5GHNA

Crystal structure of human mth1(g2k/d120n mutant) in complex with 2-oxo-datp
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
156
Chain Sequence
MKASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDNSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7,8-dihydro-8-oxoguanine triphosphatase
publication title Structural and Kinetic Studies of the Human Nudix Hydrolase MTH1 Reveal the Mechanism for Its Broad Substrate Specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 44
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5ghnA00
3N77A 1V8NA 4S2VA 4ICKA 1I9AA 1HZTA 5IW4A 1SZ3A 1PPWA 3AC9A 3BHOA 2CL3A 2YVPA 5DDGA 3GZ6A 1PUQA 2GT2A 2I8TA 4ILQA 3ID9A 1IRYA 3DKUA 2ICKA 3X0JA 5GHIA 3SMDA 3RH7A 1XSBA 3COUA 3Q91A 2G73A 4NFXA 5CFJA 3HYQA 2QJTA 3EF5A 5DEQA 2JVBA 1QVJA 1VHZA 2A6TA 3I7UA 5DD4A 1V8VA 1MQEA 4YPHA 5ANSA 3ACAA 1MP2A 3L85A 3FSPA 1PPVA 1SU2A 2XSQA 3GZ5A 2DSBA 5FSKA 2FVVA 3Q93A 4HFQA 3CNGA 4S2XA 2RRKA 2A8RA 3X0LA 1VIQA 2YVOA 3EXQA 3OGAA 3KVHA 1VIUA 2J8QA 5GHOA 5GHJA 1V8MA 1VC8A 4N1TA 1SOIA 2KDWA 1OW2A 1JKNA 5FSLA 5GHQA 4KTBA 3ZR0A 2DSDA 2I6KA 2YVMA 3E57A 5I8UA 4KYXA 3BM4A 1U20A 4JZTA 4NFWA 1NQYA 4N1UA 4C9WA 3Q1PA 1KTGA 1V8TA 4K6EA 3F13A 1KHZA 5ANVA 2DUKA 3O8SA 4S2YA 1JRKA 5CFIA 2GT4A 1MQWA 2VNQA 1NFSA 5ANWA 3MDGA 3FK9A 3GWYA 3N9UA 5DPKA 4JZVA 3A6TA 1Q33A 3MGMA 1V8SA 4KG4A 4C9XA 5BS6A 1NQZA 1VHGA 1RRSA 4V14A 1KT9A 1V8YA 5FSNA 1XSCA 1MUTA 2G74A 2I8UA 5ANUA 3SONA 3ZR1A 3MDIA 2GB5A 3Q2TA 4JZUA 2W4EA 3SHDA 4ZG0A 3X0PA 2A8PA 5FSOA 3GG6A 3A6SA 1MR2A 1PUSA 1VC9A 4S2WA 4YPRA 1V8LA 3X0RA 1F3YA 3G0QA 4HVYA 5IW5A 5BONA 1X51A 2DSCA 2O5WA 1PPXA 5C7QA 1V8IA 1GA7A 2R5WA 3HHJA 3X0KA 1PVFA 5HZXA 5LPGA 1Q27A 1VRLA 1K2EA 3I9XA 4MPOA 1G0SA 1MK1A 2A8SA 3Q2SA 1XSAA 3WHWA 3X0QA 1V8UA 5C7TA 3BAPA 3A6UA 1Q54A 3X0OA 2YYHA 1V8WA 3DUPA 1V8RA 2ICJA 5ISYA 2A8TA 2B06A 1VK6A 3A6VA 3FCMA 2O1CA 1K26A 3H95A 3GRNA 3I7VA 3X0SA 4JZSA 3X0NA 1R67A 2FKBA 4IJXA 1X83A 2DHOA 3Q4IA 4KG3A 3O61A 