5GGQH

Crystal structure of nivolumab fab fragment
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
208
structure length
208
Chain Sequence
VQLVESGGGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nivolumab light chain
publication title Structural basis of checkpoint blockade by monoclonal antibodies in cancer immunotherapy
pubmed doi rcsb
molecule tags Immune system
total genus 48
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2016-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ggqH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ggqH01
1W0YT 2QSCH 4MNQE 1YQVH 3L7FB 3U82B 3KPPA 1JRHI 4Y4HC 3U36B 2X89D 2ITCA 3WFDL 5IESH 4OCRL 2V5SA 5C3LD 3BUYB 3CH8A 4AEHL 4N9OB 3HFML 3ZHKA 4ODHL 4B7LA 4LKXA 5C0GB 1XFPA 4GAFB 5FM5O 3BXNB 1YEKL 2XN9A 2X4QA 2C3VA 1M05A 1BD2B 3UX9B 3LB6C 4MQSB 4XNXH 2ED9A 5KZCB 4KJYA 4F9PC 5DC4B 4F7TB 1VCAA 1P9MA 1Q8MA 1W72L 1RU9L 5CHNB 2GCYA 4HJJH 2YZ1A 3DV6A 4OCYH 1SYVB 4C4KT 3UTPE 4YZFE 2EDXA 1KEML 5T1KD 4RWHA 4PJHE 5SX5K 5DRNB 1PZ5B 2Y6SC 4L1DA 5EA0H 1KEGL 2Y1VA 2DIAA 3AAZB 3AUVA 3KPPB 4PREA 3PABA 3EDDA 4P99A 1S9XA 2ITCB 4O00A 1IKFH 2NY6D 4K23H 1BQSA 2ZCHH 5DT1L 3AU1A 4LKXB 4PFEA 3QIWD 1GGYA 4KAQH 3FO2A 3R06A 1WAAA 3W0WE 2XN9B 1KIQA 2C3VB 3EO9H 3QIBB 5TFSH 2YOCA 1HQRA 1JP5A 3BKYH 4HMCA 3BT2H 3RVXC 5L9DH 1T1WA 2X10A 4KJYB 5KVEL 3ELAT 4U2YA 3CFKA 3HG1D 5JR1L 2OZ4H 2VMFA 3MQIA 4XNZC 2GCYB 1BBJA 1U95A 1G1CA 4NQCD 1ZT4A 2QADB 1B2WH 2OP4L 1A3QA 5EU4B 2Y7QA 3CSPA 5I1CL 4HUMB 2CMRL 5GGVH 1U6AH 4HCRH 3S4SA 5FGCE 1PEZA 12E8L 3PABB 4XPAH 5DO2C 2AXFA 1SY6A 4MYWB 1S9XB 1KTRL 2CRZA 4OTXH 3LY6A 5KVDH 3T04D 5SWSB 4Z7OF 3NA9L 1MY5A 2HKFH 3AU1B 3FB5A 3BP7A 3SKNA 2OLDA 3FO2B 3R06B 3NIDE 4XB7A 5C9JA 1F90H 4MCZA 4JQXA 4JFZL 2F9BT 1HQRB 3ES6A 3P30L 3TVMD 4OIAA 1BBJB 1U95B 1ZT4B 3W9EA 5AEAA 3PWPA 2HWZL 4YDKL 4HC1L 1R5VA 1T3FA 2DM7A 5FUCC 1NAKL 2Y7QB 4I18A 4HZAA 2OJZH 3ROLB 5C6PB 2WWMC 5T5FL 5B3NA 3S4SB 4JZJC 5EC2A 5C07B 1QYGH 1Q9WA 3RRQA 1VADA 3O6LH 4C56D 2UWEB 5C0JA 5A3ID 3MLPA 1P6AB 4JN1H 1JZ4A 2FCBA 3LS4H 2LE9A 4TNWK 1FNSL 4BFGA 1XGPA 1QNZL 3FB5B 4Q6YA 3SKNB 5BRZE 1IGMH 4TPRL 3CCHB 5I0ZA 1EHLH 1LP9A 1CGVA 3FO0H 4LSDA 5I6XC 2IPUG 4MCZB 3ES6B 4CGTA 3D18A 3U6RA 1R3LA 2WIIA 4KY1H 3O2DH 1W2KT 4G6ML 4X6CE 3L95A 5F7KC 2XTJD 1SMAA 3N0PB 3PWPB 3HNVH 4I77H 4PJFE 1XF2A 3LVEA 3PF2A 1R5VB 1T3FB 3ULUE 1KENH 4I18B 1T66D 1CTOA 4HFUH 3VFOA 1FSKC 4MNHA 4Y5XC 3QRGH 2OX5A 1IEBA 5DJ0A 5EC2B 1Q9WB 1VADB 5C0JB 5IMOA 2R69L 2NY5L 1J5OH 4CVZA 1VFBA 3EYFA 4FP8H 3T2PA 5J1TC 1H5BA 3QHTC 1XGPB 3DYPA 1OQXA 3EHBD 1R3JA 4PBXA 2D0GA 5CEZE 1FVEA 2FYYA 4KK9C 2FZ3A 5ISZD 4CRPA 2I27N 5GJSL 3GRWA 4XC1H 3U6RB 5FOJA 3PXHA 5T1LD 1R3LB 4NJ9L 2EIDA 2WIIB 2CO6B 5JIIA 3VI3E 3VG9C 4HS8L 4HKBA 3UCRA 3L95B 4AT6A 3GMPA 4PP1C 4N1HB 1A21A 5E8DL 1AH1A 4R7DA 1TQBB 4E9LA 1XF2B 1AFVH 4OLYH 3H3PL 1A6WL 3VFOB 5FGRA 4WI8A 2X4OA 3CMGA 3SE4C 4MNHB 9CGTA 2ENSA 4XB8A 5AD0A 4Z0BH 4NIKB 4OZ4B 1IEBB 4FQIH 5DJ0B 3NFSL 4OM1H 3ABZA 1XH3A 3CDCA 5JNYA 2XOTA 3RNQA 2BSTA 1SMOA 1U3HA 4QGYA 2FDBP 1VFBB 1NL0L 3EYFB 3VXSE 4CVZB 4FTVD 3H9SD 4EXKA 4MZ3A 3O41A 3NAAH 4ALAH 1EERB 3MJGX 5E99H 2JIXD 3CXDL 1J87A 3DSFH 3P11L 1FVEB 3ESUF 4PGCA 4UDTA 1C8PA 2FYYB 4LOUC 5IHBA 3QUZB 3SGEH 2FZ3B 3ZDXF 1Q72H 4LNVA 1L7TH 4FQCL 4RGNC 2VZTA 5EUOF 4ZNEA 1PG7W 4YHZL 3GJFA 3T2NL 4LQ1A 2DLFH 4HKBB 4Q9RH 2PNDA 4AT6B 3GMPB 3QG7L 3RIFF 3E6FA 4DFIA 4OLZH 4QXUH 3ILQD 2V5TA 5I74C 2X4OB 5JHLH 4FOMA 3LRHA 4JFHE 1QG3A 5AD0B 3ARTA 4U6HA 2E3VA 1NFDA 1P6FA 3VWKD 2V2XB 3VFVA 1LDPH 1GCFA 3Q6GH 1KN2L 5J56B 1XH3B 4LDEB 5JNYB 5E4IA 4R8WH 3RNQB 4YXLL 1U3HB 2QV2A 3ZMRA 4OZIB 1Z6JT 2P8PA 3QXUA 3O41B 1QLEH 1KUMA 5GHWL 3GSUA 3SE8H 4KTYA 2OZ4A 2BC4A 4PGCB 5HYJD 4JE4B 4XPTL 3RTQA 3BZDA 4D2NA 1B0RA 1TJGL 4WI9A 1H3UA 3O6KH 5IMLA 3PNWA 1J1XH 1WFTA 4DW2H 3O9WC 4XHQA 2OTUA 3SN6N 4NHCL 4H88H 1LNUA 4JPIA 4HCRA 2ZOKA 4PJEA 3V5KA 3DVGA 4XVJH 3SDDC 4I3SL 3E6FB 1CICD 4U0QB 3I50H 4S1QH 3IXAA 5IB2A 1FAIH 3S5LA 3AMKA 3ARFB 3UPCA 3CX5J 4Y4FC 5HHME 3VFVB 4KJPD 1JZ8A 2W0PA 4GRLD 3VGBA 2BRRH 2DD8H 2NZ9C 2C1PB 3H6JA 2P8PB 5GGRA 3SCMC 3GSUB 4OQTL 5LQBH 4HS6A 3EDJA 5D7LA 1NKRA 3RTQB 1B0RB 3LS5H 4GSDL 5AZ2L 3PNWB 5F9OH 4L3EA 2HP4A 1MREL 2DWEA 2VZOA 2OTUB 4L8SA 1S7SA 4K3EH 1F3RB 3CFCL 1LNUB 3X3GH 2ZOKB 4PJEB 3V5KB 2J5LB 3DVGB 3FN3A 5IB4A 5LCVH 1SJHA 1RJYB 2JJTC 4R90H 4K94H 1IAIM 4APQC 3SE3C 1JTTA 5IB2B 2F8XC 2OXHA 4PJDF 3S5LB 4QHMA 1ONQA 4YEEA 2RR3A 2WZPD 1JFQL 3V5DB 3UJIH 3SO3B 2MJWA 1UVQA 3MV01 1A1OB 2FX9H 3X12B 3VFSA 2VDOL 2RJMA 5HY9A 1OF2A 1CL7H 1IL1A 3O8XD 3ULUL 4BZ1H 4IMLA 5GGRB 5JZ7C 5I1GH 3HZMB 4OF7A 4HXBH 2HFGL 3O2DA 2YUVA 1NMBL 1NEZA 3MLSL 5D7LB 3OGCA 4P9HH 1WBZA 1FNHA 4XH2B 3TBYA 2EKJA 1O7VA 3KLAA 5E8EA 2ZCKL 3JWNC 5I8KL 4RMVA 4L3EB 2BNRD 2A77L 3VRLE 3V52H 4L8SB 1S7SB 3MLVL 1RV6X 1EJOL 3NGBB 4DKDC 4XPFL 5KSUA 5TE4H 1I1YA 2DAVA 4F3FA 3B9AA 1V3KA 1YEIH 5DLMH 5IB4B 2XZAH 3QPQD 3QIUD 1SJHB 2RCSH 1IKNA 4KJQD 32C2A 3V0AC 5LVEA 5D1XA 4XVUC 1JJUA 4NQDE 1KXTB 1BFOB 1ONQB 4HUKB 5CZKA 2NY0C 1UVQB 1JGLH 1EHAA 4M61A 1OW0A 5F7NC 1MRDH 5HY9B 1OF2B 1EA9C 