5GHQA

Crystal structure of human mth1(g2k/d120a mutant) in complex with 2-oxo-datp under high concentrations of 2-oxo-datp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
156
structure length
156
Chain Sequence
b'MKASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDASYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7,8-dihydro-8-oxoguanine triphosphatase
publication title Structural and Kinetic Studies of the Human Nudix Hydrolase MTH1 Reveal the Mechanism for Its Broad Substrate Specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 40
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5ghqA00
1HX3A 3EXQA 2Q9PA 4N1TA 5ANUA 2O5FA 2CL3A 3OGAA 3EEUA 3Q4IA 2YVNA 1V8YA 1VC9A 1U20A 1X51A 4JZSA 2A6TA 1VC8A 2VNQA 1G0SA 1SU2A 1VCDA 4HVYA 3E57A 4HFQA 5C7QA 3FCMA 3X0LA 5CFJA 1MR2A 3EESA 5I8UA 1PPVA 1VIUA 2ICJA 2PQVA 3EF5A 3ID9A 4KYXA 3F13A 5ANWA 2J8QA 1JKNA 3GWYA 4JZTA 5ANTA 3A6SA 1JRKA 1NFZA 3N77A 5FSOA 3I7VA 4S2VA 2VNPA 3MGMA 3U53A 2QKMB 2B0VA 1I9AA 5DDGA 3X0PA 1PPXA 5DPKA 1VIQA 1PUSA 5DEQA 3FSPA 3L85A 3MDIA 4C9XA 1KT9A 1G9QA 3O8SA 3A6TA 4ZG0A 5ANSA 2A8QA 3GZ5A 1XSAA 2KDVA 3SHDA 3H95A 1SOIA 1IRYA 3I7UA 2A8RA 4K6EA 1MUTA 2DHOA 1MQWA 3J7Ye 1MK1A 5ISYA 3O61A 1MP2A 4KTBA 5GHPA 1X84A 2I8TA 2FVVA 2W4EA 3X0IA 2DSDA 4N1UA 3FK9A 1V8NA 4NFWA 4ILQA 1F3YA 1SJYA 3Q1PA 1HZTA 2QJOA 3ZR1A 2FKBA 4NFXA 3MCFA 1PPWA 5GHMA 4KG3A 5ANVA 3X0JA 3KVHA 2G73A 3GG6A 3R03A 3P6YA 1Q33A 4S2XA 3RH7A 3GRNA 3N9UA 5DD4A 2YVPA 1VRLA 2A8SA 1K26A 3A6VA 1V8RA 3FFUA 1Q27A 4IJXA 3BM4A 5C7TA 1V8SA 3O6ZA 3X0NA 2I6KA 3BHOA 5IW5A 2PNYA 3X0OA 4C9WA 4JZUA 2A8TA 1TUMA 1VHGA 1VK6A 2B06A 2QJTA 3Q2SA 5FSKA 2A8PA 5GHNA 5GHJA 4YPHA 1PUNA 2B2KA 1V8VA 4S2WA 1V8WA 2G74A 1RRQA 3O52A 1PUQA 3ZR0A 3X0MA 1PVFA 3X0SA 2O5WA 2JVBA 5HZXA 3WHWA 5BONA 5LPGA 1RRSA 1K2EA 2GB5A 5IW4A 5FSNA 3I9XA 3SMDA 1V8TA 4DYWA 2FMLA 1V8MA 4V14A 5FSMA 3Q2TA 3G0QA 1Q54A 3BAPA 1V8IA 5GHIA 1NQZA 3X0QA 3CNGA 2GT4A 1NFSA 3COUA 2YYHA 2KDWA 2XSQA 3AC9A 2DSCA 