5GHOA

Crystal structure of human mth1(g2k/d120a mutant) in complex with 8-oxo-dgtp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
156
structure length
156
Chain Sequence
MKASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDASYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7,8-dihydro-8-oxoguanine triphosphatase
publication title Structural and Kinetic Studies of the Human Nudix Hydrolase MTH1 Reveal the Mechanism for Its Broad Substrate Specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 41
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5ghoA00
3I7UA 1VHGA 1RYAA 3MGMA 1GA7A 2ICKA 5DD4A 4JZSA 3EF5A 3O52A 5DDGA 2DHOA 2O5WA 3L85A 4C9XA 1V8MA 2J8QA 4NFXA 1G9QA 1VIUA 1V8YA 3A6VA 2AZWA 1NFSA 1PPXA 5GHNA 2Q9PA 5GHJA 1V8RA 1XSBA 5ANUA 3BM4A 3COUA 4NFWA 1HX3A 3O8SA 1X51A 1G0SA 2A8RA 5C7TA 2O5FA 3OGAA 1V8VA 2I6KA 2YVOA 4YPRA 3Q4IA 3FSPA 4HVYA 1V8LA 2A8PA 3ZR0A 3FK9A 2PNYA 1SOIA 5BS6A 3A6UA 3SHDA 4N1TA 1I9AA 1SU2A 2YVNA 3GWYA 3GZ5A 3KVHA 2GB5A 4HFQA 5GHIA 3X0PA 2PQVA 2A8TA 4KTBA 3EEUA 3H95A 2FMLA 3Q1PA 3Q91A 4ILQA 4S2YA 4YPHA 3MDIA 2G74A 1VK6A 3X0IA 1PUQA 3O6ZA 1PPWA 2KDWA 2R5WA 5FSKA 3E57A 3X0LA 1SZ3A 2DSBA 5C8LA 1VRLA 2A8QA 1V8TA 2VNQA 5I8UA 2FVVA 4S2XA 3Q2TA 2XSQA 5C7QA 3R03A 1V8UA 1JRKA 3A6TA 2DUKA 1R67A 1K26A 1PVFA 1IRYA 3X0KA 4DYWA 1NQZA 5ANVA 1PPVA 5GHQA 2JVBA 1QVJA 2O1CA 2W4EA 2VNPA 1TUMA 2GT2A 2FKBA 1Q27A 2DSDA 1Q33A 3F6AA 3GRNA 3X0RA 2QJOA 4V14A 1X84A 1RRSA 3I7VA 3Q93A 3WHWA 1F3YA 5FSNA 1MQEA 1V8NA 3HHJA 3P6YA 2ICJA 5ISYA 3X0NA 2RRKA 2A8SA 4MPOA 2QJTA 5CFIA 3F13A 3SONA 5IW4A 1VIQA 5FSLA 3MDGA 3DUPA 3A6SA 3BHOA 3CNGA 1MQWA 1V8IA 4ICKA 3U53A 2B2KA 4JZTA 3X0SA 5FSOA 3GZ8A 1KT9A 1V8WA 3DKUA 1NQYA 5GHMA 4ZG0A 1X83A 2G73A 4KYXA 2QKMB 5GHPA 4KG3A 3O69A 2DSCA 5ANWA 3MCFA 3X0QA 5BONA 5FSMA 4KG4A 1NFZA 1V8SA 3EESA 1MK1A 1MR2A 2YYHA 2A6TA 5FSIA 4K6EA 3X0OA 3P5TA 4S2WA 1XSCA 3GG6A 2KDVA 2YVMA 3FCMA 4N1UA 3AC9A 1RRQA 2CL3A 1Q54A 2GT4A 3BAPA 1HZTA 1MUTA 3X0MA 