4IMLB 2AAVA 1U8MA 1P2CA 2BNQD 2KH2B 4X4YA 1A3RH 1ORSB 4ORGA 2HTKC 4TSAH 2ZUYA 1ZS8A 4D0BA 2NX5E 3OGCB 1WBZB 2YK1L 3TBYB 3KLAB 5E8EB 4XXDA 4P5MB 2DDQH 4R2GC 5DVKA 5INDA 4N90D 1T7XA 4IDJL 5GSVA 3GJEA 4HIIA 5KSUB 1I1YB 1QFWH 2M2DA 4OLXL 4MQ7A 5HVWA 1VKXA 1NCTA 3L3GA 4GRWE 1W8OA 2OL3L 3O4OB 4X6DF 5D1XB 2GYSA 1DN0B 2NW3A 3O3BA 2XTLA 5DMGD 4N8CL 4Z77A 3JTTA 4LHUA 4M61B 1MRFL 4LU5L 4CUCA 5IHUH 4AZ8A 3RWDA 1Z5LB 1BIHA 1P2CB 3KG5A 2OI9C 2L4OA 4X4YB 1ACZA 2VDML 4ORGB 1E27A 1NCBL 4D0BB 4L4VA 1EK3A 1G0XA 1EBAA 3GNMH 4XXDB 5KBNC 3CU7A 4Y19E 4HUWB 2VC2H 1CT8B 4YE4L 3WE6A 4JDTH 5CZXC 5INDB 2DQCH 3SGJA 3GJEB 4HIIB 1EFXB 5I1LA 3VXTA 3JBG7 3OKYA 4TYUA 4MQ7B 1MCKA 3SHSA 1VKXB 3X11A 3L3GB 1A7QH 1CXFA 4Z95L 5ITBH 4YPJA 3V5HB 2NW3B 1HIMH 3FOMA 3KYAA 3O3BB 3EZ8A 3MRPA 3H42L 1ES0A 2Y07L 1MJUH 4Z77B 3JTTB 3P4MA 4LHUB 3B8YA 5JQ6L 2W9DL 1LK3H 1CGXA 5DRXA 5FEBA 5L88L 3RWDB 2BOCA 3V4VH 1TFHA 1PAMA 4G9FA 4X7TA 5ELIA 4CVXB 3CVIH 3MJ7B 2Z93A 1LO5A 2MQCA 2BFVL 1E27B 1A3LL 2YN3A 5D96C 4L4VB 2Y72A 2YD5A 3MLXL 5DDHB 1JRHL 2DL2A 4KKBC 3UJJL 2ESVE 4GMTH 1FPTL 3F7QA 1G6RH 3C6LA 5GRJH 1JK8B 5HHQA 3WE6B 4PJ5D 3RL1A 2FD6L 4EQ2A 5LBSL 4Z7NE 5I1LB 3VXTB 4JFXA 4YHOH 2PR4L 1GPOH 1EHNA 1QSEE 5GZOD 4BUHA 4HLZH 5FKPA 5HI5D 4OT1L 1MCOL 1P5VA 4Q9QL 3W2DH 3EKCA 5DYOA 4KKNA 3FOMB 3MRPB 1QD0A 1ES0B 1QUNA 3QHZH 4TNWF 3P4MB 3JV6A 3TC9A 2AI0L 1OWWA 5DRXB 3LPWA 4HJ0D 1M4KA 2BOCB 3WLWC 4X7TB 2BVQA 1X5XA 1KCLA 2Z93B 4RFEA 3PGCA 2DWDA 2W9LA 1IAMA 2A6JA 5IW1A 1YEFH 3MLWH 5GS1C 1WT5A 5CGYC 1Z9OA 4YQXH 3C6LB 5HHQB 4FQ2H 1G7MA 2WINA 5BS0A 1A6VL 2VLKE 3RL1B 2PO6A 4NO0B 5SWZD 4JFXB 4ZS7L 4ONFH 4N0RA 4MD0A 3SE9L 5FKPB 5ADPH 4OCXL 1MSPA 1SBBA 1XCTA 3BSZH 2YUWA 3WUZA 5DYOB 3ARED 3LHPL 4IEFB 3EZJB 4U1HA 4GT7A 1K85A 2XA8H 4N0UA 3EYSH 3MODH 5IT2L 1NFKA 1TPXB 3JV6B 4B53A 4L5FH 3WFCL 1N4XL 4NT6A 1RULH 1KCVH 4ZSOE 5IMKA 2VRAA 5E08L 3E1F1 2O93L 3C2AL 2BVQB 3QDJA 4RFEB 4J3SA 3PGCB 1U8NB 1SM3L 2DWDB 1Y0LB 2AK4A 2L7UA 2Z8SA 1FO0H 4YHKH 5F71A 5F7UA 3MOQA 2A9ML 3E3QE 2WINB 3S97C 2PO6B 3SKJH 4DN4H 2F19L 3OJMB 4LRIA 1PY9A 1JWSB 4HW6A 4MD0B 5AAWA 1B90A 1E4WL 3PV6B 4JG0H 4QRRA 1MAMH 1XCTB 4ODVH 4GQPH 1XF1A 1QHOA 1MVUA 1LO2L 5GGVY 5GS0L 4NBZB 1R3IH 4U1HB 5ACMA 4P2OD 3CLEL 2A6DA 4X7SH 4N0UB 1BFSA 5FB8A 1DCLA 2O5ZL 3DX9A 5HYEA 5IVXB 2XA3A 1INEH 5IMKB 4P2RD 1H3GA 5TF1L 5ENWA 3DMMC 3QI9B 1WC7A 3GI8H 4U3XA 3RWHA 1CQKA 1NDMB 1QR1A 3RKDD 2Q86A 1EAPA 3BJLA 1K6QH 4WU5A 2DYPD 3GBLA 1VGKA 3NTCL 3S34L 1QVOA 1WFUA 3B9VA 1SBSL 4DK6A 4BSJA 2ARWA 1X5HA 1I1CA 3HPLA 4KUZL 5SX5H 1GRWA 3K1DA 4UB0H 1D5IL 1WWCA 3CFDA 1WAAE 2V6HA 3MUJA 5B21A 5D71H 1MQ8A 3CNKA 1SVZA 1EVTC 4D8PA 3AB0B 4QRRB 4LF3B 4UNUA 1MVUB 1X5GA 1A4JA 5HI3D 2AS5M 1MFNA 5E2VL 2A6DB 2NZIA 2WMPA 1ZEAH 5FB8B 1A5FL 3TESA 1ZVSA 1H8NA 1TJHL 2DQDL 5I18H 3DX9B 5E24E 5EUOA 2V9RA 5FIEA 4MMXC 5ENWB 3RA7H 1AO7A 3MV8D 3RDTA 3RWHB 5I1KL 2ARJQ 1QR1B 2Q86B 1UXWA 3ZSTA 1EAPB 3KJ6H 4NO2A 4WU5B 4EJ1C 4Z76A 3RX7A 4S1SL 1VGKB 4RCAA 4ZUUA 2DBJA 2EZ0C 1E6JH 4XAKE 5I30L 3CFDB 4FQJL 4F7MA 2O5XH 2FATH 3TBWA 4IRJB 1X6NA 1UGNA 4AG4H 4D8PB 2CR3A 3VG0L 4OGYL 4BM7A 5CJXA 1J1PH 3VWJD 1A4JB 5JIKA 5FO8A 1NAMH 5F97E 1Z2KA 4DQOH 3RQ3A 4NN7B 5GS0D 1AD9A 4PY8I 3B43A 3JZ7A 3RVUD 3QDMD 1ZVSB 3EDEA 4NUJA 7FABL 3HUJF 1P7QA 3MLUL 2QQLH 4KUCF 1AD0A 1G6RA 3KXFE 5EUOB 1AO7B 1ZLUK 3VFGH 1A6PA 3RDTB 3MMEA 3UTZA 1NCAH 1UXWB 4P3WA 5CUSH 1SYSA 1P53A 1YMME 3K0WA 3LQAL 4ZUUB 3S4SG 3WFBL 1FBIH 3OGOE 4OGXH 3QUYC 1EEZA 4WUUD 3GSNL 1CF8L 1DLHB 1FGVL 4XBEH 1LP9E 4F7MB 4EIZC 4LGPB 4U4BA 5IW6A 3MC0A 3TBWB 2NXYD 1UYWL 4OZFH 3SOBL 5J12B 1FIGL 5HHNA 1KLUA 3MZGB 1RUMH 1MY7A 1HHIA 4S1DD 4X99A 1OAUL 1AD9B 4NC0B 1ZHBA 4XP1H 4NUJB 2EEAA 3P73B 3I6LD 3QZWG 3VFWA 1AD0B 1G6RB 2PYEA 1KPRA 4WWKA 5DF0A 1FRGL 4P0DA 4DVRL 3MCKA 1QLFB 3MMEB 5ALBH 3UTZB 4F15C 3AM8C 1HNGA 1I9EA 5GQBA 5JHDD 3EFDH 3O4LD 1SYSB 3P2TA 5GS3A 4PJDA 2VXQL 4Z5RA 2J88H 3QG6A 5D1QA 3TN0C 1D9KC 1EEZB 3OX8B 1I1AC 1H8OA 1WBYB 1XGQA 1LEKA 4ZUSA 2ZOLA 4MXVF 3ZDYF 15C8H 5IW6B 5KOVC 3L6FA 4OIIH 3QJHA 4DZBA 3UC0L 3D69A 4OM0L 2VLME 5EU6E 4Z7WE 4POZC 1ITCA 5HHNB 4LSRH 1KLUB 3VFMA 1F6FB 4TQEH 2XWTA 2Z8WC 3HRPA 5D8JH 3ZKMD 1HHIB 1UM5L 4X99B 4MHHI 1ZHBB 5C9KA 3A6CH 4P3CL 1FO0A 3NIGF 3HE7C 3VFWB 3KPRE 2WBWB 2WBJA 2PYEB 4PJIF 5CZVH 3RY6A 4UBDD 2R8SH 4WWKB 4MNGE 5JO5A 3MCKB 4LEOA 4BELD 5DJ6A 1G7LA 3CFBA 1CLYL 3IU4L 1XF3A 3VXUE 2JF1A 2R39A 5I9QB 1MIEH 4R4NC 4MD5A 1JNLL 4PJDB 1NUGA 4Z5RB 1UACL 2EDYA 1F4XL 2VJXA 3BGFB 3C5ZB 3QG6B 1P4IH 4X5WA 2ZG3A 4PP2A 5D1QB 5CEXA 4NN6C 1XGQB 2MNUA 4QOKD 2ZOLB 2D7NA 4WI6A 3L6FB 4Z7VF 3QJHB 1A6AA 3WHE0 3QA3A 5DD1H 3TM6A 4DZBB 2APXA 1QFOA 2BHUA 2ZG2A 2DQEH 3D69B 1HE7A 4ZNEE 3VFMB 4KRPD 5JW3H 4PJCF 4LQFL 1R5WB 5D7JA 3P0YH 4M6AA 3CDYA 2WW8A 5CBAA 5IBLD 1AY1H 4PRBA 1FO0B 3U7YL 3LV3A 2VN4A 2WBJB 4I2XA 3U30B 1JL8A 3OXSA 4N0YH 2IFFH 3NPSB 4G6JH 5ALCH 1NFDE 1WFNA 5DJ6B 1G7LB 3QQ4A 4M00A 4F33A 3CFBB 3HS0A 1QFUH 1XF3B 3QNYA 1AHWA 1H8SA 3MLRH 5HDBF 4A6YH 3T0WA 4MD5B 3U1SL 3OF6A 4X6DA 1T83C 4X5WB 1NGXA 1KC5L 2BJMH 3T2QA 3MNVA 5CEXB 1U93A 5J1SC 5J3HD 2MQ0A 1FFRA 1O0VA 3QSKB 4ZAKC 