5GHNA 5GHPA 3MCFA 1TUMA 2AZWA 2KDVA 5ANTA 2B2KA 1G9QA 3O6ZA 2B0VA 2QKMB 3EESA 1X84A 3EEUA 2Q9PA 3R03A 3X0MA 3FFUA 5FSIA 3GZ8A 3X0IA 2FMLA 1RYAA 1SJYA 3O52A 1RRQA 1NFZA 3J7Ye 2VNPA 2PQVA 5GHMA 4YOQA 2A8QA 2YVNA 3QSJA 3F6AA 4DYWA 1VCDA 2PNYA 3U53A 3FJYA 3P5TA 5FSMA 5C8LA 3P6YA 1HX3A 2QJOA 1PUNA 3O69A 2O5FA
chains in the Genus database with same CATH superfamily
3N77A 1V8NA 4S2VA 4ICKA 1I9AA 1HZTA 5IW4A 1SZ3A 1PPWA 3AC9A 3BHOA 2CL3A 2YVPA 5DDGA 3GZ6A 1PUQA 2GT2A 4J7GA 2I8TA 4ILQA 3ID9A 1IRYA 3DKUA 2ICKA 3X0JA 5GHIA 3SMDA 3RH7A 1XSBA 3COUA 3Q91A 2G73A 4NFXA 5CFJA 3HYQA 2QJTA 3EF5A 5DEQA 2JVBA 1QVJA 1VHZA 2A6TA 3I7UA 5DD4A 1V8VA 1MQEA 4J7HA 4YPHA 5ANSA 3ACAA 1MP2A 3L85A 3FSPA 1PPVA 1SU2A 2XSQA 3GZ5A 2DSBA 5FSKA 2FVVA 3Q93A 4HFQA 3CNGA 4S2XA 2RRKA 2A8RA 3X0LA 1VIQA 2YVOA 3EXQA 3OGAA 3KVHA 1VIUA 2J8QA 5GHOA 5GHJA 1V8MA 1VC8A 4N1TA 1SOIA 2KDWA 1OW2A 1JKNA 5FSLA 5GHQA 4KTBA 3ZR0A 2DSDA 2I6KA 2YVMA 3E57A 5I8UA 4KYXA 3BM4A 1U20A 4JZTA 4NFWA 1NQYA 4N1UA 4C9WA 3Q1PA 1KTGA 1V8TA 4K6EA 3F13A 1KHZA 5ANVA 2DUKA 3O8SA 4S2YA 1JRKA 5CFIA 2GT4A 1MQWA 2VNQA 1NFSA 5ANWA 3MDGA 3FK9A 3GWYA 3N9UA 5DPKA 4JZVA 3A6TA 1Q33A 3MGMA 1V8SA 4KG4A 4C9XA 5BS6A 2CZRA 1NQZA 1VHGA 1RRSA 4V14A 1KT9A 1V8YA 5FSNA 1XSCA 1MUTA 2G74A 2I8UA 5ANUA 3SONA 3ZR1A 3MDIA 2GB5A 3Q2TA 4JZUA 2W4EA 3SHDA 4ZG0A 3X0PA 2A8PA 5FSOA 3GG6A 3A6SA 1MR2A 1PUSA 1VC9A 4S2WA 4YPRA 1V8LA 3X0RA 1F3YA 3G0QA 4HVYA 5IW5A 5BONA 1X51A 2DSCA 2O5WA 1PPXA 5C7QA 1V8IA 1GA7A 2R5WA 3HHJA 3X0KA 1PVFA 5HZXA 5LPGA 1Q27A 1VRLA 1K2EA 3I9XA 4MPOA 1G0SA 1MK1A 2A8SA 3Q2SA 1XSAA 3WHWA 3X0QA 1V8UA 5C7TA 3BAPA 3A6UA 1Q54A 3X0OA 2YYHA 1V8WA 3DUPA 1V8RA 2ICJA 5ISYA 2A8TA 2B06A 1VK6A 3A6VA 3FCMA 2O1CA 1K26A 3H95A 3GRNA 3I7VA 3X0SA 4JZSA 3X0NA 1R67A 2FKBA 4IJXA 1X83A 2DHOA 3Q4IA 4KG3A 3O61A 5GHNA 5GHPA 3MCFA 1TUMA 2AZWA 2KDVA 5ANTA 2B2KA 1G9QA 3O6ZA 2B0VA 2QKMB 3EESA 1X84A 3EEUA 2Q9PA 3R03A 3X0MA 3FFUA 5FSIA 3GZ8A 3X0IA 2FMLA 1RYAA 1SJYA 3O52A 1RRQA 1NFZA 3J7Ye 2VNPA 2PQVA 5GHMA 4YOQA 2A8QA 2YVNA 3QSJA 3F6AA 4DYWA 1VCDA 2PNYA 3U53A 3FJYA 3P5TA 5FSMA 5C8LA 3P6YA 1HX3A 2QJOA 1PUNA 3O69A 2O5FA