1U20A 3FFUA 1VCDA 1JKNA 5DPKA 5CFJA 3ZR1A 1OW2A 3FJYA 2YVPA 3O61A 3EXQA 5DEQA 1VHZA 1PUSA 5HZXA 4JZUA 3HYQA 1MP2A 5IW5A 4S2VA 3N77A 3G0QA 2I8UA 1SJYA 2I8TA 5ANSA 5GHOA 4C9WA 3ID9A 3I9XA 1K2EA 1PUNA 4JZVA 1VC9A 4IJXA 3RH7A 2B0VA 5LPGA 3ACAA 1KHZA 2B06A 3N9UA 3QSJA 1KTGA 5ANTA 3SMDA 3X0JA 4YOQA 1VC8A 3J7Ye 1XSAA 3GZ6A 3Q2SA
chains in the Genus database with same CATH superfamily
3I7UA 1VHGA 1RYAA 3MGMA 1GA7A 2ICKA 5DD4A 4JZSA 3EF5A 3O52A 5DDGA 2DHOA 2O5WA 3L85A 4C9XA 1V8MA 2J8QA 4NFXA 1G9QA 1VIUA 1V8YA 3A6VA 2AZWA 1NFSA 1PPXA 5GHNA 2Q9PA 5GHJA 1V8RA 1XSBA 5ANUA 3BM4A 3COUA 4NFWA 1HX3A 3O8SA 1X51A 1G0SA 2A8RA 5C7TA 2O5FA 3OGAA 1V8VA 2I6KA 2YVOA 4YPRA 3Q4IA 3FSPA 4HVYA 1V8LA 2A8PA 3ZR0A 3FK9A 2PNYA 1SOIA 5BS6A 3A6UA 3SHDA 4N1TA 1I9AA 1SU2A 2YVNA 3GWYA 3GZ5A 3KVHA 2GB5A 4HFQA 5GHIA 3X0PA 2PQVA 2A8TA 4KTBA 3EEUA 3H95A 2FMLA 3Q1PA 3Q91A 4ILQA 4S2YA 4YPHA 3MDIA 2G74A 1VK6A 3X0IA 1PUQA 3O6ZA 1PPWA 2KDWA 2R5WA 5FSKA 3E57A 3X0LA 1SZ3A 2DSBA 5C8LA 1VRLA 2A8QA 1V8TA 2VNQA 5I8UA 2FVVA 4S2XA 3Q2TA 2XSQA 5C7QA 3R03A 1V8UA 1JRKA 3A6TA 2DUKA 1R67A 1K26A 1PVFA 1IRYA 3X0KA 4DYWA 1NQZA 5ANVA 1PPVA 5GHQA 2JVBA 1QVJA 2O1CA 2W4EA 2VNPA 1TUMA 2GT2A 2FKBA 1Q27A 2DSDA 1Q33A 3F6AA 3GRNA 3X0RA 2QJOA 4V14A 1X84A 1RRSA 3I7VA 3Q93A 3WHWA 1F3YA 5FSNA 1MQEA 1V8NA 3HHJA 3P6YA 2ICJA 5ISYA 3X0NA 2RRKA 2A8SA 4MPOA 2QJTA 5CFIA 3F13A 3SONA 5IW4A 1VIQA 5FSLA 3MDGA 3DUPA 3A6SA 3BHOA 3CNGA 1MQWA 1V8IA 4ICKA 3U53A 2B2KA 4JZTA 3X0SA 5FSOA 3GZ8A 1KT9A 1V8WA 3DKUA 1NQYA 5GHMA 4ZG0A 1X83A 2G73A 4KYXA 2QKMB 5GHPA 4KG3A 3O69A 2DSCA 5ANWA 3MCFA 3X0QA 5BONA 5FSMA 4KG4A 1NFZA 1V8SA 3EESA 1MK1A 1MR2A 2YYHA 2A6TA 5FSIA 4K6EA 3X0OA 3P5TA 4S2WA 1XSCA 3GG6A 2KDVA 2YVMA 3FCMA 4N1UA 3AC9A 1RRQA 2CL3A 1Q54A 2GT4A 3BAPA 1HZTA 1MUTA 3X0MA 1U20A 3FFUA 1VCDA 1JKNA 5DPKA 5CFJA 3ZR1A 1OW2A 3FJYA 2YVPA 3O61A 3EXQA 5DEQA 1VHZA 1PUSA 4J7HA 5HZXA 4JZUA 3HYQA 1MP2A 5IW5A 4S2VA 3N77A 3G0QA 2I8UA 1SJYA 2I8TA 5ANSA 5GHOA 4C9WA 3ID9A 3I9XA 2CZRA 1K2EA 1PUNA 4JZVA 1VC9A 4IJXA 3RH7A 2B0VA 5LPGA 3ACAA 1KHZA 2B06A 3N9UA 3QSJA 1KTGA 4J7GA 5ANTA 3SMDA 3X0JA 4YOQA 1VC8A 3J7Ye 1XSAA 3GZ6A 3Q2SA