2ZNXA 3TNMA 1A6AB 4OD1H 5DR5H 1ZKAA 3QA3B 5EZIH 4H5SB 5J1AA 2GSIA 5A2KH 3BQUC 3HE6D 1E28A 5B4MD 3E0GA 1MFCL 5D7JB 4Q97A 5FM4A 2YRZA 1FN4A 5CBAB 4WW1A 4CVUA 3NCJL 1J8HE 1JTPA 3LV3B 4H0IA 1GC1H 4LPCA 3JWDL 4I2XB 4XMKH 3SBWC 2VXTH 1CLOL 3KLSA 3OXSB 2PYFA 2LU4A 2Q76A 1OQOA 4N0CC 1P7KA 4LLMA 3B4NA 3JV4A 3QQ4B 4F33B 5K9KA 2G60H 3QNYB 1AHWB 2XPGA 4PRHA 4G3YH 2AJXH 1OARH 4X6DB 2IQAA 3MRIA 1NCWL 1NGXB 3OKMA 3MNVB 1U93B 4RDQG 5C08A 1NAMA 2VSDA 1I3GH 1DQMH 4HT1H 1D5XA 1RY7B 5IJVA 3TNMB 1OAQL 5DWUH 5HGGS 5IFHH 1WIPA 3KNBA 2R2BA 4L3EE 5EWIL 3DXAA 5J1AB 1MFBH 2VE6A 4UT9H 1YY9D 1E28B 4LFHD 5INCA 1IT9H 1KG0A 1Q1JL 5HYQB 4H8WL 3T09A 3ZHLA 3KYNA 4WW1B 2YPLB 1RIHL 4QRPE 3TH2T 2ADJB 3LEYH 3QCTH 4PJAF 5C6TH 2FO1A 4OFDA 2NXZD 4WI3A 2Q76B 3MA9H 1P7KB 4LLMB 3E3QC 2R4RH 3BIKB 5CSGA 5K9KB 3S5LG 2XPGB 4PRHB 1RSFA 3D48R 5TE6L 4Q74A 4OUOA 1ZHNA 4N9GA 1MPAL 5C8JA 3BIAX 3MRIB 2VDQL 4LLDA 3OKMB 4MAYC 3EIFA 5J4MA 2Y25A 5C08B 4RGMB 1NAMB 5AWNL 2CXKA 4G6KH 5J11C 5EU5B 1J05A 3BMVA 1P9MC 2J8HA 5IJVB 3NIFF 2R2BB 2QADC 2NY3D 2VE6B 5INCB 1M7XA 4MJ6A 3BUTA 3B9KC 4MAUL 1VFOA 3KYNB 5CLTA 3WD5H 1FVDA 2VIRB 2HA1A 4KZEL 4MGXA 1VDGA 4JJ5A 4NC2B 4ZTPH 3OWEA 3GHBH 5IGXL 5KVFH 3C5SB 4QHLA 2AQ2A 5FUOH 3ISWA 5I75C 2N4IA 2EIBA 5I15H 3N06B 2EEDA 1N0LA 4G7VL 1HCVA 1NGZA 1S7RB 4TVPE 4X80H 3FHAA 2I9TA 4N9GB 2BXYA 3DHMA 4XNQA 5C8JB 3RUGA 2J6EH 4U1GB 5DK2A 5EZLA 4OZFB 3QFJD 1NSNL 1G9MC 4QTIH 4LLDB 2H8PB 4CU7A 3OJVC 5I1IL 1JIBA 3MOAL 2WAHA 4XMPL 1J05B 2AK1H 4FQLH 4MA3A 1EV2E 3SDAC 4EDXA 1YQ2A 2EDLA 1NEZG 1TNMA 5D2LE 1JZ3A 3C60A 1D5ZA 3MCLL 1AI1H 4XCNB 1S7VB 1GAFL 2EECA 4HGWB 2ZPKH 4PJ9D 1ZANH 3VXQA 1CXHA 5M7QA 2VZUA 1FVDB 4GLRH 5E8NA 2GKIA 2XG4A 3GSOB 1T1ZA 1YYML 4JJ5B 3BH8A 3RIAK 1YECH 1VPOH 4RBPK 4YDLB 4JY6A 1A7OH 1A64A 2OBGA 1DVFB 3K4ZA 1ADQH 4ODXA 2MTPA 1PG7H 1S5IH 1NGZB 5ERWA 2I9TB 2J8OA 4JO4H 2JLLA 3DJ9A 3RUGB 4PGDA 5DK2B 4OCMC 2VLJE 1Q0YL 4P4KA 4K9EC 3AXLA 4XPBH 3MJ8A 4XCYA 1M71B 4WTXA 1F3JA 4L4VE 2VDNH 4PD4K 4HGKC 4MA3B 1YJDC 2EYSA 2K7PA 3IU3A 3OAUL 4EDXB 2IPUK 1MNUL 5B8CA 5E03A 2AJZB 2VOTA 3C60B 4EDWL 1D5ZB 3TV3L 5GGTA 2DTML 5HTSA 1FLRH 1DR9A 2VYRE 4I18C 4PG2A 2NY1D 1B9ZA 3CZJA 2X4SA 3VXQB 2ICES 3C5JB 3NCEB 5DHYA 3CFJA 4ZXBC 5E8NB 1CFVH 1X5IA 5FYLH 4MVBC 2OYPA 1T1ZB 4KK9D 3BH8B 4GG6E 2D7OA 5L2KA 5GGSA 2R29H 1CDHA 5E8PA 1I85C 1HHKB 4JY6B 1O5DT 5E6ID 5I1JL 2QQNL 4H8WC 5DUBA 3ZTNL 1RHFA 5ERWB 3RGVA 1UQSA 4NHUA 2P5EA 4OSUL 4OFYA 5IM7A 4PGDB 2YR3A 3F58L 4IOFD 3IXTA 4G9FE 4NQXA 5BOPA 3FO9A 4LHUG 2X1XR 3CC5A 4MCYA 4P4KB 4C54A 2R0LL 3MJ8B 4XCYB 1DUYA 4EI5A 4O4YL 1KXQE 4F9LA 1F3JB 1ACYH 3H3BC 3TPUA 3QAZC 4ZO8A 4RFNB 4HWNA 2V2TA 4FXGA 4OLUL 3IU3B 5GRUL 3TJEH 3GIZH 1U3YA 2GY5A 5B8CB 3OBAA 3P0VL 1JPTH 3ULSB 1OGAD 1UADC 4P5KA 1LEGA 4LK4A 1T2XA 2X4SB 4NKIH 3BKJL 1VESA 5KJRH 4RMRA 1CD9B 3I6GA 3CFJB 3TFKD 4JPVH 3RZCA 4HPOH 4A6YB 2O61A 4C4KO 1S9VA 5HPMA 2CK2A 4M1DL 1UZ6F 4LOUD 3DETD 4Z7OE 3HKFA 4TOYL 5L2KB 5GGSB 3ZKXB 1BLNA 2DMKA 4FABH 1H5BC 1DBBL 5LAXA 2ADFH 5DUBB 4CMHC 1GGIL 2VO5A 2YA1A 3RGVB 2CR6A 1UQSB 3UTSE 4NHUB 2P5EB 4M7JH 1EBPA 4TUOA 2WIMA 3IXTB 4NQXB 1MFEH 4OLVL 3F7VA 3FO9B 3CC5B 3MRLA 2X42A 4YBLB 1DUYB 4EI5B 4E41A 1BBDH 3TPUB 3VXOA 1NJ9A 4G42A 5F89A 3EUUA 1P1ZB 1NCNA 3HUJA 2V2TB 4D9RD 1QSFD 4FXGB 1I7ZA 5GISL 2QQKH 3CH1A 4MJ4A 3QBTB 2DMBA 4DKAA 2VABA 4JJHA 3WIIH 4YR6A 3JV0A 5BS0E 1M7DA 4WY7H 5CINL 4HKJB 3BZFA 1LEGB 4XNYH 4X5XA 4LIQE 1YEJL 4O5LL 4CDGC 3OKLA 3I6GB 4QXGH 3SGDI 4LSSL 3RZCB 2O61B 1CGUA 1S9VB 5HPMB 5E9DE 4MA1B 2D03L 2E7MA 5IQ7L 1U3HC 1BLNB 4OZHE 1NMCB 4LPYA 2FLBT 5GRYA 5LAXB 1Q9OA 3VH8A 2P4AB 1XIWB 3WUWA 5ICXA 4JHAL 3SDDD 3G08A 5E6ZA 3TBTB 5L2JA 3F7VB 3MRLB 3QDJE 4KPHL 4QGTA 2YD6A 4RX4A 1A14H 4KXZH 2R1WA 3NH7L 3CFEB 4E41B 4Y4FD 3VXOB 4G42B 5F89B 2AK4E 4LCUA 3HUJB 4NGHL 3PHQA 3RL2A 1IGFL 4NWUH 2AXGA 3F7YA 4J12A 1I7ZB 4XP5H 1RIUL 3CH1B 3D3VB 2ZJSL 3VD3A 1VA9A 2VABB 4YR6B 1YMHA 4FZ8H 4KGLA 1HZHH 3BZFB 4X5XB 4NQEE 3OKLB 3F12A 1B4JL 1JHKH 2F54A 4LDLB 3HMXH 5C09B 2H1PL 2J6EA 3MZTA 4AEIL 3DURA 1KFAH 3ME0A 3ARBD 2MQ3A 2QSTA 1Q9OB 2DKMA 2VR5A 4EIGB 1TZGH 4HG4K 3WUWB 4MNQD 3G08B 2ZUSA 2B0SH 2DJUA 4Y8DC 3I9GH 3N1GC 3TT1L 5L2JB 2I5YH 3E2HC 4KVNH 1RUQL 1LO4L 4P4RA 3DYOA 3FFCD 2KUTA 4P59L 4M9OA 5D1ZA 3UO1H 4LCUB 3RL2B 5KSAB 3PHQB 3RWJA 1MCSA 2AXGB 3F7YB 1UA6L 3UBXI 4YHNB 2XYCA 4PJIA 1EMTH 1N3NB 4BQ6A 2J3SA 1KSRA 1UWEH 1YMHB 1XGRB 5JZ7D 3UPAA 4NM4H 5DFWH 4Q9CA 2QEJA 3O3EA 4JKPL 1ADQA 2JKXA 2VUYA 5DD5H 4WUKL 3F12B 1KLGA 5I1HL 5F3BA 4BZ2H 2F54B 3SO3C 2F5AH 1XR8A 5HBBA 3QO0A 2EO9A 3ARGA 3UTPD 5DQJA 2YD7A 4O02H 4I0CC 1CVRA 4Y1AB 35C8H 3OHXA 4Z7VA 3PGFL 3ZDXE 3O11A 3H2WA 1T03L 2HH0H 1AQDA 4KKCC 4YWGH 1GGBL 2OCFD 5IVOA 5C0CE 1TZHA 4PJCA 2DLTA 4P4RB 4XVUD 4FQXB 1WEJH 2CK0H 3WNNA 1FCGA 5CD5C 3MACH 1A0QH 4P2CG 4PV8B 3RWJB 2E6JA 1EGJL 4XMLH 1B6UA 1NGQL 3Q5YA 2O26U 1F4WL 4KMTH 5A2FA 4KJWD 4S2SA 1KCSH 2ICEB 1AKJB 5A40E 3L5XH 3DROB 4EOWH 3O3EB 1INDL 3MV9E 3GMNA 1CIUA 1KLGB 2GTWB 1CZ8L 4Y88A 4HF5H 3IAGC 1QKZL 1XR8B 3QO0B 3GSXA 5E8OA 3ARGB 3F65A 1CD1B 5DQJB 1IBGH 4MXQD 2R4SH 3VXRB 4MLIA 5SX4H 2E7LC 2AJVH 