chains in the Genus database with same CATH topology
3N77A 1V8NA 4S2VA 4ICKA 1I9AA 1HZTA 5IW4A 1SZ3A 1PPWA 3AC9A 3BHOA 2CL3A 2YVPA 5DDGA 3GZ6A 1PUQA 2GT2A 4J7GA 2I8TA 4ILQA 3ID9A 1IRYA 3DKUA 2ICKA 3X0JA 5GHIA 3SMDA 3RH7A 1XSBA 3COUA 3Q91A 2G73A 4NFXA 5CFJA 3HYQA 2QJTA 3EF5A 5DEQA 2JVBA 1QVJA 1VHZA 2A6TA 3I7UA 5DD4A 1V8VA 1MQEA 4J7HA 4YPHA 5ANSA 3ACAA 1MP2A 3L85A 3FSPA 1PPVA 1SU2A 2XSQA 3GZ5A 2DSBA 5FSKA 2FVVA 3Q93A 4HFQA 3CNGA 4S2XA 2RRKA 2A8RA 3X0LA 1VIQA 2YVOA 3EXQA 3OGAA 3KVHA 1VIUA 2J8QA 5GHOA 5GHJA 1V8MA 1VC8A 4N1TA 1SOIA 2KDWA 1OW2A 1JKNA 5FSLA 5GHQA 4KTBA 3ZR0A 2DSDA 2I6KA 2YVMA 3E57A 5I8UA 4KYXA 3BM4A 1U20A 4JZTA 4NFWA 1NQYA 4N1UA 4C9WA 3Q1PA 1KTGA 1V8TA 4K6EA 3F13A 1KHZA 5ANVA 2DUKA 3O8SA 4S2YA 1JRKA 5CFIA 2GT4A 1MQWA 2VNQA 1NFSA 5ANWA 3MDGA 3FK9A 3GWYA 3N9UA 5DPKA 4JZVA 3A6TA 1Q33A 3MGMA 1V8SA 4KG4A 4C9XA 5BS6A 2CZRA 1NQZA 1VHGA 1RRSA 4V14A 1KT9A 1V8YA 5FSNA 1XSCA 1MUTA 2G74A 2I8UA 5ANUA 3SONA 3ZR1A 3MDIA 2GB5A 3Q2TA 4JZUA 2W4EA 3SHDA 4ZG0A 3X0PA 2A8PA 5FSOA 3GG6A 3A6SA 1MR2A 1PUSA 1VC9A 4S2WA 4YPRA 1V8LA 3X0RA 1F3YA 3G0QA 4HVYA 5IW5A 5BONA 1X51A 2DSCA 2O5WA 1PPXA 5C7QA 1V8IA 1GA7A 2R5WA 3HHJA 3X0KA 1PVFA 5HZXA 5LPGA 1Q27A 1VRLA 1K2EA 3I9XA 4MPOA 1G0SA 1MK1A 2A8SA 3Q2SA 1XSAA 3WHWA 3X0QA 1V8UA 5C7TA 3BAPA 3A6UA 1Q54A 3X0OA 2YYHA 1V8WA 3DUPA 1V8RA 2ICJA 5ISYA 2A8TA 2B06A 1VK6A 3A6VA 3FCMA 2O1CA 1K26A 3H95A 3GRNA 3I7VA 3X0SA 4JZSA 3X0NA 1R67A 2FKBA 4IJXA 1X83A 2DHOA 3Q4IA 4KG3A 3O61A 5GHNA 5GHPA 3MCFA 1TUMA 2AZWA 2KDVA 5ANTA 2B2KA 1G9QA 3O6ZA 2B0VA 2QKMB 3EESA 1X84A 3EEUA 2Q9PA 3R03A 3X0MA 3FFUA 5FSIA 3GZ8A 3X0IA 2FMLA 1RYAA 1SJYA 3O52A 1RRQA 1NFZA 3J7Ye 2VNPA 2PQVA 5GHMA 4YOQA 2A8QA 2YVNA 3QSJA 3F6AA 4DYWA 1VCDA 2PNYA 3U53A 3FJYA 3P5TA 5FSMA 5C8LA 3P6YA 1HX3A 2QJOA 1PUNA 3O69A 2O5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N77 A;  1V8N