBB 1PBYA 1T1WB 1LK2B 3BZ4B 3Q3GB 2AK1L 4HUWB 4CMMB 3S88L 3FOLA 4R2GD 1IL1A 5JR1H 2D9CA 3IJHB 1Y6NR 2CKBH 1BF2A 1OT1A 4GRWB 1Q9OA 4JDZB 1AJ7H 1XGRB 4Z78B 3F5WA 2OTPA 5IR1B 3O11A 3VFOB 5GS1B 1JV5A 4UTAH 2Y72A 1Y18A 1XAUA 5K9JL 2V2WA 3GMLB 4E42A 4ZUWB 4RA3A 3T3MF 1B0GA 5HHOB 1MFDL 1MF2L 3T2PA 5FO9B 5F6HI 1YEFL 2CKBA 4EQ2A 3HHRB 4JRYD 3QG6A 4HFUL 4PRPE 4GW4B 2Q1EA 4N0UB 5CEYB 2F54E 4YHLL 4Y2DD 1S7RB 3FJTA 4LQFL 4OF8A 5TDOB 4B5EA 4OD3H 4XC3L 5BJTA 4ERSH 1HILA 1XGYH 3ALWA 32C2A 3CPLA 4L3EB 4WHYG 1KPUA 3GRWL 5C7XH 5LAXB 2YC1B 3LOWA 2UY7A 4FQQB 4DVRL 3MXWH 5CZVH 4M6OL 4QHUA 1L4IA 4FN0A 2PW2A 4LCIL 3KPQB 1M7IB 2YKLL 4A6YH 4D9RE 1DQMH 4ODXB 3WS6C 3QCVH 5D2LF 3QDJD 1TITA 4FQCH 3MRNB 5J12C 3QISA 5KSUA 2AXFB 3WS6A 3QPQC 4P48A 5IBUG 5F1NA 3ILPB 3S98A 3RWFA 5HXMA 5L8LB 4JFQB 4QRPD 4JZOA 5EU4A 1DLFH 3CVIL 5JXAH 4NN7C 5IVNA 4GXUN 3T77A 5SX4H 4NOFA 4P23D 2BHUA 4A6YA 5HI3C 5F7UA 3HC3L 5KG9B 1P6FA 3RDTD 2O5YL 1QFUH 2VB5A 1KBGH 2GAZB 4G9FD 1BBJA 3DURB 4D8PB 4RGNC 4BSVB 4OBSA 4PD4J 1A1NB 4NJAH 2LAAA 5F96L 4JHWH 1WWAX 4MZ3A 3M07A 1I4FB 3G5XA 3AU1B 5F6IC 5FB8B 4MS8C 1NMAH 4MDIA 2P1YA 1JGDB 4Y1AD 5CD5C 1RUQL 1UZ8A 4NHUA 1SMAA 1H3UA 4ONGL 1CFSA 1IGTA 4HKXB 3IDNA 4K2UL 4UOW0 2PYFA 4A2LA 4JM2D 3GM0A 4AMKL 1GZPA 4EJ1C 3TH3T 1KGCE 1L7TL 3SEPA 1KJVB 1FZJA 4OQTH 2E7BA 1I7ZB 5K9KB 1MCOH 2P8LA 2R1YB 5DGRA 5D6CA 3GI9L 2AQ3A 1QFWL 4MZ2A 1ZKAA 4G80A 3IXTA 2O5XH 1T0PB 1FJ1B 1IGCH 1OTTC 5DZOA 2VDLH 1ZK9A 1CFBA 4L4TA 2BRRL 3BH9A 1EEUA 3BP5B 2YWZA 4PJXB 5FKAB 4EZMA 3PABA 4HDIA 4RNRB 4OQTA 3ILQC 4N5EC 4XZUA 2GSIA 5KANI 3TVMB 2RIKA 4N1EA 3QIBC 1MCLA 4NKDA 4NYLB 3I84A 3RY6C 1KN4L 5DS8B 5GSVB 1CWVA 3QIBA 1T1WA 1LK2A 1YQVH 3BZ4A 4HUWA 5HVGB 2A6KB 4CMMA 1GJIA 3O3UN 1MCDA 2DJSA 3QG7H 3T0DA 5HD8C 1BOGB 3IJHA 1N5AB 3O0RH 3K2UH 4XNMB 3X11B 5GS1C 2C26A 3N50A 3O41B 1OP9A 3OKLB 1GCFA 4JDZA 1XGRA 3BXNB 1NLDL 3T3PF 4Z78A 4P9HC 1HINH 5IR1A 2YBRB 1FBIL 1IQWL 3VFOA 3MRDB 5C9KA 4TSBH 3TCLB 5D4QA 4OGZA 4ZUWA 5HHOA 4OGAC 5FO9A 1U8QB 2Y36L 4OZ4B 5INDB 2PF6A 3WIIH 1RZJL 3PF2A 3LV3B 1NAKH 4GW4A 4OM0H 5D5MB 3BKCH 4N0UA 5C0CD 2GJZB 1S7RA 5HHQB 5F1SA 2EEAA 5F7YC 5TDOA 2B7DT 3MLRL 1RUAL 3OG6B 4L3EA 4YK4B 4FQ1H 4XVTH 4LVNB 3DO7B 4ALAH 4XC1L 2Z31B 3QNYB 5LAXA 4U33A 2YC1A 2AI0L 1EZVY 4FQQA 3ARGA 2DD8H 2QSCH 4YHZH 1FAKT 4YQXH 3KPQA 1M7IA 3SBWC 3NIDF 2E6QA 4ODXA 3QXVA 5CIPB 5EBWA 5AYQA 