2ICKA 1VHZA 5C8LA 1RYAA 3DUPA 1KTGA 2GT2A 3F6AA 2DUKA 3P5TA 2YVOA 2YVMA 2DSBA 1KHZA 4ICKA 1X83A 3O69A 4MPOA 3DKUA 1GA7A 5GHQA 2O1CA 1V8LA 3FJYA 4YPRA 4KG4A 4JZVA 4S2YA 1QVJA 1SZ3A 3GZ6A 1V8UA 3Q93A 3MDGA 3HYQA 1NQYA 5FSLA 4YOQA 3GZ8A 2R5WA 1XSBA 3ACAA 5BS6A 2I8UA 3Q91A 5FSIA 3HHJA 2AZWA 3QSJA 3X0KA 3X0RA 1R67A 3SONA 1OW2A 2RRKA 1MQEA 3A6UA 1XSCA 5GHOA 5CFIA
chains in the Genus database with same CATH superfamily
1HX3A 3EXQA 2Q9PA 4N1TA 5ANUA 2O5FA 2CL3A 3OGAA 3EEUA 3Q4IA 2YVNA 1V8YA 1VC9A 1U20A 1X51A 4JZSA 2A6TA 1VC8A 2VNQA 1G0SA 1SU2A 1VCDA 4HVYA 3E57A 4HFQA 5C7QA 3FCMA 3X0LA 5CFJA 1MR2A 3EESA 5I8UA 1PPVA 1VIUA 2ICJA 2PQVA 3EF5A 3ID9A 4KYXA 3F13A 5ANWA 2J8QA 1JKNA 3GWYA 4JZTA 5ANTA 3A6SA 1JRKA 1NFZA 3N77A 5FSOA 3I7VA 4S2VA 2VNPA 3MGMA 3U53A 2QKMB 2B0VA 1I9AA 5DDGA 3X0PA 1PPXA 5DPKA 1VIQA 1PUSA 5DEQA 3FSPA 3L85A 3MDIA 4C9XA 1KT9A 1G9QA 3O8SA 3A6TA 4ZG0A 5ANSA 2A8QA 3GZ5A 1XSAA 2KDVA 3SHDA 2CZRA 1SOIA 3H95A 1IRYA 3I7UA 2A8RA 4K6EA 1MUTA 2DHOA 1MQWA 3J7Ye 1MK1A 5ISYA 3O61A 1MP2A 4KTBA 5GHPA 1X84A 2I8TA 2FVVA 2W4EA 3X0IA 2DSDA 4N1UA 3FK9A 1V8NA 4NFWA 4ILQA 1F3YA 1SJYA 3Q1PA 1HZTA 2QJOA 3ZR1A 2FKBA 4NFXA 3MCFA 1PPWA 4J7HA 5GHMA 4KG3A 5ANVA 3X0JA 3KVHA 2G73A 3GG6A 3R03A 3P6YA 1Q33A 4S2XA 3RH7A 3GRNA 3N9UA 5DD4A 2YVPA 1VRLA 2A8SA 1K26A 3A6VA 1V8RA 3FFUA 1Q27A 4IJXA 3BM4A 5C7TA 1V8SA 3O6ZA 3X0NA 4J7GA 2I6KA 3BHOA 5IW5A 2PNYA 3X0OA 4C9WA 4JZUA 2A8TA 1TUMA 1VHGA 1VK6A 2B06A 2QJTA 3Q2SA 5FSKA 2A8PA 5GHNA 5GHJA 4YPHA 1PUNA 2B2KA 1V8VA 4S2WA 1V8WA 2G74A 1RRQA 3O52A 1PUQA 3ZR0A 3X0MA 1PVFA 3X0SA 2O5WA 2JVBA 5HZXA 3WHWA 5BONA 5LPGA 1RRSA 1K2EA 2GB5A 5IW4A 5FSNA 3I9XA 3SMDA 1V8TA 4DYWA 2FMLA 1V8MA 4V14A 5FSMA 3Q2TA 3G0QA 1Q54A 3BAPA 1V8IA 5GHIA 1NQZA 3X0QA 3CNGA 2GT4A 1NFSA 3COUA 2YYHA 2KDWA 2XSQA 3AC9A 2DSCA 2ICKA 1VHZA 5C8LA 1RYAA 3DUPA 1KTGA 2GT2A 3F6AA 2DUKA 3P5TA 2YVOA 2YVMA 2DSBA 1KHZA 4ICKA 1X83A 3O69A 4MPOA 3DKUA 1GA7A 5GHQA 2O1CA 1V8LA 3FJYA 4YPRA 4KG4A 4JZVA 4S2YA 1QVJA 1SZ3A 3GZ6A 1V8UA 3Q93A 3MDGA 3HYQA 1NQYA 5FSLA 4YOQA 3GZ8A 2R5WA 1XSBA 3ACAA 5BS6A 2I8UA 3Q91A 5FSIA 3HHJA 2AZWA 3QSJA 3X0KA 3X0RA 1R67A 3SONA 1OW2A 2RRKA 1MQEA 3A6UA 1XSCA 5GHOA 5CFIA