3OHXB 4KU1A 4Z7VB 3O11B 4MA8H 3F7RA 2DQIH 1AQDB 4Z6AT 1E6OH 2Q8AH 3MBXL 3TO4D 4JGMA 1OLZA 1TZHB 4LCIL 2DLEA 2DQGL 2UVFA 4PJCB 3BKCH 3D0VA 3HZVA 5DZLA 5CILH 3THMH 2UZYB 3RVWD 1EHXA 5I8OH 1X4XA 2HKHL 4OF0A 4AIZA 4JFDA 1V05A 2KBGA 5ABDE 5FYKD 4B50A 4ODSH 4G8GA 3P77A 4OGAC 4S1RL 4QT5B 1Q0XL 4S2SB 1CFSB 2XRAH 2Q1EA 2YHGA 4TN9A 5D1XC 2W91A 2VKXA 4JCLA 4JRXA 2IH3A 3GMNB 5DSCB 4FZEH 1IVLA 1ZLUH 4DTGH 4Z8FH 3GSXB 4I9WE 4XX1G 2WSKA 3N85L 4PJ8D 4JFQA 4MQXD 5CZXD 3T4AA 2AXJA 3SDXF 1GHFH 1T0NA 4M6ML 1U0QA 2B20A 1X5KA 1NUNB 3MROA 4MJIE 4ODUA 4OB5H 1AJ7H 2NMSA 2E9IA 4K8RL 2AJYL 3D0VB 5KN5A 1RUKL 4O2EB 4JFDB 1EO7A 4P5TC 3M8OH 3HNTL 4PJAA 5F1OB 4P9ML 4AIZB 3ARDA 4G8GB 1GH7A 3L9RA 3P77B 4OJFL 3ULVE 1FDLL 4IRSD 3VDCA 3QNZB 2IH3B 4ZYKB 3GSQA 4I0PB 4Y0GA 2F58H 1AXTL 1KB9K 3WFDH 2IANA 4AEHH 4YZFF 2IAMD 3WJJA 3BRDA 3DBXA 1WUNT 5DA0B 4JFQB 4K7PX 3T4AB 1YEKH 3CLFL 1PKQA 5DURD 1T0NB 1BJMA 2HN7A 4YXHH 4HIXL 2W9EL 5CCKH 3VFPA 3MROB 4U05A 4NCC1 4ODUB 1RUAL 3OR6A 4LVNC 4ZD3L 5IF0B 3E8UH 1JNNH 1N7ML 1RMFL 5F6IB 1RU9H 3GM0A 1R0AH 5C1MB 4FFZL 5EFIA 3SGJC 4J4PA 2QLVB 4PJAB 3HMXA 3ARDB 3L9RB 4OBSA 4U1JA 1D6VL 2IEPA 3RIAF 1EZVX 3GSQB 5DGQA 3PL6B 5KW9L 1JF1A 2IANB 3QEGH 2DQHH 3VD4A 5CGYD 2JB5L 1UG9A 3ZL4L 2NNAA 3DBXB 4YO0A 3G04B 5J13C 1L6ZA 5D7KD 3IFNH 5BJTA 1KJVA 4NZRL 4LASH 1PKQB 5B3JE 5MEOA 5GRVL 1UKQA 2HN7B 6CGTA 5EC1A 5DFVC 1AE6L 1CFNA 1T7YA 1B0GB 4BK4A 4U7MA 1W0WA 5DXWA 3OR6B 4F7CB 2A0LC 5KVEH 5KVMC 3CU1A 1CK0L 4BH7A 5HGDA 3Q5OA 3VXSD 1J0JA 3O6FA 1MCHA 1J9CT 5EFIB 4S10A 1OAZL 4K8RD 4XP4L 1UB5A 4XP6H 2IMMA 4HH8A 1M7IA 5IVNA 2R0ZL 3G9VA 3TCLB 1FORL 1PVHA 3CSBA 1VB9A 4TVSa 2NR6D 3ARYA 12E8H 4M93B 4QXWA 3CVHA 1X6LA 1JF1B 1A9BA 5TDPB 4X9HA 1JZ2A 1ZGLA 1IC5H 3FRPA 3NA9H 5T3ZL 2NNAB 4YO0B 2AGJL 1R3HB 4NM8L 4Y4HB 1YEDA 3WIFB 4KMQA 4DKFL 5BJTB 1KJVB 2AERT 2MCPL 5MEOB 2DN7A 1IQWH 4L29A 1BEYL 1W0WB 3P30H 2VLRE 4IBLT 4W4NA 4K94C 4U1KA 1OTSD 4BH7B 5HGDB 4HLJA 4GAGL 3DUUB 3MUHL 2CLVA 3Q1SL 2AEPH 1UB5B 2FL5A 2G2RB 1M7IB 2ERJC 2V17L 2L7JA 4R7NA 5JW5A 3MXWL 1FNLA 4ONGL 2FSEA 5A2LH 3WSQL 3DMMD 2E27L 5DS8A 3VMOA 4X6CF 2UZIH 4PLJD 5I0DA 2DF3A 3TT3H 1A9BB 3GK8L 1ZGLB 3QWRA 1MCWW 4PJFF 1IAIL 1BZ9B 4O58H 3DXAE 1FG9C 5JDJA 3ULUF 1FNSH 2AEIT 3I6KB 1A7NL 3QQ9D 4KDWA 1YEDB 3KR3L 4TPRH 4Y4KD 5T1KA 5EB9A 5AZEL 5AYQA 4XPGL 4PLKC 2I07A 3ZHDA 2AEQL 4L29B 3ETBF 3D39A 5DJZA 4P2QA 3RAJH 3MXVL 4U1KB 2B4CC 3ARQA 4D9QE 3OSKA 2W92A 1NC4A 1RJZA 3FMGH 4HWBL 3GBNL 5MERA 2CLVB 1FV1B 5JPNA 5I73C 2FL5B 3ZT6A 2XACC 3QIWA 1UM4L 2IBBA 1T7VA 3OG4B 5HYSA 5F21B 5JW5B 4XNZB 4XP9H 4OQ1A 3S35L 1EJ6A 5DS8B 5MENE 4K07A 4OCWL 1KV3A 1NBYA 1TJIL 5IV2A 4NO5A 5C2BL 5EOCL 5C2UB 1G7QA 2HTLD 3ARPA 1CE6B 4JZOA 4R3SB 5L6YL 3KPSA 2VDPL 1AGBB 2Z35A 4UINH 1IM9D 3ULVL 3DVFA 3QUML 2HMID 3FQTB 4D94A 1U8OA 2AJUL 5T3ZD 4P46C 3RU8H 5TF0A 5KOMC 2I07B 2DM4A 4MX7A 4JKWA 3JVGA 3D39B 5GJSH 3H8NA 3VRJA 5DJZB 4TTDC 4P2QB 4OCLC 5C0ND 1P5UA 3QHFL 5I17A 4HS8H 1NC4B 5EZJA 1DQLL 1GXEA 5MERB 5E5UB 5FHAH 3H3PH 4AY0A 2CJUL 2F53E 3MRJA 1RAMA 5HYSB 2A2QT 3VGAC 1EVUA 4JY5L 2FWOA 4BH8A 3KLDA 4ZODA 1NBYB 1CFQB 1T89C 2ZCLL 3TVMA 1G7QB 1INQA 3KPSB 4Y5XA 3D25A 3NCYS 2WBKA 5LGKA 4YUEH 1MCLA 1U8OB 1X4YA 3CXDH 4G8EB 3VCLA 3P11H 5I8EA 4NQUA 2HRPH 3ORJA 4YNYB 4CKVX 1HDMA 3T0DA 3N9GL 1MFDL 3VRJB 4FQCH 3RY4A 3G5XA 2BDNH 5I17B 4YHZH 3BKMH 2D7TL 1WBXA 1OTTC 4KKAC 2H26B 3QG7H 2FJHA 4N68A 3U0WL 1MUJA 4YBQC 3QULB 3NACL 4MJ2A 5DEFA 1NMAL 5JW4M 3HAEH 5C0BE 1NCDH 3MRJB 3FQRA 3IVKA 4V1DD 1ZXQA 3ZE0F 1GIGH 3FONA 5CJXC 1KPVA 3C08H 4RBPH 1KN2H 2FWOB 4BH8B 4KI5F 2WP3T 4KZDH 3WL9A 1FSKB 5IB3A 2JJWA 1INQB 4Y5XB 4PUBL 5GHWH 1WFOA 4FRWA 1XCQA 3TN0D 1D9KD 1I1AD 2DQUL 4JM2D 4J3WA 4XHJC 3VCLB 1KCUL 4XPTH 4ERSL 5I8EB 1HDMB 2M1KA 2V9TA 4AQOA 4RISH 4TSCL 2F5BL 3VXMA 3G5XB 5A16A 4PIRF 1OP3K 2FR4A 2Z31D 4POZD 5DMIH 4KK8C 1WBXB 2FJHB 5FGSA 3A6OA 2A1WL 3LKPA 4Y2DA 1MUJB 2R0WH 2VXUL 3AMLA 3A6BL 5I19L 2CKBL 5DEFB 4N8VA 2PTVA 3FQRB 5FO7A 2GHWB 4L4TA 4OIBA 5LWYL 3IVKB 1OHQA 3FONB 1U3ZA 1KPVB 4YX2H 4MDIA 3V7MA 4WFFE 4OUUA 4R0LC 1JGUH 1JGVL 5DJCA 3SDCC 3WL9B 5IB3B 3MREB 3MRBB 1UB6A 3MRFA 2XTJB 2XWJA 4OQTH 5CJ8A 1XCQB 3BEVA 3KPLA 4KWUA 4WWKC 3TO2A 2Q8BH 2H2PC 4ODTL 5JMOC 3WXWH 3PWJA 5AZ2H 5DK0A 2H3NB 3R8QA 3VFRB 3VXMB 4GW4A 1MREH 5TE7H 5I9QC 5FOBA 2FR4B 1ZOXA 4LCWD 2EDDA 1KN4H 5D1QC 3W9DA 4M3KB 1U8KA 3QUXD 5EPMB 3LKPB 4Y2DB 5ITFA 4RGNB 4CN6A 1A1NA 1HNFA 5A2IH 3O9WA 1JI2A 1AC6A 5FO7B 4L4TB 5IHZA 3VE0B 4MDIB 5GJTH 1QR4A 1K8IB 4GAJL 2HT2D 4XXCA 1A02N 1T6WA 5DJCB 5I74B 3WBDA 4BSWA 2QSQA 1FG2A 3ULUH 1UB6B 1NKOA 1E4XI 4N8PA 2F74A 2VNCA 1QSED 1EDQA 2A9NL 2XWJB 3U30C 3BEVB 3RY6C 3KPLB 2NPLX 4L8BB 3TO2B 1YEGH 2WUBL 5I8KH 5DD3H 1JHLL 5DK0B 4J7RA 3GBMH 4M3JA 2A77H 5TQ0H 3G6JF 3MLVH 5DGRA 5FOBB 1EJOH 2B2XL 3BQUD 3V95A 3W9DB 1QRND 2X9WA 3M45A 5KS9F 1U8KB 3L5IA 2JTDA 5CEZH 4M43H 4NKOB 1A1NB 3O9WB 1OD7A 2N7AA 1MLBA 2Q3AA 5FV1L 2X09A 3SEPA 3D87B 1OTUD 3MRNA 4N0CD 1HWHB 4APQA 4PLOB 3T2OA 1VENA 5D7JC 3WKMH 4WFEE 5SWQA 2LU7A 1M1SA 3KYMA 4BSWB 1FAKT 1FG2B 3EJZC 4DAGH 4LCYB 2F74B 2H2SC 3KPMA 4GRWF 5T3XL 5BW7A 1IC1A 3FAWA 