1LO0L 2P8MB 3MRNA 4XBEH 1F4XL 2J8UA 3SBWA 4DKEL 2IBBA 1P5UA 4PJDE 4TVPH 3GUTB 3ILPA 1BFVL 1U8JA 1MIEL 2AJ3B 4XXDB 4JFQA 2A38A 1L0QA 4P3DB 4ZXBB 1QKZL 3SKNA 2PYEB 3FQRB 4YR6B 1JHKH 3L3JB 3I50H 5KG9A 5T3XE 4HWBH 5BO1H 4GO6B 4HZLB 1HIML 2GAZA 2GTWB 4OFIA 3ZYJA 4QTIL 3S8WA 3DURA 4BSVA 1QBML 1ZE3C 1A1NA 4KWUA 1KB9J 1S8DB 4MJ5B 1I4FA 5HYSB 4KQ4H 5FB8A 1A64A 4GMTH 2H2PD 1OP5H 1JGDA 1IGFL 4U1IB 1EFXD 3UBXB 1DQLL 4CJ1A 3C6LD 2EH8L 3WKNA 4HKXA 5E9DA 1DBJH 5HYFA 1GIGL 3ULSB 4X4XA 1BECA 3EUUA 1KJVA 4BSJA 3KPSD 4JO4L 1I7ZA 5K9KA 1RIVH 4YDLB 3TA3D 4JO3L 2R1YA 5FCSH 2L4OA 5BS0B 4F7MB 3LDBB 4OF0A 1ACZA 4LSSH 1FJ1A 3LEXA 4N9OB 4WGWB 3DX6B 4D0BB 4X6CE 1UG9A 3WJJC 1I8IB 2PR4H 2WP3T 2WWMC 2C9AA 2L0DA 3BP5A 4PJXA 5JR1L 1WF5A 2BRQA 2KKQA 3TVMC 2CKBL 5GGVH 5SWSE 3H9YA 1PKOA 4RNRA 3WJJA 5ETUA 2CXGA 2IGFH 2RQ8A 1HQ4B 3TVMA 2SEBB 1YC7A 2FD6H 4MJ6B 1BQLH 1CLZH 1FN4B 4NYLA 4ONHB 3LKQB 3QWOB 5DS8A 5GSVA 3TFKD 4O02H 3KHOA 1JHTB 5DZNA 5F88B 1WITA 4OSUH 3PUCA 5CINH 2BNQD 2XKSA 2CMRH 2A6KA 5TE6H 3OGCB 3VXME 5MHSD 4MNQE 3DI3B 4J2XA 4KK8C 3F6LA 4PJAB 2VQUA 1BOGA 5IKCB 1N5AA 43CAB 3X11A 3GKZA 3U7AA 3KYMB 2UVFA 3O41A 1NEZG 3OKLA 4OD3L 3BXNA 3F7PC 4ERSL 4GT7A 3D85B 1XGYL 5IMMB 2YBRA 3MRDA 5C7XL 3TCLA 4LCWD 2NY1B 1Z6JT 1P4IH 1Q8MA 3MXWL 5CZVL 3VXRE 1FV1B 1U8QA 3PXJA 5F9OH 1CQKA 7FABH 4OZ4A 5INDA 4A6YL 1DQML 4LK4A 3VWJD 5T5FH 1NCDH 3QCVL 5D5MA 4FQCL 5EU5B 3LB6D 2AK4B 4CVXB 2GJZA 4YK4C 3FQWB 1J1OH 3CZFB 5HHQA 5I1CH 4LVNC 4JFDE 3NN8B 3MV8B 5CIPH 1TNMA 3PDOB 2HYMA 2Z31C 2QADD 3L3KB 4HWEH 5E6YA 1N0XH 2Q20A 3O8XC 3T0EB 3DO7A 3RRQA 5JXAL 1U58B 2Z31A 3QNYA 4PBWD 3QUKA 5JW4M 4JHAH 5J6HB 2MHAB 5L9DH 3RVUD 5ICZB 3MJ7B 1KBGL 1GGTA 3I9GL 5DLMH 1RIUL 3R0NA 5CIPA 3WLWD 2BSSB 5TPWH 3OAZH 2F5AH 2MNUA 2P8MA 4YXHL 3MV7D 3MLVH 4NJAL 4JHWL 3I85A 4KJPC 2JB6B 3GUTA 4P2RB 4ZXBC 4OB5H 4X6EB 2AJ3A 4KI5F 4XXDA 1NMAL 2OL3B 1K8DB 4JRYE 3NPSB 4P3DA 3TT1H 4RMTA 4ONFL 4ZXBA 1T2XA 4K07A 3BZDA 4XCNB 2PYEA 3FQRA 3QIUB 4YR6A 5C09B 2DYPD 4PJEB 4R9HA 4E5XB 1YEEH 1T6WA 1YYLH 2ICWJ 2G9HB 4PJGB 5DJYB 3C87A 5DD3H 4U6HB 4HZLA 1CE1H 2GTWA 2VWEE 5ACLA 4OQTL 3NPZB 3VFGH 2Z8RA 1E4WH 1MCOL 4MJ5A 1MHHA 1MY5A 2O5XL 5HYSA 2QHRH 5E8NB 2X5PA 1IGCL 1TJHH 3MCKB 2AJVL 4JGUA 2VDLL 4U1IA 3D48R 1PKQE 1NANH 2ED9A 3QDJE 2NX5A 2EXWC 4R97B 3ULSA 2KDGA 5JXEC 4YDLC 1TXKA 4G5ZH 1ROWA 3LDBC 2NW2B 4KTDH 4QRPE 3RVWC 