chains in the Genus database with same CATH topology
1HX3A 3EXQA 2Q9PA 4N1TA 5ANUA 2O5FA 2CL3A 3OGAA 3EEUA 3Q4IA 2YVNA 1V8YA 1VC9A 1U20A 1X51A 4JZSA 2A6TA 1VC8A 2VNQA 1G0SA 1SU2A 1VCDA 4HVYA 3E57A 4HFQA 5C7QA 3FCMA 3X0LA 5CFJA 1MR2A 3EESA 5I8UA 1PPVA 1VIUA 2ICJA 2PQVA 3EF5A 3ID9A 4KYXA 3F13A 5ANWA 2J8QA 1JKNA 3GWYA 4JZTA 5ANTA 3A6SA 1JRKA 1NFZA 3N77A 5FSOA 3I7VA 4S2VA 2VNPA 3MGMA 3U53A 2QKMB 2B0VA 1I9AA 5DDGA 3X0PA 1PPXA 5DPKA 1VIQA 1PUSA 5DEQA 3FSPA 3L85A 3MDIA 4C9XA 1KT9A 1G9QA 3O8SA 3A6TA 4ZG0A 5ANSA 2A8QA 3GZ5A 1XSAA 2KDVA 3SHDA 2CZRA 1SOIA 3H95A 1IRYA 3I7UA 2A8RA 4K6EA 1MUTA 2DHOA 1MQWA 3J7Ye 1MK1A 5ISYA 3O61A 1MP2A 4KTBA 5GHPA 1X84A 2I8TA 2FVVA 2W4EA 3X0IA 2DSDA 4N1UA 3FK9A 1V8NA 4NFWA 4ILQA 1F3YA 1SJYA 3Q1PA 1HZTA 2QJOA 3ZR1A 2FKBA 4NFXA 3MCFA 1PPWA 4J7HA 5GHMA 4KG3A 5ANVA 3X0JA 3KVHA 2G73A 3GG6A 3R03A 3P6YA 1Q33A 4S2XA 3RH7A 3GRNA 3N9UA 5DD4A 2YVPA 1VRLA 2A8SA 1K26A 3A6VA 1V8RA 3FFUA 1Q27A 4IJXA 3BM4A 5C7TA 1V8SA 3O6ZA 3X0NA 4J7GA 2I6KA 3BHOA 5IW5A 2PNYA 3X0OA 4C9WA 4JZUA 2A8TA 1TUMA 1VHGA 1VK6A 2B06A 2QJTA 3Q2SA 5FSKA 2A8PA 5GHNA 5GHJA 4YPHA 1PUNA 2B2KA 1V8VA 4S2WA 1V8WA 2G74A 1RRQA 3O52A 1PUQA 3ZR0A 3X0MA 1PVFA 3X0SA 2O5WA 2JVBA 5HZXA 3WHWA 5BONA 5LPGA 1RRSA 1K2EA 2GB5A 5IW4A 5FSNA 3I9XA 3SMDA 1V8TA 4DYWA 2FMLA 1V8MA 4V14A 5FSMA 3Q2TA 3G0QA 1Q54A 3BAPA 1V8IA 5GHIA 1NQZA 3X0QA 3CNGA 2GT4A 1NFSA 3COUA 2YYHA 2KDWA 2XSQA 3AC9A 2DSCA 2ICKA 1VHZA 5C8LA 1RYAA 3DUPA 1KTGA 2GT2A 3F6AA 2DUKA 3P5TA 2YVOA 2YVMA 2DSBA 1KHZA 4ICKA 1X83A 3O69A 4MPOA 3DKUA 1GA7A 5GHQA 2O1CA 1V8LA 3FJYA 4YPRA 4KG4A 4JZVA 4S2YA 1QVJA 1SZ3A 3GZ6A 1V8UA 3Q93A 3MDGA 3HYQA 1NQYA 5FSLA 4YOQA 3GZ8A 2R5WA 1XSBA 3ACAA 5BS6A 2I8UA 3Q91A 5FSIA 3HHJA 2AZWA 3QSJA 3X0KA 3X0RA 1R67A 3SONA 1OW2A 2RRKA 1MQEA 3A6UA 1XSCA 5GHOA 5CFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HX3 