chains in the Genus database with same CATH topology
3I7UA 1VHGA 1RYAA 3MGMA 1GA7A 2ICKA 5DD4A 4JZSA 3EF5A 3O52A 5DDGA 2DHOA 2O5WA 3L85A 4C9XA 1V8MA 2J8QA 4NFXA 1G9QA 1VIUA 1V8YA 3A6VA 2AZWA 1NFSA 1PPXA 5GHNA 2Q9PA 5GHJA 1V8RA 1XSBA 5ANUA 3BM4A 3COUA 4NFWA 1HX3A 3O8SA 1X51A 1G0SA 2A8RA 5C7TA 2O5FA 3OGAA 1V8VA 2I6KA 2YVOA 4YPRA 3Q4IA 3FSPA 4HVYA 1V8LA 2A8PA 3ZR0A 3FK9A 2PNYA 1SOIA 5BS6A 3A6UA 3SHDA 4N1TA 1I9AA 1SU2A 2YVNA 3GWYA 3GZ5A 3KVHA 2GB5A 4HFQA 5GHIA 3X0PA 2PQVA 2A8TA 4KTBA 3EEUA 3H95A 2FMLA 3Q1PA 3Q91A 4ILQA 4S2YA 4YPHA 3MDIA 2G74A 1VK6A 3X0IA 1PUQA 3O6ZA 1PPWA 2KDWA 2R5WA 5FSKA 3E57A 3X0LA 1SZ3A 2DSBA 5C8LA 1VRLA 2A8QA 1V8TA 2VNQA 5I8UA 2FVVA 4S2XA 3Q2TA 2XSQA 5C7QA 3R03A 1V8UA 1JRKA 3A6TA 2DUKA 1R67A 1K26A 1PVFA 1IRYA 3X0KA 4DYWA 1NQZA 5ANVA 1PPVA 5GHQA 2JVBA 1QVJA 2O1CA 2W4EA 2VNPA 1TUMA 2GT2A 2FKBA 1Q27A 2DSDA 1Q33A 3F6AA 3GRNA 3X0RA 2QJOA 4V14A 1X84A 1RRSA 3I7VA 3Q93A 3WHWA 1F3YA 5FSNA 1MQEA 1V8NA 3HHJA 3P6YA 2ICJA 5ISYA 3X0NA 2RRKA 2A8SA 4MPOA 2QJTA 5CFIA 3F13A 3SONA 5IW4A 1VIQA 5FSLA 3MDGA 3DUPA 3A6SA 3BHOA 3CNGA 1MQWA 1V8IA 4ICKA 3U53A 2B2KA 4JZTA 3X0SA 5FSOA 3GZ8A 1KT9A 1V8WA 3DKUA 1NQYA 5GHMA 4ZG0A 1X83A 2G73A 4KYXA 2QKMB 5GHPA 4KG3A 3O69A 2DSCA 5ANWA 3MCFA 3X0QA 5BONA 5FSMA 4KG4A 1NFZA 1V8SA 3EESA 1MK1A 1MR2A 2YYHA 2A6TA 5FSIA 4K6EA 3X0OA 3P5TA 4S2WA 1XSCA 3GG6A 2KDVA 2YVMA 3FCMA 4N1UA 3AC9A 1RRQA 2CL3A 1Q54A 2GT4A 3BAPA 1HZTA 1MUTA 3X0MA 1U20A 3FFUA 1VCDA 1JKNA 5DPKA 5CFJA 3ZR1A 1OW2A 3FJYA 2YVPA 3O61A 3EXQA 5DEQA 1VHZA 1PUSA 4J7HA 5HZXA 4JZUA 3HYQA 1MP2A 5IW5A 4S2VA 3N77A 3G0QA 2I8UA 1SJYA 2I8TA 5ANSA 5GHOA 4C9WA 3ID9A 3I9XA 2CZRA 1K2EA 1PUNA 4JZVA 1VC9A 4IJXA 3RH7A 2B0VA 5LPGA 3ACAA 1KHZA 2B06A 3N9UA 3QSJA 1KTGA 4J7GA 5ANTA 3SMDA 3X0JA 4YOQA 1VC8A 3J7Ye 1XSAA 3GZ6A 3Q2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7U