A;  4S2V A;  4ICK A;  1I9A A;  1HZT A;  5IW4 A;  1SZ3 A;  1PPW A;  3AC9 A;  3BHO A;  2CL3 A;  2YVP A;  5DDG A;  3GZ6 A;  1PUQ A;  2GT2 A;  2I8T A;  4ILQ A;  3ID9 A;  1IRY A;  3DKU A;  2ICK A;  3X0J A;  5GHI A;  3SMD A;  3RH7 A;  1XSB A;  3COU A;  3Q91 A;  2G73 A;  4NFX A;  5CFJ A;  3HYQ A;  2QJT A;  3EF5 A;  5DEQ A;  2JVB A;  1QVJ A;  1VHZ A;  2A6T A;  3I7U A;  5DD4 A;  1V8V A;  1MQE A;  4YPH A;  5ANS A;  3ACA A;  1MP2 A;  3L85 A;  3FSP A;  1PPV A;  1SU2 A;  2XSQ A;  3GZ5 A;  2DSB A;  5FSK A;  2FVV A;  3Q93 A;  4HFQ A;  3CNG A;  4S2X A;  2RRK A;  2A8R A;  3X0L A;  1VIQ A;  2YVO A;  3EXQ A;  3OGA A;  3KVH A;  1VIU A;  2J8Q A;  5GHO A;  5GHJ A;  1V8M A;  1VC8 A;  4N1T A;  1SOI A;  2KDW A;  1OW2 A;  1JKN A;  5FSL A;  5GHQ A;  4KTB A;  3ZR0 A;  2DSD A;  2I6K A;  2YVM A;  3E57 A;  5I8U A;  4KYX A;  3BM4 A;  1U20 A;  4JZT A;  4NFW A;  1NQY A;  4N1U A;  4C9W A;  3Q1P A;  1KTG A;  1V8T A;  4K6E A;  3F13 A;  1KHZ A;  5ANV A;  2DUK A;  3O8S A;  4S2Y A;  1JRK A;  5CFI A;  2GT4 A;  1MQW A;  2VNQ A;  1NFS A;  5ANW A;  3MDG A;  3FK9 A;  3GWY A;  3N9U A;  5DPK A;  4JZV A;  3A6T A;  1Q33 A;  3MGM A;  1V8S A;  4KG4 A;  4C9X A;  5BS6 A;  1NQZ A;  1VHG A;  1RRS A;  4V14 A;  1KT9 A;  1V8Y A;  5FSN A;  1XSC A;  1MUT A;  2G74 A;  2I8U A;  5ANU A;  3SON A;  3ZR1 A;  3MDI A;  2GB5 A;  3Q2T A;  4JZU A;  2W4E A;  3SHD A;  4ZG0 A;  3X0P A;  2A8P A;  5FSO A;  3GG6 A;  3A6S A;  1MR2 A;  1PUS A;  1VC9 A;  4S2W A;  4YPR A;  1V8L A;  3X0R A;  1F3Y A;  3G0Q A;  4HVY A;  5IW5 A;  5BON A;  1X51 A;  2DSC A;  2O5W A;  1PPX A;  5C7Q A;  1V8I A;  1GA7 A;  2R5W A;  3HHJ A;  3X0K A;  1PVF A;  5HZX A;  5LPG A;  1Q27 A;  1VRL A;  1K2E A;  3I9X A;  4MPO A;  1G0S A;  1MK1 A;  2A8S A;  3Q2S A;  1XSA A;  3WHW A;  3X0Q A;  1V8U A;  5C7T A;  3BAP A;  3A6U A;  1Q54 A;  3X0O A;  2YYH A;  1V8W A;  3DUP A;  1V8R A;  2ICJ A;  5ISY A;  2A8T A;  2B06 A;  1VK6 A;  3A6V A;  3FCM A;  2O1C A;  1K26 A;  3H95 A;  3GRN A;  3I7V A;  3X0S