A;  3EXQ A;  2Q9P A;  4N1T A;  5ANU A;  2O5F A;  2CL3 A;  3OGA A;  3EEU A;  3Q4I A;  2YVN A;  1V8Y A;  1VC9 A;  1U20 A;  1X51 A;  4JZS A;  2A6T A;  1VC8 A;  2VNQ A;  1G0S A;  1SU2 A;  1VCD A;  4HVY A;  3E57 A;  4HFQ A;  5C7Q A;  3FCM A;  3X0L A;  5CFJ A;  1MR2 A;  3EES A;  5I8U A;  1PPV A;  1VIU A;  2ICJ A;  2PQV A;  3EF5 A;  3ID9 A;  4KYX A;  3F13 A;  5ANW A;  2J8Q A;  1JKN A;  3GWY A;  4JZT A;  5ANT A;  3A6S A;  1JRK A;  1NFZ A;  3N77 A;  5FSO A;  3I7V A;  4S2V A;  2VNP A;  3MGM A;  3U53 A;  2QKM B;  2B0V A;  1I9A A;  5DDG A;  3X0P A;  1PPX A;  5DPK A;  1VIQ A;  1PUS A;  5DEQ A;  3FSP A;  3L85 A;  3MDI A;  4C9X A;  1KT9 A;  1G9Q A;  3O8S A;  3A6T A;  4ZG0 A;  5ANS A;  2A8Q A;  3GZ5 A;  1XSA A;  2KDV A;  3SHD A;  3H95 A;  1SOI A;  1IRY A;  3I7U A;  2A8R A;  4K6E A;  1MUT A;  2DHO A;  1MQW A;  3J7Y e;  1MK1 A;  5ISY A;  3O61 A;  1MP2 A;  4KTB A;  5GHP A;  1X84 A;  2I8T A;  2FVV A;  2W4E A;  3X0I A;  2DSD A;  4N1U A;  3FK9 A;  1V8N A;  4NFW A;  4ILQ A;  1F3Y A;  1SJY A;  3Q1P A;  1HZT A;  2QJO A;  3ZR1 A;  2FKB A;  4NFX A;  3MCF A;  1PPW A;  5GHM A;  4KG3 A;  5ANV A;  3X0J A;  3KVH A;  2G73 A;  3GG6 A;  3R03 A;  3P6Y A;  1Q33 A;  4S2X A;  3RH7 A;  3GRN A;  3N9U A;  5DD4 A;  2YVP A;  1VRL A;  2A8S A;  1K26 A;  3A6V A;  1V8R A;  3FFU A;  1Q27 A;  4IJX A;  3BM4 A;  5C7T A;  1V8S A;  3O6Z A;  3X0N A;  2I6K A;  3BHO A;  5IW5 A;  2PNY A;  3X0O A;  4C9W A;  4JZU A;  2A8T A;  1TUM A;  1VHG A;  1VK6 A;  2B06 A;  2QJT A;  3Q2S A;  5FSK A;  2A8P A;  5GHN A;  5GHJ A;  4YPH A;  1PUN A;  2B2K A;  1V8V A;  4S2W A;  1V8W A;  2G74 A;  1RRQ A;  3O52 A;  1PUQ A;  3ZR0 A;  3X0M A;  1PVF A;  3X0S A;  2O5W A;  2JVB A;  5HZX A;  3WHW A;  5BON A;  5LPG A;  1RRS A;  1K2E A;  2GB5 A;  5IW4 A;  5FSN A;  3I9X A;  3SMD A;  1V8T A;  4DYW A;  2FML A;  1V8M A;  4V14 A;  5FSM A;  3Q2T A;  3G0Q A;  1Q54 A;  3BAP A;  1V8I A;  5GHI A;  1NQZ A;  3X0Q A;  3CNG A;  2GT4 A;  1NFS A;  3COU A;  2YYH