A;  1VHG A;  1RYA A;  3MGM A;  1GA7 A;  2ICK A;  5DD4 A;  4JZS A;  3EF5 A;  3O52 A;  5DDG A;  2DHO A;  2O5W A;  3L85 A;  4C9X A;  1V8M A;  2J8Q A;  4NFX A;  1G9Q A;  1VIU A;  1V8Y A;  3A6V A;  2AZW A;  1NFS A;  1PPX A;  5GHN A;  2Q9P A;  5GHJ A;  1V8R A;  1XSB A;  5ANU A;  3BM4 A;  3COU A;  4NFW A;  1HX3 A;  3O8S A;  1X51 A;  1G0S A;  2A8R A;  5C7T A;  2O5F A;  3OGA A;  1V8V A;  2I6K A;  2YVO A;  4YPR A;  3Q4I A;  3FSP A;  4HVY A;  1V8L A;  2A8P A;  3ZR0 A;  3FK9 A;  2PNY A;  1SOI A;  5BS6 A;  3A6U A;  3SHD A;  4N1T A;  1I9A A;  1SU2 A;  2YVN A;  3GWY A;  3GZ5 A;  3KVH A;  2GB5 A;  4HFQ A;  5GHI A;  3X0P A;  2PQV A;  2A8T A;  4KTB A;  3EEU A;  3H95 A;  2FML A;  3Q1P A;  3Q91 A;  4ILQ A;  4S2Y A;  4YPH A;  3MDI A;  2G74 A;  1VK6 A;  3X0I A;  1PUQ A;  3O6Z A;  1PPW A;  2KDW A;  2R5W A;  5FSK A;  3E57 A;  3X0L A;  1SZ3 A;  2DSB A;  5C8L A;  1VRL A;  2A8Q A;  1V8T A;  2VNQ A;  5I8U A;  2FVV A;  4S2X A;  3Q2T A;  2XSQ A;  5C7Q A;  3R03 A;  1V8U A;  1JRK A;  3A6T A;  2DUK A;  1R67 A;  1K26 A;  1PVF A;  1IRY A;  3X0K A;  4DYW A;  1NQZ A;  5ANV A;  1PPV A;  5GHQ A;  2JVB A;  1QVJ A;  2O1C A;  2W4E A;  2VNP A;  1TUM A;  2GT2 A;  2FKB A;  1Q27 A;  2DSD A;  1Q33 A;  3F6A A;  3GRN A;  3X0R A;  2QJO A;  4V14 A;  1X84 A;  1RRS A;  3I7V A;  3Q93 A;  3WHW A;  1F3Y A;  5FSN A;  1MQE A;  1V8N A;  3HHJ A;  3P6Y A;  2ICJ A;  5ISY A;  3X0N A;  2RRK A;  2A8S A;  4MPO A;  2QJT A;  5CFI A;  3F13 A;  3SON A;  5IW4 A;  1VIQ A;  5FSL A;  3MDG A;  3DUP A;  3A6S A;  3BHO A;  3CNG A;  1MQW A;  1V8I A;  4ICK A;  3U53 A;  2B2K A;  4JZT A;  3X0S A;  5FSO A;  3GZ8 A;  1KT9 A;  1V8W A;  3DKU A;  1NQY A;  5GHM A;  4ZG0 A;  1X83 A;  2G73 A;  4KYX A;  2QKM B;  5GHP A;  4KG3 A;  3O69 A;  2DSC A;  5ANW A;  3MCF A;  3X0Q A;  5BON A;  5FSM A;  4KG4 A;  1NFZ A;  1V8S A;  3EES A;  1MK1 A;  1MR2 A;  2YYH A;  2A6T A;  5FSI A;  4K6E A;  3X0O A;  3P5T A;  4S2W A;  1XSC A;  3GG6 A;  2KDV A;  2YVM A;  3FCM A;  4N1U A;  3AC9 