1PEWA 2H2SC 5BS0A 4KJYB 2Y9RT 4F7MA 4QNPE 1YQVL 1IJ9A 1YDPB 3WHXA 1G1YA 2C3WA 3DX6A 4D0BA 1JPGB 3QG7L 1S9WB 3HC4H 1Q72L 1P84J 4MNGB 1I8IA 2KPNA 4LHUD 3SKOB 4RQQB 2DB8A 2X4TB 1AO7B 1QSVA 3LKSA 2ZCLL 3K2UL 5FDWB 4LHJB 3CSYB 3VH8B 5C0BE 3CSGA 2SEBA 1IEHA 1HINL 4LPVA 4AK1A 1J1PH 4MJ6A 5E4EB 1FN4A 4TQEH 4ONHA 4Y1AE 3LKQA 3PWPB 3BIKA 3QWOA 4CGTA 1F00I 3B9KB 1JHTA 5FAAA 5F88A 1O0VA 4TSBL 4UNUA 1Z3GL 3BQUB 3UTPD 4BJLA 3OGCA 3VXQB 1OTSD 2VLRB 4LDOB 1CVRA 4WI6A 3WIIL 4PJAA 1NAKL 5IKCA 1OQXA 3N85H 4OM0L 3BKCL 43CAA 3KYMA 5DWUH 5TE4H 5HDBE 4RDQF 5E7FA 3GMRB 2HFEA 3D85A 5KAQF 5IMMA 2LFGA 2QQNH 4FQ1L 1I1AB 2NY1C 4XVTL 1E0OB 2BOBB 2VLJD 4LPXA 3CXHK 4YWGH 1CXHA 1TJGH 1N2RB 5TFSL 3RBSA 1ZA6B 1FV1A 1JI2A 2DD8L 5J6GA 4X7TB 2QSCL 4UUJB 4YHZL 4F15B 4YQXL 1KUMA 4D0CB 4K23H 1AFVH 3RHWF 4S1DC 3QDMD 1LE9B 5GS0L 5EU5A 2AK4A 4CVXA 2NQCA 2P5WB 2XKNB 4XBEL 1Q0XH 3CZFA 4DEPB 3T0EC 3NN8A 3MV8A 5K33A 3PDOA 1DLHB 3U46A 3ETBF 3BISA 1UWXK 5B22A 1JZ2A 3L3KA 4FQLH 3T0EA 4X9IA 4U4BA 1U58A 3VE0A 4NQUA 5J6HA 2YUWA 4K3GA 2MHAA 2OL3H 1JHKL 3I50L 5ICZA 4HWBL 1DCLA 1HHIB 1FYTD 1TQBB 2GQHA 2BSSA 3VGDA 4GRLB 3GB7B 3JV5A 3L3DB 3NPSC 2Q7NA 4JRXD 2JB6A 4OM1H 1S78C 1UH2A 4KQ4L 4GMTL 3QIUC 4OFDA 4X6EA 1WAAA 2OL3A 1K8DA 1IAIM 4APQD 3EO0B 3MSPA 3CFJB 1OLLA 4PY7B 4CN6A 1HYSC 1KN2L 5C0AA 3QIUA 4KROB 5C09A 3CDCA 5C0CE 1DBJL 5D2LB 5J1SC 4HD9A 2BFVH 1K3ZA 4E5XA 4PJDF 2APFA 4L4VD 1Q0YL 2G9HA 4PJGA 5DJYA 4DN4L 1KLFA 1I9IH 1WBXA 3VXPB 1FE8H 1TTUA 3RKPA 4YE4L 1HK6A 1FZOB 4G9DB 3U0PB 5ISZB 4X5XB 4P2QB 3O45B 4LSSL 5E8NA 2LU4A 1S3KH 3MCKA 4OIIL 4LLAA 4R97C 4WI8A 5LBSH 3ARFD 2DLTA 5GRZA 4OZGB 1VSCA 1TETH 1IM9B 4TTGA 2QSVA 5L7XH 2IGFL 2FD6L 1EUTA 2NW2A 3GK8L 1CLZL 1V7NL 4OZFB 1QSZA 2XXCB 4O02L 4KJYA 1ZMYA 4OSUL 5CINL 4M48L 1YDPA 5IV2B 5TE6L 2HMIC 5T1LB 4IBLT 1JPGA 1S9WA 4MNGA 5HSFA 1QNZH 3SKOA 4RQQA 4IRSC 2X4TA 1AO7A 2UZIH 4BYHA 3P0VH 2X89A 4ZO9A 5FDWA 5T33H 5E4EC 2Z91B 2ZCKH 2OZ4A 3CSYA 3RI5K 3VH8A 1WBZB 4RMVA 4PRDB 3B9KC 1UXSB 4PBXA 1AKJB 3OQ3B 4X6CF 3BQUC 4JHZA 4FP8H 2GW5A 3PWPA 4KHXH 3IDYB 5FOJA 4NQVB 1KTKE 3U30B 1P4IL 3BQUA 4M7JH 3VXQA 2VLRA 5F9OL 3IU3A 3U9PH 5B8CC 4MA3B 5T5FL 1NCDL 3KPSE 1M4KA 1MQ8A 3OAZK 3ZMRA 2FATH 3GMPB 2QQKH 2FEDD 1J1OL 5I1CL 1C7SA 4Y5XB 3OGOE 2XYCA 3BKMH 4HIXH 1I1AA 4HWEL 1N0XL 2GIYA 2BOBA 3T0XA 4F15C 3KPOB 4JHAL 2F8OA 4JFFB 2BC4B 4IEFB 3JV6B 1N2RA 