A;  2KDW A;  2XSQ A;  3AC9 A;  2DSC A;  2ICK A;  1VHZ A;  5C8L A;  1RYA A;  3DUP A;  1KTG A;  2GT2 A;  3F6A A;  2DUK A;  3P5T A;  2YVO A;  2YVM A;  2DSB A;  1KHZ A;  4ICK A;  1X83 A;  3O69 A;  4MPO A;  3DKU A;  1GA7 A;  5GHQ A;  2O1C A;  1V8L A;  3FJY A;  4YPR A;  4KG4 A;  4JZV A;  4S2Y A;  1QVJ A;  1SZ3 A;  3GZ6 A;  1V8U A;  3Q93 A;  3MDG A;  3HYQ A;  1NQY A;  5FSL A;  4YOQ A;  3GZ8 A;  2R5W A;  1XSB A;  3ACA A;  5BS6 A;  2I8U A;  3Q91 A;  5FSI A;  3HHJ A;  2AZW A;  3QSJ A;  3X0K A;  3X0R A;  1R67 A;  3SON A;  1OW2 A;  2RRK A;  1MQE A;  3A6U A;  1XSC A;  5GHO A;  5CFI A; 
#chains in the Genus database with same CATH topology
 1HX3 A;  3EXQ A;  2Q9P A;  4N1T A;  5ANU A;  2O5F A;  2CL3 A;  3OGA A;  3EEU A;  3Q4I A;  2YVN A;  1V8Y A;  1VC9 A;  1U20 A;  1X51 A;  4JZS A;  2A6T A;  1VC8 A;  2VNQ A;  1G0S A;  1SU2 A;  1VCD A;  4HVY A;  3E57 A;  4HFQ A;  5C7Q A;  3FCM A;  3X0L A;  5CFJ A;  1MR2 A;  3EES A;  5I8U A;  1PPV A;  1VIU A;  2ICJ A;  2PQV A;  3EF5 A;  3ID9 A;  4KYX A;  3F13 A;  5ANW A;  2J8Q A;  1JKN A;  3GWY A;  4JZT A;  5ANT A;  3A6S A;  1JRK A;  1NFZ A;  3N77 A;  5FSO A;  3I7V A;  4S2V A;  2VNP A;  3MGM A;  3U53 A;  2QKM B;  2B0V A;  1I9A A;  5DDG A;  3X0P A;  1PPX A;  5DPK A;  1VIQ A;  1PUS A;  5DEQ A;  3FSP A;  3L85 A;  3MDI A;  4C9X A;  1KT9 A;  1G9Q A;  3O8S A;  3A6T A;  4ZG0 A;  5ANS A;  2A8Q A;  3GZ5 A;  1XSA A;  2KDV A;  3SHD A;  2CZR A;  1SOI A;  3H95 A;  1IRY A;  3I7U A;  2A8R A;  4K6E A;  1MUT A;  2DHO A;  1MQW A;  3J7Y e;  1MK1 A;  5ISY A;  3O61 A;  1MP2 A;  4KTB A;  5GHP A;  1X84 A;  2I8T A;  2FVV A;  2W4E A;  3X0I A;  2DSD A;  4N1U A;  3FK9 A;  1V8N A;  4NFW A;  4ILQ A;  1F3Y A;  1SJY A;  3Q1P A;  1HZT A;  2QJO A;  3ZR1 A;  2FKB A;  4NFX A;  3MCF A;  1PPW A;  4J7H A;  5GHM A;  4KG3 A;  5ANV A;  3X0J A;  3KVH A;  2G73 A;  3GG6 A;  3R03 A;  3P6Y A;  1Q33 A;  4S2X A;  3RH7 A;  3GRN A;  3N9U A;  5DD4 A;  2YVP A;  1VRL A;  2A8S A;  1K26 A;  3A6V A;  1V8R A;  3FFU A;  