A;  1RRQ A;  2CL3 A;  1Q54 A;  2GT4 A;  3BAP A;  1HZT A;  1MUT A;  3X0M A;  1U20 A;  3FFU A;  1VCD A;  1JKN A;  5DPK A;  5CFJ A;  3ZR1 A;  1OW2 A;  3FJY A;  2YVP A;  3O61 A;  3EXQ A;  5DEQ A;  1VHZ A;  1PUS A;  5HZX A;  4JZU A;  3HYQ A;  1MP2 A;  5IW5 A;  4S2V A;  3N77 A;  3G0Q A;  2I8U A;  1SJY A;  2I8T A;  5ANS A;  5GHO A;  4C9W A;  3ID9 A;  3I9X A;  1K2E A;  1PUN A;  4JZV A;  1VC9 A;  4IJX A;  3RH7 A;  2B0V A;  5LPG A;  3ACA A;  1KHZ A;  2B06 A;  3N9U A;  3QSJ A;  1KTG A;  5ANT A;  3SMD A;  3X0J A;  4YOQ A;  1VC8 A;  3J7Y e;  1XSA A;  3GZ6 A;  3Q2S A; 
#chains in the Genus database with same CATH topology
 3I7U A;  1VHG A;  1RYA A;  3MGM A;  1GA7 A;  2ICK A;  5DD4 A;  4JZS A;  3EF5 A;  3O52 A;  5DDG A;  2DHO A;  2O5W A;  3L85 A;  4C9X A;  1V8M A;  2J8Q A;  4NFX A;  1G9Q A;  1VIU A;  1V8Y A;  3A6V A;  2AZW A;  1NFS A;  1PPX A;  5GHN A;  2Q9P A;  5GHJ A;  1V8R A;  1XSB A;  5ANU A;  3BM4 A;  3COU A;  4NFW A;  1HX3 A;  3O8S A;  1X51 A;  1G0S A;  2A8R A;  5C7T A;  2O5F A;  3OGA A;  1V8V A;  2I6K A;  2YVO A;  4YPR A;  3Q4I A;  3FSP A;  4HVY A;  1V8L A;  2A8P A;  3ZR0 A;  3FK9 A;  2PNY A;  1SOI A;  5BS6 A;  3A6U A;  3SHD A;  4N1T A;  1I9A A;  1SU2 A;  2YVN A;  3GWY A;  3GZ5 A;  3KVH A;  2GB5 A;  4HFQ A;  5GHI A;  3X0P A;  2PQV A;  2A8T A;  4KTB A;  3EEU A;  3H95 A;  2FML A;  3Q1P A;  3Q91 A;  4ILQ A;  4S2Y A;  4YPH A;  3MDI A;  2G74 A;  1VK6 A;  3X0I A;  1PUQ A;  3O6Z A;  1PPW A;  2KDW A;  2R5W A;  5FSK A;  3E57 A;  3X0L A;  1SZ3 A;  2DSB A;  5C8L A;  1VRL A;  2A8Q A;  1V8T A;  2VNQ A;  5I8U A;  2FVV A;  4S2X A;  3Q2T A;  2XSQ A;  5C7Q A;  3R03 A;  1V8U A;  1JRK A;  3A6T A;  2DUK A;  1R67 A;  1K26 A;  1PVF A;  1IRY A;  3X0K A;  4DYW A;  1NQZ A;  5ANV A;  1PPV A;  5GHQ A;  2JVB A;  1QVJ A;  2O1C A;  2W4E A;  2VNP A;  1TUM A;  2GT2 A;  2FKB A;  1Q27 A;  2DSD A;  1Q33 A;  3F6A A;  3GRN A;  3X0R A;  2QJO A;  4V14 A;  1X84 A;  1RRS A;  3I7V A;  3Q93 A;  3WHW A;  1F3Y A;  5FSN A;  1MQE