A;  4JZS A;  3X0N A;  1R67 A;  2FKB A;  4IJX A;  1X83 A;  2DHO A;  3Q4I A;  4KG3 A;  3O61 A;  5GHN A;  5GHP A;  3MCF A;  1TUM A;  2AZW A;  2KDV A;  5ANT A;  2B2K A;  1G9Q A;  3O6Z A;  2B0V A;  2QKM B;  3EES A;  1X84 A;  3EEU A;  2Q9P A;  3R03 A;  3X0M A;  3FFU A;  5FSI A;  3GZ8 A;  3X0I A;  2FML A;  1RYA A;  1SJY A;  3O52 A;  1RRQ A;  1NFZ A;  3J7Y e;  2VNP A;  2PQV A;  5GHM A;  4YOQ A;  2A8Q A;  2YVN A;  3QSJ A;  3F6A A;  4DYW A;  1VCD A;  2PNY A;  3U53 A;  3FJY A;  3P5T A;  5FSM A;  5C8L A;  3P6Y A;  1HX3 A;  2QJO A;  1PUN A;  3O69 A;  2O5F A; 
#chains in the Genus database with same CATH topology
 3N77 A;  1V8N A;  4S2V A;  4ICK A;  1I9A A;  1HZT A;  5IW4 A;  1SZ3 A;  1PPW A;  3AC9 A;  3BHO A;  2CL3 A;  2YVP A;  5DDG A;  3GZ6 A;  1PUQ A;  2GT2 A;  4J7G A;  2I8T A;  4ILQ A;  3ID9 A;  1IRY A;  3DKU A;  2ICK A;  3X0J A;  5GHI A;  3SMD A;  3RH7 A;  1XSB A;  3COU A;  3Q91 A;  2G73 A;  4NFX A;  5CFJ A;  3HYQ A;  2QJT A;  3EF5 A;  5DEQ A;  2JVB A;  1QVJ A;  1VHZ A;  2A6T A;  3I7U A;  5DD4 A;  1V8V A;  1MQE A;  4J7H A;  4YPH A;  5ANS A;  3ACA A;  1MP2 A;  3L85 A;  3FSP A;  1PPV A;  1SU2 A;  2XSQ A;  3GZ5 A;  2DSB A;  5FSK A;  2FVV A;  3Q93 A;  4HFQ A;  3CNG A;  4S2X A;  2RRK A;  2A8R A;  3X0L A;  1VIQ A;  2YVO A;  3EXQ A;  3OGA A;  3KVH A;  1VIU A;  2J8Q A;  5GHO A;  5GHJ A;  1V8M A;  1VC8 A;  4N1T A;  1SOI A;  2KDW A;  1OW2 A;  1JKN A;  5FSL A;  5GHQ A;  4KTB A;  3ZR0 A;  2DSD A;  2I6K A;  2YVM A;  3E57 A;  5I8U A;  4KYX A;  3BM4 A;  1U20 A;  4JZT A;  4NFW A;  1NQY A;  4N1U A;  4C9W A;  3Q1P A;  1KTG A;  1V8T A;  4K6E A;  3F13 A;  1KHZ A;  5ANV A;  2DUK A;  3O8S A;  4S2Y A;  1JRK A;  5CFI A;  2GT4 A;  1MQW A;  2VNQ A;  1NFS A;  5ANW A;  3MDG A;  3FK9 A;  3GWY A;  3N9U A;  5DPK A;  4JZV A;  3A6T A;  1Q33 A;  3MGM A;  1V8S A;  4KG4 A;  4C9X A;  5BS6 A;  2CZR A;  1NQZ A;  1VHG A;  1RRS A;  4V14 A;  1KT9 A;  1V8Y A;  5FSN A;  1XSC A;  1MUT A;  2G74 A;  2I8U A;  5ANU A;  3SON A;  