1Q27 A;  4IJX A;  3BM4 A;  5C7T A;  1V8S A;  3O6Z A;  3X0N A;  4J7G A;  2I6K A;  3BHO A;  5IW5 A;  2PNY A;  3X0O A;  4C9W A;  4JZU A;  2A8T A;  1TUM A;  1VHG A;  1VK6 A;  2B06 A;  2QJT A;  3Q2S A;  5FSK A;  2A8P A;  5GHN A;  5GHJ A;  4YPH A;  1PUN A;  2B2K A;  1V8V A;  4S2W A;  1V8W A;  2G74 A;  1RRQ A;  3O52 A;  1PUQ A;  3ZR0 A;  3X0M A;  1PVF A;  3X0S A;  2O5W A;  2JVB A;  5HZX A;  3WHW A;  5BON A;  5LPG A;  1RRS A;  1K2E A;  2GB5 A;  5IW4 A;  5FSN A;  3I9X A;  3SMD A;  1V8T A;  4DYW A;  2FML A;  1V8M A;  4V14 A;  5FSM A;  3Q2T A;  3G0Q A;  1Q54 A;  3BAP A;  1V8I A;  5GHI A;  1NQZ A;  3X0Q A;  3CNG A;  2GT4 A;  1NFS A;  3COU A;  2YYH A;  2KDW A;  2XSQ A;  3AC9 A;  2DSC A;  2ICK A;  1VHZ A;  5C8L A;  1RYA A;  3DUP A;  1KTG A;  2GT2 A;  3F6A A;  2DUK A;  3P5T A;  2YVO A;  2YVM A;  2DSB A;  1KHZ A;  4ICK A;  1X83 A;  3O69 A;  4MPO A;  3DKU A;  1GA7 A;  5GHQ A;  2O1C A;  1V8L A;  3FJY A;  4YPR A;  4KG4 A;  4JZV A;  4S2Y A;  1QVJ A;  1SZ3 A;  3GZ6 A;  1V8U A;  3Q93 A;  3MDG A;  3HYQ A;  1NQY A;  5FSL A;  4YOQ A;  3GZ8 A;  2R5W A;  1XSB A;  3ACA A;  5BS6 A;  2I8U A;  3Q91 A;  5FSI A;  3HHJ A;  2AZW A;  3QSJ A;  3X0K A;  3X0R A;  1R67 A;  3SON A;  1OW2 A;  2RRK A;  1MQE A;  3A6U A;  1XSC A;  5GHO A;  5CFI A; 
#chains in the Genus database with same CATH homology
 1HX3 A;  3EXQ A;  2Q9P A;  4N1T A;  5ANU A;  2O5F A;  2CL3 A;  3OGA A;  3EEU A;  3Q4I A;  2YVN A;  1V8Y A;  1VC9 A;  1U20 A;  1X51 A;  4JZS A;  2A6T A;  1VC8 A;  2VNQ A;  1G0S A;  1SU2 A;  1VCD A;  4HVY A;  3E57 A;  4HFQ A;  5C7Q A;  3FCM A;  3X0L A;  5CFJ A;  1MR2 A;  3EES A;  5I8U A;  1PPV A;  1VIU A;  2ICJ A;  2PQV A;  3EF5 A;  3ID9 A;  4KYX A;  3F13 A;  5ANW A;  2J8Q A;  1JKN A;  3GWY A;  4JZT A;  5ANT A;  3A6S A;  1JRK A;  1NFZ A;  3N77 A;  5FSO A;  3I7V A;  4S2V A;  2VNP A;  3MGM A;  3U53 A;  2QKM B;  2B0V A;  1I9A A;  5DDG A;  3X0P A;  1PPX A;  5DPK A;  1VIQ A;  1PUS A;  5DEQ A;  3FSP A;  3L85 A;  3MDI A;  4C9X A;  1KT9 