5L9DL 2QSQA 1CDUA 3SDCB 2AXGB 3P9WB 4X7TA 4UUJA 4PRIB 4DEPC 4D0CA 3TBVB 5DD5H 5DLML 4S0SD 1LE9A 1DDHB 5TPWL 1PZ5B 4K71B 2F5AL 2P5WA 2XKNA 3MCLH 1C1EH 1GOGA 5SV4A 1X7QB 3GSUB 3QEHB 3DIFB 4GXUM 1DLHA 2BNQE 5E2JA 2VXSL 4OB5L 1Q9LB 1PYWB 2EO9A 5MHSE 2P42B 3JTTB 3EKCA 3TT1L 3ZYOA 1T04B 1FL6A 1JE6A 1TQBC 4PV9A 1O7VA 3VMOA 1YEEL 1YYLL 1HHIA 5DD3L 1CE1L 3BEWB 2O5ZH 2EE2A 1E4WL 1OD9A 4GRLA 3GB7A 3KJ6H 4CW1B 4Q9QH 3L3DA 1OB1B 5B39B 4Z7VB 1SEQH 3UTZA 1MVUA 2QHRL 1P7QD 5F72S 4KROC 4Q97A 3ZT6A 1TJHL 3QJFA 2J12B 5I1HH 3SDDB 3QULB 3EO0A 4H0IA 4RMRA 3CFJA 3KYAA 5AD0B 1T4KB 4J1UB 4L9LB 4PY7A 3UZVB 4HJJH 1JNNH 1F4WL 5D2LA 2D0FA 1UJ3B 2VC2H 3FRPG 3KLDA 4OGXL 4G5ZL 1JGUH 3VXPA 2NY6B 4KTDL 3MLXH 4JN1H 4YXKH 3MRJB 3DYOA 4NQTA 1FZOA 1NCTA 3QAZB 3RL1B 3U0PA 3ZHKA 5EOTB 3OAYH 5ISZA 4X5XA 4P2QA 3O45A 2NYYC 3MYJB 5CJXC 1ORQB 4OZFH 5EZJB 4FQPA 1QPXA 3HC4L 4JPWH 5ECJE 3WN5B 3JV4B 4CL7A 4OZGA 1T5XB 4O2CB 1XZ0B 4HGMA 1G0XA 3W0WD 3MV7E 3ABZA 3MLZH 1IM9A 3OAUL 3TM6A 4TNVK 1EEYB 3STZB 1RY7B 1IC4H 3MRHB 3TH4T 1QHPA 4KMTH 5ABDE 1J1PL 4TQEL 3AGVA 1X5JA 1U0QA 1MCEA 4U1MB 5E6ZA 4OZFA 3TNMB 4QF1B 3BPNB 2VQ1B 3UAJD 2OJZH 4LCYB 2K7QA 5IV2A 2WAHA 5T1LA 3RX5A 1XGUB 2Y06H 1PLGH 3V0AC 4Z95L 2HT2C 2NY3B 3VCLB 3N85L 1LGVA 5DUMH 5JIIA 2EDKA 3DETC 2R4RH 3CUPB 1P2CB 3GSNB 4QNPF 5EPMA 5TE4L 4GRMB 5EOCJ 1WBZA 1FH5L 3IDYC 3R1GH 4PRDA 2UY6A 1UXSA 3ARED 1AKJA 2QQNL 3THMH 4KQ3L 2VOTA 3U30C 3ECBB 5ITFB 4HK3N 2N7BA 4YWGL 1BEYL 4IDLA 4N9GB 4X4YB 2R1WB 1YYMH 1QRNB 1R5VB 3QEQB 4X4ZA 1A21A 4MA3A 4K23L 3T4AB 4Y5XC 1CCZA 3GMPA 5IQ9B 3IFOB 3RNKB 2LU3A 5F9JB 2X4PB 4QYOB 3K81A 4Y5XA 4JM2F 1TVBB 1DE4B 3G6AB 4JKMA 1FVEB 3ULVD 6CGTA 2NY0B 3SDCC 3HNSL 4X9HA 3V9FA 3KPOA 1CFQB 4JFFA 2BC4A 4U2YA 3JV6A 5A3IC 3H0TB 4RRPG 3SDCA 3CFCH 5HDBF 4M6NL 4K71C 2AXGA 4PRIA 3H9HB 1CL7L 1QO3B 3TBVA 4P4RB 3RTQD 5F7WC 2E6PA 1DDHA 1JMZA 2JE8A 1PZ5A 3C2SA 1K5NA 4ZUSB 4HXBH 1X7QA 3QEHA 3DIFA 3D0VB 3UPCA 3PP3K 4OM1L 3HE7B 1CGSH 3QJHB 2HTKC 4K94C 4LDEB 3UTPE 1Q9LA 3LSOB 2IBZY 5ELIA 3B5HA 2IH3B 5D6DA 2HN7B 3JTTA 3RVXC 3VRJB 3RGVB 1T04A 4V1DB 1QUNA 1AGFB 3QXDB 4MAUL 1TTGA 4ZFZB 1DANU 3B2UD 1OAXL 4PRNB 5D2NE 1X3DA 1D9KD 4X6DB 2HP4A 1I9IL 4J4PD 4MAYB 4UT6H 1FE8L 5IG7B 4XP9H 3HE6B 2OR8A 4CW1A 1EJOH 2VLJE 3SDDC 1OB1A 5B39A 4Z7VA 1UH3A 2FL5B 4ZD3H 1BGXH 4L9LC 3MFFB 1X5XA 1NGPL 1S3KL 2OCFD 1T66D 1IEAB 3Q2CA 3QULA 