3ZR1 A;  3MDI A;  2GB5 A;  3Q2T A;  4JZU A;  2W4E A;  3SHD A;  4ZG0 A;  3X0P A;  2A8P A;  5FSO A;  3GG6 A;  3A6S A;  1MR2 A;  1PUS A;  1VC9 A;  4S2W A;  4YPR A;  1V8L A;  3X0R A;  1F3Y A;  3G0Q A;  4HVY A;  5IW5 A;  5BON A;  1X51 A;  2DSC A;  2O5W A;  1PPX A;  5C7Q A;  1V8I A;  1GA7 A;  2R5W A;  3HHJ A;  3X0K A;  1PVF A;  5HZX A;  5LPG A;  1Q27 A;  1VRL A;  1K2E A;  3I9X A;  4MPO A;  1G0S A;  1MK1 A;  2A8S A;  3Q2S A;  1XSA A;  3WHW A;  3X0Q A;  1V8U A;  5C7T A;  3BAP A;  3A6U A;  1Q54 A;  3X0O A;  2YYH A;  1V8W A;  3DUP A;  1V8R A;  2ICJ A;  5ISY A;  2A8T A;  2B06 A;  1VK6 A;  3A6V A;  3FCM A;  2O1C A;  1K26 A;  3H95 A;  3GRN A;  3I7V A;  3X0S A;  4JZS A;  3X0N A;  1R67 A;  2FKB A;  4IJX A;  1X83 A;  2DHO A;  3Q4I A;  4KG3 A;  3O61 A;  5GHN A;  5GHP A;  3MCF A;  1TUM A;  2AZW A;  2KDV A;  5ANT A;  2B2K A;  1G9Q A;  3O6Z A;  2B0V A;  2QKM B;  3EES A;  1X84 A;  3EEU A;  2Q9P A;  3R03 A;  3X0M A;  3FFU A;  5FSI A;  3GZ8 A;  3X0I A;  2FML A;  1RYA A;  1SJY A;  3O52 A;  1RRQ A;  1NFZ A;  3J7Y e;  2VNP A;  2PQV A;  5GHM A;  4YOQ A;  2A8Q A;  2YVN A;  3QSJ A;  3F6A A;  4DYW A;  1VCD A;  2PNY A;  3U53 A;  3FJY A;  3P5T A;  5FSM A;  5C8L A;  3P6Y A;  1HX3 A;  2QJO A;  1PUN A;  3O69 A;  2O5F A; 
#chains in the Genus database with same CATH homology
 3N77 A;  1V8N A;  4S2V A;  4ICK A;  1I9A A;  1HZT A;  5IW4 A;  1SZ3 A;  1PPW A;  3AC9 A;  3BHO A;  2CL3 A;  2YVP A;  5DDG A;  3GZ6 A;  1PUQ A;  2GT2 A;  4J7G A;  2I8T A;  4ILQ A;  3ID9 A;  1IRY A;  3DKU A;  2ICK A;  3X0J A;  5GHI A;  3SMD A;  3RH7 A;  1XSB A;  3COU A;  3Q91 A;  2G73 A;  4NFX A;  5CFJ A;  3HYQ A;  2QJT A;  3EF5 A;  5DEQ A;  2JVB A;  1QVJ A;  1VHZ A;  2A6T A;  3I7U A;  5DD4 A;  1V8V A;  1MQE A;  4J7H A;  4YPH A;  5ANS A;  3ACA A;  1MP2 A;  3L85 A;  3FSP A;  1PPV A;  1SU2 A;  2XSQ A;  3GZ5 A;  2DSB A;  5FSK A;  2FVV A;  3Q93 A;  4HFQ A;  3CNG A;  4S2X A;  2RRK A;  2A8R A;  3X0L A;  1VIQ A;  2YVO A;  3EXQ A;  3OGA A;  3KVH