3BAEL 1BD2D 4PJBE 5DUML 3WMSA 2YK1H 3IS0X 5E2TL 5KZCD 4R26H 1MF2L 3EBAA 2F54E 3MFFA 5DD6A 4JQVA 3WNPA 4KROC 3GJFK 4U1NA 3SCMB 3HI6L 1RFDL 1RURL 1TDQA 4OLXH 1P4LA 2VAJA 4UILH 1NBVL 1DBAH 1SY6L 5C0FA 4LP4A 4ZOEA 1MLBB 3VH8G 3WUWG 2YD1A 1YUHA 2APFA 3VFNA 3MRNB 4P23C 4APQB 1ZLSL 3NIGE 5SWQB 2ORBH 1MI5A 4M48L 3I3EA 4PJIE 5ADOH 4MSWB 5TDOA 2XN9D 4HHAA 3KPMB 2VDMH 3ARZA 5GS2D 4PD4J 3UZEA 4JRYE 3QIBD 2DBLH 1NCBH 4JANB 4DN3L 3MUGA 1N0XL 3O2VL 2V2WA 5CBEA 5GXBB 1MEXL 3ARRA 4P49A 4XCCL 5DD6B 5DJXA 4F2MA 2NQCA 2Z8RA 3HAEA 4LLUA 2VDRL 2QADD 1UKSA 5C0AE 1QFWI 3HZKA 3T0EE 4KQ3H 1P4LB 5IMMA 3KJ4B 4PJ7F 5HHOD 4IS6A 2D7MA 5C0FB 3FTGA 4J6RL 4Z95H 1L0QA 1JPGA 1BAFL 3AGVA 3QPXH 1YUHB 4YHIA 3VFNB 4UTAH 3H42H 4R96A 5SWSD 4Z7NF 3QCUL 2W9DH 1H3PH 1QSVA 5DI8A 2CDGB 1MI5B 3V7AE 1XGTA 1VEMA 2VB5A 4HPYL 5TDOB 2BSRB 3D85A 4JCMA 3QIUA 2NY0B 1FNFA 1A3LH 2CLZA 1HQ4A 4R4FL 1WITA 3MUGB 5T3XD 2V2WB 5CBEB 2ATPA 3W0WB 4JFFE 3TBVA 1JRHH 1QSZA 1U8PB 5DJXB 4UIMA 1NEUA 3G9AB 3HAEB 4M1CD 4M9PA 4LLUB 1FGNL 4AQ1B 3K7UA 3HZKB 2PR4H 4M7KL 4AK1A 3UJTL 5IMMB 2ZUXA 2EH7L 5DRZB 4OV5A 1A4KA 1C7SA 4IS6B 3FTGB 4R2GB 5BCAA 1JPGB 5FYJE 5C07D 1MCOH 4Q9QH 1LD9B 2DL9A 5SV4A 4BZYA 4OQTA 3TZVA 1LO3H 3E6HA 4YHIB 5D72L 4R96B 2X70A 3PQYE 5DI8B 1FQ9C 2EDNA 3B3IA 4JFDE 1XGTB 4G8GE 3D85B 4U1IA 4AIOA 2CLZB 4ZFOL 2QSCL 3HB3D 4JVUA 4JRXE 5BRZA 1YQVL 5DC9B 4YDLC 3LPGA 2ATPB 3TH3T 2AVGA 1RPQA 4UIMB 4QWWD 5IESL 3BIBX 2OI9B 3EAKA 4CN4A 3MV7E 2DQFA 2WQ8A 4MDJA 3PWPD 1A6VH 1O7SA 2HT3C 1F00I 3G6AA 3PV7A 4UU9A 5JMRA 4X6CA 3JSSA 2P46B 2V7HB 4OV5B 1A4KB 1XMWA 4U7KA 5C70A 2DICA 4PJFA 3IKCA 2CH8A 1RIVH 1I8IA 1MRCH 3DNKA 4MVBD 3TZVB 2VERN 3E6HB 3C60C 3B2UC 3ZYIA 1BJ1H 3X13A 5IT2H 2X70B 2W0LA 4JQIL 1CE1H 4WV1A 4HJJL 4WRLA 3WFCH 4OCYL 3B3IB 1SJVA 3KWWA 5GZND 4AM0B 5E08H 1IZJA 1UJTA 2NYYD 1PJ9A 5EA0L 4U1IB 4NNPH 4X9GA 1SM3H 5BRZB 4XI5C 4KDVA 1DQJA 1C16A 4LRNH 1N64H 2GFBB 2IANE 5CJQL 4RIRA 2DQFB 3EGSB 4ZS6C 1IKFL 2A9MH 2VSCA 4MDJB 1T7ZA 4LCCA 4PRIE 5BVJA 3IAPA 3G6AB 4UU9B 5GS1A 3PHOB 4X6CB 1ZSDB 2VN7A 3QNXA 4NNYA 5HVFB 3W81A 1I7UA 3PDGA 1E4WH 3EO9L 4G6AC 4PJFB 4RFNC 4M7LT 1AXSA 3MYJA 4J3OC 3R4DA 4MMZC 4MQTB 3BT2L 5L9DL 4HG4J 4A2LA 2NY4B 1F11A 4G43A 4QCIA 3WDJA 1YN7B 4WV1B 5HGAA 2O5ZH 4JB9H 3VI4E 3KWWB 1PG7X 3EYQD 5EIIA 1B2WL 5TF1H 4ENEC 4GRWH 4FQQB 4WI4A 3QUZD 2WUCH 2ZZUT 3DX8A 1U6AL 2FX8L 4FXKA 4HCRL 1DQJB 1WZ1H 4HS3B 4XPAL 4DKEL 4CL7A 1Q94A 3NTCH 1KBGL 2OL3A 4OTXL 3FFDA 4RIRB 3S34H 4K3DL 2X44D 5KVDL 1QA9A 4LCCB 3UROR 2IQ9H 3DTXA 2OTPA 5BVJB 2HKFL 5DJYA 1R24A 1D5IH 5GS1B 4H26B 4YBLC 4YLQT 4EI5C 3O45A 1F90L 1JTOA 1T80A 1YDPA 1U9KA 2OMBA 3MOBH 3IDUA 1AXSB 3MYJB 1GC1C 1I9JL 2MOVA 2XKNA 4C57C 1U3HD 5E2VH 4QCIB 4XC3L 2AJ3B 4D0CA 5T33H 1TJHH 2DQDH 5HGAB 1BPVA 1BZ7A 2BRQA 1A8JH 1NANI 3RVTC 2H6PB 5IB5A 5MHSE 3U46A 2MKWA 1G6VK 4FXKB 2VISA 5I1EL 1F4AA 2ZUQC 3O6LL 1VFMA 3FFDB 1KULA 1QA9B 1EUTA 3WFZA 5DJYB 5CLWA 1R24B 3IYLW 3WHXB 4HH9A 3TCXA 3ARFD 1EHLL 4QHUA 4HWZB 3O45B 1WIUA 4OGYH 3CXHK 1BGXH 3VFTA 3WDHA 1BVKA 2XKUA 4KY1L 4JREC 5BO1H 4D0CB 1JGEB 3KDMA 1HHGA 2VH5L 3HNVL 1A6UL 3C6SA 1A6TB 4JPKH 1BFTA 1KENL 4YK4C 5FYJL 3RTQD 4ZO7A 1RZJL 5FCUH 4G5ZL 4KHTH 3QRGL 4AL8L 3U46B 2LAGB 3W5MA 4CJ1A 3HMWL 5K59F 4NDMB 2VISB 2NY2C 4KTEL 3IJSA 4U2ZA 3BN9C 1BFVL 3UAJC 1YPZE 4NOFA 5DRWB 1J5OL 4P2OA 5EO1A 1Z9LA 4FMFA 3DGGA 4JHWH 5IOPA 3BPLC 2C4FT 3GKWH 4HH9B 3FRPG 4UIKL 1BJ1J 2J4WH 4QHUB 5J57B 1UYWH 3SOBH 5IJKC 1FIGH 2XI9A 4OGZA 4YGAB 2EC8A 1BVKB 1VGEH 4RMTA 3ZKNC 2DYPA 5HHMB 3LPFA 4L9LA 2ICWJ 5BQ7B 2DLIA 3KDMB 1TETL 1HHGB 4WEBL 4ONHA 1UZ6E 3C6SB 4G9DB 5D7LD 4OLYL 4WO4C 4TUKL 4Z7WF 4DVRH 3L3HA 4L1HA 4R4BB 4Z0BL 3K3QA 3R1GH 4OM1L 3IJSB 1QOKA 4PJGF 5CD5D 1D5MA 3HG1E 3K80A 2HT4D 5EO1B 2W38A 1IFHH 3EYOA 3NAAL 4JKKA 4XPHH 4ALAL 3QRFM 3DGGB 1KB9J 1IGYA 1V3JA 4HXAH 4PTUA 5E99L 3QXDA 4EEEA 4F57H 3DSFL 5D1ZC 1MJ7H 4WU7A 1FZMB 3WNMA 2P47B 3QUYA 3MV8A 4U6YA 1Q72L 2H32H 4OF6A 3RP1A 4NQDA 3IETA 5EBGA 2ICWA 4TULH 3MJ6A 1UM5H 4GMSH 3ZDZF 2DLFL 4Q9RL 1WWWX 1HSAA 4L9LB 3RX8A 4ONHB 4DVBA 3FO1A 3G6JA 4QXUL 3MRQA 5EDXA 3CD4A 5JHLL 2UVEA 3L3HB 5KS9A 1KNOA 4NP4H 3IU4H 3Q6GL 3T0EC 1D5MB 2OTWA 4R8WL 2CO7B 1JNLH 4ZOBA 2PW1A 4Q9BA 3EYOB 1QLEL 4OGAD 1IGYB 1I8KA 2XT1B 3AM8A 4MWFB 1FL3A 4UNVA 1GOFA 5D1XD 1LO0H 3QXDB 2WNGA 1DQDH 4WU7B 5HHVH 4PYHA 4I3RL 3QUYB 2PW2A 4U6YB 1J1XL 3RWGA 4DW2L 4NQDB 3CGTA 3IETB 2ICWB 4H88L 1HSAB 3GIVA 1S7TA 4XVJL 4DVBB 2EDEA 3P4OA 3I50L 4TNVK 1G9MH 3FO1B 3HNSL 1CG9A 3MRQB 5KG9A 1FAIL 1IGIH 4CVWA 1C5CH 4LSPH 1KNOB 4XVTH 3UYPA 2NX5B 5LGHL 2OJEA 5ID0A 3MA7A 5AG9A 1EFXD 4Y19A 4DUWA 1HILA 1FH5L 2DD8L 3EYVA 2PW1B 2XTJE 1K2DA 1E4XL 1I8KB 2YXMA 5H2BA 1FL3B 5IP4A 5LQBL 1EO8L 1OAYH 3QCVH 3NVQA 5FYJU 4CAGA 3LS5L 1NBZA 2PW2B 4GRWB 1IM3A 5F9OL 5ICYA 4LHUD 3LN4A 3RWGB 4IRZL 2R2HA 3RI5F 4K3EL 4WFHD 4XWGL 3RWEA 3GIVB 1S7TB 3EO1A 3MNWA 3UZQA 3JWDH 3P4OB 3W11C 3BE1H 1CG9B 2ILLA 5F1IA 1HSBA 4L4VD 1CFBA 1CLOH 5KG9B 1NUDA 3UTOA 5CMAA 1TNNA 5ISZE 5K33A 4PJ7A 1TVDA 1YJDH 2FGWH 4WHCA 4WW2C 1OP3H 2PXYC 3UJIL 2OJEB 5ID0B 3MA7B 2MPAH 5HI4C 3QQ3A 2FX9L 4Y19B 3NOIA 1HILB 