3TCXA 5LBSL 1UJ3C 5AD0A 1G9NH 4L9LA 4J1UA 3QDME 1TETL 2NY6C 1UJ3A 3ZLQC 3GDBA 4W6XB 3KPMA 4PJFB 3QAZC 4PJCB 4WUUD 2CXKA 1OLZA 5KSAA 3U7WH 1UZ6F 4EVNB 3RL1A 3WN5C 3F58H 2DLEA 5EOTA 2APXA 4IIQB 3TT3H 3MYJA 4ESKA 4X0KB 1EHNA 1ORQA 5EZJA 3FL7A 3WN5A 1FYTE 3JV4A 1WZ1H 1QNZL 2Q86B 1RUKH 1KULA 3G5VB 1T5XA 3KDMB 2UZIL 4O2CA 3P0VL 4XVUD 1XZ0A 3AAZA 4Y4KD 3B5TA 5T33L 2ERJB 2ZCKL 4FS0A 1EEYA 3STZA 3ZHDA 3L95B 3BPNC 2C4XA 1WUNT 3GSNH 3R0MA 2P46B 3GJFB 3DJ9A 4FP8L 3TNMA 4U1MA 1FL5B 5E1AB 2VQ1A 2AS5M 1UT9A 2NY3C 2ZSVA 4LCYA 4HJ0C 4M7JL 5DA0B 1XGUA 2VERN 3U9PL 3VCLA 4P57B 4KAQH 2FATL 2DWEB 2QQKL 1X4ZA 3CUPA 1P2CA 1W0WB 3B2VH 3CFDB 3ORJA 3GSNA 5BCAA 4GRMA 3MGOB 2AKRB 2OLDA 4ORGB 4XH2B 1KTRL 3BWAB 1LP9B 3ECBA 4WFHD 1TNNA 4FZ8H 4G43B 1RMFH 5ITFA 4XMPH 1GAFH 2BVPB 3UPRB 2IADB 1FP5A 4N9GA 2EDDA 3LKOB 2R1WA 4X4YA 1QRNA 1R5VA 3QEQA 3P0YH 3C6SB 2FJGB 4YBLB 3T4AA 5DD5L 1KIQB 3RKDD 1RJYB 4PB0H 2WUCH 1X9QA 5IQ9A 3MCLL 3RNKA 1C1EL 5F9JA 4QYOA 3MRPB 4X7DC 4AIXA 1TVBA 1U8KB 1DE4A 3G6AA 5INCB 1FVEA 3BRDA 1NUDA 5EA0H 2YD9A 1CFQA 5LXGL 3BH8A 3H42H 1CLCA 3H0TA 3E1F1 1JF5A 1IARB 3CLFH 2R56H 3LRHA 3H9HA 1QO3A 1N3NB 5EU3B 4P4RA 4J8RB 3OHXB 2O5ZL 3HE7C 3WHE1 3OB0K 4Q9QL 4ZUSA 3ROOB 3RGVC 1FPTH 3HE7A 3QJHA 1R0AH 1BZQK 1L6ZA 5IP4A 3LSOA 3VGEA 5I1HL 2HN7A 4HIHB 2YWYA 3VRJA 5DRXB 3RGVA 3CZJA 4V1DA 4HJJL 1JNNL 3S36X 3H7BB 4MAYC 1AGFA 3QXDA 4F33B 4U6TA 1ZVYA 4ZFZA 1KCUH 3WNLA 1GZQB 4PRNA 4HCRH 3HE6C 3ZYIA 1JGUL 4R0LB 5C0JB 4MAYA 3FO1B 4O4YH 5IG7A 4JN1L 2BCKA 3EYVB 4YXKL 2LTQB 4OI8A 2FL5A 5J57B 3V0WH 3EO1B 3IGAB 1FIGH 3MFFA 5C0ND 4G6MH 1MREH 1IEAA 2BSED 2EZ0C 2UWEF 4NUGH 5F21B 2RB8A 5HHNB 4HCRA 3VXTB 5FCUH 4PTTB 3P9LA 2VJXA 1CE6B 1BIHA 3MLZL 5KVEH 1G9ML 1AQKH 2JJVA 3MUHL 4KI5C 5D8JH 1RI8A 4C4KO 4PJFA 4PJCA 1WV7T 2EC9U 5FYJL 3RUGE 4KMTL 4IIQC 3LZFH 3MRBB 4XPAH 1CLOL 3BPOB 1NEUA 1B6UA 3I6GB 4EVNA 2OJZL 2KQNA 5GGTH 3GJFH 4IIQA 3QHZH 5JNYB 1IZKA 3VXOA 4S0TD 1PLGL 5JW5B 5FM4A 1TCRB 2Q86A 1AR1D 1CD0A 5DUML 3G5VA 3KDMA 2B2XL 4U1NB 2R4RL 3OXRB 5KOVC 3HMXA 1DUZB 2FCBA 1JGLH 1T89C 3L95A 4LEXL 3O6FD 2J5LB 3R1GL 2E9WA 1JZ8A 3THML 3GJFA 1T89A 1PX3A 2QV2A 1FL5A 4HHAB 4XMKH 5C1MB 4XPFL 3ARQA 1QLEL 4RAUB 3U4EB 2DN7A 1YYML 1TCMA 2HT3C 4HIEB 2CLVB 5I8KL 3B8SA 2VO5A 4XGZB 1HWGB 2GCYB 2DWEA 2Q3ZA 5LWYH 4BFIB 1HNGA 1W0WA 4U7SA 3HR6A 1S9XA 3MGOA 2AKRA 4R3SB 4ORGA 1J86A 4XH2A 