A;  1VIU A;  2J8Q A;  5GHO A;  5GHJ A;  1V8M A;  1VC8 A;  4N1T A;  1SOI A;  2KDW A;  1OW2 A;  1JKN A;  5FSL A;  5GHQ A;  4KTB A;  3ZR0 A;  2DSD A;  2I6K A;  2YVM A;  3E57 A;  5I8U A;  4KYX A;  3BM4 A;  1U20 A;  4JZT A;  4NFW A;  1NQY A;  4N1U A;  4C9W A;  3Q1P A;  1KTG A;  1V8T A;  4K6E A;  3F13 A;  1KHZ A;  5ANV A;  2DUK A;  3O8S A;  4S2Y A;  1JRK A;  5CFI A;  2GT4 A;  1MQW A;  2VNQ A;  1NFS A;  5ANW A;  3MDG A;  3FK9 A;  3GWY A;  3N9U A;  5DPK A;  4JZV A;  3A6T A;  1Q33 A;  3MGM A;  1V8S A;  4KG4 A;  4C9X A;  5BS6 A;  2CZR A;  1NQZ A;  1VHG A;  1RRS A;  4V14 A;  1KT9 A;  1V8Y A;  5FSN A;  1XSC A;  1MUT A;  2G74 A;  2I8U A;  5ANU A;  3SON A;  3ZR1 A;  3MDI A;  2GB5 A;  3Q2T A;  4JZU A;  2W4E A;  3SHD A;  4ZG0 A;  3X0P A;  2A8P A;  5FSO A;  3GG6 A;  3A6S A;  1MR2 A;  1PUS A;  1VC9 A;  4S2W A;  4YPR A;  1V8L A;  3X0R A;  1F3Y A;  3G0Q A;  4HVY A;  5IW5 A;  5BON A;  1X51 A;  2DSC A;  2O5W A;  1PPX A;  5C7Q A;  1V8I A;  1GA7 A;  2R5W A;  3HHJ A;  3X0K A;  1PVF A;  5HZX A;  5LPG A;  1Q27 A;  1VRL A;  1K2E A;  3I9X A;  4MPO A;  1G0S A;  1MK1 A;  2A8S A;  3Q2S A;  1XSA A;  3WHW A;  3X0Q A;  1V8U A;  5C7T A;  3BAP A;  3A6U A;  1Q54 A;  3X0O A;  2YYH A;  1V8W A;  3DUP A;  1V8R A;  2ICJ A;  5ISY A;  2A8T A;  2B06 A;  1VK6 A;  3A6V A;  3FCM A;  2O1C A;  1K26 A;  3H95 A;  3GRN A;  3I7V A;  3X0S A;  4JZS A;  3X0N A;  1R67 A;  2FKB A;  4IJX A;  1X83 A;  2DHO A;  3Q4I A;  4KG3 A;  3O61 A;  5GHN A;  5GHP A;  3MCF A;  1TUM A;  2AZW A;  2KDV A;  5ANT A;  2B2K A;  1G9Q A;  3O6Z A;  2B0V A;  2QKM B;  3EES A;  1X84 A;  3EEU A;  2Q9P A;  3R03 A;  3X0M A;  3FFU A;  5FSI A;  3GZ8 A;  3X0I A;  2FML A;  1RYA A;  1SJY A;  3O52 A;  1RRQ A;  1NFZ A;  3J7Y e;  2VNP A;  2PQV A;  5GHM A;  4YOQ A;  2A8Q A;  2YVN A;  3QSJ A;  3F6A A;  4DYW A;  1VCD A;  2PNY A;  3U53 A;  3FJY A;  3P5T A;  5FSM A;  5C8L A;  3P6Y A;  1HX3 A;  2QJO A;  1PUN A;  3O69 A;  2O5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...