3U7WL 2ESVA 3EYVB 1WCBA 1BREA 1NCWH 2PETA 2YZ8A 1E0OB 1ZT1B 1RZKC 1KGCD 1K2DB 1PEWA 4DZ8B 4U49A 3EOTL 5I1GL 3RNKA 3D2UA 4HXBL 5JA8B 5IW3A 3I3DA 4FS0A 1DQTA 3IJYA 4LSVH 1MHCA 4P9HL 3GM8A 1NBZB 1IM3B 4PS4L 4ACPA 3LN4B 1MCPH 1Q1JH 3ARDC 5MP6H 4H8WH 2R2HB 4JR9H 3ALPA 2PCPA 4ZAKA 3PWNB 2XQYG 4FTVE 4NFDA 2FB4L 3RWEB 1T6VN 3EO1B 3IDIA 1YEIL 3MNWB 5DLML 2XZAL 2RCSL 1XR9A 3BN3B 3DUSA 5F1IB 1HSBB 1MH5A 3WJJC 4PGBA 3QXTA 5CMAB 2A0LD 3GSNA 4PJ7B 3WFEH 3C6LD 3IB4A 4N8VG 3PXJA 4LARH 5K9QG 3SBWA 1E4KC 3QQ3B 1EX0A 3KAAA 1MRDL 4NO0D 2ESVB 4W70A 5CKGA 1WCBB 2VDQH 1S7WB 2KKQA 1G1YA 1JPST 4HMEA 1NLBH 1A3RL 1I3RA 2VLKA 5IBUB 3RNKB 3D2UB 3BI9X 5AWNH 4NQVA 4TSAL 5CJBA 4RMWA 3IJYB 1MHCB 3FZUC 4WHYG 1A7RH 2EYRA 3S88H 2X2YA 3VDAA 1PW3A 1BHGA 5JDSB 3IFLL 1R5IB 3OV6A 3NA4A 1A7PH 4K7PL 1HHHA 4MAUH 5I16A 1V7ML 1OY3B 1X44A 2KZ1B 2PCPB 4ZAKB 1K4DA 3NFPA 1I9IH 3IDIB 4J1UA 1U58A 1S9WA 2R1YA 3B5HA 4M93C 4HULB 2JJSC 3DUSB 1J10A 3SPVA 1MH5B 2IG2L 3OKOA 5D2LF 4PJXF 5HYJE 4PGBB 3SDXE 1DP0A 3WNOA 4G7VH 3ILPA 3KYOA 4YBHA 1GJIA 1T4KA 4CNIA 3S9DB 2B5IB 4KRPB 2PO6D 4YC2C 5IHUL 2H9GA 4NPYA 2H32A 4U6TA 4KMLB 4U0RB 5TPWL 4XAWH 4CN1A 5I1IH 1I3RB 1J0HA 2VLKB 2XQBL 1BQLL 4PTTB 4XMPH 2CGRH 2CLRA 2EYRB 3O6FC 3MRGB 2RB8A 3LKRA 1WK0A 1DUZA 4MAYA 3KPNA 2HLAB 3MCLH 4FG6D 3LH2H 1GZPA 4J23A 5LGJA 1GAFH 1HHHB 4JDTL 5I16B 1AGCA 5JW4Q 2DQCL 4MS8C 4QY8A 2FRGP 1K4DB 1NUFA 3NFPB 4N5ED 1OAXH 4J1UB 5JXEC 1U58B 1OL0A 1S9WB 2R1YB 3D9AH 3QI9D 4YAQA 1T7WA 3PUCA 4PLKD 3EW3B 1DEEA 4ZSOB 3SPVB 3B9KA 5ITBL 3OKOB 3EJYD 2BERA 3GJFH 3LKQA 5F3HA 1HIML 4YFLI 2LABA 1ZT7A 3ILPB 3V79C 3KYOB 5HGBA 2IH1A 4CNIB 1MI5E 1D3CA 2YN5A 2H9GB 4NPYB 3QDGD 3DRTA 1I7RA 3V4VL 2H32B 3FAXA 1OPGH 3L1OH 4GG6F 1MIMH 5A2JH 3CVIL 5HVGB 2GJ6A 4QRRD 1H15A 4I8DA 3P9LA 2CLRB 4LGRB 3VU2A 2X4QB 1LK2A 3OAUH 3LKRB 1M05B 1TVBA 2VUOA 1DUZB 3O0RH 4MAYB 3KPNB 4GMTL 4EDWH 1G6RL 1G7HA 5LGJB 1GZPB 2DTMH 5GRJL 5AYUH 1JF5A 1QHPA 5J11B 4KK6D 1AGCB 4QY8B 2MSPA 5JUEH 4CU8A 4YHOL 4GLRI 4JGUA 5CWSA 3SDAA 1GPOL 3DV6B 4WEUD 5D7SH 1KELH 1YNKL 4HIEA 2QTEA 4YAQB 3NCBB 2AV1A 4WENB 1MCQA 3B9KB 2P5WA 4NFBA 4NKDA 3LKQB 5F3HB 5I1JH 5IQ9A 2QQNH 4Z7UF 3AC0A 1JPFA 1UWXK 2BNRE 4KH2A 4PREB 1ZT7B 3ZTNH 3BPOC 1CBVH 5HGBB 2IH1B 3DVIA 4PY7A 3QWQB 5BV7C 5EUKA 2H41A 3DRTB 1I7RB 5I75B 3DSNA 4HZLA 4IRJD 4OFIA 2R0LH 3JWOL 2GJ6B 4PV9A 4W6WB 1OGTA 1H15B 4LPTA 1KIQB 1YEFL 1LK2B 3MLWL 5GRUH 2NY6C 1RK0A 1TVBB 3F62A 1G7HB 4U3CA 2VDLL 1T1WB 4KK5D 3DRQA 1AGFA 3QIWC 3QZWA 1MHHA 3CFKB 3BKJH 5DJ8A 3HAEG 1T22A 4EZMA 5CWSB 3QXWA 2XWBA 3SDAB 3RFZC 1DE4A 3HC0A 4HIEB 1AO7D 1OCWL 5EOQH 2K3TA 3RDTD 2AV1B 2EXWD 4NYLA 1L9MA 2P5WB 3BSZL 3KXFA 3IDNA 4GW1A 4NKDB 2VKWA 5DVLA 2RBLA 3SDYH 5IQ9B 3CFIC 4I3GA 4ZXBA 1JPFB 5C0DA 3O81A 1GGIH 2AXFB 4B7IA 4PY7B 4KRLB 4N90E 1IZKA 1YMMA 3X14A 3K74B 1RULL 5EUKB 2P8LA 3JVGC 1I85A 4HZLB 2JK5A 4PV9B 3BP7B 4OZHF 1OGTB 1UZ8A 2ZKHL 4QRQA 5C9JB 3QEQA 2FEEI 1RK0B 3S98A 2BMKA 4YHKL 3WV0A 4U1LA 1IQDA 4I0KA 5CINH 3DRQB 1AGFB 3QZWB 1MHHB 1FIEA 4LLAA 4O5LH 5EBWA 5DJ8B 1T22B 2X1PA 4DN4L 3W9EB 2XWBB 5FFLA 3HC0B 1AC0A 3HTLX 1TQCB 4CMMA 1WSST 3PP4H 4JG0L 4NYLB 2P1YA 5IQ7H 1MAML 1SJEA 1KLFA 3KXFB 4ODVL 3QP3A 3TVMC 3IDNB 4GW1B 3T1WA 3BRFA 3PJSA 1QO3A 1CGWA 3V2AR 5C7XH 2HFEA 4ZXBB 4GRMA 5C0DB 4PB0H 4OCSL 4X7SL 1MQKL 1XGYL 4JHAH 3GMLA 1YMMB 3X14B 3LRSA 1INEL 1RZ7L 4JHBA 2P8LB 4XGZA 1RK1A 3HCVA 4KPHH 4D9LL 2JK5B 1C1EL 2J8UF 2X5PA 3GI8L 4I9WD 2I60H 3NZHH 1LP9B 1OVZA 4NGHH 3BJ91 4QRQB 5EOTA 3QEQB 4HK3N 4M4RA 4TVPH 2HVJA 5IVZA 2BMKB 2FBJH 3B2VH 3D18B 3QYCA 4S0TD 1IQDB 4U1LB 4Z7WA 5EU6A 4GS7C 3QXVA 1QBLL 2XY2A 4X4ZA 3QAZB 4OFPA 5EBWB 2PYED 4EN3A 4UB0L 2L0DA 3ALWA 4PJGA 4WWKD 2GQHA 3MUZ1 5I66A 1W8NA 5D71L 3KPRA 3U4EA 2H1PH 5DTFA 3PJSB 1QO3B 3IRPX 4IMKA 4MNGA 2IGFL 5DVOA 2XTJC 2HFEB 5DJAA 1HYSD 4GRMB 1KIUA 2BVOA 4OCNC 3C5ZD 5D1QD 1ZEAL 4PJ5E 3VXUA 5IMOB 3GMLB 1XAUA 4JFPA 5I18L 5GIRA 3LRSB 1SVCP 4XGZB 1RK1B 1H5BB 3MJ9L 5IUSA 1RUQH 2V7NA 3HCVB 4KXZI 5H8DA 4CMHB 2GUOA 1R3JB 4U1MA 1OLLA 3L3JA 5FXCH 5KANG 5EOTB 1UA6H 2E9JA 1QQDA 3KJ6L 1D5BA 4HGMA 2AEWA 4Y2DC 3P40A 2B7DT 3BW9A 5GGQH 5EU6B 4Z7WB 1S7UA 1YY8A 3MNZA 1E6JL 4TNVF 4JFYA 5DD0L 1EH9A 2WBJD 4KV5F 2EDHA 4EN3B 3JWOC 4JKPH 3TLRA 4WUKH 1N59A 3UTTA 2IBGA 4R7DB 2FATL 4XZUA 5I66B 4G6FB 2C7UA 2DOCA 4F7PA 3KPRB 3U4EB 5L8KB 5DTFB 4AG4L 1J1PL 3U79A 4URTB 4EXPX 2D2OA 4MNGB 3LEVH 3LCYA 5DJAB 1BF2A 4XVSL 1VACA 2FEDD 3TGXA 3CSYA 2EYTA 1GGUA 3VXUB 1T03H 1JN6A 2BSTB 5GIRB 3TPKA 2QQLL 1GGBH 5F9AC 5SWZE 2YPVH 2X4PA 3SQOL 2V7NB 3MLZH 3BGAA 4LMQI 1U92A 3FT2A 4GKZA 5D7IF 1IRAY 5FM8A 4HWEH 3VFGL 2GUOB 4U1MB 3RHWF 3L3JB 1VERA 1NCAL 4UDTB 4BFEA 3BO8A 4K3GA 3SGKA 1QQDB 1D5BB 5CUSL 5D7JD 5E4EC 2VZ1A 3BW9B 3ZE0E 2PKDA 4W6YB 1YY8B 4PLNC 1FBIL 3GJFB 3MNZB 4JFYB 1ODAA 4KI5E 1N59B 3UTTB 5LKNA 4XBEL 1CZ8H 4GXUM 1QKZH 1J8HA 1PQZA 2C7UB 4F7PB 1GGTA 3VMNA 1HXYA 1MCIA 2YUXA 4LSTL 4XXCC 2ARJA 2AABL 5IHLB 3G5VA 1TCRA 4QHNA 4U6HB 3OF6D 1RUML 1NFDB 1KXVC 1VACB 1W0VA 2X4RA 4JFEA 3CSYB 2EYTB 4XP1L 1CIDA 2VQTA 4UAOC 2B1HH 4UTBH 1JN6B 3ZZ1A 2XZCH 4M5YL 2IBZY 4LCIH 2X4PB 4O9HL 3MLYL 3FT2B 