2AEPH 3QCTH 3BWAA 1LP9A 4G43A 5IB4B 3QDHA 3P4LA 3DO3A 1H3VA 2BVPA 4YBLC 3DNKA 3JBG7 3UPRA 1KPRA 4OKDA 1A7RH 2IADA 2JCCE 3W0WE 4RCAA 3CFCL 3LKOA 1FNHA 4NRYB 3C6SA 2FJGA 4LRIA 2VDKH 1KIQA 3VFPB 5JZ7C 1RJYA 1H5BB 2ZPKH 5D7LB 2YZ1A 1EH9A 1SQ2N 4X6CB 1E6JH 4JQVC 4HXBL 1YNKH 3WFBH 3MRPA 1CGSL 2E27H 1HOCB 5SWSB 1U8KA 3KGRA 5INCA 3JZ7A 4JQVA 1CBVH 4I8DA 3F7VB 3OJVC 4PJBE 5CSZB 5H2BA 5TDPB 1KJMB 5AAWA 1F3DH 2FJHB 1MLBB 5K9OB 1JYXA 1IQDB 1BLNB 1BJ8A 4QXUH 1N3NA 5EU3A 1A5FH 1FZKB 4J8RA 3OHXA 4ODUA 4XWGH 3QRGH 4KJWC 4G6AC 1FC2D 2YRLA 1EJOL 3QQ4B 5IJKA 1MIMH 1BOYA 2X09A 2BY3A 3QPQD 3S9DB 5HDQH 2IPUK 4ZD3L 1BGXL 4UINH 1AE6H 4HX1B 4XB8A 2CRYA 4HIHA 3CU1A 5DRXA 5ADOH 4BQBA 1G9NL 2BDNH 4JE4B 4R0LC 3H7BA 5HI3D 4F33A 1T1XB 4GG8B 1GZQA 5AYUH 5L88H 2LTQC 1FNSH 3VXSE 4FQXB 4R0LA 5C0JA 2NY7L 3FO1A 4RGND 4BQ6A 5CKAA 3VXRB 3ULVE 3EYVA 3RJDA 1OWWA 2OP4H 1MJ8L 4KKAC 4XP5H 3F58L 1MY7A 3TT3L 4MS8D 3EO1A 3DX8B 1IILE 3IGAA 2HJKB 1WT5A 4JFDB 4X4ME 1OAQH 5CD5D 1WZ1L 4KU1A 1S7UB 2AJXH 3C5JB 1RUKL 5HHNA 4DJMA 4YHPB 1R3JB 2VLMD 3VXTA 2PO6B 1J1XH 4ZFFB 3CLEL 1CE6A 2JIXB 3P4MB 1R3IL 2AABH 3KLHC 3FB7B 3MRBA 2BY2A 4ZPVB 3I6GA 4L4TD 4OZHB 2QBWA 2BNUA 1OTTD 5JW5A 1H3GA 1TCRA 4P4KB 5DC4B 4PP1C 1RUPH 1SJHB 2J5LC 4U1NA 4HGKC 2IANB 1K4DB 3HR5B 3OXRA 3ILQD 4N5ED 1E28B 4CU7A 1DUZA 4PJ8B 1YECL 3KYOB 3QIBD 3F8UB 4ODHH 3PXHA 4EOWH 3T65B 4HW6A 4FZ8L 1OPGH 3UJIH 1RMFL 4HWNA 4XMPL 1GAFL 2G5BB 4HHAA 2H26B 3QWQB 4RAUA 2Y1VA 4W6WB 3U4EA 4NO0B 4FOMA 1WQVT 3SKJH 5EIVA 1HHHB 4LPTA 1NGXB 3CXHJ 3P0YL 2C4FU 4LNRB 5HD8D 2WWKO 4WUUE 2CLVA 2VDQH 4PB0L 2NY5L 2FBJH 1I3VA 2GCYA 5EC1B 4BFIA 4FXKB 1QEWB 1RZFH 1V7MH 2D7NA 4R3SA 2EDTA 5HHOD 1DBAH 5IB4A 5EA0L 5DK0B 2E9JA 5DFVC 2Q76B 4QRPB 1YMMB 3H42L 4OGAD 1H5BC 4NRYA 4P49A 3CLFL 3MJ9H 2R56L 3FFCB 3KJ4B 4P23B 3RVVC 3DPBA 3AM8A 5DD1H 3VFPA 1A7BA 1H5BA 3L3HB 5D7LA 1A6TB 1FQ9C 4L3ED 4NNXA 4X6CA 3OMZA 1JN6B 1ZTXH 3V6BR 3DVIA 1FPTL 5SWSA 1U8HB 1HOCA 3GSVB 1R0AL 5DJCB 2HVKB 2V9TA 2C3GA 4J3XA 3F7VA 5CSZA 5C0BB 5JA9A 1KJMA 1JUFA 2FJHA 1MLBA 5K9OA 2JLLA 3VRLE 1IQDA 5L0QB 2CD0A 1BLNA 1KCUL 2XZZA 3LCYA 1FZKA 1KSRA 4Y4HB 5C6PB 4JHBA 3NCMA 1N59B 3QQ4A 1JZ4A 1KXVC 5DYOB 3GJFK 1FFPB 3WDHA 4QLRA 1JJUA 3V0WL 1FIGL 5DA4A 1NFIB 4G6ML 4N8VG 2AGJH 2GUOB 1MREL 4LARH 4NUGL 1QA9B 4FQXC 5FCUL 1U9KA 4TVPD 2J88L 1T1XA 4GG8A 1FO0L 3MLPA 1AQKL 5D8JL 3O6KH 4FQXA 