A;  1V8N A;  3HHJ A;  3P6Y A;  2ICJ A;  5ISY A;  3X0N A;  2RRK A;  2A8S A;  4MPO A;  2QJT A;  5CFI A;  3F13 A;  3SON A;  5IW4 A;  1VIQ A;  5FSL A;  3MDG A;  3DUP A;  3A6S A;  3BHO A;  3CNG A;  1MQW A;  1V8I A;  4ICK A;  3U53 A;  2B2K A;  4JZT A;  3X0S A;  5FSO A;  3GZ8 A;  1KT9 A;  1V8W A;  3DKU A;  1NQY A;  5GHM A;  4ZG0 A;  1X83 A;  2G73 A;  4KYX A;  2QKM B;  5GHP A;  4KG3 A;  3O69 A;  2DSC A;  5ANW A;  3MCF A;  3X0Q A;  5BON A;  5FSM A;  4KG4 A;  1NFZ A;  1V8S A;  3EES A;  1MK1 A;  1MR2 A;  2YYH A;  2A6T A;  5FSI A;  4K6E A;  3X0O A;  3P5T A;  4S2W A;  1XSC A;  3GG6 A;  2KDV A;  2YVM A;  3FCM A;  4N1U A;  3AC9 A;  1RRQ A;  2CL3 A;  1Q54 A;  2GT4 A;  3BAP A;  1HZT A;  1MUT A;  3X0M A;  1U20 A;  3FFU A;  1VCD A;  1JKN A;  5DPK A;  5CFJ A;  3ZR1 A;  1OW2 A;  3FJY A;  2YVP A;  3O61 A;  3EXQ A;  5DEQ A;  1VHZ A;  1PUS A;  4J7H A;  5HZX A;  4JZU A;  3HYQ A;  1MP2 A;  5IW5 A;  4S2V A;  3N77 A;  3G0Q A;  2I8U A;  1SJY A;  2I8T A;  5ANS A;  5GHO A;  4C9W A;  3ID9 A;  3I9X A;  2CZR A;  1K2E A;  1PUN A;  4JZV A;  1VC9 A;  4IJX A;  3RH7 A;  2B0V A;  5LPG A;  3ACA A;  1KHZ A;  2B06 A;  3N9U A;  3QSJ A;  1KTG A;  4J7G A;  5ANT A;  3SMD A;  3X0J A;  4YOQ A;  1VC8 A;  3J7Y e;  1XSA A;  3GZ6 A;  3Q2S A; 
#chains in the Genus database with same CATH homology
 3I7U A;  1VHG A;  1RYA A;  3MGM A;  1GA7 A;  2ICK A;  5DD4 A;  4JZS A;  3EF5 A;  3O52 A;  5DDG A;  2DHO A;  2O5W A;  3L85 A;  4C9X A;  1V8M A;  2J8Q A;  4NFX A;  1G9Q A;  1VIU A;  1V8Y A;  3A6V A;  2AZW A;  1NFS A;  1PPX A;  5GHN A;  2Q9P A;  5GHJ A;  1V8R A;  1XSB A;  5ANU A;  3BM4 A;  3COU A;  4NFW A;  1HX3 A;  3O8S A;  1X51 A;  1G0S A;  2A8R A;  5C7T A;  2O5F A;  3OGA A;  1V8V A;  2I6K A;  2YVO A;  4YPR A;  3Q4I A;  3FSP A;  4HVY A;  1V8L A;  2A8P A;  3ZR0 A;  3FK9 A;  2PNY A;  1SOI A;  5BS6 A;  3A6U A;  3SHD A;  4N1T A;  1I9A A;  1SU2 A;  2YVN A;  3GWY A;  3GZ5 A;  3KVH A;  2GB5 A;  4HFQ A;  5GHI A;  3X0P A;  2PQV A;  2A8T A;  4KTB