4GKZB 2LAAA 4KVCL 1IMHC 5HJ3A 3T77A 1IGTA 2BC4B 2DRUA 2HKHH 5F88A 3BO8B 1K9TA 3EFDL 5IMLB 3E2HB 1A9EA 2GJZA 2XY1A 2NY5C 4JZNA 2YPLD 2GAZA 1Q0XH 4KRMB 1WTLA 3LSOA 3RWFA 4I4WA 2J88L 1TTUA 4JPIB 4P2RE 1MAJA 1TMCB 5IG7A 3V0WL 3OR7A 3WIHL 1KB5L 4QRPA 1UM6H 1J8HB 1PQZB 4OIIL 3FFCA 1HXYB 2PN5A 3IXAB 3N85H 1EFQA 1RUPL 4PRHD 3ULVF 2WK2A 3G5VB 4QHNB 4LSRL 3NCCB 5SX4I 2LQRA 5BW7C 1CICC 4LIQH 4TQEL 4M6MH 1DBKH 2X4RB 4JFEB 3A6CL 2C9AA 5C08D 2KPNA 5GRXG 5C86A 5DVMA 2AW2A 4JQVC 2R0KH 3VRIA 2AJYH 2E7LA 3OG6B 4GRLC 5FHBH 5HJ3B 1U41A 1WZLA 4HS6B 3T77B 5F88B 5T1MA 4AJ0A 3KJ4C 1A9EB 4M7ZC 2GJZB 4JZNB 4OJFH 2GAZB 2Y36L 2DWEB 3LSOB 3RWFB 4I4WB 8CGTA 4JY4A 1P4IL 1F58H 1RVFH 1DBMH 4IHOA 5IG7B 3OR7B 2XIDA 4FFVD 1AXTH 3NPZB 3O2WH 4QRPB 1H0DA 2CUIA 1X5FA 3STLA 1I3VA 3DI3B 1BX2A 3MV8E 2B4CH 2C4XA 4LNRA 4AYFA 3Q6FA 1CDGA 2DQEL 4QHMB 1UKTA 4JO3L 1J0IA 1U8JA 3PWLA 4X9BA 5E95B 5JW3L 4GXVL 4PB9H 4MXWH 3SJVA 1AY1L 3VFSB 2W9EH 3GO1L 5DEZA 5C0EA 4X4XA 3G6JE 4ESKA 1IL1B 1LDSA 5GRWA 2SEBA 2Q3ZA 3VRIB 1FNEA 4ODBD 1N7MH 2IFFL 4P57A 5KS9E 3UPRA 1ZGLP 5ALCL 2GJJA 1NEZB 1X9QA 3MBEA 5T1MB 5B3JF 1QFUL 4DGVL 3MLRL 1AQKH 1G0YR 1Z0NA 2QHLA 4A6YL 3UDWA 2W59A 5D2LA 4PJXA 3ZE1E 1D6VH 3QDME 5E7BA 4JY4B 2BJML 3J7HA 1AGDA 4IHOB 4F3FB 4P5TA 5KW9H 1PLGH 1H0DB 3STLB 4M02A 4LVEA 1BX2B 1AIFA 32C2B 4OZGE 2GITA 4LNRB 3ZL4H 1DVFD 5J0BA 3Q6FB 4LLVA 1KOAA 5GGUA 4AEEA 3PE9A 2YD2A 1JNJA 3PWLB 2P48B 3QIUC 4XTRD 4KJQC 3QUKA 4OF3A 1AE6H 3SJVB 4W4OA 2E6PA 2IC2A 4X4XB 1U8MB 2VLJA 2VXTL 2BHZA 2SEBB 1CK0H 2WLZA 1FNEB 4P57B 3UPRB 4G8FA 1ZS8B 4JN2A 3C60D 3MBEB 4PJ8A 4Z0XA 1DEDA 2AJXL 3LKSA 1OARL 4CADA 5D2LB 4I1NB 7CGTA 3QJFA 1FORH 3ET9F 5GSVB 4P2YA 5TJWK 1AGDB 2OR8A 3TZVC 3DYMA 4P5TB 1I3GL 2KDGA 3GFUA 4HT1L 5IFHL 5DWUL 2XXCB 3K1KC 4LLVB 4GG6A 5GGUB 2NTSP 4ZS6D 1MFBL 4NM8H 5JHDE 1IT9L 3CXHJ 3RVVD 3QUKB 4P4KD 1BEYH 1EGJA 3QCTL 4LDOB 4GBXA 2BCKA 2VLJB 5DMGC 2NY7H 1NCCH 4GAGH 3WHE1 4G8FB 2EDWA 4HMDA 4PJ7E 4MD4A 4JN2B 5I71C 4Z0XB 3Q1SH 4UT6L 5B39G 5FUZL 3LKSB 2ADIA 4LVNB 1UJ3C 4CADB 1J18A 4J3UA 2V17H 5AUMA 1JUFA 1IARB 4HUUA 3ULUC 3MXWH 3B9EA 3WSQH 2E27H 4Z7UA 3WO3B 4HUNB 1TITA 2MCG1 5L2KD 2NY4C 5BMFL 3H9ZA 3LN5A 5F6HJ 3GK8H 3X11B 1IAIH 4WV1C 25C8H 1WV7T 2ZSVA 4BQ9A 3BRGC 3HPJA 2P43B 4GG6B 1A7NH 3RGVD 2HRLA 2G9HA 2P5ED 4X4ME 3K8MA 4OFYD 1CGSH 3UTSA 4EI5D 4QOKE 5J13B 4GBXB 2BCKB 4G9FB 4ZTPL 3GHBL 3ESVF 3UP1A 1WQVT 5KVFL 4FNLH 1LO5B 1KCRL 4LCCC 4MD4B 2VQUA 2JB6A 5I15L 2YPKA 3BVNA 2E9WA 1JYXA 3GBNH 3ARSA 2ADIB 2V5YA 4N0FA 2YXFA 1UM4H 2PF6A 4MLSA 5AUMB 1JUFB 4KC3B 3RZCD 4Z7QE 4HUUB 4QTIL 3T0VA 1B88A 2DIJA 3S35H 1S5HA 1TJIH 2QHRH 5EG6C 3LN5B 5EOCH 5IBUG 5E9DA 1V7NH 3CK0L 4DGYH 2Y4SA 2AJSH 3HPJB 3ULVH 1XIWD 3RGHA 1AI1L 3V6FA 3G5YA 2G9HB 4OZHA 2AJUH 4C55A 5EULV 4D0DA 2Z4QA 5HI5C 3BZEA 4NN5C 3UTSB 2D0FA 4E41D 2D31A 5CJ5A 3P9MA 1VPOL 4KUCD 4UV7L 1GGCL 3D3VD 4LLYA 3KPTA 5IW1B 2A6JB 2YPKB 3BVNB 2V9QA 3WLBA 1ADQL 1YEEL 1I4FA 2UWEF 2R1XA 1K3IA 2YD8A 1EEYA 2YD9A 1U2HA 1G7MB 5IR1A 5BS0B 1YA5A 5C09D 4WVRA 2BVTA 4ZFZA 1S5HB 4NQEA 3IDXH 1WWBX 4LVHC 1HOCA 4AEFA 3TA3A 2R15A 5E9DB 2ERJB 1D6EA 3QO1A 2J8UA 1MJ8L 3G5YB 4HWUA 1S7QA 2ZUWA 4OZHB 3INUH 3V6FB 1FLRL 3S3PA 1AR1D 2YD3A 4D0DB 2Z4QB 3BZEB 3N9GH 1MFDH 4RX4D 1U8HA 4NT6B 3BD4A 5J89A 3AREC 4XCFL 1HH9A 5KSAD 3P9MB 2D7TH 3QDJB 4P46A 3DI2B 2R29L 5F9WB 4I48A 4Y16A 3ZKND 2AK4B 3U0WH 3WLBB 2EH8H 1KJ2L 4KI5C 1KTDA 3NACH 2R1XB 1NMAH 1EEYB 2GTZA 2BZDA 2F54D 2GJ6E 4ZFZB 2M26A 4NQEB 1ACYL 4EKXA 3LZFH 5I73B 3CUPA 3TA3B 1J88A 3QEHA 1Q9KA 4Y1AD 2FEEL 4PUBH 3ZT7A 1RQ5A 3QO1B 1J0ZA 1S7QB 4U33A 3P4NA 1T89A 2DQUH 1KCUH 2AQ1A 4ERSH 1T5WA 1U8HB 4HPOL 4TSCH 1L9NA 5C0RH 1JGDA 4FQXD 1FFNA 2Y5EA 2P5WE 1N6QH 5C0CA 3DX7A 4P46B 4P2OC 4QRUA 1WC7B 5E00A 2R9HC 4I48B 4Y16B 1WISA 2ADFL 2I26N 2VXUH 3A6BH 3WO4C 1AKJD 2G5RA 1KTDB 2CKBH 3VW3H 4M7JL 3DLQR 2WV3A 1QVOB 4X6BA 2GTZB 4OI7A 1MFEL 2C3XA 4LFHG 3HPLB 3AS3A 3RKDC 1YNTA 5I1AA 3X3FL 1DBJH 3ARGD 1BBDL 3MV9A 2Y06L 5HHXL 3CUPB 1JGVH 3QEHB 3VXRD 1Q9KB 4L9LC 5E0QA 1UWXH 2QQKL 2VXVL 3VGAB 5D7IA 4HJGA 4GAYA 1DQQA 2R23A 4WY7L 3GUTA 4H1LG 4YGVA 4OI8A 3QFJE 1T5WB 3UMTA 5I8CA 4YFEA 3NBNA 1JGDB 5JIHA 1FFNB 1SJXA 4G80A 5HI3C 5C0CB 3DX7B 4O51A 3TWCH 5FYLD 4TRPH 4QRUB 3NCYP 5E00B 3OKNA 3PIQA 3TJHD 2CDEA 5LXGH 4NO2B 1HXMA 1G7JA 4Z76B 4F58H 5A43C 1PSKL 5EOCJ 1WZMA 4X6BB 3C9NA 4OZIF 1T2QH 4QF1A 5JOEA 3BD3A 4OLEA 1A14L 3OKKA 1YNTB 5I1AB 2D4DA 4GAJH 5MEPA 3MV9B 5TH2A 4DGIL 5F7EL 3QEQE 4Z9KB 5AAMA 3RPIA 4NWUL 4UUJA 4GOSA 3GGWA 2QR0A 2A9NH 4HJGB 4GAYB 1DQQB 2R23B 3GUTB 4FZ8L 5FO8B 5K59E 1HZHL 4R0LA 4M62L 4HK0A 3SDCA 5ILTH 4U1SA 1JHLH 3O3AA 5I8CB 1P7QB 1JHKL 3RJDA 3HMXL 3VWJC 4M1GH 4G80B 4MJIA 2WWKT 1FFOA 1KFAL 4JFDD 1YYLH 5E2UL 5GS0C 1MJJA 4QHKI 2PUQT 4G8GD 3BDYH 3OKNB 1RZGA 3PIQB 4PJBF 3M1BA 1CXIA 1YN6A 1TZGL 2E7CA 1SEQL 2B0SL 4NUGL 3QEUA 3C9NB 4I0PD 3I9GL 4C59B 3V4UH 4QF1B 4ZPVA 3OKKB 2HFFA 4RAUA 2CRYA 5MEPB 3UO1L 5TH2B 3RPIB 4UUJB 3GGWB 5HI4D 3PDOA 1EMTL 2QR0B 1K5NA 3BAEH 3T3PF 1P4BH 5DUMH 3FQXA 4R0LB 5E2TH 4HK0B 3SDCB 1CCZA 4PJGE 2BP3A 3QDAA 1MF2H 3F5WA 5DD5L 4U1SB 2DLHA 3O3AB 