5HGGS 4DK3A 2V5RA 4HPOH 2IQAB 1ZLUH 3VXRA 5I76B 3LZFL 4XPAL 3QNZB 1A14H 5GGTL 2XG4A 3QHZL 3DX8A 2HJKA 2X4UB 3O6LH 2PO6C 2AV7A 4JFDA 1XF2B 5DURB 1S7UA 1T83C 4X8JB 4YHPA 1RUMH 1R3JA 2PO6A 5KS9E 4ZFFA 2JIXA 1ZSDA 1LD9B 3P4MA 1T83A 1JGLL 5GXBB 4GKOA 1HKLH 2W1NA 4GUPB 4M9PA 3FB7A 3FN9A 5IBLC 4DK6A 4WI3A 4ZPVA 4XMKL 3L7EA 2HVJB 3D0LB 4OZHA 1D5BB 4P4KC 1A0QH 2FX7L 5KVFH 3RUGF 2WWMD 3NFPB 4PJ8C 3QUMA 4P4KA 3TVMD 2CLRB 3A67L 3RPKA 3WFZA 5DMKB 5LWYL 2IANA 3HR5A 2J4WL 1E28A 4Q74A 4PJ8A 3ZTJG 3AS2A 3KYOA 5E7BA 2AEPL 3QCTL 4I0CC 2X1WL 3IDMB 2H26A 4IRZH 3KYKH 1Z5LB 3MRIB 1OY3B 1A7RL 4HKBB 4NO0A 5D71H 2WMPA 2CQVA 1HHHA 4PGDB 1NGXA 3ARUA 4LLWA 3UYRH 2P47B 4LNRA 4KK8D 2FBOJ 1DN2A 2VDKL 3C5ZB 2ZPKL 3TIEB 3I6LD 5EC1A 2EYTB 3S3SA 1YNKL 3QDJA 1QEWA 3WFDH 2E27L 4WCYH 1UENA 1CBVL 1H8OA 2FEEI 4ZUVA 4DW2H 1HSBA 4N8CH 4E41B 5DK0A 3KJ4C 1OHQA 2Q76A 1F97A 3MV9D 4QRPA 3V8OA 3RIAF 3TEUA 3P2TA 3BE1H 4JEGB 1WWCA 1TQCB 4QXUL 2VH5L 4P23A 5F7EH 5KSBE 1A5FL 2XFXB 2NCMA 1UB6B 3L3HA 1A6TA 4XWGL 3QRGL 2NTSP 2QR0B 5FYKU 1UQSB 3IS0X 2HH0H 2JCCF 5HDQL 2Z31D 1U8HA 3GSVA 4UINL 1AE6L 5DJCA 4JDTH 1A6UH 3O8XD 4AEHH 5L0QC 5C0BA 5ADOL 1J88A 2VZ3A 2BDNL 4P5MB 3O3DB 4NQCB 2VYRE 3PHSA 2AXHA 1NUFA 4Y4HC 5AYUL 5L88L 1FNSL 3BN3B 3C5SB 1UB5B 2GFBB 2BK8A 4KHTH 4PJBF 4JM2A 1XGQB 1MWAB 1A1OB 4Y4HA 4C57C 1AH1A 2OP4L 1N59A 4KJPD 2YD5A 5EH1A 5DYOA 4XP5L 3FT4B 1FFPA 1UM4H 4WENB 4ZXBD 2CJUH 2YN3A 4N90E 5I1LB 2PYED 2Q8BL 2MSPA 1NFIA 4K8RC 2LAGB 2RAMA 4F57H 1QFPA 2DMCA 2AJXL 1QVOB 1W72B 3LN4B 1SBSH 1BREA 4UIMA 1J1XL 3ZKMC 1MFEH 5JW4R 3RY4A 4WJ5B 1J18A 5I0DA 1U8IA 2AABL 3FFDB 3WYRA 4ZTPH 3PP4H 4BFGA 3UCRA 2IQAA 1MHEA 4ZOEA 4JY4A 3BD3A 5I76A 2QHLA 3QNZA 3DYPA 2EDYA 1HQRB 1JZ7A 5EIIB 1RURH 4HC1H 2X4UA 1GRWA 2HTLC 3VDAA 5HI4C 1XF2A 4BA8A 4X8JA 1ULVA 2OMBA 2EXWD 3G5YB 3T0VA 2Q87A 5JXED 2BOCB 1LD9A 5F7KC 3BMWA 5BS0D 4ODHL 4GUPA 1JPTH 1L7IH 1NAMH 4HC1A 3RVWD 1SEBB 4EOWL 1OPGL 5K9QI 2H2SD 2F19H 2UWEB 4YFLF 2ZG1A 3FO0H 3D0LA 2LVEA 4IHOB 2R2CA 5C8JB 3SKJL 4XMLH 2DLHA 1LMKA 3Q6GH 3NFPA 4H88H 4WTZA 4RGNE 2XI9A 2VDQL 4HK3J 2FBJL 2CLRA 5DMKA 3CC5B 1GGYA 3VD9A 4ZNCD 1RZFL 1WK0A 3UXFA 4EI5B 4U7KA 4S1SH 4HWUA 1DBAL 3BYTA 3IDMA 3X3GH 4H5SB 4M03A 2B4CC 3UJJL 1Z5LA 2VLME 1VFUA 3MRIA 1OF2B 3MV11 4DGYH 3C5ZC 2EEBA 4MMZC 4PGDA 4GKZB 3NA4A 3RNQB 3MJ9L 2DBLH 4CUCA 2IMMA 5DD1L 1LO5B 3C5ZA 2QJDA 3D85D 