A;  1G9Q A;  3O8S A;  3A6T A;  4ZG0 A;  5ANS A;  2A8Q A;  3GZ5 A;  1XSA A;  2KDV A;  3SHD A;  2CZR A;  1SOI A;  3H95 A;  1IRY A;  3I7U A;  2A8R A;  4K6E A;  1MUT A;  2DHO A;  1MQW A;  3J7Y e;  1MK1 A;  5ISY A;  3O61 A;  1MP2 A;  4KTB A;  5GHP A;  1X84 A;  2I8T A;  2FVV A;  2W4E A;  3X0I A;  2DSD A;  4N1U A;  3FK9 A;  1V8N A;  4NFW A;  4ILQ A;  1F3Y A;  1SJY A;  3Q1P A;  1HZT A;  2QJO A;  3ZR1 A;  2FKB A;  4NFX A;  3MCF A;  1PPW A;  4J7H A;  5GHM A;  4KG3 A;  5ANV A;  3X0J A;  3KVH A;  2G73 A;  3GG6 A;  3R03 A;  3P6Y A;  1Q33 A;  4S2X A;  3RH7 A;  3GRN A;  3N9U A;  5DD4 A;  2YVP A;  1VRL A;  2A8S A;  1K26 A;  3A6V A;  1V8R A;  3FFU A;  1Q27 A;  4IJX A;  3BM4 A;  5C7T A;  1V8S A;  3O6Z A;  3X0N A;  4J7G A;  2I6K A;  3BHO A;  5IW5 A;  2PNY A;  3X0O A;  4C9W A;  4JZU A;  2A8T A;  1TUM A;  1VHG A;  1VK6 A;  2B06 A;  2QJT A;  3Q2S A;  5FSK A;  2A8P A;  5GHN A;  5GHJ A;  4YPH A;  1PUN A;  2B2K A;  1V8V A;  4S2W A;  1V8W A;  2G74 A;  1RRQ A;  3O52 A;  1PUQ A;  3ZR0 A;  3X0M A;  1PVF A;  3X0S A;  2O5W A;  2JVB A;  5HZX A;  3WHW A;  5BON A;  5LPG A;  1RRS A;  1K2E A;  2GB5 A;  5IW4 A;  5FSN A;  3I9X A;  3SMD A;  1V8T A;  4DYW A;  2FML A;  1V8M A;  4V14 A;  5FSM A;  3Q2T A;  3G0Q A;  1Q54 A;  3BAP A;  1V8I A;  5GHI A;  1NQZ A;  3X0Q A;  3CNG A;  2GT4 A;  1NFS A;  3COU A;  2YYH A;  2KDW A;  2XSQ A;  3AC9 A;  2DSC A;  2ICK A;  1VHZ A;  5C8L A;  1RYA A;  3DUP A;  1KTG A;  2GT2 A;  3F6A A;  2DUK A;  3P5T A;  2YVO A;  2YVM A;  2DSB A;  1KHZ A;  4ICK A;  1X83 A;  3O69 A;  4MPO A;  3DKU A;  1GA7 A;  5GHQ A;  2O1C A;  1V8L A;  3FJY A;  4YPR A;  4KG4 A;  4JZV A;  4S2Y A;  1QVJ A;  1SZ3 A;  3GZ6 A;  1V8U A;  3Q93 A;  3MDG A;  3HYQ A;  1NQY A;  5FSL A;  4YOQ A;  3GZ8 A;  2R5W A;  1XSB A;  3ACA A;  5BS6 A;  2I8U A;  3Q91 A;  5FSI A;  3HHJ A;  2AZW A;  3QSJ A;  3X0K A;  3X0R A;  1R67 A;  3SON A;  1OW2 A;  2RRK A;  1MQE A;  3A6U A;  1XSC A;  5GHO A;  5CFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...