A;  3EEU A;  3H95 A;  2FML A;  3Q1P A;  3Q91 A;  4ILQ A;  4S2Y A;  4YPH A;  3MDI A;  2G74 A;  1VK6 A;  3X0I A;  1PUQ A;  3O6Z A;  1PPW A;  2KDW A;  2R5W A;  5FSK A;  3E57 A;  3X0L A;  1SZ3 A;  2DSB A;  5C8L A;  1VRL A;  2A8Q A;  1V8T A;  2VNQ A;  5I8U A;  2FVV A;  4S2X A;  3Q2T A;  2XSQ A;  5C7Q A;  3R03 A;  1V8U A;  1JRK A;  3A6T A;  2DUK A;  1R67 A;  1K26 A;  1PVF A;  1IRY A;  3X0K A;  4DYW A;  1NQZ A;  5ANV A;  1PPV A;  5GHQ A;  2JVB A;  1QVJ A;  2O1C A;  2W4E A;  2VNP A;  1TUM A;  2GT2 A;  2FKB A;  1Q27 A;  2DSD A;  1Q33 A;  3F6A A;  3GRN A;  3X0R A;  2QJO A;  4V14 A;  1X84 A;  1RRS A;  3I7V A;  3Q93 A;  3WHW A;  1F3Y A;  5FSN A;  1MQE A;  1V8N A;  3HHJ A;  3P6Y A;  2ICJ A;  5ISY A;  3X0N A;  2RRK A;  2A8S A;  4MPO A;  2QJT A;  5CFI A;  3F13 A;  3SON A;  5IW4 A;  1VIQ A;  5FSL A;  3MDG A;  3DUP A;  3A6S A;  3BHO A;  3CNG A;  1MQW A;  1V8I A;  4ICK A;  3U53 A;  2B2K A;  4JZT A;  3X0S A;  5FSO A;  3GZ8 A;  1KT9 A;  1V8W A;  3DKU A;  1NQY A;  5GHM A;  4ZG0 A;  1X83 A;  2G73 A;  4KYX A;  2QKM B;  5GHP A;  4KG3 A;  3O69 A;  2DSC A;  5ANW A;  3MCF A;  3X0Q A;  5BON A;  5FSM A;  4KG4 A;  1NFZ A;  1V8S A;  3EES A;  1MK1 A;  1MR2 A;  2YYH A;  2A6T A;  5FSI A;  4K6E A;  3X0O A;  3P5T A;  4S2W A;  1XSC A;  3GG6 A;  2KDV A;  2YVM A;  3FCM A;  4N1U A;  3AC9 A;  1RRQ A;  2CL3 A;  1Q54 A;  2GT4 A;  3BAP A;  1HZT A;  1MUT A;  3X0M A;  1U20 A;  3FFU A;  1VCD A;  1JKN A;  5DPK A;  5CFJ A;  3ZR1 A;  1OW2 A;  3FJY A;  2YVP A;  3O61 A;  3EXQ A;  5DEQ A;  1VHZ A;  1PUS A;  4J7H A;  5HZX A;  4JZU A;  3HYQ A;  1MP2 A;  5IW5 A;  4S2V A;  3N77 A;  3G0Q A;  2I8U A;  1SJY A;  2I8T A;  5ANS A;  5GHO A;  4C9W A;  3ID9 A;  3I9X A;  2CZR A;  1K2E A;  1PUN A;  4JZV A;  1VC9 A;  4IJX A;  3RH7 A;  2B0V A;  5LPG A;  3ACA A;  1KHZ A;  2B06 A;  3N9U A;  3QSJ A;  1KTG A;  4J7G A;  5ANT A;  3SMD A;  3X0J A;  4YOQ A;  1VC8 A;  3J7Y e;  1XSA A;  3GZ6 A;  3Q2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...