4N1CA 2EYTA 4L4TE 2Y25A 3STLB 1PSKH 2E9IA 2EIEA 2X1QA 4JJ5A 4MD5B 3TO4B 3ZL4H 5GZNC 2NY1D 3GNMH 5M7QA 4NKMA 2EC8A 4E41A 4P2OB 1EIBA 3O2DH 3JWOH 4OCLC 3EOTH 4UNTA 1H9VA 4IDJH 2VISB 1AGCB 2AK4D 1WEJH 3CSPA 4FXGB 4M93B 4H0GA 1AR2A 4J3TA 2FZ3B 3MV8D 4S1DD 5CEZH 2XFXA 1UB6A 1HYRC 4HBQA 1J0ZA 2QR0A 1UQSA 4BK4A 3JWOC 3T0ED 1WC7B 4WI7A 3VMNA 4X9FA 1MWAH 5IB5B 3PV7A 5HI5C 3J7HA 4LARL 3L5IA 4JGMA 4P5MA 3O3DA 4NQCA 5FKPA 1P1ZB 4KDTC 4EI6B 2J6EA 3VFRB 3O6KL 1VPOH 4LSRH 3C5SA 4UQ3B 1DSFH 4HPOL 5DGQA 4P2RD 1VFAB 4KDTA 5JOPD 1XGQA 5HHOE 1MWAA 5A16B 1A1OA 1J0KA 2HKFH 3ZE1E 1EO5A 1XFPA 3DTXB 5D7SH 3UYOD 4JB9H 3UTSD 1S7SB 3VRLF 3FT4A 1A14L 1S78D 5I1LA 5ITBH 4R4FH 1D6EB 3QIUD 1V5JA 5C09D 3MODH 4K9EH 4XP6H 5I15H 2V5TA 3HI5H 1QVOA 1W72A 2ESVB 3MRQB 5DVMA 5K59E 1HYSD 1RUML 1AXIB 4JCLA 3LN4A 4L3EE 4Q6YA 1CVSC 1J9CT 4OLXL 2F5BH 4JAMB 2AERT 3TN0B 4LSUH 3FFDA 3SE3C 4K9EC 2QSTA 3KLAB 1HKLL 5EBLB 4Y16B 3WDIA 2XKUA 3CMGA 3VH8G 1BQSA 1G0DA 2YD8A 1MNUL 1HQRA 3SE3A 5EIIA 4MNHB 3IRPX 4OTXH 3NZ8B 3TPUB 1JZ5A 3FAXA 4X6BB 1A0QL 1Z9LA 2KZWA 1AGBB 5KVFL 2BNQA 3G5YA 2HFTA 3TNNB 3U4AA 2Y5TB 2YR3A 2BOCA 3G5ZB 3GI8H 4PRAB 1UADC 1ZGLB 3WFCL 4YBQC 3LKRB 4R96B 1QTYT 5D2NB 1SEBA 4HZAA 1DUYB 5CLWA 5KVDL 2UWEA 4QGTA 4OF3A 3KYKL 1OGAE 3ARPA 4TVPE 4IHOA 5D71L 5C8JA 1AO7D 2HMID 3T2OA 3HS0B 1B2WH 2X89D 5DRWB 3UYRL 1URLA 4IRSD 3IF1B 4EI5C 4TSAH 3CC5A 1N7ML 5DT1H 1INEL 3PWPD 3WFDL 4BUGA 3B9KD 2JJSA 3TO2B 2FGWH 4GXVH 1W2KT 3TH2T 3BQUD 4WCYL 5F97E 3ZKSD 4TTDC 2PKDA 1M7DB 4DW2L 4PPTA 3WDJA 4LLYB 1WVZA 2APTA 2X9WA 4N8CL 4H5SA 3SDYH 1OF2A 4NJ9L 1BQHB 4UOW1 4GKZA 2V5MA 1OW0C 3GIVB 4NQEB 2ENSA 5EG6C 3RNQA 5F7EL 2A6JB 1RD6A 5IHUL 1ZLWH 1EERB 1LO5A 3TO4C 2F74B 2WBJB 1OW0A 1CR9H 4TRPH 2HH0L 2N56A 4ZTOH 3STLA 4F7TB 3TO4A 4P2OC 4MD5A 4PJXE 3OKMB 4KI1A 2Y07H 1U6AH 4JDTL 4OV6F 4WO4B 4L4JA 1A6UL 4AEHL 3ARBB 4G3YL 4M93C 1HCVA 4OJFH 2VISA 1AGCA 4Q2ZB 2Q8AH 2P5WD 4FXGA 5J1AB 2FZ3A 3HNTH 3RGHA 4KHTL 5E8DH 4XCFL 5JIPA 3TJHC 1C16B 1A7NH 4W81A 1WC7A 1UM4L 5IUSA 1EO8H 4F57L 4ELMB 5KSBF 2VUYA 1P69B 1X5HA 3S7GA 4P9MH 2X10A 4P5KA 3ZT5A 2CSPA 1WFUA 4LOUC 4GH7B 3I6LE 1SBSL 4G7VH 3S35X 1P1ZA 2EIDA 1A3LH 1F3RB 1MFEL 3ARFB 4EI6A 1WCQA 3GBNH 5F9AC 3VFRA 3QZWB 5JPNB 3PV6A 4UQ3A 5B38G 4XPBL 2UZYB 1VFAA 2VQTA 2N4IA 4JCMA 5A16A 5F3BB 1UEYA 3DTXA 3L1OH 1R3LB 3EYFB 5BW7C 1S7SA 1RURL 4GW5B 2E7LC 4RMQA