2NXYC 1IC7H 4UZGA 3VA6A 2F5AL 1RFDH 1A6ZA 1KPRB 4MJIB 3NMEA 1FFOB 1TCMA 2VXSH 3WS6C 5LJYH 1MJJB 3A67H 3ARDD 3PGDA 4LSUH 4ELME 2CRMA 5TQ2H 1VFAA 1NBVH 3M1BB 1C12A 1YN6B 1I9RH 1OGAE 5JW4N 2EDBA 2Y9RT 5HDQL 1DSFH 1IGCH 1R3KA 3PL6D 3GHEL 1PX4A 4GJTB 2IAND 4ZPVB 3ZDZE 1LEKB 2HFFB 4RAUB 1PGRB 4ZUSB 1LHZA 1WEJL 2CK0L 8FABA 1KTLA 2ADGA 3HC3L 4KHXH 2Z9TA 3LN9A 5JXAL 4XMLL 3PDOB 1F4HA 2LTQC 1K5NB 5F1KC 3QUXA 4KMTL 2OSLA 6FABH 1KCSL 4DN3H 3T0BA 4XWOD 3FQXB 2XWTB 1N0XH 5K9JH 1BF8A 1I8LA 2R56L 3UTTE 2XQYK 3F5WB 3BPNC 4WGVB 3U4BL 4HF5L 1A6ZB 2BNUA 2VDRH 4J4PD 4JM4H 5L0QB 5GGTH 3ZKMC 4X5LA 4D9RE 1QSFE 4OD3H 5JO5B 4LLWA 4LEOB 3PGDB 1VFAB 4OLWH 2AJVL 1C12B 3F6IA 4MA8L 5E94A 2DQIL 1N2RA 4UBDC 1E6OL 2Q8AL 1UWGL 1R3KB 2ZSWA 1U8QA 2HLFD 4PP2B 3L7EA 3OAYK 5E7FA 8FABB 5CILL 3BP5A 5J9PA 1S3KH 1KTLB 3ZE2E 5I8OL 3ZSSA 4Y4HD 4FFWC 1T2JA 2DKSA 4HPYH 1QRNA 4ODSL 1EXUA 4ZTOH 2OR9L 3LQAC 5EORH 4X0KA 1EEQA 4JO1L 2OSLB 4P23A 3L7FA 3U36A 2CDFA 5ACZA 4PRBB 4K71B 4FZEL 2P45B 2CKBA 4Z8FL 3BZ4A 1TTFA 2VLRA 2B5IC 2BNUB 1FGNH 3BMWA 2CKNA 3LB6D 4KRPC 4LLWB 1OSPH 4M7KH 3UJTH 5HVHC 4U0RC 5IBLC 1CDCA 5EZOH 3HS0B 4KROB 4JFEE 4M6NH 2FECI 1V5JA 5CAYB 1N2RB 4Q0XL 5MI0C 2ZSWB 1U8QB 1YNLH 4F7TA 5D72H 2Y6SD 1AJ7L 2YKLL 4WW2F 3T0AA 1B4RA 1JCKA 5CHNA 5J9PB 4FFYH 1SYVA 3M8OL 2GSIB 1EXUB 4L9DA 4ETYA 4Y5VA 4PG9A 4X0KB 4P23B 1H3WM 1FN4B 3AAZA 4GKNA 5FDYA 3T4YA 5ACZB 2CDFB 2F58L 2CKBB 3V4PH 3FFCE 3HE6C 3BZ4B 1LILA 2VLRB 5B4MC 2PYFB 1BM3H 2C3HA 3JUYA 3TYFA 3RVXD 5IKCA 2FGZA 3JV4B 1GOGA 3U4AA 4QNPF 4LAQL 5E2WH 4YXHL 2X4NA 4OBRA 4WNQA 3QIBA 2EDRA 4J3VA 2IQAB 1X5JA 2EIZA 3UBXA 5CCKL 5ECJE 2Q6WA 1QPXA 1FNAA 3E8UL 3QWRD 1JNNL 4JQIH 5MENA 1R0AL 2D4FA 1JMZA 1D5XB 2ZUVA 5DO2D 1I1FA 3KNBB 1N5YH 1EAJA 5EU4A 3DXAB 2BY0A 4U3HA 5HHOA 4Y5VB 4PG9B 4LBEA 1KG0B 3L5WA 1L7IH 2C26A 3D39D 3UYRL 3QWOA 4P2QD 4GKNB 3T4YB 1NGWA 3QQNA 3FQNA 5CJQH 1NC4D 3SKUD 3VI4F 3QEGL 1YY9C 2DQHL 5SWSA 3TYFB 5JOFA 4NJAH 5IKCB 4PRPA 3N1QC 4UI2A 2UUDK 3IFNL 3KPQA 3W39A 4LASL 2FX7H 3SJVE 1CDYA 3D0LA 5FF6A 2X4NB 1OB1A 1ZHNB 4GKSA 4WNQB 2NXZC 3G5ZA 3UBXB 2EIZB 2Q6WB 2F53A 4D3CH 3O6ML 1RZFL 1ZTXL 4BQCA 3CJJA 2FO4A 2IJ0C 1FHGA 1FYHB 3KPSD 3S36H 3S7GA 5MENB 5DMKA 3IF1A 2WWMD 2D9CA 4F37K 4BQ8A 1I1FB 1QBMH 4L4JA 4XP6L 4PJXE 4X6FA 5HHOB 3DOSA 1GOHA 1QFHA 4LBEB 4GQ9H 2ICWI 3L5WB 4MJ6B 2EO1A 3ROLA 1UCTA 3P9WB 2FX8H 3QWOB 5C07A 5CJOH 1DANU 1NGWB 1LE5A 2UWEA 3FQNB 4DKEH 2X9XA 2NY3C 1KBGH 4BK5A 2PTTA 4K3DH 1F4YH 1IC5L 4Y7MA 5IK3A 5C71A 5JOFB 4QHLB 4PRPB 2QKIA 3VD5A 2F15A 1F8TL 2IPTH 5FYKE 3KPQB 3CCHA 2APTA 4H20H 3W39B 4LL9A 3ECBA 4JLRA 3D0LB 2APVA 5FF6B 1IQWL 1OB1B 4GKSB 4XNQB 3G5ZB 2E8YA 5EZLB 5C0BA 1I9JH 3JWDC 2F53B 3OJ2C 5FGBC 1OP9A 1H3VA 5EBMA 2FO4B 4XC3H 4EVNA 5DMKB 3IF1B 4OKVA 4RWYL 2AEPL 4X6FB 1TQCC 5JOPD 1JWMA 1DL7H 4XNUL 2AV7A 3OPZH 5FV2A 3UEZA 1NGPH 1JYNA 5I1EH 5IWLA 1LE5B 1UFUA 3ROOA 2UZIL 3FB8A 2PTTB 3TT3L 4Z78A 4ISVA 4O58L 2N7BA 4PJ9C 5IK3B 2Q87A 2QKIB 1NBQA 4ODXB 3ECBB 4JLRB 1BMGA 1C5BL 1JWUA 2MWCA 1KT2A 4PP1D 3IAQA 4NOBA 5IVXF 1YPZF 5E5MA 5ID1A 5C0BB 2EDOA 2C3WA 4NZTH 3RAJL 5D93C 3ZO0A 4RQQA 2X6MA 1RZIA 3AXLB 5EBMB 4EVNB 3FMGL 3ARWA 4OKVB 4JKMA 1FE8L 5F96H 2VH5H 1A6UH 2A73A 2BVPA 2EYSB 1NPUA 3K2UH 3LIZH 3FN0L 5FYJH 3G6DH 1KJ3H 4YHLL 4ZUTA 4B5EA 1JWMB 1RZJH 4G7YL 4G5ZH 4AL8H 4Z7UE 2AV7B 3HMWH 3VXMD 3QB7C 4OZ4A 4XP9L 4KTEH 4NQTA 5DHYB 3ZYOA 3VXNA 1RZ8A 3CMOL 4LEXH 1BFVH 3ROOB 3LQMA 3FB8B 2EE6A 2DJ4A 4Z78B 4ISVB 3DO3A 4Y2DD 2NY1C 3DUHA 4UINL 4RGND 5E8PB 4UIKH 4X6EA 4L4TD 5HDOA 4UV4H 4YDIL 1ZLWK 3RU8L 2QJDA 1JWUB 3BISA 1KT2B 3QUZA 4FQ1H 3RY5A 5F7LB 3O3UN 4LHQB 5FA3A 5E5MB 5IM7B 2IFGA 5ID1B 2Z92A 4PGJA 2LFGA 4MCYB 4RQQB 1FYTA 1RZIB 5E6IC 4ZFOA 2P44B 3I02A 4HBCL 1TETH 1OM3H 1UC6A 4WEBH 4K2UL 3NABL 4EN3C 2A73B 2VL5A 2BVPB 4P48A 4IOFC 1RZKH 5FHAL 5D7KE 3KYKH 4NKMA 3V6BR 2B8OT 4UT7H 4ZUTB 4TUKH 3OZ9L 1X3DA 4P5KB 1CYGA 1ZMYA 2V2XA 4IMKC 3VXNB 1RZ8B 1HINL 4RFOH 4MA7H 1Y6MR 3PDDA 4OZIA 5H37G 1NC2A 2OXGA 4MHHG 1BIIA 3O9WD 4YUEL 2ZUQB 2B1AH 4NZUH 3TFKC 4WI2A 4X6EB 5D4QA 3UZVB 5F8RC 2HRPL 3DETC 4TUOB 5FA3B 1CLZH 1DFBL 2Z92B 1OSZA 2BDNL 1FYTB 4ZFOB 5KVGL 4JVPA 2IALA 2FJFA 3BKML 3I02B 1QFWM 3Q5TA 1NJ9B 4ZDHA 4WFGD 2VL5B 5IJKA 2G75A 5E1HB 4NKMB 1PX3A 5H35A 1NCDL 2NZ9D 4JREB 3ARFA 1M7DB 1GIGL 3SCMD 3ARVA 4PJBA 3C08L 4ZQKA 4KFZC 1ZV5A 4YK4B 4KZDL 4WO4A 5J7CC 1F42A 1QTYT 3MLTA 4FQPA 2C1PA 4Y8AA 1NC2B 2J8UE 1BIIB 1NFIA 2NY2B 4KTDL 3VH8B 4OKDA 2UY7A 5E5RB 5ICXB 5D5MF 4I3RH 1EO5A 1MHEA 1R6VA 4RISL 4APQD 3SGKC 4O2CA 1CS6A 1OSZB 1K3ZA 3BPLB 2LU3A 4N1CA 2IALB 2FJFB 2I25N 2R1WB 4MZ2A 5DMIL 4TSBH 4R9HA 4X98A 3OMZA 5FYKL 1KCKA 4ZDHB 1FL5A 1ZLVK 3BP4A 1RJYA 2G75B 2R0WL 3HNSH 5H35B 4IIQC 4HQQL 3NCFB 4NBYB 4JRYA 3QISA 4ZFFA 4YX2L 4PJBB 3V5DA 5LGHH 3EYUH 4ZQKB 2Z0BA 1A1OA 3X12A 1CD8A 1JGUL 1FH5H 1MCCA 4WO4B 3C8KA 1I7TA 3MLTB 1MCRA 3DURB 1E4XH 1NFIB 2X1WL 3HZMA 5C0AA 3T0EA 1EO8H 2HJLA 1MCDA 3CVHH 2Q8BL 4WCYL 4XH2A 3K8LA 3WXWL 1MHEB 1MWAL 1OAKL 5F72S 1J7VR 2MFNA 3ARBC 4O2CB 4M4PA 5TE7L 1MI5D 4IRZH 3K4AA 4KV5E 5DHXB 2AP2A 4XWGH 5D1ZB 4X98B 1KN4L 3I2CL 1FL5B 4YPGA 1HH6A